1WP7A

Crystal structure of nipah virus fusion core
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
76
structure length
64
Chain Sequence
b'NINKLKSSIESTNEAVVKLQETAEKTVYVLTALQDISSQISSMNQSLQQSKDYIKEAQRLLDTV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords fusion protein
publication title Crystal structure of Nipah Virus fusion core
rcsb
source organism Nipah virus
molecule tags Viral protein
total genus 33
structure length 64
sequence length 76
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2004-08-31
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.770 Mainly Alpha Orthogonal Bundle Helix Hairpins YojJ-like 1wp7A00
2QTSA 4FZ1A 2FB5A 3S3WA 1WP8A 4NYKA 4NTXA 4FZ0A 4NTWA 1WP7A 3N27A 3IJ4A 3S3XA 4NTYA 2L35A
chains in the Genus database with same CATH superfamily
2HEPA 2ARHA 5H9CA 1OCCC 2P06A 2YI9A 1PKXA 2AHYA 4JI7B 3BCCH 1XL4A 4BIUA 3G67A 4NXMB 3ZX6A 5DM6V 4LC1A 5LA6B 4JI7O 4BW5A 5LYJB 4DV0B 1IZ3A 2AZ2A 4NXMO 4MVOA 1XMQB 1NBMG 4J10A 4H44B 2ZD9A 1IXMA 4I7ZB 2YEVA 2JJ2G 4DV0O 4PI0A 3OUSA 5JCOC 1XMQO 4TQDA 3GWOA 3AG3C 4W4KA 3JASA 2ODMA 2ZIMA 3OFNG 3H1HH 3SR2C 2E76B 3CJHB 2RMKB 2RJZA 3G71V 1RSOB 3RYIB 3TCUA 2UUBB 3FAVA 4QNHB 4Q6GA 5CB4A 3SYOA 1NJIW 5A9GA 2PUSA 5JVDB 3W7XA 2UUBO 2W6JG 5KHKA 3SGIA 1ZUQA 3FYIB 4DR1B 1PL0A 4Q20A 1V9PA 4DK1A 4CH4A 3JD2A 4XDKA 2DJVA 4DR1O 2BE3A 2JEUA 2QE7G 2JS5A 3IC9A 3G4SV 4ABMA 2GBOA 4L8JA 1XHZA 2EIMC 4B3RB 3F7VC 1AJPA 2WA3A 1JJOA 1F23A 4PA7A 3D36C 2JK5C 4FIPC 1UFIA 2QR4A 1BSMA 4B3RO 4UVBA 5AG2A 2CH7B 4YIOA 3THOA 4AQYB 1GMGA 1YTFB 5IE9A 2XAHA 1OCCB 1TVKA 5DN6G 3OM3B 2CTRA 4CC6A 4TUYB 4MVRA 1F4MA 2JRIA 1Y4MA 4AQYO 1GN4A 4BW9A 4UFZA 4GYCB 2PZSA 2R72A 1AJNA 4KHPB 1WN7A 4LR3A 3CCQV 5J2UB 4K35A 1VF6C 1GRJA 5EZYA 2ZNJA 3SJBC 4KHPO 1W0JG 1XL6A 5JJEB 3CRAA 1OCZB 3VOUA 2XAQA 3B09A 4KL1A 4Z1VA 2Y0PA 1YJNV 4QJFB 1S0VA 2DQ0A 1FXVA 3LUTB 1VQLV 3RT3C 4J7ZA 2V7QG 1V54C 4I9QA 5L3FA 4LF6O 1TGOA 3CB2A 2MK3A 1GKFA 2GUZB 3T1HB 3F7YC 3RW0A 3HKBA 4ZIBA 2ZE7A 2X6CA 4CS3A 1PP9H 1W0KG 3P30A 5CA3A 1AVMA 1SQPH 3WG7B 3T1HO 2EBOA 2WLIB 1VMGA 2ZQMA 3KCXA 1MG1A 2HLDG 4UXNA 4PA4A 3FB8C 1IDSA 1BE3H 3QVNA 4MVSA 2IH3C 3KG2A 1AP5A 5IYZA 2R9AA 3RFRA 4JGSA 1SZXA 1JPXA 2YC0A 4B3SB 1FXKC 3CYOA 3ABKC 4UUJC 1B6QA 1WLEA 5KX5B 5D5PA 4B3SO 3JARA 1PPJH 4FLWA 3ETGA 4MW3A 1F7YA 3LSSA 4EB6B 2LFRA 2V4DA 2PY5A 1WAZA 2Y69C 1SQVH 2D3OW 5JWPA 1VQ7V 1TUBB 4H0LB 2F4VB 2R9RB 3CC4V 3E8GA 2B1GA 4D7TA 1V55C 1HW7A 5IYDO 3JSNA 5LYJA 3JATB 5C8YA 3SPHA 3WB0A 4NTWA 2GDSA 1XREA 4FPPA 3AK3A 3OMAB 3ETEA 1SQQH 3RVYA 2YXHA 1ZAUA 4FVMA 1M1KW 2QWOB 3DSQA 4D6TH 5B1AB 3VBBA 4YXWG 4GKKB 3L75H 3CJHA 2OYQA 4X8AA 3CCEV 3A8TA 3RWRD 3RYIA 3VQWA 4GKKO 2EZOA 3K0GA 4D7SA 3I55V 1K34A 1S76D 1H2KA 1Q6IA 3FB6C 5JVDA 1ORQC 3CCJV 1Q8IA 3LDDA 3VQVA 4A5UB 2XNDG 1RP3B 3HKDB 1SETA 4GX1A 4I0XB 4N23A 4AILC 3CHXA 1LNQA 3JAWA 4KUMA 2QM4A 3SJQC 3IAYA 4OPHA 2XOKG 4CBCA 2JEXA 4H13B 1S5LZ 5BZBA 5E1AC 2KB1A 1QR8A 5CMUA 1FXKB 4OGQB 1YI2V 1JX9A 1BHAA 3K03A 2IJHA 2DWDC 1M5IA 1Y74A 4U7NA 2CH7A 4JI3B 3CCRV 4IHJB 2QTOA 5B66Z 3AEIA 2Y69B 4CC5A 4UV9A 1X4TA 4MS2A 3OW2U 4JI3O 1YHQV 3KZIZ 4LH7A 1AI4A 4TUYA 2BTOA 1XBLA 3K9SA 3B8NA 2ITDC 4UV8A 2OCCB 4C7UA 3HKCB 1PM9A 4ZI7B 3ZHSA 4TOIA 5J2UA 5JH7B 4XBFA 1CPYA 3B8MA 3AG1B 2F1MA 3X2QB 4K0KB 1SF9A 5KAIZ 4MVQA 4OPAA 2P67A 3ABMC 4J9ZB 2WLMA 5LMNB 1W2BU 1IVSA 3N2GB 3K3WA 4JAVA 2CTWA 2IJJA 3ABUA 4JI5B 2GUZA 3SYAA 2PYLA 2ZDIC 1EZJA 4F6EA 1G1XB 1YZBA 2JDIG 2QGNA 4X1KB 4CH5A 4CH3A 4B08A 4JI5O 2WLIA 2RCVA 2WLJA 4JI8B 1NVPD 5CBHA 4WFBV 1YCIA 2D2CB 1PNMA 4JI8O 1VQMV 2ATKC 1WB8A 1XOUA 2HVJC 3CP1A 1S5HC 2XAFA 2Q68A 2IU3A 2EILB 5EYPB 3OEEG 2JJ1G 4MT8A 3MHSC 2OIEA 3D3IA 2EIKB 2IJIA 2JGDB 3K57A 4JI0B 4FLVA 2LW7A 1BQZA 4EB6A 4IT5A 2DW4A 3AG2C 4DV3B 2OIGA 4JYCA 1RM1C 3I56V 2E74B 4JI0O 1BL8A 5LL6Y 3H1IH 4DV3O 1QHTA 1Y66A 3QG5A 4P2ZA 1R6TA 1TUBA 3P3PA 1MZFA 3BY6A 2VWKA 2QEXV 2AGAA 2ZE8A 2X0LA 4HAMA 3ABLC 4WFFA 4QIWF 2WWWA 4BR6A 3JATA 3HKEB 2CTPA 2KG7B 3CMAV 5E79Z 4GLXA 5IT9N 5KHHA 3ETDA 3BEHA 2DYRB 1CXZB 2CUGA 5FNVB 4JI6B 4BAYA 2P7TC 5CBFA 5IJ0B 1GM7A 4JI6O 2ZIOA 2XUMA 4WBNB 4MTXA 4RAIA 3ABMB 4NR1A 3M7MX 3OR7C 2IW5A 4TT3G 1H38A 4UCSA 4O2AB 4QE7A 3ML0A 4EKWA 2P6JA 2QWRB 1VF5B 1WA8B 3GB7C 2Z0AA 1O9HA 4H37A 4IIJB 4TV9A 2CAZC 5EIBC 3HKDA 5B1BB 1EZVH 1Q7YW 2QM8A 3CRQA 3KKYA 4JI1B 2W0XA 4JAAA 3LNMB 4HYOA 3MAQA 4MTOA 4DYLA 2CE4A 1MZEA 4J7KA 1K92A 2ZT9B 1U97A 1QR9A 3JALB 4X20B 3E8BA 3AG4C 5B5EZ 1GAXA 5KUMA 2OT5A 1EN5A 3CCLV 3CXHF 1Q6HA 5LOVB 4NXNB 3FD9A 1AR5A 4MVUA 4IHJA 4DK0A 2E5LO 1DTOA 4K8ZA 3OMNB 4NXNO 3SPGA 1FPOA 4LNUA 4O4JB 3UO2A 2RDCA 3C3TA 2Q7EA 1GO3F 2HR3A 2HP8A 5ITZB 3W7TA 2A0LA 4K8XA 1OCOC 2Q0AA 3GWKC 4ZI7A 1JMKC 2H8PC 5JQGB 5IJ9B 1GN3A 3ABLB 3OGCC 1L8DA 1P7BA 2EX3A 3SYCA 3ETQA 1KC8W 3BVOA 2RNBA 1QU7A 2OWOA 1XHXA 2NN4A 1IX9A 1N36O 4PELA 4WFAV 4EEQA 4DUZB 1YVWA 3N2GA 4G2KA 3WB1A 3H01A 1E1QG 1R1BA 4DUZO 3ZJZA 1S77D 5J2TB 4X1KA 4DV7B 5LP6C 5DEDA 2V1DA 2P5OA 2GV9A 2QWNB 2WPDG 4J41A 4DV7O 2Q6AA 1NZ6A 4JZGA 2W0FC 3FKSG 1HDJA 3TGUH 1M56C 4FLUA 3JD4A 2JVDA 3STLC 2OTLV 1IURA 1G6UA 1K4CC 1M93A 5H6QA 3U11A 4UCVA 2WLNA 3JCUZ 5EYPA 1FXHA 5LBQA 4MVMA 3ASOC 5H5NA 5KLVH 2F95B 1FS0G 4Z1MG 3K59A 5KA5A 2M7WA 1H2NA 2EINC 1OCRB 1OJHA 3KCYA 3HB3B 5L3BA 3TXQA 3AG4B 3AK1A 4MSWC 1SZTA 2ZR2A 3JCZA 1YITV 1KQSU 2PTMA 2O57A 3OTFA 2NR5A 3B77A 2QKCA 2QTSA 1A32A 3ZMUA 1P84F 3ZBHA 3WFVA 1SA0B 1VQNV 1I5XA 3HKEA 3ZMVA 1AROP 2KG7A 1URFA 5GONB 2YXYA 4LFBB 4X66B 3FB7C 1WJZA 1LR1A 4FK5C 1S5JA 5FNVA 4U3JB 1R3IC 5CN0A 4GKJB 4CH6A 4LFBO 4X66O 4LWSB 4LF6B 2ZKOA 1DF4A 1S72V 1P7GA 1I08A 5B1OA 3QO7A 1IXBA 4GKJO 1QBZA 4DV2B 1ZTEA 1MABG 1XEQA 3AG3B 1N34B 2PYJA 3ZMSA 3LSUA 1QNMA 3E22B 4O2AA 1NTMH 2DYSC 4DUYB 4DV2O 2QKAA 1N34O 2XASA 1WA8A 3FFQA 4B3TB 4JI4B 3CD6V 1NT2B 2XHBA 4IIJA 4WF9V 4DUYO 3EHBB 1KP3A 4G28B 1SQGA 4PA6A 2UUAB 4B3TO 4JI4O 1XUQA 5LGNA 2A9HA 4LBEC 2IBZH 2WAMA 3CSXA 1SQFA 4NB5A 2LGWA 3CRCA 2UUAO 4FM0A 1VQ5V 1FAFA 3K0DA 3OMIB 1QLNA 4DV1B 3S3XA 1W59A 3C3SA 3QTCA 1D2DA 1TAEA 2NNUA 3JALA 5LGUA 1ZSPA 4FM2A 3ASOB 4DV1O 2YS8A 5CBGA 1HNXB 4ZHQB 2B1IA 2Q0OC 5LOVA 1AB3A 1JJ2U 1SQBH 2EIMB 1FFTB 3SJCC 5TISZ 1NS1A 4YJ3B 4PDMA 2AHZA 3BAAA 3SPJA 2EINB 1HNXO 1IBMB 5KAFZ 1M57C 1TA8A 2BTQB 4WFHA 5L3EA 2QSAA 1XQ8A 4O4JA 4PHZA 5CA0B 3CRRA 1NTZH 5F2VO 3ZHRA 4EFEA 1IBMO 5ITZA 3ZRWB 2UXXA 2VWJA 1BS3A 5LA6A 1T5EA 5JQGA 4LF8B 3G6BA 4JYYA 3M8AA 3CRMA 1SC5B 4PDVA 3TXSA 3B40A 1JCHA 4AI8A 4FMTA 2WLHA 4LF8O 5IYCO 3BPZA 3R65A 3CCSV 4O4HB 2YI8A 3IJ4A 3L9DA 4JASA 1DLBA 3JD3A 1DF5A 1K7DA 4TSFG 1RPRA 3PN1A 2ITCC 1DGSA 5LGTA 5GW7A 3BA8A 3R66A 2WA4A 4B7KA 2X6AA 5IYBO 1KP2A 1SKVA 2YXLA 1NR7A 1LUWA 1P4RA 2R9IA 5FPOA 4FLTA 4XDJA 4KXRA 1RSOA 5J2TA 1V54B 2Q7GA 3RYFB 4U3FH 3VQYA 2DYSB 4CZZA 4DR7B 1K33A 1D5NA 1SQXH 1N32B 3RYCB 2OTJV 1SERA 5BMVB 4DR7O 1Y76B 2A06H 5HFMA 4PV1B 1RPOA 2YIBD 2ZCEA 1N32O 3J81N 1UJWB 3G6EV 3A2FA 2GTSA 4MVZA 1RFYA 1KMIZ 1MNGA 3ZCCA 2LJ2A 2CDYA 2LGQA 5LXTB 4LFCB 3ABKB 2FKXA 4UCTA 1YIJV 2HG5C 1GM8A 4PA3A 1WP7A 3B4SA 4X1IB 1MOFA 1NH2D 4LFCO 3OEHG 1J95A 2CK3G 1HWYA 3A0HZ 2GHYA 1IBLB 1AR1B 4I55B 4KP4A 4DO2A 1N0JA 1SA0A 1K3EA 3JAMN 1KKDA 1IBLO 2K1EA 4DR6B 4X9QA 2AZ0A 5GONA 1SS3A 4LH6A 2YIDA 4UB8Z 3ZMTA 1V55B 5BXZA 1G4YB 4PJ0Z 5KUKA 4DR6O 3SYQA 3Q4HB 3BA9A 2B5UA 2R70A 3T1CA 2EIJC 2F23A 3K79A 1MMMA 4UVCA 3ZRSA 1L0NH 5JCOA 2E3CA 1F4NA 1E1RG 5IY5C 3H1KH 3E22A 1PD3A 2FMLA 1GH6A 1Y67A 1US6A 1M4UA 5EBMC 1BMFG 4U7OA 2X7RB 3TETA 2Q7HA 1B04A 5KHGA 3L73H 3CXCU 2YIAA 4PD4F 1JVMA 4YHHB 3E2EA 2F93B 3APOA 3ASNC 1L1FA 4WFEA 3W7SA 4LF9B 4JV5B 4R8CA 3JD1A 4YHHO 5CB4B 4X64B 1GK9A 5KX5A 5EK0A 4LF9O 4JV5O 2Y0IA 3AG7A 3JD0A 1QLEC 1EFRG 4X64O 1NKDA 4CS4A 4ZHQA 4I50B 4YJ3A 5A2QN 2FL4A 3E35A 1R3LC 3D36A 2BTQA 2HKOA 3JYCA 1EN6A 3C90A 2ADPA 5CA0A 4J11A 2OCHA 1VP7A 4PI2A 3N2KB 5FPRA 3ZRWA 1ZL8B 3CS5A 3U0ZA 1VIBA 3AK2A 4DV6B 1FKAO 3CEIA 2BSKB 3ZHTA 2AW9A 3RN4A 3ZEDA 5JJNB 1NH2B 4DV6O 1E79G 1QVGU 2IM9A 4W4LA 1Q5OA 4LF7B 3ZHVA 2P4VA 4DW1A 1Z5WA 5BR8O 2HFEC 4O4HA 1VF6A 2EJ7A 5EC2C 1H8EG 4LF7O 5GTHZ 2N05A 4DRXB 2KSDA 3E83A 2YICA 2DN9A 2F66C 4RWUA 2Y4UA 2C2AA 3QF7A 2RN9A 2UXCB 5EIBD 1B3QA 3JSLA 1UPGA 1YF2A 3RYFA 4DR3B 2UXCO 4P9OA 3DC6A 2QWPB 4LF5O 1BGYH 1JFFB 5B3SC 3CC2V 4DR3O 3RYCA 1VEWA 5BMVA 4I0XA 1Y76A 2L6LA 4EFBA 2UXDB 4WCEV 3K06A 3K5OA 3RVZA 2DWEC 3SDLA 3ZMZA 1OZ0A 1Q90D 2YUAA 2BCCH 1YDXA 2DMXA 2UXDO 1MSWD 1EN4A 4FZ0A 5LXTA 2HHHB 1GTOA 1FXKA 4F6RB 5L3DA 4DR4B 2VQFB 3E86A 2Y48A 1YJWV 2HHHO 3UO3A 1THZA 1N0NA 4H33A 1KBHA 2E5LB 5IYZB 4FJCC 4DR4O 2VS0A 1F51A 2VQFO 1JOYA 2EULA 2IH1C 5L3GA 1FD9A 4DXWA 3AG2B 1D5AA 2IJKA 2Z3YA 1RM1B 4NTXA 4I55A 3QNEA 3FB5C 1Q81W 3CX5F 3WU2Z 1GM9A 3CE2A 1KYOF 3HPLC 3HKCA 1SRYA 1ZX3A 5JH7A 4DV4B 2QDOA 3H1LH 3L71H 2HJDA 1K9MW 1N36B 3Q4HA 2Q69A 3UKMA 4DV4O 3LSQA 1AP6A 2HVKC 4DV5B 4QGPA 3A0RA 1NQTA 4J7JA 4R6ZA 2MW2B 1BCCH 3UM7A 5KA6A 5C8YB 4O4LB 4GT1A 5C93A 4LCUC 3S3WA 4DV5O 5LHHA 1OCZC 1VQPV 2YSUB 1KECA 3O9OA 1Z2GA 3MHHC 1XMOB 2GTAA 4NTYA 4UVAA 2ZNIA 2Q4PA 1XMOO 3QO8A 4QPJA 1YSCA 2Q5ZA 4GZRB 4O4IB 1U96A 5B3SB 3ABTA 1M90W 1R3KC 1YXBA 4BWAA 4AHCA 3WG7C 1NU1H 4B7EA 3ZHUA 4NKGB 3J80N 1M9NA 3IC7A 2QWQB 2ZXWC 2LW1A 1VQOV 4R50A 1YEWA 2YDEA 2PI4A 2LO1A 2JGDA 2DE0X 3JAWB 2WSSG 5KMGB 1G8MA 3W7WA 4FZ1A 1EM1A 1NTKH 1CEZA 2UUCB 4I50A 3OAAG 4GX5A 2YIBA 4B3MB 1WNSA 3UCSC 3K08A 4IGGA 5CA1B 4UB6Z 4HZ3A 3ZIAG 2UUCO 4X1YB 4FFKA 4B3MO 1AI5A 3N2KA 4GX0A 1ZL8A 1I94B 1R6NA 2KQXA 4JYAB 4FLZA 3BRCA 2BSKA 2X6BA 1KU9A 2XTAA 3MD0A 3RYHB 1Y74B 1I94O 3ZRVA 4PA9A 4JYAO 1BHBA 1OCOB 2Y4TA 5FLXN 1BQ0A 1H2LA 5LHIA 1H2MA 1K4DC 1K5QA 4DRXA 3ICXA 2VQEB 1VQ9V 2A79B 5IJ0A 1AILA 4WBNA 3JAKB 3CCMV 4F4LA 1B06A 4I5SA 1KD1W 5EBLC 4FFBB 2VQEO 2EZPA 1I0HA 3L74H 2A7WA 3E8HA 3K58A 5B1AC 1KUQA 2HJFC 4JTDB 4MTGA 5BY1A 3BFRA 2AXTZ 1JFFA 2WLLB 2ZDIA 3EXAA 5LHGA 2DOSA 5GTIZ 1BZKA 2CTQA 1QCEA 4JYBA 4UCOA 4CS2A 5LP6B 4J80A 2CGOA 5L3CA 5B1NA 4JAUA 2ILMA 2ADQB 4QPKA 3T1YB 4ZOLB 2Z5UA 2P4KA 4HBNA 1M56B 4DW0A 3T1YO 1ROPA 3CMEV 3CWBH 3LDEA 4DR2B 1FYJA 3SPIA 4X62B 5HFLA 4F6RA 5IDJA 1DK1A 3RGBA 4X20A 2BOBC 4DR2O 2ZXWB 3G80A 4X62O 4HNAB 4GX2A 1YJ9V 2PGGA 4RQEA 1Q86W 1BT8A 4BIOA 5H6RA 4MW8A 1R3JC 1R6KA 1TUEB 3T2MA 4ICGA 3STZC 3ZS8C 4JI2B 4ZKIA 3I5DA 1HP8A 5J9PC 2ZM6B 2ZE6A 1OHHG 2M6YA 3SPCA 1MA1A 4JI2O 2LFSA 4PDRA 2ZM6O 3VQXA 4LF4B 4P30A 3IFXA 5IJ9A 1XI1A 3H1JH 1WPXA 3B2EE 1K5SA 1VARA 1FFXB 1I7FA 3LNNA 3RBZA 4L87A 4FLYA 4LF4O 4X88A 2OCCC 3CPWU 2XAGA 1XNRB 1ENVA 3AG1C 3LDCA 4O2BB 1L0LH 4GCZA 3X2QC 1NR1A 3UT5B 1AI6A 4MTFA 1I5YA 1XNRO 2F4VO 4O4LA 2G38A 4LFAB 3E89A 5JJJB 5K1PA 4G27B 4E4EA 4YJ2B 1PNLA 3BHPA 3P32A 4TV8B 4LFAO 4BIZA 1WB7A 1XILA 1Q82W 3ZHQA 3D8CA 1H2SB 4IYIA 3O65A 4O4IA 1MSDA 4Z2WA 3FYEB 4P9PA 4KFMA 3K5MA 3T4DA 4ASUG 2E75B 2Q9LA 5FL7G 4NVPA 1VQ6V 1AI7A 3IGAC 2UU9B 1LUVA 4R7CA 4TV9B 4OXSA 3L72H 3U10A 1OV9A 1Z5VA 4JF3A 2UU9O 1N33B 5KMGA 3DXRB 4J9YB 2EILC 2A3QA 4DR5B 1P49A 4TQFA 1N33O 2LP7A 2GSMB 5CA1A 5LMUB 1VQ4V 2EIKC 2XT9A 2EJRA 4X1YA 4K3AA 2H3OA 4DR5O 3QO5A 3APQA 3K5LA 1JR9A 1GN6A 1ZLZA 3OD4A 5LMUO 1M57B 1AJQA 3ZN1A 1O9GA 1J5EB 4I4TB 4RUFA 1S3JA 3OGIB 5EC1C 3RYHA 1CP9A 2NLJC 1Q3EA 1J5EO 1NI8A 4XDLA 4U3JA 3OTOB 4GUNA 1KKCA 1XNQB 4NYKA 4JTCB 3E8FA 5K1XA 1Q43A 2K9PA 3OT7A 4LNUB 3EFFK 3N27A 4LWSA 5D5QA 2L35A 3OTOO 4OX9B 3JAKA 1XNQO 2DYRC 3OE7G 3EVKA 2LQTA 3OUFA 4FFBA 1FJGB 2ZR3A 2DQ3A 4X89A 5EBWC 2JS3A 4E2LA 4FM1A 4OX9O 2RQ6A 4N21A 3TK1A 3FX7A 1FJGO 1VQKV 1Q6UA 2YEVB 2WLLA 4K0KO 2ETNA 1PL4A 3JASB 3W7UA 5LP6A 3SJAC 4ZOLA 5LMNO 1HNZB 2XAJA 2QM7A 4UCUA 1K8AW 2FTKA 3FAVB 1HNZO 5B1BC 1WP8A 1H2GA 3P3NA 3BABA 3UQ8A 4JTAB 1SESA 2Q8VA 3TJTA 4HNAA 2Q73A 2QA4V 1JA8A 4RQFA 1PV0A 1N8RW 3MDSA 3F5TA 4FLXA 3NXSA 1ZWIC 1HR0B 2UXBB 3DGEA 4TWKA 3ZN0A 4JZ2A 3K9AA 1HR0O 2UXBO 5BR8B 3CCVV 2ZE5A 3K5NA 3T4ZA 4J42A 1FFXA 1Y6XA 3DC5A 4IL6Z 5DECA 1EBOA 4X65B 1K73W 1TVKB 4O2BA 2BOCC 3UT5A 1QQCA 1X59A 4X65O 2JGUA 2KKWA 2FYUH 2UXNA 3WB2A 2P22C 3SYPA 3GVMA 1VQ8V 4LF5B 2EIJB 2QJ1A 2CGNA 1R73A 3ZRXA 4YJ2A 5EZYB 3F5WC 1COWG 3K04A 1N4CA 4TV8A 5IY5B 2IU0A 1VF7A 3PJSK 3NR7A 1XDCA 4I9WA 5H2FZ 1H8HG 3D3QA 2B9ZA 4YIPA 1IBKB 2PI5A 1HNWB 1KB9F 2ZINA 1IBKO 2N74A 2FB5A 3HKBB 1HNWO 5IWAB 1PNKA 3OR6C 4UCRA 2QKSA 4QE9A 1AR4A 3ASNB 2Q67A 1JQ0A 3CCUV 1GN2A 2F43G 5KHJA 5IWAO 3L70H 1WPBA 4RO2A 3DXRA 4IYHA 1K97A 2WLKA 2H94A 4X1IA 3HR0A 3H9VA 2JIZG 1QLEB 2N04A 4WFGA 2PF4E 1YTFD 4ZBMA 4JPRA 4RUEA 3M99B 4JI1O 2P90A 1OCRC 1NVPB 3JARB 4YY3B 4PDLA 3CC7V 3J7AU 2W6IG 3DTUB 4LP8A 4I4TA 5KHIA 2VRZA 3A0BZ 4YY3O 1QVFU
chains in the Genus database with same CATH topology
2QTSA 4FZ1A 2FB5A 3S3WA 1WP8A 4NYKA 4NTXA 4FZ0A 4NTWA 1WP7A 3N27A 3IJ4A 3S3XA 4NTYA 2L35A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QTS A;  4FZ1 A;  2FB5 A;  3S3W A;  1WP8 A;  4NYK A;  4NTX A;  4FZ0 A;  4NTW A;  1WP7 A;  3N27 A;  3IJ4 A;  3S3X A;  4NTY A;  2L35 A; 
#chains in the Genus database with same CATH topology
 2HEP A;  2ARH A;  5H9C A;  1OCC C;  2P06 A;  2YI9 A;  1PKX A;  2AHY A;  4JI7 B;  3BCC H;  1XL4 A;  4BIU A;  3G67 A;  4NXM B;  3ZX6 A;  5DM6 V;  4LC1 A;  5LA6 B;  4JI7 O;  4BW5 A;  5LYJ B;  4DV0 B;  1IZ3 A;  2AZ2 A;  4NXM O;  4MVO A;  1XMQ B;  1NBM G;  4J10 A;  4H44 B;  2ZD9 A;  1IXM A;  4I7Z B;  2YEV A;  2JJ2 G;  4DV0 O;  4PI0 A;  3OUS A;  5JCO C;  1XMQ O;  4TQD A;  3GWO A;  3AG3 C;  4W4K A;  3JAS A;  2ODM A;  2ZIM A;  3OFN G;  3H1H H;  3SR2 C;  2E76 B;  3CJH B;  2RMK B;  2RJZ A;  3G71 V;  1RSO B;  3RYI B;  3TCU A;  2UUB B;  3FAV A;  4QNH B;  4Q6G A;  5CB4 A;  3SYO A;  1NJI W;  5A9G A;  2PUS A;  5JVD B;  3W7X A;  2UUB O;  2W6J G;  5KHK A;  3SGI A;  1ZUQ A;  3FYI B;  4DR1 B;  1PL0 A;  4Q20 A;  1V9P A;  4DK1 A;  4CH4 A;  3JD2 A;  4XDK A;  2DJV A;  4DR1 O;  2BE3 A;  2JEU A;  2QE7 G;  2JS5 A;  3IC9 A;  3G4S V;  4ABM A;  2GBO A;  4L8J A;  1XHZ A;  2EIM C;  4B3R B;  3F7V C;  1AJP A;  2WA3 A;  1JJO A;  1F23 A;  4PA7 A;  3D36 C;  2JK5 C;  4FIP C;  1UFI A;  2QR4 A;  1BSM A;  4B3R O;  4UVB A;  5AG2 A;  2CH7 B;  4YIO A;  3THO A;  4AQY B;  1GMG A;  1YTF B;  5IE9 A;  2XAH A;  1OCC B;  1TVK A;  5DN6 G;  3OM3 B;  2CTR A;  4CC6 A;  4TUY B;  4MVR A;  1F4M A;  2JRI A;  1Y4M A;  4AQY O;  1GN4 A;  4BW9 A;  4UFZ A;  4GYC B;  2PZS A;  2R72 A;  1AJN A;  4KHP B;  1WN7 A;  4LR3 A;  3CCQ V;  5J2U B;  4K35 A;  1VF6 C;  1GRJ A;  5EZY A;  2ZNJ A;  3SJB C;  4KHP O;  1W0J G;  1XL6 A;  5JJE B;  3CRA A;  1OCZ B;  3VOU A;  2XAQ A;  3B09 A;  4KL1 A;  4Z1V A;  2Y0P A;  1YJN V;  4QJF B;  1S0V A;  2DQ0 A;  1FXV A;  3LUT B;  1VQL V;  3RT3 C;  4J7Z A;  2V7Q G;  1V54 C;  4I9Q A;  5L3F A;  4LF6 O;  1TGO A;  3CB2 A;  2MK3 A;  1GKF A;  2GUZ B;  3T1H B;  3F7Y C;  3RW0 A;  3HKB A;  4ZIB A;  2ZE7 A;  2X6C A;  4CS3 A;  1PP9 H;  1W0K G;  3P30 A;  5CA3 A;  1AVM A;  1SQP H;  3WG7 B;  3T1H O;  2EBO A;  2WLI B;  1VMG A;  2ZQM A;  3KCX A;  1MG1 A;  2HLD G;  4UXN A;  4PA4 A;  3FB8 C;  1IDS A;  1BE3 H;  3QVN A;  4MVS A;  2IH3 C;  3KG2 A;  1AP5 A;  5IYZ A;  2R9A A;  3RFR A;  4JGS A;  1SZX A;  1JPX A;  2YC0 A;  4B3S B;  1FXK C;  3CYO A;  3ABK C;  4UUJ C;  1B6Q A;  1WLE A;  5KX5 B;  5D5P A;  4B3S O;  3JAR A;  1PPJ H;  4FLW A;  3ETG A;  4MW3 A;  1F7Y A;  3LSS A;  4EB6 B;  2LFR A;  2V4D A;  2PY5 A;  1WAZ A;  2Y69 C;  1SQV H;  2D3O W;  5JWP A;  1VQ7 V;  1TUB B;  4H0L B;  2F4V B;  2R9R B;  3CC4 V;  3E8G A;  2B1G A;  4D7T A;  1V55 C;  1HW7 A;  5IYD O;  3JSN A;  5LYJ A;  3JAT B;  5C8Y A;  3SPH A;  3WB0 A;  4NTW A;  2GDS A;  1XRE A;  4FPP A;  3AK3 A;  3OMA B;  3ETE A;  1SQQ H;  3RVY A;  2YXH A;  1ZAU A;  4FVM A;  1M1K W;  2QWO B;  3DSQ A;  4D6T H;  5B1A B;  3VBB A;  4YXW G;  4GKK B;  3L75 H;  3CJH A;  2OYQ A;  4X8A A;  3CCE V;  3A8T A;  3RWR D;  3RYI A;  3VQW A;  4GKK O;  2EZO A;  3K0G A;  4D7S A;  3I55 V;  1K34 A;  1S76 D;  1H2K A;  1Q6I A;  3FB6 C;  5JVD A;  1ORQ C;  3CCJ V;  1Q8I A;  3LDD A;  3VQV A;  4A5U B;  2XND G;  1RP3 B;  3HKD B;  1SET A;  4GX1 A;  4I0X B;  4N23 A;  4AIL C;  3CHX A;  1LNQ A;  3JAW A;  4KUM A;  2QM4 A;  3SJQ C;  3IAY A;  4OPH A;  2XOK G;  4CBC A;  2JEX A;  4H13 B;  1S5L Z;  5BZB A;  5E1A C;  2KB1 A;  1QR8 A;  5CMU A;  1FXK B;  4OGQ B;  1YI2 V;  1JX9 A;  1BHA A;  3K03 A;  2IJH A;  2DWD C;  1M5I A;  1Y74 A;  4U7N A;  2CH7 A;  4JI3 B;  3CCR V;  4IHJ B;  2QTO A;  5B66 Z;  3AEI A;  2Y69 B;  4CC5 A;  4UV9 A;  1X4T A;  4MS2 A;  3OW2 U;  4JI3 O;  1YHQ V;  3KZI Z;  4LH7 A;  1AI4 A;  4TUY A;  2BTO A;  1XBL A;  3K9S A;  3B8N A;  2ITD C;  4UV8 A;  2OCC B;  4C7U A;  3HKC B;  1PM9 A;  4ZI7 B;  3ZHS A;  4TOI A;  5J2U A;  5JH7 B;  4XBF A;  1CPY A;  3B8M A;  3AG1 B;  2F1M A;  3X2Q B;  4K0K B;  1SF9 A;  5KAI Z;  4MVQ A;  4OPA A;  2P67 A;  3ABM C;  4J9Z B;  2WLM A;  5LMN B;  1W2B U;  1IVS A;  3N2G B;  3K3W A;  4JAV A;  2CTW A;  2IJJ A;  3ABU A;  4JI5 B;  2GUZ A;  3SYA A;  2PYL A;  2ZDI C;  1EZJ A;  4F6E A;  1G1X B;  1YZB A;  2JDI G;  2QGN A;  4X1K B;  4CH5 A;  4CH3 A;  4B08 A;  4JI5 O;  2WLI A;  2RCV A;  2WLJ A;  4JI8 B;  1NVP D;  5CBH A;  4WFB V;  1YCI A;  2D2C B;  1PNM A;  4JI8 O;  1VQM V;  2ATK C;  1WB8 A;  1XOU A;  2HVJ C;  3CP1 A;  1S5H C;  2XAF A;  2Q68 A;  2IU3 A;  2EIL B;  5EYP B;  3OEE G;  2JJ1 G;  4MT8 A;  3MHS C;  2OIE A;  3D3I A;  2EIK B;  2IJI A;  2JGD B;  3K57 A;  4JI0 B;  4FLV A;  2LW7 A;  1BQZ A;  4EB6 A;  4IT5 A;  2DW4 A;  3AG2 C;  4DV3 B;  2OIG A;  4JYC A;  1RM1 C;  3I56 V;  2E74 B;  4JI0 O;  1BL8 A;  5LL6 Y;  3H1I H;  4DV3 O;  1QHT A;  1Y66 A;  3QG5 A;  4P2Z A;  1R6T A;  1TUB A;  3P3P A;  1MZF A;  3BY6 A;  2VWK A;  2QEX V;  2AGA A;  2ZE8 A;  2X0L A;  4HAM A;  3ABL C;  4WFF A;  4QIW F;  2WWW A;  4BR6 A;  3JAT A;  3HKE B;  2CTP A;  2KG7 B;  3CMA V;  5E79 Z;  4GLX A;  5IT9 N;  5KHH A;  3ETD A;  3BEH A;  2DYR B;  1CXZ B;  2CUG A;  5FNV B;  4JI6 B;  4BAY A;  2P7T C;  5CBF A;  5IJ0 B;  1GM7 A;  4JI6 O;  2ZIO A;  2XUM A;  4WBN B;  4MTX A;  4RAI A;  3ABM B;  4NR1 A;  3M7M X;  3OR7 C;  2IW5 A;  4TT3 G;  1H38 A;  4UCS A;  4O2A B;  4QE7 A;  3ML0 A;  4EKW A;  2P6J A;  2QWR B;  1VF5 B;  1WA8 B;  3GB7 C;  2Z0A A;  1O9H A;  4H37 A;  4IIJ B;  4TV9 A;  2CAZ C;  5EIB C;  3HKD A;  5B1B B;  1EZV H;  1Q7Y W;  2QM8 A;  3CRQ A;  3KKY A;  4JI1 B;  2W0X A;  4JAA A;  3LNM B;  4HYO A;  3MAQ A;  4MTO A;  4DYL A;  2CE4 A;  1MZE A;  4J7K A;  1K92 A;  2ZT9 B;  1U97 A;  1QR9 A;  3JAL B;  4X20 B;  3E8B A;  3AG4 C;  5B5E Z;  1GAX A;  5KUM A;  2OT5 A;  1EN5 A;  3CCL V;  3CXH F;  1Q6H A;  5LOV B;  4NXN B;  3FD9 A;  1AR5 A;  4MVU A;  4IHJ A;  4DK0 A;  2E5L O;  1DTO A;  4K8Z A;  3OMN B;  4NXN O;  3SPG A;  1FPO A;  4LNU A;  4O4J B;  3UO2 A;  2RDC A;  3C3T A;  2Q7E A;  1GO3 F;  2HR3 A;  2HP8 A;  5ITZ B;  3W7T A;  2A0L A;  4K8X A;  1OCO C;  2Q0A A;  3GWK C;  4ZI7 A;  1JMK C;  2H8P C;  5JQG B;  5IJ9 B;  1GN3 A;  3ABL B;  3OGC C;  1L8D A;  1P7B A;  2EX3 A;  3SYC A;  3ETQ A;  1KC8 W;  3BVO A;  2RNB A;  1QU7 A;  2OWO A;  1XHX A;  2NN4 A;  1IX9 A;  1N36 O;  4PEL A;  4WFA V;  4EEQ A;  4DUZ B;  1YVW A;  3N2G A;  4G2K A;  3WB1 A;  3H01 A;  1E1Q G;  1R1B A;  4DUZ O;  3ZJZ A;  1S77 D;  5J2T B;  4X1K A;  4DV7 B;  5LP6 C;  5DED A;  2V1D A;  2P5O A;  2GV9 A;  2QWN B;  2WPD G;  4J41 A;  4DV7 O;  2Q6A A;  1NZ6 A;  4JZG A;  2W0F C;  3FKS G;  1HDJ A;  3TGU H;  1M56 C;  4FLU A;  3JD4 A;  2JVD A;  3STL C;  2OTL V;  1IUR A;  1G6U A;  1K4C C;  1M93 A;  5H6Q A;  3U11 A;  4UCV A;  2WLN A;  3JCU Z;  5EYP A;  1FXH A;  5LBQ A;  4MVM A;  3ASO C;  5H5N A;  5KLV H;  2F95 B;  1FS0 G;  4Z1M G;  3K59 A;  5KA5 A;  2M7W A;  1H2N A;  2EIN C;  1OCR B;  1OJH A;  3KCY A;  3HB3 B;  5L3B A;  3TXQ A;  3AG4 B;  3AK1 A;  4MSW C;  1SZT A;  2ZR2 A;  3JCZ A;  1YIT V;  1KQS U;  2PTM A;  2O57 A;  3OTF A;  2NR5 A;  3B77 A;  2QKC A;  2QTS A;  1A32 A;  3ZMU A;  1P84 F;  3ZBH A;  3WFV A;  1SA0 B;  1VQN V;  1I5X A;  3HKE A;  3ZMV A;  1ARO P;  2KG7 A;  1URF A;  5GON B;  2YXY A;  4LFB B;  4X66 B;  3FB7 C;  1WJZ A;  1LR1 A;  4FK5 C;  1S5J A;  5FNV A;  4U3J B;  1R3I C;  5CN0 A;  4GKJ B;  4CH6 A;  4LFB O;  4X66 O;  4LWS B;  4LF6 B;  2ZKO A;  1DF4 A;  1S72 V;  1P7G A;  1I08 A;  5B1O A;  3QO7 A;  1IXB A;  4GKJ O;  1QBZ A;  4DV2 B;  1ZTE A;  1MAB G;  1XEQ A;  3AG3 B;  1N34 B;  2PYJ A;  3ZMS A;  3LSU A;  1QNM A;  3E22 B;  4O2A A;  1NTM H;  2DYS C;  4DUY B;  4DV2 O;  2QKA A;  1N34 O;  2XAS A;  1WA8 A;  3FFQ A;  4B3T B;  4JI4 B;  3CD6 V;  1NT2 B;  2XHB A;  4IIJ A;  4WF9 V;  4DUY O;  3EHB B;  1KP3 A;  4G28 B;  1SQG A;  4PA6 A;  2UUA B;  4B3T O;  4JI4 O;  1XUQ A;  5LGN A;  2A9H A;  4LBE C;  2IBZ H;  2WAM A;  3CSX A;  1SQF A;  4NB5 A;  2LGW A;  3CRC A;  2UUA O;  4FM0 A;  1VQ5 V;  1FAF A;  3K0D A;  3OMI B;  1QLN A;  4DV1 B;  3S3X A;  1W59 A;  3C3S A;  3QTC A;  1D2D A;  1TAE A;  2NNU A;  3JAL A;  5LGU A;  1ZSP A;  4FM2 A;  3ASO B;  4DV1 O;  2YS8 A;  5CBG A;  1HNX B;  4ZHQ B;  2B1I A;  2Q0O C;  5LOV A;  1AB3 A;  1JJ2 U;  1SQB H;  2EIM B;  1FFT B;  3SJC C;  5TIS Z;  1NS1 A;  4YJ3 B;  4PDM A;  2AHZ A;  3BAA A;  3SPJ A;  2EIN B;  1HNX O;  1IBM B;  5KAF Z;  1M57 C;  1TA8 A;  2BTQ B;  4WFH A;  5L3E A;  2QSA A;  1XQ8 A;  4O4J A;  4PHZ A;  5CA0 B;  3CRR A;  1NTZ H;  5F2V O;  3ZHR A;  4EFE A;  1IBM O;  5ITZ A;  3ZRW B;  2UXX A;  2VWJ A;  1BS3 A;  5LA6 A;  1T5E A;  5JQG A;  4LF8 B;  3G6B A;  4JYY A;  3M8A A;  3CRM A;  1SC5 B;  4PDV A;  3TXS A;  3B40 A;  1JCH A;  4AI8 A;  4FMT A;  2WLH A;  4LF8 O;  5IYC O;  3BPZ A;  3R65 A;  3CCS V;  4O4H B;  2YI8 A;  3IJ4 A;  3L9D A;  4JAS A;  1DLB A;  3JD3 A;  1DF5 A;  1K7D A;  4TSF G;  1RPR A;  3PN1 A;  2ITC C;  1DGS A;  5LGT A;  5GW7 A;  3BA8 A;  3R66 A;  2WA4 A;  4B7K A;  2X6A A;  5IYB O;  1KP2 A;  1SKV A;  2YXL A;  1NR7 A;  1LUW A;  1P4R A;  2R9I A;  5FPO A;  4FLT A;  4XDJ A;  4KXR A;  1RSO A;  5J2T A;  1V54 B;  2Q7G A;  3RYF B;  4U3F H;  3VQY A;  2DYS B;  4CZZ A;  4DR7 B;  1K33 A;  1D5N A;  1SQX H;  1N32 B;  3RYC B;  2OTJ V;  1SER A;  5BMV B;  4DR7 O;  1Y76 B;  2A06 H;  5HFM A;  4PV1 B;  1RPO A;  2YIB D;  2ZCE A;  1N32 O;  3J81 N;  1UJW B;  3G6E V;  3A2F A;  2GTS A;  4MVZ A;  1RFY A;  1KMI Z;  1MNG A;  3ZCC A;  2LJ2 A;  2CDY A;  2LGQ A;  5LXT B;  4LFC B;  3ABK B;  2FKX A;  4UCT A;  1YIJ V;  2HG5 C;  1GM8 A;  4PA3 A;  1WP7 A;  3B4S A;  4X1I B;  1MOF A;  1NH2 D;  4LFC O;  3OEH G;  1J95 A;  2CK3 G;  1HWY A;  3A0H Z;  2GHY A;  1IBL B;  1AR1 B;  4I55 B;  4KP4 A;  4DO2 A;  1N0J A;  1SA0 A;  1K3E A;  3JAM N;  1KKD A;  1IBL O;  2K1E A;  4DR6 B;  4X9Q A;  2AZ0 A;  5GON A;  1SS3 A;  4LH6 A;  2YID A;  4UB8 Z;  3ZMT A;  1V55 B;  5BXZ A;  1G4Y B;  4PJ0 Z;  5KUK A;  4DR6 O;  3SYQ A;  3Q4H B;  3BA9 A;  2B5U A;  2R70 A;  3T1C A;  2EIJ C;  2F23 A;  3K79 A;  1MMM A;  4UVC A;  3ZRS A;  1L0N H;  5JCO A;  2E3C A;  1F4N A;  1E1R G;  5IY5 C;  3H1K H;  3E22 A;  1PD3 A;  2FML A;  1GH6 A;  1Y67 A;  1US6 A;  1M4U A;  5EBM C;  1BMF G;  4U7O A;  2X7R B;  3TET A;  2Q7H A;  1B04 A;  5KHG A;  3L73 H;  3CXC U;  2YIA A;  4PD4 F;  1JVM A;  4YHH B;  3E2E A;  2F93 B;  3APO A;  3ASN C;  1L1F A;  4WFE A;  3W7S A;  4LF9 B;  4JV5 B;  4R8C A;  3JD1 A;  4YHH O;  5CB4 B;  4X64 B;  1GK9 A;  5KX5 A;  5EK0 A;  4LF9 O;  4JV5 O;  2Y0I A;  3AG7 A;  3JD0 A;  1QLE C;  1EFR G;  4X64 O;  1NKD A;  4CS4 A;  4ZHQ A;  4I50 B;  4YJ3 A;  5A2Q N;  2FL4 A;  3E35 A;  1R3L C;  3D36 A;  2BTQ A;  2HKO A;  3JYC A;  1EN6 A;  3C90 A;  2ADP A;  5CA0 A;  4J11 A;  2OCH A;  1VP7 A;  4PI2 A;  3N2K B;  5FPR A;  3ZRW A;  1ZL8 B;  3CS5 A;  3U0Z A;  1VIB A;  3AK2 A;  4DV6 B;  1FKA O;  3CEI A;  2BSK B;  3ZHT A;  2AW9 A;  3RN4 A;  3ZED A;  5JJN B;  1NH2 B;  4DV6 O;  1E79 G;  1QVG U;  2IM9 A;  4W4L A;  1Q5O A;  4LF7 B;  3ZHV A;  2P4V A;  4DW1 A;  1Z5W A;  5BR8 O;  2HFE C;  4O4H A;  1VF6 A;  2EJ7 A;  5EC2 C;  1H8E G;  4LF7 O;  5GTH Z;  2N05 A;  4DRX B;  2KSD A;  3E83 A;  2YIC A;  2DN9 A;  2F66 C;  4RWU A;  2Y4U A;  2C2A A;  3QF7 A;  2RN9 A;  2UXC B;  5EIB D;  1B3Q A;  3JSL A;  1UPG A;  1YF2 A;  3RYF A;  4DR3 B;  2UXC O;  4P9O A;  3DC6 A;  2QWP B;  4LF5 O;  1BGY H;  1JFF B;  5B3S C;  3CC2 V;  4DR3 O;  3RYC A;  1VEW A;  5BMV A;  4I0X A;  1Y76 A;  2L6L A;  4EFB A;  2UXD B;  4WCE V;  3K06 A;  3K5O A;  3RVZ A;  2DWE C;  3SDL A;  3ZMZ A;  1OZ0 A;  1Q90 D;  2YUA A;  2BCC H;  1YDX A;  2DMX A;  2UXD O;  1MSW D;  1EN4 A;  4FZ0 A;  5LXT A;  2HHH B;  1GTO A;  1FXK A;  4F6R B;  5L3D A;  4DR4 B;  2VQF B;  3E86 A;  2Y48 A;  1YJW V;  2HHH O;  3UO3 A;  1THZ A;  1N0N A;  4H33 A;  1KBH A;  2E5L B;  5IYZ B;  4FJC C;  4DR4 O;  2VS0 A;  1F51 A;  2VQF O;  1JOY A;  2EUL A;  2IH1 C;  5L3G A;  1FD9 A;  4DXW A;  3AG2 B;  1D5A A;  2IJK A;  2Z3Y A;  1RM1 B;  4NTX A;  4I55 A;  3QNE A;  3FB5 C;  1Q81 W;  3CX5 F;  3WU2 Z;  1GM9 A;  3CE2 A;  1KYO F;  3HPL C;  3HKC A;  1SRY A;  1ZX3 A;  5JH7 A;  4DV4 B;  2QDO A;  3H1L H;  3L71 H;  2HJD A;  1K9M W;  1N36 B;  3Q4H A;  2Q69 A;  3UKM A;  4DV4 O;  3LSQ A;  1AP6 A;  2HVK C;  4DV5 B;  4QGP A;  3A0R A;  1NQT A;  4J7J A;  4R6Z A;  2MW2 B;  1BCC H;  3UM7 A;  5KA6 A;  5C8Y B;  4O4L B;  4GT1 A;  5C93 A;  4LCU C;  3S3W A;  4DV5 O;  5LHH A;  1OCZ C;  1VQP V;  2YSU B;  1KEC A;  3O9O A;  1Z2G A;  3MHH C;  1XMO B;  2GTA A;  4NTY A;  4UVA A;  2ZNI A;  2Q4P A;  1XMO O;  3QO8 A;  4QPJ A;  1YSC A;  2Q5Z A;  4GZR B;  4O4I B;  1U96 A;  5B3S B;  3ABT A;  1M90 W;  1R3K C;  1YXB A;  4BWA A;  4AHC A;  3WG7 C;  1NU1 H;  4B7E A;  3ZHU A;  4NKG B;  3J80 N;  1M9N A;  3IC7 A;  2QWQ B;  2ZXW C;  2LW1 A;  1VQO V;  4R50 A;  1YEW A;  2YDE A;  2PI4 A;  2LO1 A;  2JGD A;  2DE0 X;  3JAW B;  2WSS G;  5KMG B;  1G8M A;  3W7W A;  4FZ1 A;  1EM1 A;  1NTK H;  1CEZ A;  2UUC B;  4I50 A;  3OAA G;  4GX5 A;  2YIB A;  4B3M B;  1WNS A;  3UCS C;  3K08 A;  4IGG A;  5CA1 B;  4UB6 Z;  4HZ3 A;  3ZIA G;  2UUC O;  4X1Y B;  4FFK A;  4B3M O;  1AI5 A;  3N2K A;  4GX0 A;  1ZL8 A;  1I94 B;  1R6N A;  2KQX A;  4JYA B;  4FLZ A;  3BRC A;  2BSK A;  2X6B A;  1KU9 A;  2XTA A;  3MD0 A;  3RYH B;  1Y74 B;  1I94 O;  3ZRV A;  4PA9 A;  4JYA O;  1BHB A;  1OCO B;  2Y4T A;  5FLX N;  1BQ0 A;  1H2L A;  5LHI A;  1H2M A;  1K4D C;  1K5Q A;  4DRX A;  3ICX A;  2VQE B;  1VQ9 V;  2A79 B;  5IJ0 A;  1AIL A;  4WBN A;  3JAK B;  3CCM V;  4F4L A;  1B06 A;  4I5S A;  1KD1 W;  5EBL C;  4FFB B;  2VQE O;  2EZP A;  1I0H A;  3L74 H;  2A7W A;  3E8H A;  3K58 A;  5B1A C;  1KUQ A;  2HJF C;  4JTD B;  4MTG A;  5BY1 A;  3BFR A;  2AXT Z;  1JFF A;  2WLL B;  2ZDI A;  3EXA A;  5LHG A;  2DOS A;  5GTI Z;  1BZK A;  2CTQ A;  1QCE A;  4JYB A;  4UCO A;  4CS2 A;  5LP6 B;  4J80 A;  2CGO A;  5L3C A;  5B1N A;  4JAU A;  2ILM A;  2ADQ B;  4QPK A;  3T1Y B;  4ZOL B;  2Z5U A;  2P4K A;  4HBN A;  1M56 B;  4DW0 A;  3T1Y O;  1ROP A;  3CME V;  3CWB H;  3LDE A;  4DR2 B;  1FYJ A;  3SPI A;  4X62 B;  5HFL A;  4F6R A;  5IDJ A;  1DK1 A;  3RGB A;  4X20 A;  2BOB C;  4DR2 O;  2ZXW B;  3G80 A;  4X62 O;  4HNA B;  4GX2 A;  1YJ9 V;  2PGG A;  4RQE A;  1Q86 W;  1BT8 A;  4BIO A;  5H6R A;  4MW8 A;  1R3J C;  1R6K A;  1TUE B;  3T2M A;  4ICG A;  3STZ C;  3ZS8 C;  4JI2 B;  4ZKI A;  3I5D A;  1HP8 A;  5J9P C;  2ZM6 B;  2ZE6 A;  1OHH G;  2M6Y A;  3SPC A;  1MA1 A;  4JI2 O;  2LFS A;  4PDR A;  2ZM6 O;  3VQX A;  4LF4 B;  4P30 A;  3IFX A;  5IJ9 A;  1XI1 A;  3H1J H;  1WPX A;  3B2E E;  1K5S A;  1VAR A;  1FFX B;  1I7F A;  3LNN A;  3RBZ A;  4L87 A;  4FLY A;  4LF4 O;  4X88 A;  2OCC C;  3CPW U;  2XAG A;  1XNR B;  1ENV A;  3AG1 C;  3LDC A;  4O2B B;  1L0L H;  4GCZ A;  3X2Q C;  1NR1 A;  3UT5 B;  1AI6 A;  4MTF A;  1I5Y A;  1XNR O;  2F4V O;  4O4L A;  2G38 A;  4LFA B;  3E89 A;  5JJJ B;  5K1P A;  4G27 B;  4E4E A;  4YJ2 B;  1PNL A;  3BHP A;  3P32 A;  4TV8 B;  4LFA O;  4BIZ A;  1WB7 A;  1XIL A;  1Q82 W;  3ZHQ A;  3D8C A;  1H2S B;  4IYI A;  3O65 A;  4O4I A;  1MSD A;  4Z2W A;  3FYE B;  4P9P A;  4KFM A;  3K5M A;  3T4D A;  4ASU G;  2E75 B;  2Q9L A;  5FL7 G;  4NVP A;  1VQ6 V;  1AI7 A;  3IGA C;  2UU9 B;  1LUV A;  4R7C A;  4TV9 B;  4OXS A;  3L72 H;  3U10 A;  1OV9 A;  1Z5V A;  4JF3 A;  2UU9 O;  1N33 B;  5KMG A;  3DXR B;  4J9Y B;  2EIL C;  2A3Q A;  4DR5 B;  1P49 A;  4TQF A;  1N33 O;  2LP7 A;  2GSM B;  5CA1 A;  5LMU B;  1VQ4 V;  2EIK C;  2XT9 A;  2EJR A;  4X1Y A;  4K3A A;  2H3O A;  4DR5 O;  3QO5 A;  3APQ A;  3K5L A;  1JR9 A;  1GN6 A;  1ZLZ A;  3OD4 A;  5LMU O;  1M57 B;  1AJQ A;  3ZN1 A;  1O9G A;  1J5E B;  4I4T B;  4RUF A;  1S3J A;  3OGI B;  5EC1 C;  3RYH A;  1CP9 A;  2NLJ C;  1Q3E A;  1J5E O;  1NI8 A;  4XDL A;  4U3J A;  3OTO B;  4GUN A;  1KKC A;  1XNQ B;  4NYK A;  4JTC B;  3E8F A;  5K1X A;  1Q43 A;  2K9P A;  3OT7 A;  4LNU B;  3EFF K;  3N27 A;  4LWS A;  5D5Q A;  2L35 A;  3OTO O;  4OX9 B;  3JAK A;  1XNQ O;  2DYR C;  3OE7 G;  3EVK A;  2LQT A;  3OUF A;  4FFB A;  1FJG B;  2ZR3 A;  2DQ3 A;  4X89 A;  5EBW C;  2JS3 A;  4E2L A;  4FM1 A;  4OX9 O;  2RQ6 A;  4N21 A;  3TK1 A;  3FX7 A;  1FJG O;  1VQK V;  1Q6U A;  2YEV B;  2WLL A;  4K0K O;  2ETN A;  1PL4 A;  3JAS B;  3W7U A;  5LP6 A;  3SJA C;  4ZOL A;  5LMN O;  1HNZ B;  2XAJ A;  2QM7 A;  4UCU A;  1K8A W;  2FTK A;  3FAV B;  1HNZ O;  5B1B C;  1WP8 A;  1H2G A;  3P3N A;  3BAB A;  3UQ8 A;  4JTA B;  1SES A;  2Q8V A;  3TJT A;  4HNA A;  2Q73 A;  2QA4 V;  1JA8 A;  4RQF A;  1PV0 A;  1N8R W;  3MDS A;  3F5T A;  4FLX A;  3NXS A;  1ZWI C;  1HR0 B;  2UXB B;  3DGE A;  4TWK A;  3ZN0 A;  4JZ2 A;  3K9A A;  1HR0 O;  2UXB O;  5BR8 B;  3CCV V;  2ZE5 A;  3K5N A;  3T4Z A;  4J42 A;  1FFX A;  1Y6X A;  3DC5 A;  4IL6 Z;  5DEC A;  1EBO A;  4X65 B;  1K73 W;  1TVK B;  4O2B A;  2BOC C;  3UT5 A;  1QQC A;  1X59 A;  4X65 O;  2JGU A;  2KKW A;  2FYU H;  2UXN A;  3WB2 A;  2P22 C;  3SYP A;  3GVM A;  1VQ8 V;  4LF5 B;  2EIJ B;  2QJ1 A;  2CGN A;  1R73 A;  3ZRX A;  4YJ2 A;  5EZY B;  3F5W C;  1COW G;  3K04 A;  1N4C A;  4TV8 A;  5IY5 B;  2IU0 A;  1VF7 A;  3PJS K;  3NR7 A;  1XDC A;  4I9W A;  5H2F Z;  1H8H G;  3D3Q A;  2B9Z A;  4YIP A;  1IBK B;  2PI5 A;  1HNW B;  1KB9 F;  2ZIN A;  1IBK O;  2N74 A;  2FB5 A;  3HKB B;  1HNW O;  5IWA B;  1PNK A;  3OR6 C;  4UCR A;  2QKS A;  4QE9 A;  1AR4 A;  3ASN B;  2Q67 A;  1JQ0 A;  3CCU V;  1GN2 A;  2F43 G;  5KHJ A;  5IWA O;  3L70 H;  1WPB A;  4RO2 A;  3DXR A;  4IYH A;  1K97 A;  2WLK A;  2H94 A;  4X1I A;  3HR0 A;  3H9V A;  2JIZ G;  1QLE B;  2N04 A;  4WFG A;  2PF4 E;  1YTF D;  4ZBM A;  4JPR A;  4RUE A;  3M99 B;  4JI1 O;  2P90 A;  1OCR C;  1NVP B;  3JAR B;  4YY3 B;  4PDL A;  3CC7 V;  3J7A U;  2W6I G;  3DTU B;  4LP8 A;  4I4T A;  5KHI A;  2VRZ A;  3A0B Z;  4YY3 O;  1QVF U; 
#chains in the Genus database with same CATH homology
 2QTS A;  4FZ1 A;  2FB5 A;  3S3W A;  1WP8 A;  4NYK A;  4NTX A;  4FZ0 A;  4NTW A;  1WP7 A;  3N27 A;  3IJ4 A;  3S3X A;  4NTY A;  2L35 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...