1WOLA

Crystal structure of st0689, an archaeal hepn homologue
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
122
structure length
122
Chain Sequence
MKRVEDWIKQAERDLEEARYAKSGGYYELACFLSQQCAEKAVKGLLQFQGIEKRGHSISHLLTNPPADILQCATFLDKQYTPSRYPDVYYEGAPYEYYTERDADECINCAIRILNWVKGQIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure Analysis of ST0689, an archaeal HEPN protein
rcsb
source organism Sulfolobus tokodaii
molecule tags Unknown function
molecule keywords 122aa long conserved hypothetical protein
total genus 47
structure length 122
sequence length 122
ec nomenclature
pdb deposition date 2004-08-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05168 HEPN HEPN domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.330 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Nucleotidyltransferases domain 2 1wolA00
2JPUA 3S9OA 4R32A 2YWAA 3K7DA 2HSBA 1KTMA 2L6FA 1OW6A 3C8GB 5F28E 2Q00A 1QVXA 3C18A 1V4AA 3L8IA 3GM1A 1KNYA 3B71A 2JX0A 2L6GA 1K40A 3BRJA 3GM2A 3U3FA 3RQGA 4EBKA 3GM3A 3RQEA 4XEFA 1OW8A 2L6HA 2LK4A 1WOLA 3C8GA 4EBJA 2KK1A 1WTYA 3O10A 1O3UA 3TULA 3AJMA 3C8GD 1K05A 1ZZPA 1PV3A 3RQFA 3L8JA 3MFNA 3U0CA 4XEKA 3JYYA 2PBEA 1UFBA 1WWPA 1K04A 1JOGA 4NQFA 1OW7A 3JZ0A 4XEVA
chains in the Genus database with same CATH superfamily
4OIRF 2A0UA 3H2VA 3IQTA 4U5DE 3JRTA 1H9GA 3W8HA 2YL7A 2H8AA 3FXHA 4K1OA 4K7BA 3ZG1A 3EPVA 4P9FA 2EILC 3R7CA 4LACB 4LDKA 3V7OA 3W8IA 3DI5A 1NFOA 2R7WA 4N06A 1DOVA 4UDVA 3AOUA 3CQZA 3FDQA 2HMZA 1YZCA 4MVRA 5DQTA 4BG0A 3NMKA 2KGOA 1HE1A 4J7YA 4DBRA 2G3KA 1UG7A 2VASA 3PCVA 4MNDA 2RSEB 5COGA 2YL3A 3DJUB 3HJCA 2HSQA 2VH3A 2YKZA 3IQ5A 2PBEA 3KPHA 5JUAA 1E84A 4KI2A 4KC9A 4BPMA 3EFOB 3ZDLA 3DAGA 1AUEA 3S9OA 2DB4A 2L81A 2OU6A 3IPMO 3R2PA 4GEHA 5JVEA 4XLPF 2HSBA 1YJGA 3RIPA 4GYTA 4NCQA 2YQYA 2V3CC 1T9KA 2V26A 3GANA 3LLIA 4K0DA 1NSGB 3MYFA 2AU5A 4JZAA 3B71A 2ETSA 3LLKA 5CIVA 5COFA 2GWWA 5A6BA 1RCPA 1H9TA 4DXWA 1LI5A 2XLDA 1JR8A 2ICWG 3ASNC 1TWCA 3KKBA 5JSLA 1G4US 3C8GA 3O39A 2DYSC 3MX3A 1YYXA 1OKKD 1O3UA 3DM5A 5CI9A 2UUIA 1I4YA 2EIMC 1KU2A 4NTAA 2BC5A 4HFKB 1Y6DA 2NG1A 1Z7Qc 3RVYA 1L3PA 1PV3A 4EUKB 2MYSA 2R7RA 4JW1A 1FNTc 3EZHA 2EPKX 5T3WA 3J06A 1OXKA 2WZLA 4MTFA 1VYIA 3VM6A 2A68F 4DJ9A 2WVQA 4XPWA 4E0HA 3KL4A 2Z15A 4PR9A 4Q5SF 1FAPB 4MS2A 4YN0B 4JC7A 1JRAA 5D92A 3LESA 2EIJC 1C03A 4BJTA 3FAPB 2HV7A 2P61A 3RFYA 3SXZA 3TJ6A 4F4BA 2NUPA 2XXAB 1YARO 2Q7RA 1YLMA 4QDLA 3SNHA 2NUPB 3KYJA 3SYNA 5E3AA 2XXAA 1LM3B 5KYNA 3NDBB 1TWGA 2B0HA 1MMDA 1G8XA 2XS8A 2QTVA 4YJWA 4RDAA 2NUTA 2QLAA 5DQZA 2J9BA 3C63A 4CDVA 3SP1A 3S28A 4ANJA 3F47A 3E70C 4PJLA 3T6GB 1Y4CA 1FMVA 3RYLA 4WGYA 4MTOA 2D4UA 2IXPA 1OQCA 3QZCA 3ZSUA 3G50A 4FESA 2HKVA 3IQ6A 2XLVA 1WGWA 3V5ZA 1OW6A 1LS4A 2A0BA 2OKUA 1FFTC 1CPRA 1IW7F 1OR3A 5EHHA 2H7BA 3ECSA 2CNWA 3G4XA 1G4WR 3CAXA 3MBGA 3W2WA 4EBKA 2YEVA 2CDQA 1ZHWA 2H7VC 4Z9JA 3GWNA 4HEAJ 2XM4A 2KC3A 5B1BC 2CYDA 3K6BA 3US6A 1M57C 3AQBA 4DVYP 4RD9A 1B68A 3T6JA 3LNRA 4AL1A 1WASA 3RQFA 4A2NB 3EG9A 4C3DA 1CGME 3H2UA 2VCCA 4G0HA 2GDCA 3W2VA 3FOOA 1UFBA 2YVKA 3IHUA 5JRAA 1JOGA 4WGZA 2LFFA 4IRUA 2R7SA 2JPUA 5KYWA 3RH3A 4MTGA 2EPLX 3EGDA 2R05A 2OG2A 4XPYA 4PACA 1PCXA 3W4YA 2J0WA 2P7VA 4W8KA 1U89A 1KNYA 3PHF2 4U9DA 1R5ID 2XL4A 1Z5ZA 3DJNB 3V5YA 2HFIA 1C02A 2CNWD 1FMWA 3LUTB 3RQEA 2LK4A 4CIHA 1NLXA 4P6IC 1ZU5A 1T01A 5CI8A 3SEOA 2Y3DA 4N6HA 3JYHA 5L0IA 1K05A 2GA0A 2IYLD 5EGYA 2IXMA 3U0CA 4CSAA 2C04A 5BQGA 1ZHXA 1MQVA 3UGOA 3VRCA 3ABKC 1R4TA 4I3MA 4XTKA 3EJNA 3BRJA 1TFKB 2AVKA 2KYHA 2MHRA 5DS6A 4H4KC 3A11A 3NRHA 1T6UA 3NKDA 1YYJA 4CSAC 5A69A 3LAYA 4IWBA 2J0XA 2HMQA 5JLIA 3ASOC 4JJGA 4PFOA 3ITFA 3G4ZA 3M15A 2NSFA 1A7DA 1GQAA 3EFOA 3GM1A 2L6GA 3KYIA 1K40A 3U3FA 2R7XA 4MVMA 3UMKA 3CSKA 2QE9A 3RQGA 3PDMP 2Y3HA 4IAQA 4X0RA 4Q4ZF 1T6QA 5BQIA 4J7TA 1M56C 3U2LA 2J9UA 4I44A 3HKKA 1J8MF 2IOQA 1H6GA 4J30B 3FHDA 2DI3A 4MQ9F 3EH1A 3I5PA 2OJQA 3IQCA 4YT2A 2LQGA 2WB7A 2E87A 5KYWB 4O7GA 3AGTA 1QQ3A 5T1DB 1K04A 3EGXA 3HNKA 1LS1A 3B9QA 3IEEA 4XEVA 2F22A 2LFDA 1ZHYA 2YLIA 4CS9A 2EPOA 3DWWA 1M2OA 2XL6A 3LEVA 1GM5A 4C7OA 5T3TA 5A6KA 1T6IA 2YLGA 1VYKA 1LIHA 5F28E 1QKRA 1GS9A 4W8PA 2WZFA 4KNVA 3ZVRA 1ORSC 1NU9C 2WVOA 1VLSA 2J46A 5JS5A 3ZQVA 1ZHZA 4CJGA 3GM3A 3ATPA 1D1CA 1WOLA 5A6BD 4MVQA 1Z63A 4DRJB 3M79A 2A6EF 3Q6NA 1ZW2A 1VK5A 2Q3TA 3DXJF 3JSZA 1ZZPA 2O9XA 4LERA 1Q0FA 4L6RA 4D4NA 3NYJA 4NTBA 4O6MA 4ZLDA 4NY3A 2HS5A 1YA7O 2BE5F 5E2QA 4JURI 3DM9B 4O79A 1A0BA 1JPNA 1RJ9A 5HV9A 1LKXA 1VOMA 3AG4C 4AX2A 2A69F 1TKNA 1OCOC 2LSEA 3NG1A 4I1MA 1SR2A 5L0HA 1RKCA 3HLZA 3B0VC 1YDIA 3C18A 3GODA 3K1IA 3DAFA 3L1MA 4ULWA 4BJ5C 4JTCB 3K1IC 1G5ZA 1AVOB 4LDQA 4DOZA 3L0IA 4CIPA 4JTDB 4KNWA 2LP4A 3EGDB 1L7CA 4FX5A 1OR2A 2OOCA 3TK0A 5B3IA 5F5FA 2KK1A 4Z9HA 3TJ5A 2JD3A 2QUPA 1JMWA 2DYRC 3I5QA 1ZW3A 3JCUQ 4XWJA 4XLNF 3VYWA 1XZQA 1RKEB 1ZVZA 3DD7A 4YT5A 2Y3BA 1Q0MA 1JPJA 4U5BE 2J9VA 2GAQA 4PFPA 4ULVA 2L7AA 4B6IA 4HE8D 3JRMO 2P0NA 1V54C 1LVKA 4C3BA 3T6BA 3C62A 2VCBA 1WN0A 3GEHA 5A6AA 2FAPB 4JIOA 1QVXA 4OD4A 1Z6AA 2LCHA 4YL0A 4D4XA 1XZPA 2R02A 5EK0A 1HY5A 4NTFA 1GGQA 3FAJA 1HMDA 1D0ZA 1ORYA 1YAUO 2XLMA 4JKVA 5TJ5E 3GWLA 3L34A 1WTYA 3O10A 1CPQA 4E17A 1APCA 5D91A 2J8WA 2M4EA 2XLWA 3RW0A 5B1AC 3WAQA 3WHNA 3UGPA 3LS1A 4YL3A 2OCCC 1LPEA 1AEPA 1TFOB 4WABA 3DZAA 1JAFA 2L9JA 2VCAA 3M1CB 3JSEO 4AE4A 2ASRA 2NUTB 5JT4A 2IM8A 2W45A 2J9WA 4YK5A 1DOWA 2WZGA 2WVNA 4GQHA 3B0UX 3N24A 5A6JA 3U5SA 2WL8A 2L6FA 3AG2C 4E18A 4ER9A 2XLEA 2NPUA 4CJOA 3B29A 1I4ZA 1Q0KA 3LJBA 3BEHA 3RKOF 1NFNA 1V4AA 3ABLC 3EHNA 3M4CA 4N6CA 5DVWA 3ZC4A 1ZU4A 4JE9A 2J45A 4U5HA 1MMGA 3QTHA 5F5HA 3SXKA 3X2QC 5KYXA 1E83A 4XEFA 1MMNA 4N4WA 2PNOA 3HNIA 4EBJA 3DMDA 3E9VA 2PF4E 1RMVA 1ZYRF 3C7JA 2YHSA 1M6TA 3AG3C 2C03A 3SXYA 1VTMP 1D0XA 4BJ5A 3U8PA 3LS0A 5L0CA 2DGJA 4J32B 1WWPA 2ZXOA 1TR2A 3KH2A 2D5RB 4JRZA 2GFHA 2HV6A 3V5XA 2YWAA 3WG7C 3EQLF 3K7DA 2B0JA 4LLCA 2OEVA 1I5NA 5BUOA 4JTAB 2R25A 4QI0A 4DRIB 2CGEA 4P9TA 3VAYA 2OQMA 3Q6MA 5DS4A 1PD0A 3EZIA 2IXNA 1FR0A 3ZWIA 3U9MA 4MVUA 1D1AA 4BEJA 1OW8A 1CGOA 2ZXWC 4MW3A 4O6YA 3NMIA 1S7ZA 2EPMX 3AGUA 3GEEA 3ZIBA 1TWAA 1NBBA 4FAPB 1FFHA 3TULA 1EKYA 2XRHA 3QVYA 4U5GA 4BJ1A 1F1MA 1SZIA 2XM0A 3MFNA 4KBLA 1EI7A 1OCCC 2P1AA 2VB6A 3QW0A 5L3QA 3QVZA 4IARA 1HMOA 2LD6A 2Y69C 3N2ZB 1BR4A 1TQGA 4I1OB 5IY5C 1QLEC 1M2VB 4BJ6C 4G78A 4Q7CA 4M63A 1Z23A 3NYLA 4XQ1A 1HW2A 2KJGA 2PP4A 4HFFB 3T9OA 3TOLA 1XWJA 4NC3A 1QPUA 3QMKA 4AL0A 4EBBA 1E85A 3X1OA 4MW8A 3S27A 4E0IA 1BR1A 3K33A 2IBFA 3EG9B 2L6HA 3CZ6A 3KMIA 2NSGA 2A6HF 3OA1A 4CS9C 2KW3C 2Q4FA 3JT1A 4OIQF 1V74B 4IAOA 3FMSA 4DRHB 2KNHA 3AQCA 3EGXB 3MLGA 5GPGB 3TD7A 1D1BA 2CCYA 2W4MA 2W9YA 3EH2A 2H7OA 3JYYA 3Q7LA 4PJJA 4RBNA 3U8VA 4AE4B 1WATA 2HUJA 3U3BA 4G7ZF 3K66A 2XS1A 2TMVP 1YVIA 3O6XA 4OIPF 1BZ4A 3TOMA 1VLTA 3H65A 1SYQA 4LLEA 3TQOA 2BL2A 1VB5A 2AWCA 2PX0A 3F46A 1CGNA 4ONSA 4CX9A 1J8YF 3AG1C 3U2MA 2I15A 4CDYA 1Z3IX 5FCLA 4E7ZA 2G62A 5L0GA 4LDRA 3SXMA 1A41A 4MVSA 4BEMJ 1HE9A 1Q0GA 4O6NA 5DLJA 4U5CE 3N0TA 5L0JA 3DKAA 3AJMA 4G7HF 1MNDA 2YL0A 3GEIA 2XL8A 2QNLA 3JTLO 3HNJA 4FWVA 3L8JA 1W2WA 4PJNA 4CS8C 1RJ9B 5AC4A 3DE9A 4U5EE 3UNGC 2FGYA 2Y3GA 1LE4A 3M4BA 4C3EA 1A7EA 5B3SC 5KYXB 3S84A 1T5OA 1EQ1A 2Q9AA 1VMAA 1H7IA 4NQFA 4E7SA 2R7UA 4MVZA 3SZRA 3POVA 4YT4A 1LI7A 3A9CA 4CS8A 1SMYF 4Z9IA 3RF3A 1YZAA 3ABMC 2UUHA 5L0DA 1QSPA 2J7PA 2ZD9A 4C7OB 1O87A 2Q00A 2R7VA 2LIGA 3ZTZA 3LEOA 3S0XA 3GM2A 1M2VA 1MNEA 1NG1A 4WJ0A 1S05A 2ZXRA 2R7OA 3RVZA 3ZTMA 4EKWA 4EHPA 3CEXA 5HSWA 4QI2A 256BA 3FVYA 4A4AA 4DBQA 2KSFA 4AK9A 3HNLA 1V55C 1SF8A 4CS7A 3NMJA 2OJED 3C8GD 1TWHA 2YL1A 4IJJA 5COMA 1OCZC 1C17M 3VF0A 2HJMA 4XEKA 1RXQA 1ST6A 2EINC 2W4BA 3OWTA 2Q9CA 1U0BB 2YLDA 4YT8A 5L0FA 3UMHA 4U5FE 4JEBA 3JZ0A 1EA8A 3FOPA 3PMRA 5KYUA 3O55A 5KYYA 4MVOA 1OXBA 3DE8A 1ZHTA 4H54A 1BDJB 1KTMA 1A7VA 2G3VA 4IGGA 4ZLCA 4JCHA 3Q7GA 2JX0A 1D0YA 2XLHA 4JVSA 1HW1A 2ZPAA 3QW1A 1IZMA 4PJMA 3S90A 1FTSA 2X51A 4EWCA 1NU7D 3T4RA 5AC5A 4JJFA 5E33A 4OD5A 2CW0F 4OINF 5DS5A 2KQ9A 1OKKA 4DVZA 5K0IA 1N1CA 3I4UA 2FFHA 2R7QA 3NKEA 2XLOA 1LE2A 5FZTA 2QY9A 3C8ZA 5E3CA 1BR2A 2MWQA 3EHMA 3WODF 2IXOA 4U9EA 4R32A 4JCZA 5KYUB 5KYYB 4G7OF 2HJ3A 2R7TA 1PD1A 1RKEA 3K1HA 1BBHA 4PK4A 5AGFA 2PFDA 1U6HA 3C8GB 2J7PD 2XSEA 3NYMA 2YRFA 5BQHA 3HTKC 2HZ8A 3L8IA 3GORA 2YZSA 3MYIA 3U9JA 4BJ6A 4YL1A 2I8BA 2PX3A 2R9RB 4EIYA 2M64A 2RD9A 2EIKC 3LNMB 2Y39A 5L3VA 1E2XA 1O5HA 2P6VA 1MMAA 3B0PA 4JEAA 4CDAA 3ZQYA 2EPNA 2Q9BA 2X0CA 4CBEA 4OIOF 4XPXA 4YWQA 1NZEA 5JP7A 1YA9A 3S29A 1QZXA 2AP3A 4IB4A 2R03A 3UMIA 2OEXA 1E86A 2ZXPA 1OCRC 2VC9A 1ORJA 3OEOA 2A1DD 1OW7A 3UR3C 2AWYA 1Q0DA
chains in the Genus database with same CATH topology
2JPUA 3S9OA 4R32A 2YWAA 3K7DA 2HSBA 1KTMA 2L6FA 1OW6A 3C8GB 5F28E 2Q00A 1QVXA 3C18A 1V4AA 3L8IA 3GM1A 1KNYA 3B71A 2JX0A 2L6GA 1K40A 3BRJA 3GM2A 3U3FA 3RQGA 4EBKA 3GM3A 3RQEA 4XEFA 1OW8A 2L6HA 2LK4A 1WOLA 3C8GA 4EBJA 2KK1A 1WTYA 3O10A 1O3UA 3TULA 3AJMA 3C8GD 1K05A 1ZZPA 1PV3A 3RQFA 3L8JA 3MFNA 3U0CA 4XEKA 3JYYA 2PBEA 1UFBA 1WWPA 1K04A 1JOGA 4NQFA 1OW7A 3JZ0A 4XEVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JPU A;  3S9O A;  4R32 A;  2YWA A;  3K7D A;  2HSB A;  1KTM A;  2L6F A;  1OW6 A;  3C8G B;  5F28 E;  2Q00 A;  1QVX A;  3C18 A;  1V4A A;  3L8I A;  3GM1 A;  1KNY A;  3B71 A;  2JX0 A;  2L6G A;  1K40 A;  3BRJ A;  3GM2 A;  3U3F A;  3RQG A;  4EBK A;  3GM3 A;  3RQE A;  4XEF A;  1OW8 A;  2L6H A;  2LK4 A;  1WOL A;  3C8G A;  4EBJ A;  2KK1 A;  1WTY A;  3O10 A;  1O3U A;  3TUL A;  3AJM A;  3C8G D;  1K05 A;  1ZZP A;  1PV3 A;  3RQF A;  3L8J A;  3MFN A;  3U0C A;  4XEK A;  3JYY A;  2PBE A;  1UFB A;  1WWP A;  1K04 A;  1JOG A;  4NQF A;  1OW7 A;  3JZ0 A;  4XEV A; 
#chains in the Genus database with same CATH topology
 4OIR F;  2A0U A;  3H2V A;  3IQT A;  4U5D E;  3JRT A;  1H9G A;  3W8H A;  2YL7 A;  2H8A A;  3FXH A;  4K1O A;  4K7B A;  3ZG1 A;  3EPV A;  4P9F A;  2EIL C;  3R7C A;  4LAC B;  4LDK A;  3V7O A;  3W8I A;  3DI5 A;  1NFO A;  2R7W A;  4N06 A;  1DOV A;  4UDV A;  3AOU A;  3CQZ A;  3FDQ A;  2HMZ A;  1YZC A;  4MVR A;  5DQT A;  4BG0 A;  3NMK A;  2KGO A;  1HE1 A;  4J7Y A;  4DBR A;  2G3K A;  1UG7 A;  2VAS A;  3PCV A;  4MND A;  2RSE B;  5COG A;  2YL3 A;  3DJU B;  3HJC A;  2HSQ A;  2VH3 A;  2YKZ A;  3IQ5 A;  2PBE A;  3KPH A;  5JUA A;  1E84 A;  4KI2 A;  4KC9 A;  4BPM A;  3EFO B;  3ZDL A;  3DAG A;  1AUE A;  3S9O A;  2DB4 A;  2L81 A;  2OU6 A;  3IPM O;  3R2P A;  4GEH A;  5JVE A;  4XLP F;  2HSB A;  1YJG A;  3RIP A;  4GYT A;  4NCQ A;  2YQY A;  2V3C C;  1T9K A;  2V26 A;  3GAN A;  3LLI A;  4K0D A;  1NSG B;  3MYF A;  2AU5 A;  4JZA A;  3B71 A;  2ETS A;  3LLK A;  5CIV A;  5COF A;  2GWW A;  5A6B A;  1RCP A;  1H9T A;  4DXW A;  1LI5 A;  2XLD A;  1JR8 A;  2ICW G;  3ASN C;  1TWC A;  3KKB A;  5JSL A;  1G4U S;  3C8G A;  3O39 A;  2DYS C;  3MX3 A;  1YYX A;  1OKK D;  1O3U A;  3DM5 A;  5CI9 A;  2UUI A;  1I4Y A;  2EIM C;  1KU2 A;  4NTA A;  2BC5 A;  4HFK B;  1Y6D A;  2NG1 A;  1Z7Q c;  3RVY A;  1L3P A;  1PV3 A;  4EUK B;  2MYS A;  2R7R A;  4JW1 A;  1FNT c;  3EZH A;  2EPK X;  5T3W A;  3J06 A;  1OXK A;  2WZL A;  4MTF A;  1VYI A;  3VM6 A;  2A68 F;  4DJ9 A;  2WVQ A;  4XPW A;  4E0H A;  3KL4 A;  2Z15 A;  4PR9 A;  4Q5S F;  1FAP B;  4MS2 A;  4YN0 B;  4JC7 A;  1JRA A;  5D92 A;  3LES A;  2EIJ C;  1C03 A;  4BJT A;  3FAP B;  2HV7 A;  2P61 A;  3RFY A;  3SXZ A;  3TJ6 A;  4F4B A;  2NUP A;  2XXA B;  1YAR O;  2Q7R A;  1YLM A;  4QDL A;  3SNH A;  2NUP B;  3KYJ A;  3SYN A;  5E3A A;  2XXA A;  1LM3 B;  5KYN A;  3NDB B;  1TWG A;  2B0H A;  1MMD A;  1G8X A;  2XS8 A;  2QTV A;  4YJW A;  4RDA A;  2NUT A;  2QLA A;  5DQZ A;  2J9B A;  3C63 A;  4CDV A;  3SP1 A;  3S28 A;  4ANJ A;  3F47 A;  3E70 C;  4PJL A;  3T6G B;  1Y4C A;  1FMV A;  3RYL A;  4WGY A;  4MTO A;  2D4U A;  2IXP A;  1OQC A;  3QZC A;  3ZSU A;  3G50 A;  4FES A;  2HKV A;  3IQ6 A;  2XLV A;  1WGW A;  3V5Z A;  1OW6 A;  1LS4 A;  2A0B A;  2OKU A;  1FFT C;  1CPR A;  1IW7 F;  1OR3 A;  5EHH A;  2H7B A;  3ECS A;  2CNW A;  3G4X A;  1G4W R;  3CAX A;  3MBG A;  3W2W A;  4EBK A;  2YEV A;  2CDQ A;  1ZHW A;  2H7V C;  4Z9J A;  3GWN A;  4HEA J;  2XM4 A;  2KC3 A;  5B1B C;  2CYD A;  3K6B A;  3US6 A;  1M57 C;  3AQB A;  4DVY P;  4RD9 A;  1B68 A;  3T6J A;  3LNR A;  4AL1 A;  1WAS A;  3RQF A;  4A2N B;  3EG9 A;  4C3D A;  1CGM E;  3H2U A;  2VCC A;  4G0H A;  2GDC A;  3W2V A;  3FOO A;  1UFB A;  2YVK A;  3IHU A;  5JRA A;  1JOG A;  4WGZ A;  2LFF A;  4IRU A;  2R7S A;  2JPU A;  5KYW A;  3RH3 A;  4MTG A;  2EPL X;  3EGD A;  2R05 A;  2OG2 A;  4XPY A;  4PAC A;  1PCX A;  3W4Y A;  2J0W A;  2P7V A;  4W8K A;  1U89 A;  1KNY A;  3PHF 2;  4U9D A;  1R5I D;  2XL4 A;  1Z5Z A;  3DJN B;  3V5Y A;  2HFI A;  1C02 A;  2CNW D;  1FMW A;  3LUT B;  3RQE A;  2LK4 A;  4CIH A;  1NLX A;  4P6I C;  1ZU5 A;  1T01 A;  5CI8 A;  3SEO A;  2Y3D A;  4N6H A;  3JYH A;  5L0I A;  1K05 A;  2GA0 A;  2IYL D;  5EGY A;  2IXM A;  3U0C A;  4CSA A;  2C04 A;  5BQG A;  1ZHX A;  1MQV A;  3UGO A;  3VRC A;  3ABK C;  1R4T A;  4I3M A;  4XTK A;  3EJN A;  3BRJ A;  1TFK B;  2AVK A;  2KYH A;  2MHR A;  5DS6 A;  4H4K C;  3A11 A;  3NRH A;  1T6U A;  3NKD A;  1YYJ A;  4CSA C;  5A69 A;  3LAY A;  4IWB A;  2J0X A;  2HMQ A;  5JLI A;  3ASO C;  4JJG A;  4PFO A;  3ITF A;  3G4Z A;  3M15 A;  2NSF A;  1A7D A;  1GQA A;  3EFO A;  3GM1 A;  2L6G A;  3KYI A;  1K40 A;  3U3F A;  2R7X A;  4MVM A;  3UMK A;  3CSK A;  2QE9 A;  3RQG A;  3PDM P;  2Y3H A;  4IAQ A;  4X0R A;  4Q4Z F;  1T6Q A;  5BQI A;  4J7T A;  1M56 C;  3U2L A;  2J9U A;  4I44 A;  3HKK A;  1J8M F;  2IOQ A;  1H6G A;  4J30 B;  3FHD A;  2DI3 A;  4MQ9 F;  3EH1 A;  3I5P A;  2OJQ A;  3IQC A;  4YT2 A;  2LQG A;  2WB7 A;  2E87 A;  5KYW B;  4O7G A;  3AGT A;  1QQ3 A;  5T1D B;  1K04 A;  3EGX A;  3HNK A;  1LS1 A;  3B9Q A;  3IEE A;  4XEV A;  2F22 A;  2LFD A;  1ZHY A;  2YLI A;  4CS9 A;  2EPO A;  3DWW A;  1M2O A;  2XL6 A;  3LEV A;  1GM5 A;  4C7O A;  5T3T A;  5A6K A;  1T6I A;  2YLG A;  1VYK A;  1LIH A;  5F28 E;  1QKR A;  1GS9 A;  4W8P A;  2WZF A;  4KNV A;  3ZVR A;  1ORS C;  1NU9 C;  2WVO A;  1VLS A;  2J46 A;  5JS5 A;  3ZQV A;  1ZHZ A;  4CJG A;  3GM3 A;  3ATP A;  1D1C A;  1WOL A;  5A6B D;  4MVQ A;  1Z63 A;  4DRJ B;  3M79 A;  2A6E F;  3Q6N A;  1ZW2 A;  1VK5 A;  2Q3T A;  3DXJ F;  3JSZ A;  1ZZP A;  2O9X A;  4LER A;  1Q0F A;  4L6R A;  4D4N A;  3NYJ A;  4NTB A;  4O6M A;  4ZLD A;  4NY3 A;  2HS5 A;  1YA7 O;  2BE5 F;  5E2Q A;  4JUR I;  3DM9 B;  4O79 A;  1A0B A;  1JPN A;  1RJ9 A;  5HV9 A;  1LKX A;  1VOM A;  3AG4 C;  4AX2 A;  2A69 F;  1TKN A;  1OCO C;  2LSE A;  3NG1 A;  4I1M A;  1SR2 A;  5L0H A;  1RKC A;  3HLZ A;  3B0V C;  1YDI A;  3C18 A;  3GOD A;  3K1I A;  3DAF A;  3L1M A;  4ULW A;  4BJ5 C;  4JTC B;  3K1I C;  1G5Z A;  1AVO B;  4LDQ A;  4DOZ A;  3L0I A;  4CIP A;  4JTD B;  4KNW A;  2LP4 A;  3EGD B;  1L7C A;  4FX5 A;  1OR2 A;  2OOC A;  3TK0 A;  5B3I A;  5F5F A;  2KK1 A;  4Z9H A;  3TJ5 A;  2JD3 A;  2QUP A;  1JMW A;  2DYR C;  3I5Q A;  1ZW3 A;  3JCU Q;  4XWJ A;  4XLN F;  3VYW A;  1XZQ A;  1RKE B;  1ZVZ A;  3DD7 A;  4YT5 A;  2Y3B A;  1Q0M A;  1JPJ A;  4U5B E;  2J9V A;  2GAQ A;  4PFP A;  4ULV A;  2L7A A;  4B6I A;  4HE8 D;  3JRM O;  2P0N A;  1V54 C;  1LVK A;  4C3B A;  3T6B A;  3C62 A;  2VCB A;  1WN0 A;  3GEH A;  5A6A A;  2FAP B;  4JIO A;  1QVX A;  4OD4 A;  1Z6A A;  2LCH A;  4YL0 A;  4D4X A;  1XZP A;  2R02 A;  5EK0 A;  1HY5 A;  4NTF A;  1GGQ A;  3FAJ A;  1HMD A;  1D0Z A;  1ORY A;  1YAU O;  2XLM A;  4JKV A;  5TJ5 E;  3GWL A;  3L34 A;  1WTY A;  3O10 A;  1CPQ A;  4E17 A;  1APC A;  5D91 A;  2J8W A;  2M4E A;  2XLW A;  3RW0 A;  5B1A C;  3WAQ A;  3WHN A;  3UGP A;  3LS1 A;  4YL3 A;  2OCC C;  1LPE A;  1AEP A;  1TFO B;  4WAB A;  3DZA A;  1JAF A;  2L9J A;  2VCA A;  3M1C B;  3JSE O;  4AE4 A;  2ASR A;  2NUT B;  5JT4 A;  2IM8 A;  2W45 A;  2J9W A;  4YK5 A;  1DOW A;  2WZG A;  2WVN A;  4GQH A;  3B0U X;  3N24 A;  5A6J A;  3U5S A;  2WL8 A;  2L6F A;  3AG2 C;  4E18 A;  4ER9 A;  2XLE A;  2NPU A;  4CJO A;  3B29 A;  1I4Z A;  1Q0K A;  3LJB A;  3BEH A;  3RKO F;  1NFN A;  1V4A A;  3ABL C;  3EHN A;  3M4C A;  4N6C A;  5DVW A;  3ZC4 A;  1ZU4 A;  4JE9 A;  2J45 A;  4U5H A;  1MMG A;  3QTH A;  5F5H A;  3SXK A;  3X2Q C;  5KYX A;  1E83 A;  4XEF A;  1MMN A;  4N4W A;  2PNO A;  3HNI A;  4EBJ A;  3DMD A;  3E9V A;  2PF4 E;  1RMV A;  1ZYR F;  3C7J A;  2YHS A;  1M6T A;  3AG3 C;  2C03 A;  3SXY A;  1VTM P;  1D0X A;  4BJ5 A;  3U8P A;  3LS0 A;  5L0C A;  2DGJ A;  4J32 B;  1WWP A;  2ZXO A;  1TR2 A;  3KH2 A;  2D5R B;  4JRZ A;  2GFH A;  2HV6 A;  3V5X A;  2YWA A;  3WG7 C;  3EQL F;  3K7D A;  2B0J A;  4LLC A;  2OEV A;  1I5N A;  5BUO A;  4JTA B;  2R25 A;  4QI0 A;  4DRI B;  2CGE A;  4P9T A;  3VAY A;  2OQM A;  3Q6M A;  5DS4 A;  1PD0 A;  3EZI A;  2IXN A;  1FR0 A;  3ZWI A;  3U9M A;  4MVU A;  1D1A A;  4BEJ A;  1OW8 A;  1CGO A;  2ZXW C;  4MW3 A;  4O6Y A;  3NMI A;  1S7Z A;  2EPM X;  3AGU A;  3GEE A;  3ZIB A;  1TWA A;  1NBB A;  4FAP B;  1FFH A;  3TUL A;  1EKY A;  2XRH A;  3QVY A;  4U5G A;  4BJ1 A;  1F1M A;  1SZI A;  2XM0 A;  3MFN A;  4KBL A;  1EI7 A;  1OCC C;  2P1A A;  2VB6 A;  3QW0 A;  5L3Q A;  3QVZ A;  4IAR A;  1HMO A;  2LD6 A;  2Y69 C;  3N2Z B;  1BR4 A;  1TQG A;  4I1O B;  5IY5 C;  1QLE C;  1M2V B;  4BJ6 C;  4G78 A;  4Q7C A;  4M63 A;  1Z23 A;  3NYL A;  4XQ1 A;  1HW2 A;  2KJG A;  2PP4 A;  4HFF B;  3T9O A;  3TOL A;  1XWJ A;  4NC3 A;  1QPU A;  3QMK A;  4AL0 A;  4EBB A;  1E85 A;  3X1O A;  4MW8 A;  3S27 A;  4E0I A;  1BR1 A;  3K33 A;  2IBF A;  3EG9 B;  2L6H A;  3CZ6 A;  3KMI A;  2NSG A;  2A6H F;  3OA1 A;  4CS9 C;  2KW3 C;  2Q4F A;  3JT1 A;  4OIQ F;  1V74 B;  4IAO A;  3FMS A;  4DRH B;  2KNH A;  3AQC A;  3EGX B;  3MLG A;  5GPG B;  3TD7 A;  1D1B A;  2CCY A;  2W4M A;  2W9Y A;  3EH2 A;  2H7O A;  3JYY A;  3Q7L A;  4PJJ A;  4RBN A;  3U8V A;  4AE4 B;  1WAT A;  2HUJ A;  3U3B A;  4G7Z F;  3K66 A;  2XS1 A;  2TMV P;  1YVI A;  3O6X A;  4OIP F;  1BZ4 A;  3TOM A;  1VLT A;  3H65 A;  1SYQ A;  4LLE A;  3TQO A;  2BL2 A;  1VB5 A;  2AWC A;  2PX0 A;  3F46 A;  1CGN A;  4ONS A;  4CX9 A;  1J8Y F;  3AG1 C;  3U2M A;  2I15 A;  4CDY A;  1Z3I X;  5FCL A;  4E7Z A;  2G62 A;  5L0G A;  4LDR A;  3SXM A;  1A41 A;  4MVS A;  4BEM J;  1HE9 A;  1Q0G A;  4O6N A;  5DLJ A;  4U5C E;  3N0T A;  5L0J A;  3DKA A;  3AJM A;  4G7H F;  1MND A;  2YL0 A;  3GEI A;  2XL8 A;  2QNL A;  3JTL O;  3HNJ A;  4FWV A;  3L8J A;  1W2W A;  4PJN A;  4CS8 C;  1RJ9 B;  5AC4 A;  3DE9 A;  4U5E E;  3UNG C;  2FGY A;  2Y3G A;  1LE4 A;  3M4B A;  4C3E A;  1A7E A;  5B3S C;  5KYX B;  3S84 A;  1T5O A;  1EQ1 A;  2Q9A A;  1VMA A;  1H7I A;  4NQF A;  4E7S A;  2R7U A;  4MVZ A;  3SZR A;  3POV A;  4YT4 A;  1LI7 A;  3A9C A;  4CS8 A;  1SMY F;  4Z9I A;  3RF3 A;  1YZA A;  3ABM C;  2UUH A;  5L0D A;  1QSP A;  2J7P A;  2ZD9 A;  4C7O B;  1O87 A;  2Q00 A;  2R7V A;  2LIG A;  3ZTZ A;  3LEO A;  3S0X A;  3GM2 A;  1M2V A;  1MNE A;  1NG1 A;  4WJ0 A;  1S05 A;  2ZXR A;  2R7O A;  3RVZ A;  3ZTM A;  4EKW A;  4EHP A;  3CEX A;  5HSW A;  4QI2 A;  256B A;  3FVY A;  4A4A A;  4DBQ A;  2KSF A;  4AK9 A;  3HNL A;  1V55 C;  1SF8 A;  4CS7 A;  3NMJ A;  2OJE D;  3C8G D;  1TWH A;  2YL1 A;  4IJJ A;  5COM A;  1OCZ C;  1C17 M;  3VF0 A;  2HJM A;  4XEK A;  1RXQ A;  1ST6 A;  2EIN C;  2W4B A;  3OWT A;  2Q9C A;  1U0B B;  2YLD A;  4YT8 A;  5L0F A;  3UMH A;  4U5F E;  4JEB A;  3JZ0 A;  1EA8 A;  3FOP A;  3PMR A;  5KYU A;  3O55 A;  5KYY A;  4MVO A;  1OXB A;  3DE8 A;  1ZHT A;  4H54 A;  1BDJ B;  1KTM A;  1A7V A;  2G3V A;  4IGG A;  4ZLC A;  4JCH A;  3Q7G A;  2JX0 A;  1D0Y A;  2XLH A;  4JVS A;  1HW1 A;  2ZPA A;  3QW1 A;  1IZM A;  4PJM A;  3S90 A;  1FTS A;  2X51 A;  4EWC A;  1NU7 D;  3T4R A;  5AC5 A;  4JJF A;  5E33 A;  4OD5 A;  2CW0 F;  4OIN F;  5DS5 A;  2KQ9 A;  1OKK A;  4DVZ A;  5K0I A;  1N1C A;  3I4U A;  2FFH A;  2R7Q A;  3NKE A;  2XLO A;  1LE2 A;  5FZT A;  2QY9 A;  3C8Z A;  5E3C A;  1BR2 A;  2MWQ A;  3EHM A;  3WOD F;  2IXO A;  4U9E A;  4R32 A;  4JCZ A;  5KYU B;  5KYY B;  4G7O F;  2HJ3 A;  2R7T A;  1PD1 A;  1RKE A;  3K1H A;  1BBH A;  4PK4 A;  5AGF A;  2PFD A;  1U6H A;  3C8G B;  2J7P D;  2XSE A;  3NYM A;  2YRF A;  5BQH A;  3HTK C;  2HZ8 A;  3L8I A;  3GOR A;  2YZS A;  3MYI A;  3U9J A;  4BJ6 A;  4YL1 A;  2I8B A;  2PX3 A;  2R9R B;  4EIY A;  2M64 A;  2RD9 A;  2EIK C;  3LNM B;  2Y39 A;  5L3V A;  1E2X A;  1O5H A;  2P6V A;  1MMA A;  3B0P A;  4JEA A;  4CDA A;  3ZQY A;  2EPN A;  2Q9B A;  2X0C A;  4CBE A;  4OIO F;  4XPX A;  4YWQ A;  1NZE A;  5JP7 A;  1YA9 A;  3S29 A;  1QZX A;  2AP3 A;  4IB4 A;  2R03 A;  3UMI A;  2OEX A;  1E86 A;  2ZXP A;  1OCR C;  2VC9 A;  1ORJ A;  3OEO A;  2A1D D;  1OW7 A;  3UR3 C;  2AWY A;  1Q0D A; 
#chains in the Genus database with same CATH homology
 2JPU A;  3S9O A;  4R32 A;  2YWA A;  3K7D A;  2HSB A;  1KTM A;  2L6F A;  1OW6 A;  3C8G B;  5F28 E;  2Q00 A;  1QVX A;  3C18 A;  1V4A A;  3L8I A;  3GM1 A;  1KNY A;  3B71 A;  2JX0 A;  2L6G A;  1K40 A;  3BRJ A;  3GM2 A;  3U3F A;  3RQG A;  4EBK A;  3GM3 A;  3RQE A;  4XEF A;  1OW8 A;  2L6H A;  2LK4 A;  1WOL A;  3C8G A;  4EBJ A;  2KK1 A;  1WTY A;  3O10 A;  1O3U A;  3TUL A;  3AJM A;  3C8G D;  1K05 A;  1ZZP A;  1PV3 A;  3RQF A;  3L8J A;  3MFN A;  3U0C A;  4XEK A;  3JYY A;  2PBE A;  1UFB A;  1WWP A;  1K04 A;  1JOG A;  4NQF A;  1OW7 A;  3JZ0 A;  4XEV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...