1WOLA

Crystal structure of st0689, an archaeal hepn homologue
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
122
structure length
122
Chain Sequence
MKRVEDWIKQAERDLEEARYAKSGGYYELACFLSQQCAEKAVKGLLQFQGIEKRGHSISHLLTNPPADILQCATFLDKQYTPSRYPDVYYEGAPYEYYTERDADECINCAIRILNWVKGQIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 122aa long conserved hypothetical protein
publication title Crystal Structure Analysis of ST0689, an archaeal HEPN protein
rcsb
source organism Sulfolobus tokodaii
molecule tags Unknown function
total genus 47
structure length 122
sequence length 122
ec nomenclature
pdb deposition date 2004-08-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05168 HEPN HEPN domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.330 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Nucleotidyltransferases domain 2 1wolA00
3O10A 3C18A 5F28E 1QVXA 3GM2A 4NQFA 4EBKA 2KK1A 3RQFA 1KNYA 3U0CA 3TULA 4R32A 3U3FA 3C8GA 1OW7A 2L6HA 4XEVA 3MFNA 2L6FA 2L6GA 3GM3A 2YWAA 4XEKA 1O3UA 1PV3A 3C8GD 3AJMA 3JZ0A 3K7DA 1ZZPA 4EBJA 1WOLA 1OW6A 1UFBA 2HSBA 3RQGA 2JX0A 3JYYA 1K40A 3L8JA 1K04A 3BRJA 1WWPA 3RQEA 3B71A 3L8IA 2JPUA 4XEFA 1JOGA 1OW8A 1V4AA 3GM1A 1WTYA 1K05A 2Q00A 2PBEA 2LK4A 3C8GB 3S9OA 1KTMA
chains in the Genus database with same CATH superfamily
4JJFA 3C18A 3S90A 5COMA 2YRFA 1ZW3A 3CQZA 3JSEO 3GEHA 1EQ1A 2YKZA 3N24A 4CS9A 2LQGA 1TWAA 2XS8A 1QZXA 1YAUO 2YLGA 1PD0A 4PJMA 2LCHA 4XEVA 4D4NA 1ZHXA 2YWAA 3A11A 3GORA 3QZCA 1O3UA 5E33A 2VASA 1PD1A 5F5HA 3K1IA 1ZZPA 3W8IA 3TJ5A 1OW6A 2NSGA 2QE9A 4JZAA 3W2VA 1H6GA 2JX0A 4BJ1A 2EPLX 1RMVA 3GWLA 3ZDLA 2VCAA 3M4BA 1JPJA 2ZPAA 1E83A 4CSAA 1MQVA 3RYLA 1WTYA 3WG7C 2PX0A 4EUKB 1GGQA 5A6BD 1L7CA 3NDBB 1ZU4A 3GEIA 3GM2A 5L0FA 1MMGA 3UMKA 2KK1A 1M2VB 3EG9B 3T6BA 2CCYA 1H7IA 2L7AA 2L9JA 4O79A 3X2QC 4DJ9A 3F46A 2LIGA 1QLEC 2XLEA 2Y3BA 4N4WA 2L6GA 3M15A 3FXHA 4IB4A 5GPGB 5TJ5E 3C7JA 3S28A 2V3CC 3GM3A 4U5CE 1Q0KA 2YLIA 1ORJA 1ZHYA 3T4RA 3G50A 1TWGA 1OXKA 2I15A 3IPMO 4CX9A 2W9YA 4NTFA 1OKKA 4Z9HA 4LLCA 4OIQF 2CDQA 4CBEA 2XLWA 5L0DA 3LLIA 2J45A 4XEFA 4I1OB 2XSEA 4NC3A 1FNTc 5COGA 3DE9A 4BEMJ 2GFHA 3OA1A 3V5ZA 1T5OA 2V26A 3FAJA 3O10A 3UR3C 5L0GA 4W8KA 5DVWA 1KNYA 5D91A 1SYQA 2D5RB 2FFHA 3MYIA 4CJGA 3RH3A 1TKNA 4G78A 3SXMA 1J8MF 2WL8A 3AG1C 1LM3B 1RJ9B 2R03A 1D1CA 1MMDA 4HEAJ 4XEKA 5FCLA 1UG7A 2KJGA 1Z3IX 3JRTA 3L0IA 3AOUA 3B29A 2YL0A 3JYYA 2MWQA 1VYKA 2IXMA 3A9CA 4DRJB 4J7TA 4LDKA 1FMVA 2J46A 3CEXA 1RCPA 3B71A 5A6AA 4E18A 3T6GB 2YEVA 2WVQA 4HE8D 2TMVP 2G3VA 2P7VA 2Q3TA 2PBEA 3HKKA 4DBRA 3C8GB 5A6JA 2YQYA 3TOLA 3HNKA 3TQOA 5BUOA 1HW2A 1RKEB 2UUHA 4QI2A 5JT4A 1M56C 3RVZA 2W45A 3DWWA 1Q0GA 4U5DE 3U3FA 4IRUA 4J7YA 5E3CA 4JKVA 4Q4ZF 2W4MA 3SXKA 3UGPA 2BL2A 2CNWD 5CI9A 5KYUB 5B3SC 1VLSA 5A69A 4OD5A 4K7BA 2XL8A 5JSLA 2UUIA 1VMAA 3IQ5A 3NMIA 2WVNA 2X51A 4Z9JA 1U6HA 2QLAA 4XQ1A 1XZQA 1BDJB 1ZHWA 4WABA 2J9UA 2OG2A 3AGTA 2CW0F 3RW0A 1NFNA 1PCXA 1D0ZA 1GS9A 4MNDA 4JTDB 2VCCA 4AL1A 4O6MA 1C17M 2XXAA 1I5NA 3KH2A 3M1CB 1KTMA 5F28E 3UMHA 4JC7A 4EIYA 3IQCA 1SMYF 2WZFA 3FVYA 3U0CA 1A7EA 4W8PA 5DQTA 4YL0A 1NSGB 2L6HA 3V5XA 1JMWA 1V74B 1IW7F 1ORSC 2NUTA 2ASRA 2JD3A 1JR8A 3KL4A 1LVKA 2EIJC 3LAYA 4KBLA 4BJ6C 4DVZA 4EBJA 1ORYA 3NYMA 4NCQA 2O9XA 4MVUA 1WATA 2HJMA 3JRMO 3OEOA 4LDQA 3MYFA 3EGXA 1K40A 3HJCA 4JCZA 3N2ZB 3U5SA 1T9KA 2KGOA 4FWVA 4OINF 1E84A 2A68F 4JVSA 5KYXA 1H9TA 4JEBA 3AGUA 3ITFA 4YT5A 1TWHA 1OCOC 2YZSA 2ZXRA 3GM1A 1QKRA 2QTVA 1GQAA 2X0CA 2H7VC 1QPUA 1OR3A 2IXPA 1YJGA 2F22A 3DJNB 3ZQYA 1NU7D 256BA 4L6RA 2A1DD 1EKYA 2XL6A 3MLGA 2P0NA 3EH1A 1G5ZA 3Q6NA 2KYHA 4MVQA 1APCA 1PV3A 2KW3C 2J8WA 4DRIB 3S27A 4HFFB 3AQCA 3R2PA 3V5YA 4O6YA 2C03A 3HNIA 4JW1A 4ER9A 4PFOA 2FAPB 2P1AA 4BPMA 5EHHA 1M6TA 2XS1A 3LS1A 1VK5A 1S7ZA 4PJLA 2AVKA 3DM9B 1OW8A 3VYWA 2HZ8A 1JPNA 2OCCC 3FDQA 4QDLA 2Q9CA 3ZQVA 3POVA 4JURI 3L1MA 2ICWG 5DLJA 2NSFA 1TQGA 4C3BA 3DE8A 4YK5A 1A41A 3LNRA 2EPNA 3DD7A 2CNWA 3QW0A 3FMSA 2HKVA 3LNMB 2LFFA 1BZ4A 2VH3A 4XPYA 5L0IA 2Q9AA 3EZHA 2J9VA 4BJ6A 3H65A 5L3QA 1Y4CA 4CIPA 4ONSA 2D4UA 2R7XA 2P61A 3T9OA 2G3KA 1YLMA 4KI2A 1UFBA 2R7UA 2GAQA 1TFOB 3DI5A 4MVZA 1A0BA 1T6UA 2AU5A 4LERA 2NUPA 1HE1A 1T6QA 4I3MA 4NTAA 2EIKC 4ZLCA 3G4ZA 1H9GA 1ZW2A 2ZD9A 1A7DA 1OCRC 1ZYRF 3EHMA 4O7GA 1JAFA 2B0HA 3S29A 1O5HA 3ZIBA 4H54A 2EIMC 4JCHA 1I4YA 1M2OA 1Y6DA 1QVXA 2HV7A 3Q7LA 2FGYA 4IAQA 3SEOA 2J7PA 1OQCA 4U9EA 4K1OA 4GYTA 3AG2C 2OKUA 5A6KA 4E7SA 3DAFA 3MFNA 1CPRA 2R7QA 2DGJA 3SYNA 1ZHZA 3DKAA 4N6HA 3FOPA 4WGZA 1LKXA 4P9TA 4H4KC 3HTKC 2R05A 2GDCA 2A0UA 4ULWA 1MNEA 1I4ZA 3HNLA 1MMAA 4OIOF 5AC4A 1LS4A 2RD9A 2XXAB 4YN0B 2VB6A 3R7CA 1B68A 4DXWA 1FFHA 3IEEA 1HMOA 4U5EE 1OXBA 2J9BA 4N6CA 1C02A 4CDVA 1QSPA 4YT4A 1E2XA 4XWJA 3U2MA 2NUTB 3GANA 5AC5A 2EPOA 1HMDA 5DS6A 4MVMA 2BE5F 1G8XA 2W4BA 2YL1A 3H2VA 2R7RA 2L6FA 3ZTZA 2R7WA 1KU2A 4DRHB 2XM0A 2G62A 3EGXB 3AG3C 1D0XA 3VM6A 4CIHA 3E70C 3ZWIA 1BR2A 3KMIA 5KYXB 4YL3A 3B0PA 4BJ5A 4CDAA 3MX3A 2Q9BA 3TD7A 4CS8C 2R25A 3V7OA 4E17A 4CS7A 3VRCA 2LD6A 4ULVA 3T6JA 3UGOA 5A6BA 4G7OF 1AEPA 2VCBA 2H7OA 4ANJA 1LE2A 4JIOA 1V4AA 1Q0FA 3K66A 2L81A 4G7HF 2R9RB 3RKOF 3JTLO 3CAXA 2ZXOA 5K0IA 3M79A 3SZRA 5JRAA 3QVYA 3TOMA 3TULA 3AG4C 4RD9A 5L0JA 1F1MA 2NPUA 3EGDA 3I4UA 2R7OA 4Q7CA 3VF0A 3CZ6A 1HE9A 4G0HA 5DS5A 1RXQA 2RSEB 3L34A 4F4BA 2DI3A 3K7DA 4PR9A 3AJMA 5AGFA 2WZLA 3U8VA 4AE4A 1VYIA 2R7VA 1Q0MA 1K04A 4JEAA 2CGEA 3KYJA 3GWNA 2YL3A 5IY5C 4U5BE 1R5ID 4JJGA 2Z15A 3ECSA 3HLZA 5D92A 5JVEA 3UNGC 2JPUA 2PF4E 3ATPA 3RIPA 3U9MA 4J32B 4MW3A 2HV6A 2NG1A 2Q00A 2MYSA 3U9JA 4DOZA 4KC9A 3Q6MA 4DVYP 1ZVZA 3ABKC 4N06A 1YARO 4C3DA 2OJED 4QI0A 2DB4A 3RF3A 5T3WA 5KYNA 2KSFA 3FHDA 3LLKA 1HW1A 3NG1A 1VB5A 3LJBA 3NYLA 2J0XA 1RKCA 1LI7A 2IOQA 3KPHA 4GQHA 2KNHA 3SP1A 3EQLF 3K1HA 2OQMA 3H2UA 4KNVA 2NUPB 3SXZA 1R4TA 3DAGA 3WAQA 2LFDA 2XLMA 5E2QA 1CGOA 1WN0A 4CS8A 1JRAA 2A6HF 3EH2A 3J06A 3L8JA 3TJ6A 4XTKA 3BRJA 3EHNA 3B9QA 4EKWA 1G4US 5E3AA 2IYLD 5JP7A 1LI5A 4JE9A 1G4WR 3KYIA 2Y39A 3JT1A 4RBNA 4X0RA 5L0HA 5BQIA 2M4EA 2B0JA 1DOVA 1CPQA 3ABLC 5HV9A 4C3EA 2H8AA 1LE4A 4JRZA 5B1AC 1CGME 3W2WA 2AWCA 2HMQA 2Y3GA 3JSZA 3EFOA 3MBGA 4R32A 4U5HA 1OW7A 3O6XA 2LSEA 2R7SA 3EPVA 4JTAB 5HSWA 2OEXA 1WGWA 4I1MA 3PMRA 5KYYA 1WASA 3ZSUA 4E0IA 2J0WA 3EJNA 5F5FA 3K33A 1AUEA 4BG0A 2DYSC 1S05A 1HY5A 1U89A 1D1BA 3UMIA 4XLPF 2I8BA 1WWPA 2Q4FA 4P9FA 3F47A 4BJ5C 3K6BA 2EPMX 3EZIA 1EA8A 3NYJA 2OU6A 1YVIA 1D1AA 2MHRA 4C7OA 3JYHA 1VOMA 2ETSA 4YT2A 5EK0A 3S9OA 4MTGA 2WZGA 2YLDA 4YWQA 2HFIA 1YA9A 3LS0A 4NQFA 1LS1A 4MQ9F 3RQFA 5FZTA 3ZC4A 1U0BB 5CIVA 1N1CA 2YHSA 4B6IA 5EGYA 3Q7GA 4BEJA 4WJ0A 2BC5A 2EPKX 1YZCA 1EI7A 2E87A 1BR4A 4LACB 3B0UX 4GEHA 1BBHA 1Z7Qc 3C8GD 1Z6AA 5BQHA 2HUJA 2HSQA 2PNOA 3NKEA 1WOLA 2XLOA 3IQTA 3PCVA 4JTCB 4MS2A 4MW8A 2HSBA 3M4CA 3RQGA 2OOCA 2IM8A 2R7TA 1Z63A 1XWJA 1FMWA 1YZAA 1ZHTA 2WB7A 1YYJA 3QVZA 4MTFA 4O6NA 3W8HA 1C03A 1NFOA 2GWWA 1E85A 4IARA 1O87A 1VLTA 3S84A 2AP3A 2VC9A 2YL7A 5L3VA 4M63A 4LLEA 2PFDA 2J9WA 4IAOA 1QQ3A 1FTSA 4MVSA 2OJQA 3ASOC 3EGDB 4EBBA 3CSKA 4EBKA 4DBQA 3HNJA 3GEEA 5COFA 1FR0A 2R02A 4PJNA 4PK4A 2QNLA 1Z23A 2HJ3A 3U3BA 4CDYA 2ZXWC 3C63A 4J30B 3RFYA 4FX5A 4AE4B 3FAPB 4U9DA 4Z9IA 1OCCC 1M2VA 1XZPA 1IZMA 2A6EF 3EG9A 5B3IA 1SZIA 5L0CA 3JZ0A 1A7VA 1FFTC 1NU9C 1TFKB 2XLVA 4IWBA 4KNWA 3ZTMA 4MTOA 2Y3DA 4YJWA 4PACA 4U5FE 1T01A 1ZU5A 2C04A 1AVOB 2HMZA 3DMDA 4I44A 4MVRA 4A4AA 4WGYA 3DXJF 3ABMC 2M64A 2QY9A 1NZEA 3O39A 2ZXPA 3QMKA 3U2LA 4EHPA 1ST6A 1M57C 3PDMP 4OIPF 5JS5A 1FAPB 2KQ9A 1J8YF 2XLHA 4K0DA 3I5PA 5CI8A 1YA7O 4FAPB 3IHUA 1NG1A 2KC3A 4PFPA 4RDAA 3ZG1A 2XLDA 2Y3HA 4BJTA 2GA0A 5KYWB 3NRHA 4CJOA 4G7ZF 2A69F 2LP4A 3NMJA 2IBFA 4CS9C 1VTMP 2A0BA 2EINC 2YVKA 4Q5SF 3QTHA 4LDRA 2XM4A 3PHF2 5BQGA 2AWYA 4E7ZA 3DM5A 4EWCA 1MMNA 1RJ9A 3E9VA 3K1IC 1LPEA 3S0XA 4NY3A 3SXYA 4E0HA 4AL0A 3L8IA 5T3TA 1OKKD 4UDVA 3LEVA 3I5QA 1JOGA 2EILC 3NKDA 4MVOA 3RVYA 3C62A 4XLNF 1TR2A 1K05A 3DZAA 3EFOB 2LK4A 1Q0DA 3BEHA 1YYXA 1T6IA 3DJUB 3JCUQ 1GM5A 2PX3A 5JLIA 4CSAC 2WVOA 4P6IC 5DS4A 5B1BC 2IXNA 2PP4A 1OCZC 3KKBA 5T1DB 3NMKA 2OEVA 4HFKB 3C8ZA 3ZVRA 3C8GA 5KYYB 1SF8A 3LESA 4D4XA 4OIRF 4IJJA 3TK0A 4FESA 2CYDA 2H7BA 1RKEA 2J7PD 1MNDA 3N0TA 1SR2A 4NTBA 4XPWA 2Q7RA 3LUTB 1L3PA 3U8PA 3X1OA 2HS5A 3FOOA 4AK9A 3ASNC 1LIHA 3OWTA 1V55C 3US6A 3WHNA 2P6VA 5KYWA 1BR1A 2XRHA 2XL4A 3AQBA 5JUAA 1E86A 1Z5ZA 5DQZA 4YT8A 4XPXA 1V54C 5KYUA 3SNHA 3B0VC 3W4YA 2QUPA 1NBBA 1NLXA 3IQ6A 4U5GA 3RQEA 4C7OB 1DOWA 1CGNA 1OR2A 1W2WA 3GODA 3O55A 2Y69C 3VAYA 3LEOA 1TWCA 3QW1A 4PJJA 1YDIA 2IXOA 4ZLDA 4OD4A 4A2NB 3G4XA 4AX2A 1D0YA 4YL1A 2DYRC 3WODF 4IGGA
chains in the Genus database with same CATH topology
3O10A 3C18A 5F28E 1QVXA 3GM2A 4NQFA 4EBKA 2KK1A 3RQFA 1KNYA 3U0CA 3TULA 4R32A 3U3FA 3C8GA 1OW7A 2L6HA 4XEVA 3MFNA 2L6FA 2L6GA 3GM3A 2YWAA 4XEKA 1O3UA 1PV3A 3C8GD 3AJMA 3JZ0A 3K7DA 1ZZPA 4EBJA 1WOLA 1OW6A 1UFBA 2HSBA 3RQGA 2JX0A 3JYYA 1K40A 3L8JA 1K04A 3BRJA 1WWPA 3RQEA 3B71A 3L8IA 2JPUA 4XEFA 1JOGA 1OW8A 1V4AA 3GM1A 1WTYA 1K05A 2Q00A 2PBEA 2LK4A 3C8GB 3S9OA 1KTMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3O10 A;  3C18 A;  5F28 E;  1QVX A;  3GM2 A;  4NQF A;  4EBK A;  2KK1 A;  3RQF A;  1KNY A;  3U0C A;  3TUL A;  4R32 A;  3U3F A;  3C8G A;  1OW7 A;  2L6H A;  4XEV A;  3MFN A;  2L6F A;  2L6G A;  3GM3 A;  2YWA A;  4XEK A;  1O3U A;  1PV3 A;  3C8G D;  3AJM A;  3JZ0 A;  3K7D A;  1ZZP A;  4EBJ A;  1WOL A;  1OW6 A;  1UFB A;  2HSB A;  3RQG A;  2JX0 A;  3JYY A;  1K40 A;  3L8J A;  1K04 A;  3BRJ A;  1WWP A;  3RQE A;  3B71 A;  3L8I A;  2JPU A;  4XEF A;  1JOG A;  1OW8 A;  1V4A A;  3GM1 A;  1WTY A;  1K05 A;  2Q00 A;  2PBE A;  2LK4 A;  3C8G B;  3S9O A;  1KTM A; 
#chains in the Genus database with same CATH topology
 4JJF A;  3C18 A;  3S90 A;  5COM A;  2YRF A;  1ZW3 A;  3CQZ A;  3JSE O;  3GEH A;  1EQ1 A;  2YKZ A;  3N24 A;  4CS9 A;  2LQG A;  1TWA A;  2XS8 A;  1QZX A;  1YAU O;  2YLG A;  1PD0 A;  4PJM A;  2LCH A;  4XEV A;  4D4N A;  1ZHX A;  2YWA A;  3A11 A;  3GOR A;  3QZC A;  1O3U A;  5E33 A;  2VAS A;  1PD1 A;  5F5H A;  3K1I A;  1ZZP A;  3W8I A;  3TJ5 A;  1OW6 A;  2NSG A;  2QE9 A;  4JZA A;  3W2V A;  1H6G A;  2JX0 A;  4BJ1 A;  2EPL X;  1RMV A;  3GWL A;  3ZDL A;  2VCA A;  3M4B A;  1JPJ A;  2ZPA A;  1E83 A;  4CSA A;  1MQV A;  3RYL A;  1WTY A;  3WG7 C;  2PX0 A;  4EUK B;  1GGQ A;  5A6B D;  1L7C A;  3NDB B;  1ZU4 A;  3GEI A;  3GM2 A;  5L0F A;  1MMG A;  3UMK A;  2KK1 A;  1M2V B;  3EG9 B;  3T6B A;  2CCY A;  1H7I A;  2L7A A;  2L9J A;  4O79 A;  3X2Q C;  4DJ9 A;  3F46 A;  2LIG A;  1QLE C;  2XLE A;  2Y3B A;  4N4W A;  2L6G A;  3M15 A;  3FXH A;  4IB4 A;  5GPG B;  5TJ5 E;  3C7J A;  3S28 A;  2V3C C;  3GM3 A;  4U5C E;  1Q0K A;  2YLI A;  1ORJ A;  1ZHY A;  3T4R A;  3G50 A;  1TWG A;  1OXK A;  2I15 A;  3IPM O;  4CX9 A;  2W9Y A;  4NTF A;  1OKK A;  4Z9H A;  4LLC A;  4OIQ F;  2CDQ A;  4CBE A;  2XLW A;  5L0D A;  3LLI A;  2J45 A;  4XEF A;  4I1O B;  2XSE A;  4NC3 A;  1FNT c;  5COG A;  3DE9 A;  4BEM J;  2GFH A;  3OA1 A;  3V5Z A;  1T5O A;  2V26 A;  3FAJ A;  3O10 A;  3UR3 C;  5L0G A;  4W8K A;  5DVW A;  1KNY A;  5D91 A;  1SYQ A;  2D5R B;  2FFH A;  3MYI A;  4CJG A;  3RH3 A;  1TKN A;  4G78 A;  3SXM A;  1J8M F;  2WL8 A;  3AG1 C;  1LM3 B;  1RJ9 B;  2R03 A;  1D1C A;  1MMD A;  4HEA J;  4XEK A;  5FCL A;  1UG7 A;  2KJG A;  1Z3I X;  3JRT A;  3L0I A;  3AOU A;  3B29 A;  2YL0 A;  3JYY A;  2MWQ A;  1VYK A;  2IXM A;  3A9C A;  4DRJ B;  4J7T A;  4LDK A;  1FMV A;  2J46 A;  3CEX A;  1RCP A;  3B71 A;  5A6A A;  4E18 A;  3T6G B;  2YEV A;  2WVQ A;  4HE8 D;  2TMV P;  2G3V A;  2P7V A;  2Q3T A;  2PBE A;  3HKK A;  4DBR A;  3C8G B;  5A6J A;  2YQY A;  3TOL A;  3HNK A;  3TQO A;  5BUO A;  1HW2 A;  1RKE B;  2UUH A;  4QI2 A;  5JT4 A;  1M56 C;  3RVZ A;  2W45 A;  3DWW A;  1Q0G A;  4U5D E;  3U3F A;  4IRU A;  4J7Y A;  5E3C A;  4JKV A;  4Q4Z F;  2W4M A;  3SXK A;  3UGP A;  2BL2 A;  2CNW D;  5CI9 A;  5KYU B;  5B3S C;  1VLS A;  5A69 A;  4OD5 A;  4K7B A;  2XL8 A;  5JSL A;  2UUI A;  1VMA A;  3IQ5 A;  3NMI A;  2WVN A;  2X51 A;  4Z9J A;  1U6H A;  2QLA A;  4XQ1 A;  1XZQ A;  1BDJ B;  1ZHW A;  4WAB A;  2J9U A;  2OG2 A;  3AGT A;  2CW0 F;  3RW0 A;  1NFN A;  1PCX A;  1D0Z A;  1GS9 A;  4MND A;  4JTD B;  2VCC A;  4AL1 A;  4O6M A;  1C17 M;  2XXA A;  1I5N A;  3KH2 A;  3M1C B;  1KTM A;  5F28 E;  3UMH A;  4JC7 A;  4EIY A;  3IQC A;  1SMY F;  2WZF A;  3FVY A;  3U0C A;  1A7E A;  4W8P A;  5DQT A;  4YL0 A;  1NSG B;  2L6H A;  3V5X A;  1JMW A;  1V74 B;  1IW7 F;  1ORS C;  2NUT A;  2ASR A;  2JD3 A;  1JR8 A;  3KL4 A;  1LVK A;  2EIJ C;  3LAY A;  4KBL A;  4BJ6 C;  4DVZ A;  4EBJ A;  1ORY A;  3NYM A;  4NCQ A;  2O9X A;  4MVU A;  1WAT A;  2HJM A;  3JRM O;  3OEO A;  4LDQ A;  3MYF A;  3EGX A;  1K40 A;  3HJC A;  4JCZ A;  3N2Z B;  3U5S A;  1T9K A;  2KGO A;  4FWV A;  4OIN F;  1E84 A;  2A68 F;  4JVS A;  5KYX A;  1H9T A;  4JEB A;  3AGU A;  3ITF A;  4YT5 A;  1TWH A;  1OCO C;  2YZS A;  2ZXR A;  3GM1 A;  1QKR A;  2QTV A;  1GQA A;  2X0C A;  2H7V C;  1QPU A;  1OR3 A;  2IXP A;  1YJG A;  2F22 A;  3DJN B;  3ZQY A;  1NU7 D;  256B A;  4L6R A;  2A1D D;  1EKY A;  2XL6 A;  3MLG A;  2P0N A;  3EH1 A;  1G5Z A;  3Q6N A;  2KYH A;  4MVQ A;  1APC A;  1PV3 A;  2KW3 C;  2J8W A;  4DRI B;  3S27 A;  4HFF B;  3AQC A;  3R2P A;  3V5Y A;  4O6Y A;  2C03 A;  3HNI A;  4JW1 A;  4ER9 A;  4PFO A;  2FAP B;  2P1A A;  4BPM A;  5EHH A;  1M6T A;  2XS1 A;  3LS1 A;  1VK5 A;  1S7Z A;  4PJL A;  2AVK A;  3DM9 B;  1OW8 A;  3VYW A;  2HZ8 A;  1JPN A;  2OCC C;  3FDQ A;  4QDL A;  2Q9C A;  3ZQV A;  3POV A;  4JUR I;  3L1M A;  2ICW G;  5DLJ A;  2NSF A;  1TQG A;  4C3B A;  3DE8 A;  4YK5 A;  1A41 A;  3LNR A;  2EPN A;  3DD7 A;  2CNW A;  3QW0 A;  3FMS A;  2HKV A;  3LNM B;  2LFF A;  1BZ4 A;  2VH3 A;  4XPY A;  5L0I A;  2Q9A A;  3EZH A;  2J9V A;  4BJ6 A;  3H65 A;  5L3Q A;  1Y4C A;  4CIP A;  4ONS A;  2D4U A;  2R7X A;  2P61 A;  3T9O A;  2G3K A;  1YLM A;  4KI2 A;  1UFB A;  2R7U A;  2GAQ A;  1TFO B;  3DI5 A;  4MVZ A;  1A0B A;  1T6U A;  2AU5 A;  4LER A;  2NUP A;  1HE1 A;  1T6Q A;  4I3M A;  4NTA A;  2EIK C;  4ZLC A;  3G4Z A;  1H9G A;  1ZW2 A;  2ZD9 A;  1A7D A;  1OCR C;  1ZYR F;  3EHM A;  4O7G A;  1JAF A;  2B0H A;  3S29 A;  1O5H A;  3ZIB A;  4H54 A;  2EIM C;  4JCH A;  1I4Y A;  1M2O A;  1Y6D A;  1QVX A;  2HV7 A;  3Q7L A;  2FGY A;  4IAQ A;  3SEO A;  2J7P A;  1OQC A;  4U9E A;  4K1O A;  4GYT A;  3AG2 C;  2OKU A;  5A6K A;  4E7S A;  3DAF A;  3MFN A;  1CPR A;  2R7Q A;  2DGJ A;  3SYN A;  1ZHZ A;  3DKA A;  4N6H A;  3FOP A;  4WGZ A;  1LKX A;  4P9T A;  4H4K C;  3HTK C;  2R05 A;  2GDC A;  2A0U A;  4ULW A;  1MNE A;  1I4Z A;  3HNL A;  1MMA A;  4OIO F;  5AC4 A;  1LS4 A;  2RD9 A;  2XXA B;  4YN0 B;  2VB6 A;  3R7C A;  1B68 A;  4DXW A;  1FFH A;  3IEE A;  1HMO A;  4U5E E;  1OXB A;  2J9B A;  4N6C A;  1C02 A;  4CDV A;  1QSP A;  4YT4 A;  1E2X A;  4XWJ A;  3U2M A;  2NUT B;  3GAN A;  5AC5 A;  2EPO A;  1HMD A;  5DS6 A;  4MVM A;  2BE5 F;  1G8X A;  2W4B A;  2YL1 A;  3H2V A;  2R7R A;  2L6F A;  3ZTZ A;  2R7W A;  1KU2 A;  4DRH B;  2XM0 A;  2G62 A;  3EGX B;  3AG3 C;  1D0X A;  3VM6 A;  4CIH A;  3E70 C;  3ZWI A;  1BR2 A;  3KMI A;  5KYX B;  4YL3 A;  3B0P A;  4BJ5 A;  4CDA A;  3MX3 A;  2Q9B A;  3TD7 A;  4CS8 C;  2R25 A;  3V7O A;  4E17 A;  4CS7 A;  3VRC A;  2LD6 A;  4ULV A;  3T6J A;  3UGO A;  5A6B A;  4G7O F;  1AEP A;  2VCB A;  2H7O A;  4ANJ A;  1LE2 A;  4JIO A;  1V4A A;  1Q0F A;  3K66 A;  2L81 A;  4G7H F;  2R9R B;  3RKO F;  3JTL O;  3CAX A;  2ZXO A;  5K0I A;  3M79 A;  3SZR A;  5JRA A;  3QVY A;  3TOM A;  3TUL A;  3AG4 C;  4RD9 A;  5L0J A;  1F1M A;  2NPU A;  3EGD A;  3I4U A;  2R7O A;  4Q7C A;  3VF0 A;  3CZ6 A;  1HE9 A;  4G0H A;  5DS5 A;  1RXQ A;  2RSE B;  3L34 A;  4F4B A;  2DI3 A;  3K7D A;  4PR9 A;  3AJM A;  5AGF A;  2WZL A;  3U8V A;  4AE4 A;  1VYI A;  2R7V A;  1Q0M A;  1K04 A;  4JEA A;  2CGE A;  3KYJ A;  3GWN A;  2YL3 A;  5IY5 C;  4U5B E;  1R5I D;  4JJG A;  2Z15 A;  3ECS A;  3HLZ A;  5D92 A;  5JVE A;  3UNG C;  2JPU A;  2PF4 E;  3ATP A;  3RIP A;  3U9M A;  4J32 B;  4MW3 A;  2HV6 A;  2NG1 A;  2Q00 A;  2MYS A;  3U9J A;  4DOZ A;  4KC9 A;  3Q6M A;  4DVY P;  1ZVZ A;  3ABK C;  4N06 A;  1YAR O;  4C3D A;  2OJE D;  4QI0 A;  2DB4 A;  3RF3 A;  5T3W A;  5KYN A;  2KSF A;  3FHD A;  3LLK A;  1HW1 A;  3NG1 A;  1VB5 A;  3LJB A;  3NYL A;  2J0X A;  1RKC A;  1LI7 A;  2IOQ A;  3KPH A;  4GQH A;  2KNH A;  3SP1 A;  3EQL F;  3K1H A;  2OQM A;  3H2U A;  4KNV A;  2NUP B;  3SXZ A;  1R4T A;  3DAG A;  3WAQ A;  2LFD A;  2XLM A;  5E2Q A;  1CGO A;  1WN0 A;  4CS8 A;  1JRA A;  2A6H F;  3EH2 A;  3J06 A;  3L8J A;  3TJ6 A;  4XTK A;  3BRJ A;  3EHN A;  3B9Q A;  4EKW A;  1G4U S;  5E3A A;  2IYL D;  5JP7 A;  1LI5 A;  4JE9 A;  1G4W R;  3KYI A;  2Y39 A;  3JT1 A;  4RBN A;  4X0R A;  5L0H A;  5BQI A;  2M4E A;  2B0J A;  1DOV A;  1CPQ A;  3ABL C;  5HV9 A;  4C3E A;  2H8A A;  1LE4 A;  4JRZ A;  5B1A C;  1CGM E;  3W2W A;  2AWC A;  2HMQ A;  2Y3G A;  3JSZ A;  3EFO A;  3MBG A;  4R32 A;  4U5H A;  1OW7 A;  3O6X A;  2LSE A;  2R7S A;  3EPV A;  4JTA B;  5HSW A;  2OEX A;  1WGW A;  4I1M A;  3PMR A;  5KYY A;  1WAS A;  3ZSU A;  4E0I A;  2J0W A;  3EJN A;  5F5F A;  3K33 A;  1AUE A;  4BG0 A;  2DYS C;  1S05 A;  1HY5 A;  1U89 A;  1D1B A;  3UMI A;  4XLP F;  2I8B A;  1WWP A;  2Q4F A;  4P9F A;  3F47 A;  4BJ5 C;  3K6B A;  2EPM X;  3EZI A;  1EA8 A;  3NYJ A;  2OU6 A;  1YVI A;  1D1A A;  2MHR A;  4C7O A;  3JYH A;  1VOM A;  2ETS A;  4YT2 A;  5EK0 A;  3S9O A;  4MTG A;  2WZG A;  2YLD A;  4YWQ A;  2HFI A;  1YA9 A;  3LS0 A;  4NQF A;  1LS1 A;  4MQ9 F;  3RQF A;  5FZT A;  3ZC4 A;  1U0B B;  5CIV A;  1N1C A;  2YHS A;  4B6I A;  5EGY A;  3Q7G A;  4BEJ A;  4WJ0 A;  2BC5 A;  2EPK X;  1YZC A;  1EI7 A;  2E87 A;  1BR4 A;  4LAC B;  3B0U X;  4GEH A;  1BBH A;  1Z7Q c;  3C8G D;  1Z6A A;  5BQH A;  2HUJ A;  2HSQ A;  2PNO A;  3NKE A;  1WOL A;  2XLO A;  3IQT A;  3PCV A;  4JTC B;  4MS2 A;  4MW8 A;  2HSB A;  3M4C A;  3RQG A;  2OOC A;  2IM8 A;  2R7T A;  1Z63 A;  1XWJ A;  1FMW A;  1YZA A;  1ZHT A;  2WB7 A;  1YYJ A;  3QVZ A;  4MTF A;  4O6N A;  3W8H A;  1C03 A;  1NFO A;  2GWW A;  1E85 A;  4IAR A;  1O87 A;  1VLT A;  3S84 A;  2AP3 A;  2VC9 A;  2YL7 A;  5L3V A;  4M63 A;  4LLE A;  2PFD A;  2J9W A;  4IAO A;  1QQ3 A;  1FTS A;  4MVS A;  2OJQ A;  3ASO C;  3EGD B;  4EBB A;  3CSK A;  4EBK A;  4DBQ A;  3HNJ A;  3GEE A;  5COF A;  1FR0 A;  2R02 A;  4PJN A;  4PK4 A;  2QNL A;  1Z23 A;  2HJ3 A;  3U3B A;  4CDY A;  2ZXW C;  3C63 A;  4J30 B;  3RFY A;  4FX5 A;  4AE4 B;  3FAP B;  4U9D A;  4Z9I A;  1OCC C;  1M2V A;  1XZP A;  1IZM A;  2A6E F;  3EG9 A;  5B3I A;  1SZI A;  5L0C A;  3JZ0 A;  1A7V A;  1FFT C;  1NU9 C;  1TFK B;  2XLV A;  4IWB A;  4KNW A;  3ZTM A;  4MTO A;  2Y3D A;  4YJW A;  4PAC A;  4U5F E;  1T01 A;  1ZU5 A;  2C04 A;  1AVO B;  2HMZ A;  3DMD A;  4I44 A;  4MVR A;  4A4A A;  4WGY A;  3DXJ F;  3ABM C;  2M64 A;  2QY9 A;  1NZE A;  3O39 A;  2ZXP A;  3QMK A;  3U2L A;  4EHP A;  1ST6 A;  1M57 C;  3PDM P;  4OIP F;  5JS5 A;  1FAP B;  2KQ9 A;  1J8Y F;  2XLH A;  4K0D A;  3I5P A;  5CI8 A;  1YA7 O;  4FAP B;  3IHU A;  1NG1 A;  2KC3 A;  4PFP A;  4RDA A;  3ZG1 A;  2XLD A;  2Y3H A;  4BJT A;  2GA0 A;  5KYW B;  3NRH A;  4CJO A;  4G7Z F;  2A69 F;  2LP4 A;  3NMJ A;  2IBF A;  4CS9 C;  1VTM P;  2A0B A;  2EIN C;  2YVK A;  4Q5S F;  3QTH A;  4LDR A;  2XM4 A;  3PHF 2;  5BQG A;  2AWY A;  4E7Z A;  3DM5 A;  4EWC A;  1MMN A;  1RJ9 A;  3E9V A;  3K1I C;  1LPE A;  3S0X A;  4NY3 A;  3SXY A;  4E0H A;  4AL0 A;  3L8I A;  5T3T A;  1OKK D;  4UDV A;  3LEV A;  3I5Q A;  1JOG A;  2EIL C;  3NKD A;  4MVO A;  3RVY A;  3C62 A;  4XLN F;  1TR2 A;  1K05 A;  3DZA A;  3EFO B;  2LK4 A;  1Q0D A;  3BEH A;  1YYX A;  1T6I A;  3DJU B;  3JCU Q;  1GM5 A;  2PX3 A;  5JLI A;  4CSA C;  2WVO A;  4P6I C;  5DS4 A;  5B1B C;  2IXN A;  2PP4 A;  1OCZ C;  3KKB A;  5T1D B;  3NMK A;  2OEV A;  4HFK B;  3C8Z A;  3ZVR A;  3C8G A;  5KYY B;  1SF8 A;  3LES A;  4D4X A;  4OIR F;  4IJJ A;  3TK0 A;  4FES A;  2CYD A;  2H7B A;  1RKE A;  2J7P D;  1MND A;  3N0T A;  1SR2 A;  4NTB A;  4XPW A;  2Q7R A;  3LUT B;  1L3P A;  3U8P A;  3X1O A;  2HS5 A;  3FOO A;  4AK9 A;  3ASN C;  1LIH A;  3OWT A;  1V55 C;  3US6 A;  3WHN A;  2P6V A;  5KYW A;  1BR1 A;  2XRH A;  2XL4 A;  3AQB A;  5JUA A;  1E86 A;  1Z5Z A;  5DQZ A;  4YT8 A;  4XPX A;  1V54 C;  5KYU A;  3SNH A;  3B0V C;  3W4Y A;  2QUP A;  1NBB A;  1NLX A;  3IQ6 A;  4U5G A;  3RQE A;  4C7O B;  1DOW A;  1CGN A;  1OR2 A;  1W2W A;  3GOD A;  3O55 A;  2Y69 C;  3VAY A;  3LEO A;  1TWC A;  3QW1 A;  4PJJ A;  1YDI A;  2IXO A;  4ZLD A;  4OD4 A;  4A2N B;  3G4X A;  4AX2 A;  1D0Y A;  4YL1 A;  2DYR C;  3WOD F;  4IGG A; 
#chains in the Genus database with same CATH homology
 3O10 A;  3C18 A;  5F28 E;  1QVX A;  3GM2 A;  4NQF A;  4EBK A;  2KK1 A;  3RQF A;  1KNY A;  3U0C A;  3TUL A;  4R32 A;  3U3F A;  3C8G A;  1OW7 A;  2L6H A;  4XEV A;  3MFN A;  2L6F A;  2L6G A;  3GM3 A;  2YWA A;  4XEK A;  1O3U A;  1PV3 A;  3C8G D;  3AJM A;  3JZ0 A;  3K7D A;  1ZZP A;  4EBJ A;  1WOL A;  1OW6 A;  1UFB A;  2HSB A;  3RQG A;  2JX0 A;  3JYY A;  1K40 A;  3L8J A;  1K04 A;  3BRJ A;  1WWP A;  3RQE A;  3B71 A;  3L8I A;  2JPU A;  4XEF A;  1JOG A;  1OW8 A;  1V4A A;  3GM1 A;  1WTY A;  1K05 A;  2Q00 A;  2PBE A;  2LK4 A;  3C8G B;  3S9O A;  1KTM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...