1WP7A

Crystal structure of nipah virus fusion core
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
76
structure length
64
Chain Sequence
NINKLKSSIESTNEAVVKLQETAEKTVYVLTALQDISSQISSMNQSLQQSKDYIKEAQRLLDTV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal structure of Nipah Virus fusion core
rcsb
source organism Nipah virus
molecule tags Viral protein
molecule keywords fusion protein
total genus 33
structure length 64
sequence length 76
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2004-08-31
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.770 Mainly Alpha Orthogonal Bundle Helix Hairpins YojJ-like 1wp7A00
3S3WA 1WP8A 2L35A 1WP7A 2QTSA 3IJ4A 4NTYA 4NYKA 3S3XA 3N27A 4FZ0A 4NTWA 4FZ1A 4NTXA 2FB5A
chains in the Genus database with same CATH superfamily
4EB6B 5JCOC 3T1HO 1SC5B 4O4HB 4O4LB 1XNRO 3F7YC 5B1BB 2JRIA 1HNXO 3W7UA 4UB6Z 2HHHO 5EK0A 3P3NA 2Q9LA 4UXNA 2WSSG 4O2BB 5EIBC 1R6NA 1XEQA 5BXZA 1M57C 4ZHQB 4DV6B 3EFFK 1AI6A 1I08A 4GKJB 1KMIZ 5L3DA 1YVWA 2B1GA 2QKSA 3M8AA 3K59A 3ML0A 5J2UA 1VQ7V 3TJTA 1S5HC 3S3XA 1I0HA 1H8EG 3L72H 2P4KA 4H13B 3AG3C 1K3EA 1BL8A 4JAAA 1URFA 4YIPA 1HNZO 1K8AW 1Q6HA 5EBMC 1SZTA 1PPJH 2VQEO 3O9OA 4J9ZB 5L3CA 5DEDA 3VQVA 5K1PA 1N33B 2B1IA 3ASOC 4FLWA 4CS4A 4DUYB 4KL1A 4FZ1A 1M57B 5LXTA 1GAXA 1XILA 1WP8A 2MK3A 2HKOA 1WB8A 4ZIBA 3U0ZA 4H0LB 1MNGA 3AG3B 3CCSV 1SF9A 2PYJA 2UXCO 3SYQA 2L35A 5FPOA 1DK1A 2AGAA 4MW3A 1YEWA 4RQFA 3UO3A 1PL0A 2ZM6B 3K08A 2YUAA 4X1KB 2UUAB 4O2AB 4YY3O 1JVMA 1ROPA 3TCUA 2HEPA 2N05A 4GKKB 1HNZB 2Z3YA 3TXSA 4JI0O 4GZRB 4PI0A 2Y4TA 1NKDA 4UCOA 4LCUC 2VS0A 4W4LA 1AR4A 1RPRA 2EULA 1G4YB 4DO2A 2M7WA 3JAKA 4AI8A 5DN6G 3W7WA 4J7KA 3OR6C 1Q86W 5A2QN 1OZ0A 2QWRB 3LDEA 4I7ZB 4AQYO 1VQ8V 1N0JA 4OX9O 3G4SV 4X62O 3CCVV 1W0KG 2IJHA 2JIZG 5LA6B 2JJ2G 2HHHB 5KAIZ 2VRZA 3T2MA 5H6QA 2X6AA 3DC6A 3RT3C 4O4HA 5D5PA 1SQXH 1Q6IA 4DR5O 4X66B 1M5IA 4TUYB 1M90W 4LF4O 4ZKIA 3RYHA 4B7EA 1WPBA 3K58A 1AR5A 2UXDB 4UVAA 1PL4A 2XUMA 3FX7A 3QNEA 4X1YA 2OCCB 3QO5A 2Y48A 4FFBB 2XAQA 1X59A 3BHPA 5GTIZ 4DR4O 3JATB 1YJ9V 4FLUA 4YHHB 4PI2A 1L8DA 4EFBA 4YJ2B 3HKCB 1A32A 2HJFC 5FNVB 1BZKA 4CS2A 4MVMA 2V1DA 1KP3A 3TGUH 1AR1B 1XNQO 3A8TA 1IBMO 3OGCC 4PELA 4JI5B 1M1KW 4B3MB 3ZS8C 3WB2A 4NTXA 2EJRA 3SJCC 1QVFU 4DV4O 1TA8A 2QSAA 2JDIG 3JD1A 3J81N 1XHZA 4LF7O 4LFBB 1FYJA 3CXHF 4X1IB 2AW9A 4O4IB 2DMXA 4NTWA 3G6EV 1R3KC 1S0VA 4I55B 4JI2O 1V55C 2XT9A 3DXRA 4TWKA 3WG7C 4X9QA 3RW0A 4MS2A 3FB5C 4FK5C 3A2FA 5IJ0B 4I4TA 3E8GA 2VQFO 2W0XA 1U97A 1QNMA 1I94O 2A79B 1QR8A 1DF5A 2ITDC 3DXRB 4LF7B 4LFBO 2CTWA 3QF7A 5ITZB 1IXMA 2GTSA 5IDJA 1JJOA 1BHAA 4DRXB 1E79G 1N8RW 2HFEC 4PDRA 1JR9A 3AG4C 5B1AC 1RM1C 4YJ3B 2CTPA 3RFRA 3E35A 1Y66A 2Q73A 2IJIA 1HR0B 3I5DA 1OCCC 2ADQB 2WLIA 4DV2B 4GX2A 3H1IH 4LBEC 4FM1A 1KU9A 1JFFA 1GN3A 3UT5B 5CA0A 4PJ0Z 4WF9V 1WN7A 2ZR2A 2DE0X 5KHKA 4D7TA 4UCVA 1QQCA 4DR4B 2KQXA 3JD4A 4B7KA 4X20B 5GW7A 4CH4A 4ZOLA 2UUCB 4I55A 1Y74B 4RAIA 4Q20A 1TVKA 3BABA 3ZRWB 2IM9A 4LR3A 3CC4V 2ARHA 4ASUG 4JYAO 1H2LA 5JCOA 3DSQA 1HNWB 3ETGA 1YHQV 3JAWB 4FZ0A 3K9AA 2CE4A 2F66C 2ZIOA 5BZBA 1KD1W 3I55V 1IBKO 1F7YA 1NZ6A 2XAGA 2OTLV 4WFHA 2HVJC 4U7NA 2KB1A 4TUYA 2H8PC 1R6TA 1NS1A 3WB0A 2PGGA 2ZXWC 4B3SO 2ATKC 5LGUA 2EIJC 1IZ3A 1LUVA 1TUEB 1YITV 2R72A 3CRCA 1G6UA 1ENVA 4JI1O 2YXHA 4B3RO 3AG7A 3CEIA 1P7GA 2CAZC 3UO2A 1J5EB 3ASOB 4OXSA 4PV1B 2R70A 4CH5A 2UUAO 1AJPA 5D5QA 4X64O 5B5EZ 3WG7B 2IBZH 5BMVA 1QVGU 2QDOA 4AILC 4MVRA 2IJJA 2DQ0A 5LMNB 4RUFA 3WB1A 3ZHUA 4D7SA 1PKXA 1BGYH 2LGQA 4XDKA 1Q6UA 1D5AA 1KBHA 2NLJC 1FFTB 2XAHA 2E5LO 1IX9A 1JJ2U 4TSFG 4LFAB 4IHJB 4BR6A 3JALA 1AB3A 3RN4A 4W4KA 3L9DA 2LGWA 2X7RB 3APQA 4DW1A 3K3WA 4ICGA 4O2AA 3SDLA 4DR6B 1GM9A 1Y4MA 4JTDB 2P6JA 1SRYA 3BA8A 1TVKB 1PNLA 3JCUZ 5JJEB 4H37A 1BE3H 2DYSB 4Z1VA 2Q5ZA 1L1FA 2G38A 3ETEA 2WWWA 4JI6B 4LF6B 3L73H 4LWSA 2PUSA 2YS8A 4GUNA 2EIKC 3J80N 5LMUB 1OCOC 3JARB 5CBHA 4P9PA 4HYOA 5HFMA 1GN6A 4EFEA 5IY5B 4MTGA 4UCSA 5KHJA 1FXKA 1F4NA 2BSKB 1HR0O 1VQ9V 3ASNB 2HG5C 3W7TA 1XNQB 4UUJC 1GM8A 5LHIA 1T5EA 1MSDA 2RCVA 1XMQO 3ZMZA 1SETA 3JASB 1XOUA 1VQNV 2PYLA 4U7OA 1OCOB 1VIBA 5IYZA 4MW8A 4DUZO 2E74B 4JV5O 3FB8C 1O9GA 2BOCC 1K9MW 4B3RB 4TQDA 4FM0A 4I0XA 2UXBB 3ICXA 4K0KO 1MG1A 3DGEA 2WLHA 2F93B 1OCZC 2HR3A 4JI2B 5B1OA 2ZDIA 3QO8A 1S76D 4PDVA 2EX3A 3GB7C 3W7SA 1WP7A 3EXAA 1IURA 1H8HG 3U10A 3FD9A 2AHYA 5L3BA 1XUQA 4UVBA 2YC0A 2Q67A 3ABKC 3FAVA 1VARA 1UPGA 3BFRA 1BQ0A 1IBKB 2EILB 5EYPA 3ABMB 1V54B 2LJ2A 2DOSA 3N2KA 2UXDO 2BSKA 1GM7A 2GTAA 3QTCA 3K79A 1EM1A 3MHHC 3K0GA 1WAZA 1S5JA 1H2SB 4PDLA 3CB2A 3K5NA 4EKWA 2E75B 5LYJB 3E22A 2BOBC 1JX9A 4FFBA 2ZKOA 3OTFA 2RN9A 2HVKC 2VQEB 3KCXA 1WJZA 2N04A 2A0LA 1VQMV 5EZYB 5TISZ 3CHXA 4CBCA 2PI5A 2P7TC 2UU9O 3JATA 1PV0A 4JI7O 5B1NA 1Y6XA 4MSWC 2IH3C 4C7UA 4F6RA 1Q82W 2YI8A 1XREA 3FFQA 2EIJB 1AJNA 4YXWG 2ZNIA 2GV9A 2NNUA 4BWAA 1K4CC 5JQGA 1DTOA 4A5UB 3M7MX 1R1BA 2JGUA 2R9IA 1RSOB 4LC1A 3JSNA 1FJGB 3K06A 3SPIA 1WA8A 1TAEA 3K5MA 3GWOA 1KECA 2E3CA 3VOUA 1RSOA 3A0HZ 4QNHB 1LR1A 1S77D 1KB9F 1RM1B 1Y67A 1CXZB 2QWPB 1ZAUA 3OMAB 3ZIAG 1Z5VA 2BTQB 4QGPA 1EN4A 3CXCU 3EHBB 1QBZA 4WCEV 5LHGA 1K73W 3JD3A 1M9NA 3K0DA 4DR2B 3JD0A 4R6ZA 4DRXA 3K03A 3AEIA 5LGTA 4CZZA 2A9HA 4E4EA 1HP8A 3RVYA 5FLXN 4WFGA 3SJBC 1VQKV 2XHBA 1R6KA 2AZ2A 4IL6Z 1N32B 4N23A 4TOIA 1JOYA 2YIBD 4OPAA 2GUZB 1D5NA 3B40A 3B8NA 4MT8A 5LXTB 5CA0B 2Q7EA 4I9WA 4X1IA 1OCRC 2DJVA 4JAUA 4AHCA 4JYCA 1Y76A 3H01A 3H1JH 5LP6B 1ZLZA 3WFVA 2AHZA 2FKXA 2UU9B 4NXMB 1JPXA 3GWKC 4J41A 1ZSPA 1HNWO 1BMFG 1PP9H 3QVNA 5J2UB 3OTOO 3THOA 4DR3O 1S3JA 4LF4B 5LL6Y 4P2ZA 5JVDA 3SJQC 2IH1C 4PA4A 1P49A 4DR5B 2QKCA 1XHXA 4GX5A 4O4LA 1MABG 4B3SB 2IJKA 3LSUA 4LWSB 4R8CA 5KAFZ 2HJDA 5H2FZ 3ZCCA 3OW2U 4JI4B 1GRJA 1YI2V 3ZHSA 4WBNA 2BE3A 2ZDIC 4FLZA 3WU2Z 5IYZB 1AI7A 3N2KB 1H2MA 4DV3B 4IYHA 3LUTB 1VQ4V 4IIJA 2JGDA 4FLTA 2Q68A 3MAQA 2WPDG 4X1YB 1N36O 2JK5C 1SA0B 4L8JA 1PNKA 3VQWA 4FFKA 3BCCH 1YTFD 3RWRD 1CP9A 2B5UA 5CN0A 5A9GA 1NI8A 4GKKO 5C8YA 1GO3F 3CMAV 4JI7B 3D3QA 1GH6A 4PA9A 1H2KA 1N32O 1ORQC 5BMVB 2AZ0A 2ZXWB 3S3WA 4JV5B 1FFXB 3ABMC 3UM7A 1VQ5V 1QHTA 1DF4A 1FXKC 3MDSA 4OPHA 2FTKA 4XDJA 3N27A 4DXWA 2DWDC 5C93A 1YSCA 3D8CA 5HFLA 4J42A 4LF5O 2IU0A 3HKEB 1FJGO 3RYIB 5GONB 3IGAC 3CCRV 4ZBMA 5KA6A 2OTJV 1Z5WA 1R3IC 3PN1A 3HR0A 4G27B 2JGDB 1N33O 3MD0A 3E86A 5CBFA 2QM8A 3VBBA 2RMKB 1VP7A 4MVUA 1K5QA 3SYPA 2X6CA 2XNDG 2RQ6A 4JAVA 3L71H 4CC6A 4RWUA 2KKWA 2YIBA 1K5SA 2EILC 2QA4V 1I7FA 3D36C 4HZ3A 3SYAA 4R50A 2R9AA 3E83A 3OTOB 4JI8O 4GT1A 3PJSK 1PM9A 2WA4A 4JYYA 4EB6A 2ODMA 1NR1A 2ZR3A 5ITZA 4NXMO 4P9OA 1NVPD 4IT5A 2F4VB 1MMMA 2XOKG 3G67A 5EIBD 1Z2GA 1Q8IA 4WFFA 5IYBO 3ETDA 4UV8A 3CRMA 4D6TH 4LF5B 4JI3O 5FL7G 1FD9A 5LA6A 2DN9A 2XAJA 4GX1A 4MVSA 1QLNA 1H2NA 1SQPH 1DGSA 5KLVH 4JTCB 3G6BA 1OCZB 4H33A 1KKCA 1FKAO 3SPCA 1Q7YW 3ZRXA 1NTZH 4WFAV 1VQ6V 2W6IG 2EIMC 3E89A 4CS3A 1SESA 3A0BZ 4B3TB 2VWKA 2XAFA 5CB4A 1H38A 3X2QB 3ASNC 4LF8B 2FMLA 3C3TA 2Z0AA 3RBZA 2EINC 5KUKA 2FL4A 2Y0PA 2CH7B 3CCMV 4PHZA 4UB8Z 5LOVB 3RGBA 1M56B 1SKVA 4U3JA 1V54C 1VF5B 4IYIA 1SQVH 1N34O 2BCCH 1OHHG 2R9RB 4G2KA 1EN5A 1U96A 2DYRB 4FLVA 4Q6GA 4UV9A 3ZX6A 1GMGA 5L3EA 4AQYB 3K5LA 2ZD9A 5E1AC 3ZN1A 1KC8W 4DV7B 1JFFB 4QE9A 5GTHZ 3UQ8A 3HKDB 5F2VO 3CC7V 2Q0OC 3ABLC 1W0JG 2Q69A 1I5YA 2A3QA 4ZI7A 4I9QA 3CJHA 1NU1H 1GK9A 3OUSA 2YI9A 3H1HH 5EC2C 4FLYA 1EZVH 3TXQA 4GLXA 2A7WA 2ZCEA 4CH6A 3L74H 4KHPO 4U3FH 1D2DA 3FYIB 3CMEV 5KUMA 3P30A 2OCHA 2VQFB 2P06A 3UKMA 2JEXA 1RFYA 2QE7G 2MW2B 4FIPC 3VQYA 2CTRA 1E1QG 2K1EA 5KA5A 4YY3B 3HB3B 2ZM6O 5JQGB 2RDCA 1DLBA 3RVZA 1K92A 4QJFB 2X0LA 3K5OA 3OEEG 2O57A 3SJAC 3ZRSA 3KZIZ 4TV8B 3ZHVA 3JCZA 4JI5O 3BPZA 3STLC 2WLLA 4JASA 2E5LB 3HKDA 4ABMA 4X89A 4KUMA 4XBFA 4B3TO 4NTYA 5B3SB 1VF6A 5FNVA 1FAFA 2FYUH 3BVOA 2CK3G 3CS5A 5J2TA 3AG1C 3CX5F 2JJ1G 3CE2A 1KP2A 2UXBO 4DR7B 4MTOA 1B04A 2CUGA 3FB6C 4NR1A 2YXLA 1N36B 4LF9B 5IJ9B 4BW5A 5BY1A 4MTFA 3ZEDA 2LFRA 3CD6V 1KUQA 3RYHB 1NH2B 1QLEC 1I5XA 1P7BA 3D36A 1BCCH 1PNMA 4JI3B 1R3JC 3BEHA 4KHPB 5H9CA 1KYOF 3M99B 5JH7A 2WLKA 4YHHO 3I56V 2IW5A 1EBOA 4LP8A 4DW0A 1AILA 2LP7A 3CYOA 4ZHQA 4X62B 2OWOA 3F7VC 5JVDB 2JVDA 5BR8O 5CA1A 2V4DA 2CGNA 1K7DA 3K57A 1XI1A 1IBLO 2GBOA 1ZTEA 1MA1A 4P30A 2ILMA 4UCRA 4JZGA 3ZMUA 1NH2D 2E76B 2P67A 5EC1C 3ABUA 3JSLA 2JS3A 4IHJA 3ZHQA 2FB5A 3T4DA 4DUZB 2QTOA 3ABTA 4NXNB 2CGOA 3BY6A 3BAAA 2W6JG 3T1YB 4WBNB 1OCRB 4YIOA 1IBMB 4NB5A 5IJ9A 4DYLA 2UUBB 2QWNB 4CH3A 5IYDO 5CA3A 1BHBA 1WPXA 3ZN0A 1BT8A 1EFRG 4DR1B 1XBLA 4O4JB 4DR3B 2YICA 1COWG 1SS3A 3OGIB 3CC2V 2Y4UA 3B8MA 4B08A 1L0LH 3TETA 3QO7A 2DYRC 2EZPA 3OAAG 2YEVA 4JI1B 1I94B 3UCSC 3CCLV 5IT9N 3H9VA 3O65A 4J9YB 5KHIA 1K4DC 3JD2A 3X2QC 1G8MA 2XASA 1B6QA 3Q4HB 2Q6AA 3CPWU 4J10A 1NBMG 3P3PA 1GN4A 3CCUV 5CBGA 2QWOB 4UCUA 1NTMH 5LMNO 1VQPV 1B3QA 2DW4A 2N74A 5JWPA 1MZFA 1IDSA 2KSDA 3OT7A 4MVOA 1Q3EA 5LYJA 4JI4O 2LQTA 4J11A 2WLLB 3UT5A 4NVPA 1N4CA 3JYCA 3SPJA 1WA8B 3E22B 4N21A 2ZT9B 1AP5A 2A06H 4HNAA 3AG2B 2Q7GA 3ZHTA 3ZRWA 1JCHA 1M4UA 4LH6A 3IC9A 4HAMA 4K8XA 4ZOLB 2OYQA 1VMGA 4E2LA 4DV0O 2OCCC 2DWEC 4K0KB 3KCYA 1IBLB 1M56C 2LFSA 3L75H 4IGGA 3P32A 4DR6O 3N2GA 4BIUA 1SQFA 3SYCA 1WNSA 1F4MA 1AP6A 5LGNA 3NXSA 4DV1B 3NR7A 4GCZA 1SQQH 1US6A 5KX5B 5LOVA 1HNXB 4NKGB 1THZA 2XTAA 2QM4A 3ZJZA 2EIMB 4GX0A 3LDDA 2Y69B 3SR2C 1IVSA 1QR9A 3B4SA 1TUBB 3E8HA 2M6YA 1HW7A 1V9PA 2PI4A 1Y76B 3G80A 3STZC 4X66O 1F51A 3SGIA 3OD4A 1ZWIC 4ZI7B 5LBQA 1VEWA 3FKSG 2NR5A 2EJ7A 1JMKC 1S72V 1RP3B 2D3OW 5CB4B 3CRRA 2WLNA 3CRQA 4UFZA 2QEXV 4JYBA 2W0FC 3KKYA 1AROP 4DR1O 3JARA 4I50A 3VQXA 4DR2O 4DV3O 1FXKB 5JJNB 1WB7A 3B09A 3JAMN 3HKBA 4J80A 4UCTA 5IWAB 4JGSA 4UVCA 2QM7A 4F4LA 4I50B 2P90A 3R66A 1M93A 4J7ZA 3JAWA 1NVPB 1P4RA 3FAVB 4F6EA 3JALB 3CCJV 2WLIB 1EN6A 4FMTA 3MHSC 4DK1A 3HPLC 4BIZA 4BW9A 2QJ1A 1N0NA 2JEUA 3JASA 3TK1A 4K3AA 2KG7A 4O2BA 2HLDG 5CA1B 4LNUB 2CTQA 1R73A 3E8BA 4DV5B 1J5EO 1QCEA 4JTAB 4MVQA 2EBOA 2Z5UA 5IJ0A 1SQGA 1KKDA 5E79Z 1VF7A 5JH7B 1AI4A 1LUWA 1QU7A 4LH7A 4YJ2A 3EVKA 3LNNA 3ZBHA 2GDSA 4X64B 3IFXA 1SERA 1YJWV 4K35A 3B77A 4TV9A 3HKCA 3SYOA 2LO1A 3Q4HA 3ABKB 3RYFA 2UXXA 1GTOA 4B3MO 4F6RB 3ZMVA 5B1BC 2Q7HA 1O9HA 2EINB 2QTSA 2ZE8A 5IE9A 4QPKA 2YSUB 4NYKA 3ZHRA 4PA6A 2LW1A 3CRAA 4DV7O 3IAYA 1BQZA 3AG4B 4X88A 1FXHA 4FM2A 4TQFA 2Q4PA 1ZUQA 2GHYA 4KFMA 4XDLA 4DR7O 5LP6C 3T1HB 2F1MA 3KG2A 1NT2B 1XQ8A 5DM6V 3E8FA 2ITCC 5LMUO 4I5SA 1XNRB 5EZYA 1WLEA 3OUFA 4QIWF 1YTFB 3A0RA 4LNUA 3F5TA 2YEVB 2WLMA 5AG2A 3H1KH 5KHHA 1HDJA 4LFCB 2IU3A 3CCQV 1JQ0A 1S5LZ 1GN2A 1AVMA 1PD3A 4DK0A 3RYFB 2X6BA 2EIKB 3R65A 3DTUB 1SQBH 2QKAA 4DV4B 4CC5A 5EYPB 3T4ZA 1GKFA 3FB7C 3OMNB 2L6LA 3HKEA 4JF3A 1W59A 3IC7A 4L87A 3C90A 4JPRA 4X8AA 4TT3G 2DQ3A 2ZNJA 1LNQA 3LSSA 1IXBA 3H1LH 4PDMA 4X65O 1XMOO 1L0NH 2GUZA 2DYSC 1YCIA 1J95A 3OR7C 5KHGA 3T1CA 1AI5A 5JJJB 2F23A 2P5OA 5BR8B 3K04A 3OM3B 5C8YB 2VWJA 4PA3A 4FJCC 2OIEA 4HBNA 5IYCO 2Q0AA 3ZMTA 1ZL8B 2KG7B 4IIJB 1N34B 3B2EE 2EZOA 1MSWD 4FVMA 4KXRA 1TGOA 1K97A 3ZMSA 1Y74A 1VF6C 5H5NA 1BS3A 2V7QG 5K1XA 4JI8B 2QGNA 3AG1B 1SA0A 3CJHB 4R7CA 3QG5A 5B3SC 2B9ZA 2QWQB 1FS0G 2UXCB 5J9PC 4JI0B 5KMGA 5EBWC 3OFNG 4JZ2A 4X65B 5EBLC 3HKBB 1SZXA 2H94A 2ETNA 4DV6O 3D3IA 2UUBO 2HP8A 2RJZA 2RNBA 5KX5A 3IJ4A 1OV9A 1UFIA 1RPOA 3GVMA 1VQOV 1YIJV 4GYCB 1EZJA 2P22C 3OEHG 1UJWB 1B06A 4O4IA 5B1AB 4LF8O 4DV0B 3LDCA 3CCEV 1CEZA 4JYAB 1Q90D 1E1RG 3CWBH 4KP4A 4TV8A 2YIAA 2PZSA 2PY5A 5LP6A 5L3FA 4DV1O 1MOFA 5CMUA 2ADPA 2F4VO 4GKJO 2JS5A 3K9SA 4HNAB 1NQTA 1W2BU 2F95B 4MVZA 1XDCA 4TV9B 3ZRVA 2AXTZ 2Y69C 4H44B 4I4TB 4EEQA 4Z2WA 3L70H 1XMQB 2D2CB 5KMGB 2ZE6A 1OJHA 3FYEB 3AK1A 5H6RA 3ETQA 2WA3A 3ABLB 3SPGA 2PF4E 4QE7A 2CDYA 2ZQMA 1XMOB 4MTXA 4FLXA 3BA9A 4BIOA 2WAMA 1FXVA 4FPPA 2ZE7A 3RYCB 3CP1A 3LSQA 1KQSU 2K9PA 4LF9O 1FPOA 1YZBA 3G71V 4OGQB 1OCCB 3RYIA 3T1YO 1TUBA 4JI6O 3AG2C 2H3OA 1Q81W 3RYCA 4WFBV 2YDEA 1YXBA 1QLEB 4PA7A 4X20A 5IWAO 1VQLV 2ZINA 3AK2A 4Z1MG 2GSMB 4LFCO 2BTOA 4RQEA 4DV5O 2BTQA 3LNMB 1X4TA 3N2GB 1MZEA 2LW7A 1HWYA 4U3JB 3W7XA 5DECA 1K34A 1NJIW 4K8ZA 2YIDA 4WFEA 5J2TB 2UUCO 4LFAO 2PTMA 3APOA 3F5WC 2UXNA 5IY5C 2ZIMA 1P84F 4PD4F 4QPJA 1NR7A 1XL4A 2WLJA 4YJ3A 5GONA 3OMIB 2YXYA 5L3GA 1BSMA 2Y0IA 2OT5A 4RUEA 2Q8VA 1K33A 1ZL8A 2OIGA 1H2GA 3SPHA 5LHHA 2F43G 3AK3A 3J7AU 1Q43A 1V55B 4RO2A 4DV2O 1G1XB 3CSXA 4BAYA 3OE7G 4NXNO 4DUYO 1JA8A 4X1KA 4I0XB 1ZX3A 1R3LC 1F23A 1YDXA 4O4JA 4OX9B 3E2EA 2ZE5A 1AJQA 4LF6O 1CPYA 1FFXA 3DC5A 3BRCA 3U11A 2C2AA 3JAKB 1YJNV 1Q5OA 4J7JA 1NTKH 4G28B 2NN4A 5B66Z 2QR4A 2P4VA 1XL6A 2CH7A 5FPRA 3C3SA 1YF2A
chains in the Genus database with same CATH topology
3S3WA 1WP8A 2L35A 1WP7A 2QTSA 3IJ4A 4NTYA 4NYKA 3S3XA 3N27A 4FZ0A 4NTWA 4FZ1A 4NTXA 2FB5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3S3W A;  1WP8 A;  2L35 A;  1WP7 A;  2QTS A;  3IJ4 A;  4NTY A;  4NYK A;  3S3X A;  3N27 A;  4FZ0 A;  4NTW A;  4FZ1 A;  4NTX A;  2FB5 A; 
#chains in the Genus database with same CATH topology
 4EB6 B;  5JCO C;  3T1H O;  1SC5 B;  4O4H B;  4O4L B;  1XNR O;  3F7Y C;  5B1B B;  2JRI A;  1HNX O;  3W7U A;  4UB6 Z;  2HHH O;  5EK0 A;  3P3N A;  2Q9L A;  4UXN A;  2WSS G;  4O2B B;  5EIB C;  1R6N A;  1XEQ A;  5BXZ A;  1M57 C;  4ZHQ B;  4DV6 B;  3EFF K;  1AI6 A;  1I08 A;  4GKJ B;  1KMI Z;  5L3D A;  1YVW A;  2B1G A;  2QKS A;  3M8A A;  3K59 A;  3ML0 A;  5J2U A;  1VQ7 V;  3TJT A;  1S5H C;  3S3X A;  1I0H A;  1H8E G;  3L72 H;  2P4K A;  4H13 B;  3AG3 C;  1K3E A;  1BL8 A;  4JAA A;  1URF A;  4YIP A;  1HNZ O;  1K8A W;  1Q6H A;  5EBM C;  1SZT A;  1PPJ H;  2VQE O;  3O9O A;  4J9Z B;  5L3C A;  5DED A;  3VQV A;  5K1P A;  1N33 B;  2B1I A;  3ASO C;  4FLW A;  4CS4 A;  4DUY B;  4KL1 A;  4FZ1 A;  1M57 B;  5LXT A;  1GAX A;  1XIL A;  1WP8 A;  2MK3 A;  2HKO A;  1WB8 A;  4ZIB A;  3U0Z A;  4H0L B;  1MNG A;  3AG3 B;  3CCS V;  1SF9 A;  2PYJ A;  2UXC O;  3SYQ A;  2L35 A;  5FPO A;  1DK1 A;  2AGA A;  4MW3 A;  1YEW A;  4RQF A;  3UO3 A;  1PL0 A;  2ZM6 B;  3K08 A;  2YUA A;  4X1K B;  2UUA B;  4O2A B;  4YY3 O;  1JVM A;  1ROP A;  3TCU A;  2HEP A;  2N05 A;  4GKK B;  1HNZ B;  2Z3Y A;  3TXS A;  4JI0 O;  4GZR B;  4PI0 A;  2Y4T A;  1NKD A;  4UCO A;  4LCU C;  2VS0 A;  4W4L A;  1AR4 A;  1RPR A;  2EUL A;  1G4Y B;  4DO2 A;  2M7W A;  3JAK A;  4AI8 A;  5DN6 G;  3W7W A;  4J7K A;  3OR6 C;  1Q86 W;  5A2Q N;  1OZ0 A;  2QWR B;  3LDE A;  4I7Z B;  4AQY O;  1VQ8 V;  1N0J A;  4OX9 O;  3G4S V;  4X62 O;  3CCV V;  1W0K G;  2IJH A;  2JIZ G;  5LA6 B;  2JJ2 G;  2HHH B;  5KAI Z;  2VRZ A;  3T2M A;  5H6Q A;  2X6A A;  3DC6 A;  3RT3 C;  4O4H A;  5D5P A;  1SQX H;  1Q6I A;  4DR5 O;  4X66 B;  1M5I A;  4TUY B;  1M90 W;  4LF4 O;  4ZKI A;  3RYH A;  4B7E A;  1WPB A;  3K58 A;  1AR5 A;  2UXD B;  4UVA A;  1PL4 A;  2XUM A;  3FX7 A;  3QNE A;  4X1Y A;  2OCC B;  3QO5 A;  2Y48 A;  4FFB B;  2XAQ A;  1X59 A;  3BHP A;  5GTI Z;  4DR4 O;  3JAT B;  1YJ9 V;  4FLU A;  4YHH B;  4PI2 A;  1L8D A;  4EFB A;  4YJ2 B;  3HKC B;  1A32 A;  2HJF C;  5FNV B;  1BZK A;  4CS2 A;  4MVM A;  2V1D A;  1KP3 A;  3TGU H;  1AR1 B;  1XNQ O;  3A8T A;  1IBM O;  3OGC C;  4PEL A;  4JI5 B;  1M1K W;  4B3M B;  3ZS8 C;  3WB2 A;  4NTX A;  2EJR A;  3SJC C;  1QVF U;  4DV4 O;  1TA8 A;  2QSA A;  2JDI G;  3JD1 A;  3J81 N;  1XHZ A;  4LF7 O;  4LFB B;  1FYJ A;  3CXH F;  4X1I B;  2AW9 A;  4O4I B;  2DMX A;  4NTW A;  3G6E V;  1R3K C;  1S0V A;  4I55 B;  4JI2 O;  1V55 C;  2XT9 A;  3DXR A;  4TWK A;  3WG7 C;  4X9Q A;  3RW0 A;  4MS2 A;  3FB5 C;  4FK5 C;  3A2F A;  5IJ0 B;  4I4T A;  3E8G A;  2VQF O;  2W0X A;  1U97 A;  1QNM A;  1I94 O;  2A79 B;  1QR8 A;  1DF5 A;  2ITD C;  3DXR B;  4LF7 B;  4LFB O;  2CTW A;  3QF7 A;  5ITZ B;  1IXM A;  2GTS A;  5IDJ A;  1JJO A;  1BHA A;  4DRX B;  1E79 G;  1N8R W;  2HFE C;  4PDR A;  1JR9 A;  3AG4 C;  5B1A C;  1RM1 C;  4YJ3 B;  2CTP A;  3RFR A;  3E35 A;  1Y66 A;  2Q73 A;  2IJI A;  1HR0 B;  3I5D A;  1OCC C;  2ADQ B;  2WLI A;  4DV2 B;  4GX2 A;  3H1I H;  4LBE C;  4FM1 A;  1KU9 A;  1JFF A;  1GN3 A;  3UT5 B;  5CA0 A;  4PJ0 Z;  4WF9 V;  1WN7 A;  2ZR2 A;  2DE0 X;  5KHK A;  4D7T A;  4UCV A;  1QQC A;  4DR4 B;  2KQX A;  3JD4 A;  4B7K A;  4X20 B;  5GW7 A;  4CH4 A;  4ZOL A;  2UUC B;  4I55 A;  1Y74 B;  4RAI A;  4Q20 A;  1TVK A;  3BAB A;  3ZRW B;  2IM9 A;  4LR3 A;  3CC4 V;  2ARH A;  4ASU G;  4JYA O;  1H2L A;  5JCO A;  3DSQ A;  1HNW B;  3ETG A;  1YHQ V;  3JAW B;  4FZ0 A;  3K9A A;  2CE4 A;  2F66 C;  2ZIO A;  5BZB A;  1KD1 W;  3I55 V;  1IBK O;  1F7Y A;  1NZ6 A;  2XAG A;  2OTL V;  4WFH A;  2HVJ C;  4U7N A;  2KB1 A;  4TUY A;  2H8P C;  1R6T A;  1NS1 A;  3WB0 A;  2PGG A;  2ZXW C;  4B3S O;  2ATK C;  5LGU A;  2EIJ C;  1IZ3 A;  1LUV A;  1TUE B;  1YIT V;  2R72 A;  3CRC A;  1G6U A;  1ENV A;  4JI1 O;  2YXH A;  4B3R O;  3AG7 A;  3CEI A;  1P7G A;  2CAZ C;  3UO2 A;  1J5E B;  3ASO B;  4OXS A;  4PV1 B;  2R70 A;  4CH5 A;  2UUA O;  1AJP A;  5D5Q A;  4X64 O;  5B5E Z;  3WG7 B;  2IBZ H;  5BMV A;  1QVG U;  2QDO A;  4AIL C;  4MVR A;  2IJJ A;  2DQ0 A;  5LMN B;  4RUF A;  3WB1 A;  3ZHU A;  4D7S A;  1PKX A;  1BGY H;  2LGQ A;  4XDK A;  1Q6U A;  1D5A A;  1KBH A;  2NLJ C;  1FFT B;  2XAH A;  2E5L O;  1IX9 A;  1JJ2 U;  4TSF G;  4LFA B;  4IHJ B;  4BR6 A;  3JAL A;  1AB3 A;  3RN4 A;  4W4K A;  3L9D A;  2LGW A;  2X7R B;  3APQ A;  4DW1 A;  3K3W A;  4ICG A;  4O2A A;  3SDL A;  4DR6 B;  1GM9 A;  1Y4M A;  4JTD B;  2P6J A;  1SRY A;  3BA8 A;  1TVK B;  1PNL A;  3JCU Z;  5JJE B;  4H37 A;  1BE3 H;  2DYS B;  4Z1V A;  2Q5Z A;  1L1F A;  2G38 A;  3ETE A;  2WWW A;  4JI6 B;  4LF6 B;  3L73 H;  4LWS A;  2PUS A;  2YS8 A;  4GUN A;  2EIK C;  3J80 N;  5LMU B;  1OCO C;  3JAR B;  5CBH A;  4P9P A;  4HYO A;  5HFM A;  1GN6 A;  4EFE A;  5IY5 B;  4MTG A;  4UCS A;  5KHJ A;  1FXK A;  1F4N A;  2BSK B;  1HR0 O;  1VQ9 V;  3ASN B;  2HG5 C;  3W7T A;  1XNQ B;  4UUJ C;  1GM8 A;  5LHI A;  1T5E A;  1MSD A;  2RCV A;  1XMQ O;  3ZMZ A;  1SET A;  3JAS B;  1XOU A;  1VQN V;  2PYL A;  4U7O A;  1OCO B;  1VIB A;  5IYZ A;  4MW8 A;  4DUZ O;  2E74 B;  4JV5 O;  3FB8 C;  1O9G A;  2BOC C;  1K9M W;  4B3R B;  4TQD A;  4FM0 A;  4I0X A;  2UXB B;  3ICX A;  4K0K O;  1MG1 A;  3DGE A;  2WLH A;  2F93 B;  1OCZ C;  2HR3 A;  4JI2 B;  5B1O A;  2ZDI A;  3QO8 A;  1S76 D;  4PDV A;  2EX3 A;  3GB7 C;  3W7S A;  1WP7 A;  3EXA A;  1IUR A;  1H8H G;  3U10 A;  3FD9 A;  2AHY A;  5L3B A;  1XUQ A;  4UVB A;  2YC0 A;  2Q67 A;  3ABK C;  3FAV A;  1VAR A;  1UPG A;  3BFR A;  1BQ0 A;  1IBK B;  2EIL B;  5EYP A;  3ABM B;  1V54 B;  2LJ2 A;  2DOS A;  3N2K A;  2UXD O;  2BSK A;  1GM7 A;  2GTA A;  3QTC A;  3K79 A;  1EM1 A;  3MHH C;  3K0G A;  1WAZ A;  1S5J A;  1H2S B;  4PDL A;  3CB2 A;  3K5N A;  4EKW A;  2E75 B;  5LYJ B;  3E22 A;  2BOB C;  1JX9 A;  4FFB A;  2ZKO A;  3OTF A;  2RN9 A;  2HVK C;  2VQE B;  3KCX A;  1WJZ A;  2N04 A;  2A0L A;  1VQM V;  5EZY B;  5TIS Z;  3CHX A;  4CBC A;  2PI5 A;  2P7T C;  2UU9 O;  3JAT A;  1PV0 A;  4JI7 O;  5B1N A;  1Y6X A;  4MSW C;  2IH3 C;  4C7U A;  4F6R A;  1Q82 W;  2YI8 A;  1XRE A;  3FFQ A;  2EIJ B;  1AJN A;  4YXW G;  2ZNI A;  2GV9 A;  2NNU A;  4BWA A;  1K4C C;  5JQG A;  1DTO A;  4A5U B;  3M7M X;  1R1B A;  2JGU A;  2R9I A;  1RSO B;  4LC1 A;  3JSN A;  1FJG B;  3K06 A;  3SPI A;  1WA8 A;  1TAE A;  3K5M A;  3GWO A;  1KEC A;  2E3C A;  3VOU A;  1RSO A;  3A0H Z;  4QNH B;  1LR1 A;  1S77 D;  1KB9 F;  1RM1 B;  1Y67 A;  1CXZ B;  2QWP B;  1ZAU A;  3OMA B;  3ZIA G;  1Z5V A;  2BTQ B;  4QGP A;  1EN4 A;  3CXC U;  3EHB B;  1QBZ A;  4WCE V;  5LHG A;  1K73 W;  3JD3 A;  1M9N A;  3K0D A;  4DR2 B;  3JD0 A;  4R6Z A;  4DRX A;  3K03 A;  3AEI A;  5LGT A;  4CZZ A;  2A9H A;  4E4E A;  1HP8 A;  3RVY A;  5FLX N;  4WFG A;  3SJB C;  1VQK V;  2XHB A;  1R6K A;  2AZ2 A;  4IL6 Z;  1N32 B;  4N23 A;  4TOI A;  1JOY A;  2YIB D;  4OPA A;  2GUZ B;  1D5N A;  3B40 A;  3B8N A;  4MT8 A;  5LXT B;  5CA0 B;  2Q7E A;  4I9W A;  4X1I A;  1OCR C;  2DJV A;  4JAU A;  4AHC A;  4JYC A;  1Y76 A;  3H01 A;  3H1J H;  5LP6 B;  1ZLZ A;  3WFV A;  2AHZ A;  2FKX A;  2UU9 B;  4NXM B;  1JPX A;  3GWK C;  4J41 A;  1ZSP A;  1HNW O;  1BMF G;  1PP9 H;  3QVN A;  5J2U B;  3OTO O;  3THO A;  4DR3 O;  1S3J A;  4LF4 B;  5LL6 Y;  4P2Z A;  5JVD A;  3SJQ C;  2IH1 C;  4PA4 A;  1P49 A;  4DR5 B;  2QKC A;  1XHX A;  4GX5 A;  4O4L A;  1MAB G;  4B3S B;  2IJK A;  3LSU A;  4LWS B;  4R8C A;  5KAF Z;  2HJD A;  5H2F Z;  3ZCC A;  3OW2 U;  4JI4 B;  1GRJ A;  1YI2 V;  3ZHS A;  4WBN A;  2BE3 A;  2ZDI C;  4FLZ A;  3WU2 Z;  5IYZ B;  1AI7 A;  3N2K B;  1H2M A;  4DV3 B;  4IYH A;  3LUT B;  1VQ4 V;  4IIJ A;  2JGD A;  4FLT A;  2Q68 A;  3MAQ A;  2WPD G;  4X1Y B;  1N36 O;  2JK5 C;  1SA0 B;  4L8J A;  1PNK A;  3VQW A;  4FFK A;  3BCC H;  1YTF D;  3RWR D;  1CP9 A;  2B5U A;  5CN0 A;  5A9G A;  1NI8 A;  4GKK O;  5C8Y A;  1GO3 F;  3CMA V;  4JI7 B;  3D3Q A;  1GH6 A;  4PA9 A;  1H2K A;  1N32 O;  1ORQ C;  5BMV B;  2AZ0 A;  2ZXW B;  3S3W A;  4JV5 B;  1FFX B;  3ABM C;  3UM7 A;  1VQ5 V;  1QHT A;  1DF4 A;  1FXK C;  3MDS A;  4OPH A;  2FTK A;  4XDJ A;  3N27 A;  4DXW A;  2DWD C;  5C93 A;  1YSC A;  3D8C A;  5HFL A;  4J42 A;  4LF5 O;  2IU0 A;  3HKE B;  1FJG O;  3RYI B;  5GON B;  3IGA C;  3CCR V;  4ZBM A;  5KA6 A;  2OTJ V;  1Z5W A;  1R3I C;  3PN1 A;  3HR0 A;  4G27 B;  2JGD B;  1N33 O;  3MD0 A;  3E86 A;  5CBF A;  2QM8 A;  3VBB A;  2RMK B;  1VP7 A;  4MVU A;  1K5Q A;  3SYP A;  2X6C A;  2XND G;  2RQ6 A;  4JAV A;  3L71 H;  4CC6 A;  4RWU A;  2KKW A;  2YIB A;  1K5S A;  2EIL C;  2QA4 V;  1I7F A;  3D36 C;  4HZ3 A;  3SYA A;  4R50 A;  2R9A A;  3E83 A;  3OTO B;  4JI8 O;  4GT1 A;  3PJS K;  1PM9 A;  2WA4 A;  4JYY A;  4EB6 A;  2ODM A;  1NR1 A;  2ZR3 A;  5ITZ A;  4NXM O;  4P9O A;  1NVP D;  4IT5 A;  2F4V B;  1MMM A;  2XOK G;  3G67 A;  5EIB D;  1Z2G A;  1Q8I A;  4WFF A;  5IYB O;  3ETD A;  4UV8 A;  3CRM A;  4D6T H;  4LF5 B;  4JI3 O;  5FL7 G;  1FD9 A;  5LA6 A;  2DN9 A;  2XAJ A;  4GX1 A;  4MVS A;  1QLN A;  1H2N A;  1SQP H;  1DGS A;  5KLV H;  4JTC B;  3G6B A;  1OCZ B;  4H33 A;  1KKC A;  1FKA O;  3SPC A;  1Q7Y W;  3ZRX A;  1NTZ H;  4WFA V;  1VQ6 V;  2W6I G;  2EIM C;  3E89 A;  4CS3 A;  1SES A;  3A0B Z;  4B3T B;  2VWK A;  2XAF A;  5CB4 A;  1H38 A;  3X2Q B;  3ASN C;  4LF8 B;  2FML A;  3C3T A;  2Z0A A;  3RBZ A;  2EIN C;  5KUK A;  2FL4 A;  2Y0P A;  2CH7 B;  3CCM V;  4PHZ A;  4UB8 Z;  5LOV B;  3RGB A;  1M56 B;  1SKV A;  4U3J A;  1V54 C;  1VF5 B;  4IYI A;  1SQV H;  1N34 O;  2BCC H;  1OHH G;  2R9R B;  4G2K A;  1EN5 A;  1U96 A;  2DYR B;  4FLV A;  4Q6G A;  4UV9 A;  3ZX6 A;  1GMG A;  5L3E A;  4AQY B;  3K5L A;  2ZD9 A;  5E1A C;  3ZN1 A;  1KC8 W;  4DV7 B;  1JFF B;  4QE9 A;  5GTH Z;  3UQ8 A;  3HKD B;  5F2V O;  3CC7 V;  2Q0O C;  3ABL C;  1W0J G;  2Q69 A;  1I5Y A;  2A3Q A;  4ZI7 A;  4I9Q A;  3CJH A;  1NU1 H;  1GK9 A;  3OUS A;  2YI9 A;  3H1H H;  5EC2 C;  4FLY A;  1EZV H;  3TXQ A;  4GLX A;  2A7W A;  2ZCE A;  4CH6 A;  3L74 H;  4KHP O;  4U3F H;  1D2D A;  3FYI B;  3CME V;  5KUM A;  3P30 A;  2OCH A;  2VQF B;  2P06 A;  3UKM A;  2JEX A;  1RFY A;  2QE7 G;  2MW2 B;  4FIP C;  3VQY A;  2CTR A;  1E1Q G;  2K1E A;  5KA5 A;  4YY3 B;  3HB3 B;  2ZM6 O;  5JQG B;  2RDC A;  1DLB A;  3RVZ A;  1K92 A;  4QJF B;  2X0L A;  3K5O A;  3OEE G;  2O57 A;  3SJA C;  3ZRS A;  3KZI Z;  4TV8 B;  3ZHV A;  3JCZ A;  4JI5 O;  3BPZ A;  3STL C;  2WLL A;  4JAS A;  2E5L B;  3HKD A;  4ABM A;  4X89 A;  4KUM A;  4XBF A;  4B3T O;  4NTY A;  5B3S B;  1VF6 A;  5FNV A;  1FAF A;  2FYU H;  3BVO A;  2CK3 G;  3CS5 A;  5J2T A;  3AG1 C;  3CX5 F;  2JJ1 G;  3CE2 A;  1KP2 A;  2UXB O;  4DR7 B;  4MTO A;  1B04 A;  2CUG A;  3FB6 C;  4NR1 A;  2YXL A;  1N36 B;  4LF9 B;  5IJ9 B;  4BW5 A;  5BY1 A;  4MTF A;  3ZED A;  2LFR A;  3CD6 V;  1KUQ A;  3RYH B;  1NH2 B;  1QLE C;  1I5X A;  1P7B A;  3D36 A;  1BCC H;  1PNM A;  4JI3 B;  1R3J C;  3BEH A;  4KHP B;  5H9C A;  1KYO F;  3M99 B;  5JH7 A;  2WLK A;  4YHH O;  3I56 V;  2IW5 A;  1EBO A;  4LP8 A;  4DW0 A;  1AIL A;  2LP7 A;  3CYO A;  4ZHQ A;  4X62 B;  2OWO A;  3F7V C;  5JVD B;  2JVD A;  5BR8 O;  5CA1 A;  2V4D A;  2CGN A;  1K7D A;  3K57 A;  1XI1 A;  1IBL O;  2GBO A;  1ZTE A;  1MA1 A;  4P30 A;  2ILM A;  4UCR A;  4JZG A;  3ZMU A;  1NH2 D;  2E76 B;  2P67 A;  5EC1 C;  3ABU A;  3JSL A;  2JS3 A;  4IHJ A;  3ZHQ A;  2FB5 A;  3T4D A;  4DUZ B;  2QTO A;  3ABT A;  4NXN B;  2CGO A;  3BY6 A;  3BAA A;  2W6J G;  3T1Y B;  4WBN B;  1OCR B;  4YIO A;  1IBM B;  4NB5 A;  5IJ9 A;  4DYL A;  2UUB B;  2QWN B;  4CH3 A;  5IYD O;  5CA3 A;  1BHB A;  1WPX A;  3ZN0 A;  1BT8 A;  1EFR G;  4DR1 B;  1XBL A;  4O4J B;  4DR3 B;  2YIC A;  1COW G;  1SS3 A;  3OGI B;  3CC2 V;  2Y4U A;  3B8M A;  4B08 A;  1L0L H;  3TET A;  3QO7 A;  2DYR C;  2EZP A;  3OAA G;  2YEV A;  4JI1 B;  1I94 B;  3UCS C;  3CCL V;  5IT9 N;  3H9V A;  3O65 A;  4J9Y B;  5KHI A;  1K4D C;  3JD2 A;  3X2Q C;  1G8M A;  2XAS A;  1B6Q A;  3Q4H B;  2Q6A A;  3CPW U;  4J10 A;  1NBM G;  3P3P A;  1GN4 A;  3CCU V;  5CBG A;  2QWO B;  4UCU A;  1NTM H;  5LMN O;  1VQP V;  1B3Q A;  2DW4 A;  2N74 A;  5JWP A;  1MZF A;  1IDS A;  2KSD A;  3OT7 A;  4MVO A;  1Q3E A;  5LYJ A;  4JI4 O;  2LQT A;  4J11 A;  2WLL B;  3UT5 A;  4NVP A;  1N4C A;  3JYC A;  3SPJ A;  1WA8 B;  3E22 B;  4N21 A;  2ZT9 B;  1AP5 A;  2A06 H;  4HNA A;  3AG2 B;  2Q7G A;  3ZHT A;  3ZRW A;  1JCH A;  1M4U A;  4LH6 A;  3IC9 A;  4HAM A;  4K8X A;  4ZOL B;  2OYQ A;  1VMG A;  4E2L A;  4DV0 O;  2OCC C;  2DWE C;  4K0K B;  3KCY A;  1IBL B;  1M56 C;  2LFS A;  3L75 H;  4IGG A;  3P32 A;  4DR6 O;  3N2G A;  4BIU A;  1SQF A;  3SYC A;  1WNS A;  1F4M A;  1AP6 A;  5LGN A;  3NXS A;  4DV1 B;  3NR7 A;  4GCZ A;  1SQQ H;  1US6 A;  5KX5 B;  5LOV A;  1HNX B;  4NKG B;  1THZ A;  2XTA A;  2QM4 A;  3ZJZ A;  2EIM B;  4GX0 A;  3LDD A;  2Y69 B;  3SR2 C;  1IVS A;  1QR9 A;  3B4S A;  1TUB B;  3E8H A;  2M6Y A;  1HW7 A;  1V9P A;  2PI4 A;  1Y76 B;  3G80 A;  3STZ C;  4X66 O;  1F51 A;  3SGI A;  3OD4 A;  1ZWI C;  4ZI7 B;  5LBQ A;  1VEW A;  3FKS G;  2NR5 A;  2EJ7 A;  1JMK C;  1S72 V;  1RP3 B;  2D3O W;  5CB4 B;  3CRR A;  2WLN A;  3CRQ A;  4UFZ A;  2QEX V;  4JYB A;  2W0F C;  3KKY A;  1ARO P;  4DR1 O;  3JAR A;  4I50 A;  3VQX A;  4DR2 O;  4DV3 O;  1FXK B;  5JJN B;  1WB7 A;  3B09 A;  3JAM N;  3HKB A;  4J80 A;  4UCT A;  5IWA B;  4JGS A;  4UVC A;  2QM7 A;  4F4L A;  4I50 B;  2P90 A;  3R66 A;  1M93 A;  4J7Z A;  3JAW A;  1NVP B;  1P4R A;  3FAV B;  4F6E A;  3JAL B;  3CCJ V;  2WLI B;  1EN6 A;  4FMT A;  3MHS C;  4DK1 A;  3HPL C;  4BIZ A;  4BW9 A;  2QJ1 A;  1N0N A;  2JEU A;  3JAS A;  3TK1 A;  4K3A A;  2KG7 A;  4O2B A;  2HLD G;  5CA1 B;  4LNU B;  2CTQ A;  1R73 A;  3E8B A;  4DV5 B;  1J5E O;  1QCE A;  4JTA B;  4MVQ A;  2EBO A;  2Z5U A;  5IJ0 A;  1SQG A;  1KKD A;  5E79 Z;  1VF7 A;  5JH7 B;  1AI4 A;  1LUW A;  1QU7 A;  4LH7 A;  4YJ2 A;  3EVK A;  3LNN A;  3ZBH A;  2GDS A;  4X64 B;  3IFX A;  1SER A;  1YJW V;  4K35 A;  3B77 A;  4TV9 A;  3HKC A;  3SYO A;  2LO1 A;  3Q4H A;  3ABK B;  3RYF A;  2UXX A;  1GTO A;  4B3M O;  4F6R B;  3ZMV A;  5B1B C;  2Q7H A;  1O9H A;  2EIN B;  2QTS A;  2ZE8 A;  5IE9 A;  4QPK A;  2YSU B;  4NYK A;  3ZHR A;  4PA6 A;  2LW1 A;  3CRA A;  4DV7 O;  3IAY A;  1BQZ A;  3AG4 B;  4X88 A;  1FXH A;  4FM2 A;  4TQF A;  2Q4P A;  1ZUQ A;  2GHY A;  4KFM A;  4XDL A;  4DR7 O;  5LP6 C;  3T1H B;  2F1M A;  3KG2 A;  1NT2 B;  1XQ8 A;  5DM6 V;  3E8F A;  2ITC C;  5LMU O;  4I5S A;  1XNR B;  5EZY A;  1WLE A;  3OUF A;  4QIW F;  1YTF B;  3A0R A;  4LNU A;  3F5T A;  2YEV B;  2WLM A;  5AG2 A;  3H1K H;  5KHH A;  1HDJ A;  4LFC B;  2IU3 A;  3CCQ V;  1JQ0 A;  1S5L Z;  1GN2 A;  1AVM A;  1PD3 A;  4DK0 A;  3RYF B;  2X6B A;  2EIK B;  3R65 A;  3DTU B;  1SQB H;  2QKA A;  4DV4 B;  4CC5 A;  5EYP B;  3T4Z A;  1GKF A;  3FB7 C;  3OMN B;  2L6L A;  3HKE A;  4JF3 A;  1W59 A;  3IC7 A;  4L87 A;  3C90 A;  4JPR A;  4X8A A;  4TT3 G;  2DQ3 A;  2ZNJ A;  1LNQ A;  3LSS A;  1IXB A;  3H1L H;  4PDM A;  4X65 O;  1XMO O;  1L0N H;  2GUZ A;  2DYS C;  1YCI A;  1J95 A;  3OR7 C;  5KHG A;  3T1C A;  1AI5 A;  5JJJ B;  2F23 A;  2P5O A;  5BR8 B;  3K04 A;  3OM3 B;  5C8Y B;  2VWJ A;  4PA3 A;  4FJC C;  2OIE A;  4HBN A;  5IYC O;  2Q0A A;  3ZMT A;  1ZL8 B;  2KG7 B;  4IIJ B;  1N34 B;  3B2E E;  2EZO A;  1MSW D;  4FVM A;  4KXR A;  1TGO A;  1K97 A;  3ZMS A;  1Y74 A;  1VF6 C;  5H5N A;  1BS3 A;  2V7Q G;  5K1X A;  4JI8 B;  2QGN A;  3AG1 B;  1SA0 A;  3CJH B;  4R7C A;  3QG5 A;  5B3S C;  2B9Z A;  2QWQ B;  1FS0 G;  2UXC B;  5J9P C;  4JI0 B;  5KMG A;  5EBW C;  3OFN G;  4JZ2 A;  4X65 B;  5EBL C;  3HKB B;  1SZX A;  2H94 A;  2ETN A;  4DV6 O;  3D3I A;  2UUB O;  2HP8 A;  2RJZ A;  2RNB A;  5KX5 A;  3IJ4 A;  1OV9 A;  1UFI A;  1RPO A;  3GVM A;  1VQO V;  1YIJ V;  4GYC B;  1EZJ A;  2P22 C;  3OEH G;  1UJW B;  1B06 A;  4O4I A;  5B1A B;  4LF8 O;  4DV0 B;  3LDC A;  3CCE V;  1CEZ A;  4JYA B;  1Q90 D;  1E1R G;  3CWB H;  4KP4 A;  4TV8 A;  2YIA A;  2PZS A;  2PY5 A;  5LP6 A;  5L3F A;  4DV1 O;  1MOF A;  5CMU A;  2ADP A;  2F4V O;  4GKJ O;  2JS5 A;  3K9S A;  4HNA B;  1NQT A;  1W2B U;  2F95 B;  4MVZ A;  1XDC A;  4TV9 B;  3ZRV A;  2AXT Z;  2Y69 C;  4H44 B;  4I4T B;  4EEQ A;  4Z2W A;  3L70 H;  1XMQ B;  2D2C B;  5KMG B;  2ZE6 A;  1OJH A;  3FYE B;  3AK1 A;  5H6R A;  3ETQ A;  2WA3 A;  3ABL B;  3SPG A;  2PF4 E;  4QE7 A;  2CDY A;  2ZQM A;  1XMO B;  4MTX A;  4FLX A;  3BA9 A;  4BIO A;  2WAM A;  1FXV A;  4FPP A;  2ZE7 A;  3RYC B;  3CP1 A;  3LSQ A;  1KQS U;  2K9P A;  4LF9 O;  1FPO A;  1YZB A;  3G71 V;  4OGQ B;  1OCC B;  3RYI A;  3T1Y O;  1TUB A;  4JI6 O;  3AG2 C;  2H3O A;  1Q81 W;  3RYC A;  4WFB V;  2YDE A;  1YXB A;  1QLE B;  4PA7 A;  4X20 A;  5IWA O;  1VQL V;  2ZIN A;  3AK2 A;  4Z1M G;  2GSM B;  4LFC O;  2BTO A;  4RQE A;  4DV5 O;  2BTQ A;  3LNM B;  1X4T A;  3N2G B;  1MZE A;  2LW7 A;  1HWY A;  4U3J B;  3W7X A;  5DEC A;  1K34 A;  1NJI W;  4K8Z A;  2YID A;  4WFE A;  5J2T B;  2UUC O;  4LFA O;  2PTM A;  3APO A;  3F5W C;  2UXN A;  5IY5 C;  2ZIM A;  1P84 F;  4PD4 F;  4QPJ A;  1NR7 A;  1XL4 A;  2WLJ A;  4YJ3 A;  5GON A;  3OMI B;  2YXY A;  5L3G A;  1BSM A;  2Y0I A;  2OT5 A;  4RUE A;  2Q8V A;  1K33 A;  1ZL8 A;  2OIG A;  1H2G A;  3SPH A;  5LHH A;  2F43 G;  3AK3 A;  3J7A U;  1Q43 A;  1V55 B;  4RO2 A;  4DV2 O;  1G1X B;  3CSX A;  4BAY A;  3OE7 G;  4NXN O;  4DUY O;  1JA8 A;  4X1K A;  4I0X B;  1ZX3 A;  1R3L C;  1F23 A;  1YDX A;  4O4J A;  4OX9 B;  3E2E A;  2ZE5 A;  1AJQ A;  4LF6 O;  1CPY A;  1FFX A;  3DC5 A;  3BRC A;  3U11 A;  2C2A A;  3JAK B;  1YJN V;  1Q5O A;  4J7J A;  1NTK H;  4G28 B;  2NN4 A;  5B66 Z;  2QR4 A;  2P4V A;  1XL6 A;  2CH7 A;  5FPR A;  3C3S A;  1YF2 A; 
#chains in the Genus database with same CATH homology
 3S3W A;  1WP8 A;  2L35 A;  1WP7 A;  2QTS A;  3IJ4 A;  4NTY A;  4NYK A;  3S3X A;  3N27 A;  4FZ0 A;  4NTW A;  4FZ1 A;  4NTX A;  2FB5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...