1WP7A

Crystal structure of nipah virus fusion core
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
76
structure length
64
Chain Sequence
NINKLKSSIESTNEAVVKLQETAEKTVYVLTALQDISSQISSMNQSLQQSKDYIKEAQRLLDTV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal structure of Nipah Virus fusion core
rcsb
source organism Nipah virus
molecule tags Viral protein
molecule keywords fusion protein
total genus 33
structure length 64
sequence length 76
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2004-08-31
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.770 Mainly Alpha Orthogonal Bundle Helix Hairpins YojJ-like 1wp7A00
3N27A 4FZ0A 1WP7A 3S3XA 2QTSA 2FB5A 4NYKA 2L35A 1WP8A 4FZ1A 3IJ4A 4NTXA 4NTYA 4NTWA 3S3WA
chains in the Genus database with same CATH superfamily
2WLLB 1RM1B 3AG4C 1TUEB 2Q8VA 1XNRO 3STLC 3KG2A 3OGIB 3CRRA 2ZR2A 4JAUA 2P22C 2BSKA 1I5XA 2UXDB 3ETQA 2FYUH 4B3SO 2UUAB 3CJHB 4UCOA 3ZHSA 1LR1A 2E75B 1YJ9V 2Q0OC 1H2GA 2Y48A 3ZMSA 1EZVH 1YITV 2UXBO 1JMKC 4O2AA 5FL7G 2NLJC 3I5DA 1XOUA 1XDCA 3AK2A 3JASB 2FB5A 1AR4A 2YICA 3OMIB 2P7TC 1OCOB 3A8TA 4H0LB 4I4TA 4NXMO 1H2NA 1TUBB 2UXCO 4BW5A 3ASOC 4EKWA 2ITCC 3HB3B 2AGAA 1BGYH 1FD9A 1KP2A 1RFYA 4CBCA 3OE7G 4JTAB 1KECA 4LNUA 2UU9O 3MHHC 2JGDB 5B3SC 2FL4A 2PI5A 3S3WA 3T2MA 1Y67A 1V54C 3T1YB 5KUKA 4DR3O 3JAWB 3A0HZ 3E8HA 3DXRB 4JI0B 3W7SA 2EZOA 2PGGA 5L3CA 1R73A 4N23A 4HZ3A 1IBLO 4MVSA 3QTCA 3ABUA 1Q82W 3OR6C 1VF6C 1H2LA 3CC2V 3E22A 1F7YA 1NI8A 1Y76B 1NT2B 3D8CA 1AR1B 1SZTA 1QCEA 4GKJO 3TETA 1H8HG 3UT5B 2PY5A 5LXTB 4DR6B 1R6NA 5LP6A 1R3JC 3ZMVA 4X89A 5LHGA 4MVUA 1SQFA 3BPZA 5EZYA 1VARA 2ARHA 2EJ7A 5D5QA 2Y69B 2ZE5A 3RYIA 5J2UB 4D7SA 5KAIZ 1I94O 1EN4A 5HFMA 4O2AB 2UXXA 5IJ0B 1KU9A 5KMGB 2DMXA 3UKMA 1PD3A 4DUYO 4UV8A 5EBWC 1B04A 4FZ0A 1MZEA 4DR5O 4NTYA 4WF9V 5A9GA 3H1HH 3T1CA 4QIWF 3E86A 4X62B 2MK3A 1I08A 1M1KW 5JVDA 2WA3A 2ADQB 4JF3A 5KHHA 2P67A 4O4JA 4O4LA 1MZFA 3BCCH 5B1AC 1JVMA 2P4VA 3K3WA 3ABMC 3WU2Z 5K1XA 1DK1A 2EULA 4PA7A 3CPWU 3E8FA 5JQGA 3CD6V 1JFFA 2XAHA 1N33B 2RCVA 2EILB 4LR3A 1NJIW 4PA9A 1OZ0A 1K34A 2ZKOA 1AI4A 1PNMA 1SQGA 2UUCO 3DGEA 4TQFA 3O9OA 4GX0A 2GV9A 1QQCA 3B4SA 3OT7A 2F43G 4YJ2A 5BR8O 4JYBA 2A9HA 3D36A 2ILMA 4MVQA 1Z2GA 3E83A 1YIJV 1I0HA 1QLEC 4I9QA 1SQQH 3ASOB 4DV5B 2WLKA 5KHJA 1NR7A 3SYAA 4DR7O 5TISZ 2VWKA 3T1HO 4H33A 4MTOA 1K8AW 1ZX3A 1HNZB 2WLJA 2LW7A 4GZRB 3K03A 1IVSA 4DV5O 3DC6A 3JSLA 1ZSPA 3IC9A 2QWNB 3VOUA 1GN4A 2YXYA 4FLYA 1HNXO 4GX1A 2YXHA 2VQEO 2HHHO 2CH7B 1NH2D 3CRMA 1DTOA 1R1BA 4FLZA 1J5EO 4DR4B 3CCRV 4H37A 3CE2A 1WNSA 1ZL8B 2QM8A 1OCCB 4JI3B 3N27A 1IBKB 1VQMV 2CUGA 3ZCCA 1K73W 2HKOA 2P90A 3CB2A 4FIPC 4LF9O 2IJKA 2VWJA 1RSOA 3W7TA 1D5AA 3EFFK 2EJRA 1WLEA 2AHZA 3QO8A 1SS3A 3I55V 2A06H 4KP4A 3WB2A 1CP9A 3C3SA 3W7XA 2YUAA 5LGNA 4DW0A 5CA0A 3CRQA 4FK5C 4DW1A 2QGNA 3C90A 2E5LO 4JV5O 5LYJB 2OIEA 3A0BZ 3BHPA 4IYHA 2LP7A 1R3LC 3K5LA 4GYCB 4X62O 3LDDA 4U7NA 5H6RA 2P4KA 4J10A 1NU1H 1VMGA 2DN9A 1GKFA 1N32O 3OTOB 4DK1A 3P32A 1B06A 2YI9A 5IWAO 1KYOF 3SYOA 1BCCH 3QO5A 5JCOC 4X1KA 4DUYB 2B1GA 2X0LA 1M93A 4JTDB 3SPGA 3X2QC 1MOFA 1M9NA 3AG4B 5H2FZ 2DW4A 3K5OA 1R6KA 1N36B 5LMNO 3WB1A 2LGQA 4JI8O 3EVKA 1IXBA 5K1PA 4GX2A 5LGUA 3QG5A 4LFCO 2Q5ZA 4N21A 3LSQA 1HP8A 5JVDB 3R65A 2A79B 1Z5VA 1G6UA 3AEIA 2RN9A 3JAMN 1SRYA 1AB3A 3SDLA 2QEXV 4U3FH 1GN2A 3B2EE 3I56V 5B1BC 4DR6O 1D5NA 2XAGA 3HPLC 1KUQA 2DE0X 3CCMV 5J9PC 1P49A 3CMEV 3P3NA 4MTXA 4GKKB 4UVBA 1OCCC 3U10A 1VQ5V 2OCCB 2BE3A 1JR9A 4G2KA 2R70A 2Q73A 1M56C 3TCUA 1QLEB 3CS5A 1H8EG 1KBHA 2JGUA 3ZHTA 1L0LH 3OR7C 4ZBMA 1MABG 2N04A 3RT3C 4IIJB 1K9MW 4TSFG 1XQ8A 4J7JA 2JK5C 1VF5B 1PPJH 3ZN1A 3U0ZA 3ZRWA 3W7UA 4JI2B 1P7GA 4DO2A 4QJFB 2EX3A 3SJQC 3HKBB 5KA6A 1KB9F 2HLDG 1BSMA 3RYHB 3RVZA 4U7OA 5KHGA 1QU7A 1Q6IA 1JFFB 3M7MX 3SJCC 4DRXA 2YIAA 4IGGA 1HR0O 3TXQA 1K5SA 3E2EA 1BZKA 2HP8A 4JI8B 2DJVA 5LMNB 2PI4A 1N36O 4O2BA 2QKSA 4CC6A 1AJNA 3PJSK 4FLUA 2E76B 1N34O 5LGTA 4NKGB 5LP6C 4DV3O 1PP9H 1VEWA 2EIKC 4WCEV 4MW8A 4AQYB 5IWAB 2KG7A 3IGAC 1AI5A 1NVPB 2CH7A 2IW5A 3QVNA 1XILA 1YZBA 1WP7A 1WPBA 2A3QA 5DN6G 2ZQMA 2H3OA 3WB0A 2Y0PA 2YI8A 4X20B 4JV5B 2GHYA 1Y76A 3CEIA 1AP6A 5BMVA 1D2DA 2GUZB 2Z3YA 4CH5A 4PELA 1FXHA 4CH4A 1J5EB 3THOA 1JPXA 4C7UA 3UQ8A 3OFNG 3JALA 3OD4A 1FFXA 1M4UA 5IYCO 5B3SB 2WLLA 4J41A 4PDLA 4HBNA 1K97A 2Y0IA 5IY5C 4DUZO 3RYCB 2LGWA 4B3MB 3SPCA 2HHHB 2VQEB 3T1HB 2B5UA 2YEVB 4IYIA 1I5YA 1YJNV 3KKYA 5LOVB 5EC1C 3CWBH 3ABLC 4ICGA 3AG2B 2JS3A 5A2QN 2IJJA 2ZIMA 2ETNA 4RQFA 2XAJA 2LW1A 2Y4UA 1IBMB 5BR8B 3OMNB 5IDJA 3LNMB 2EIMB 4ZOLB 2WAMA 1SQVH 2Q67A 1SQBH 4I0XB 4FM2A 4CS2A 1WAZA 4TT3G 1WA8A 1CEZA 1NTKH 4FJCC 4JZGA 1YHQV 4F6EA 3ZHVA 4P30A 2ADPA 2KG7B 4FLXA 2EIMC 1FKAO 2ZXWB 1Y4MA 4LF6O 1CXZB 1R3IC 4WFAV 1JJ2U 3FB5C 1H38A 2JGDA 2YSUB 4JGSA 3OGCC 2DYSC 4LH6A 4BWAA 1YVWA 4F6RA 2ZXWC 3RW0A 1N0JA 1DF5A 2PYLA 4RAIA 3K5MA 3GVMA 4PHZA 4Z1MG 4WFFA 2E5LB 3QF7A 1F51A 4FM1A 4NXNB 3K08A 1S5JA 4YY3O 2XTAA 4JYYA 1GH6A 2DYRC 2B1IA 3VQWA 1VQ8V 2EIKB 1GRJA 4JI3O 1WJZA 5LBQA 5LP6B 4AILC 4F4LA 2OCHA 3TXSA 4OX9O 2GSMB 3JCZA 4LCUC 2WLIA 1N8RW 1Q81W 2AHYA 1WN7A 2QR4A 1Q3EA 3BA8A 4DK0A 1E79G 4BW9A 1HNXB 1YSCA 1MSDA 1O9GA 5J2UA 3SYCA 4B08A 3ZN0A 3CCSV 1NBMG 4JI1O 1I94B 3KZIZ 1IURA 5L3GA 4LF7B 3ZRSA 3AG3C 2W6IG 3VQYA 4YXWG 2F1MA 2WLHA 3ASNC 4D7TA 3A0RA 4DR7B 1S0VA 5KHKA 2CTWA 1NQTA 1YEWA 3RYCA 3JYCA 1S5LZ 2F93B 4CS3A 1IBLB 3O65A 2GDSA 1M57B 3K5NA 2EIJC 3FAVA 4G27B 1WPXA 1KMIZ 2QE7G 3ZRVA 4B3RB 4O4IA 2V7QG 1URFA 1HNWB 2R9RB 1K4DC 5JH7A 3JSNA 5KLVH 1TUBA 1M90W 5EK0A 3RFRA 2UUCB 4TV8A 2UU9B 1EBOA 2BTQB 3HKBA 3CC7V 5LL6Y 1XNQB 4LFAB 5CB4B 4JI0O 1NS1A 2BCCH 3K9SA 4K0KB 1CPYA 4NXMB 3BA9A 2UUBB 3RYIB 3K58A 4ASUG 4XDJA 2UUBO 2Y4TA 1MSWD 2IBZH 2GUZA 5DM6V 2UXBB 3JATB 1GM8A 2JDIG 3OTFA 1KP3A 3FD9A 2CE4A 4JAVA 2IU3A 3UCSC 3MDSA 1NKDA 4F6RB 4UCTA 1K92A 4B3SB 3DSQA 4PA6A 2CTQA 2UXDO 4PD4F 1U97A 3L9DA 1I7FA 4DV1B 4PI2A 1VQLV 5J2TA 4DV4B 2CTPA 5FNVA 4B3RO 4U3JB 4LC1A 3E8GA 4MTFA 5CA1B 4KXRA 1XUQA 1SC5B 4J9ZB 3JD0A 2OTLV 1AJQA 2ZE8A 1G8MA 3T4ZA 4DR2B 4LF4O 1Y74A 3GWOA 2QWQB 3R66A 5IYDO 1YJWV 5LMUB 3H1KH 1NVPD 2ZM6O 5LOVA 3CXHF 3HR0A 4UVCA 2ZM6B 4KFMA 5F2VO 5LMUO 2XOKG 1JCHA 2RQ6A 3CP1A 4HNAA 4X66B 4DR2O 4LF4B 3FAVB 4YHHB 2YIBA 2LJ2A 5LHIA 1VF7A 1S77D 5CBFA 4RUFA 5GTHZ 1P4RA 4DV7B 1QHTA 4DV4O 2L35A 4B7EA 2H8PC 5L3FA 3TK1A 1Q5OA 4JTCB 4AHCA 4OX9B 1JA8A 4O4LB 4NR1A 2VS0A 4I55A 3G6BA 3SGIA 3X2QB 2FTKA 3APOA 2PZSA 1Q6HA 1W0KG 1AJPA 1QVGU 4B3TB 3OAAG 1K7DA 4TWKA 2NN4A 3K59A 3T1YO 3HKEA 3WG7B 2N05A 2G38A 3JATA 2LFSA 1XHZA 5CMUA 5C8YA 2Z5UA 3AG3B 1K33A 4KL1A 2Z0AA 3KCYA 4TUYB 4LFBO 3WFVA 4NXNO 2DQ0A 2CK3G 1XMQO 2CGNA 5EC2C 2DWDC 2EIJB 3K9AA 4XDLA 2CGOA 3L73H 2BTQA 2LFRA 2KKWA 1WB7A 5CB4A 4LF5B 1OJHA 1G4YB 5CN0A 4K0KO 1HNWO 4X88A 3L70H 1Z5WA 4IT5A 5B5EZ 3CHXA 5H9CA 1FPOA 1QR8A 1Y66A 2X6AA 5KA5A 4UCSA 2O57A 4UB6Z 1GN3A 4J7KA 3L72H 4DRXB 3PN1A 4YJ3B 3APQA 1Q43A 2W6JG 4OGQB 4MTGA 2XUMA 3L75H 4X1IA 3J80N 3SJAC 2WWWA 3F5TA 3BEHA 1K5QA 2WPDG 1IXMA 1BQ0A 1RM1C 2W0FC 5IYZB 3CXCU 3H1IH 2ZINA 4JI7B 4UB8Z 2RMKB 2D3OW 1SQPH 4IHJA 1JQ0A 1QVFU 3J7AU 4MVMA 3F7VC 2IH1C 4WFEA 5BY1A 4UFZA 5IY5B 4DR1B 1XMOO 1VQ9V 1US6A 2QTSA 3SPIA 2OIGA 4DUZB 4JI1B 2ATKC 4JI4B 5CBGA 1UJWB 3ZX6A 2XAQA 4TOIA 2CTRA 3CC4V 1T5EA 5BMVB 3N2GB 1YTFD 3ML0A 2IJHA 4R8CA 1AI7A 4TQDA 5LHHA 4ZI7B 1FXKB 4JASA 4JAAA 4RUEA 3JALB 3J81N 2QWOB 3BRCA 2PUSA 4CS4A 2JS5A 5AG2A 2RJZA 2ZE7A 3ZMTA 4CH6A 3LSUA 2K1EA 1AP5A 3AG1B 2ZDIC 5ITZA 2QA4V 4FPPA 3MD0A 1AVMA 4X20A 2AZ0A 4PV1B 4HAMA 1EM1A 1NTZH 5EYPA 4YIPA 3F5WC 1E1QG 2ZCEA 4QPKA 4QGPA 1N34B 4J9YB 2X7RB 4BAYA 1W59A 3CJHA 4FFBB 3ZRXA 1BHAA 4RQEA 3N2KB 3UT5A 4UVAA 2DYSB 5LA6B 1QBZA 1F23A 1SESA 4O4JB 5IYZA 4LFBB 3RGBA 1FS0G 4DV2B 5C8YB 1VQ7V 1XL4A 4JI2O 5GONA 2R9IA 1IBMO 4ZHQA 4B3TO 1FAFA 2BOCC 1KC8W 4YJ3A 4X64O 5D5PA 4LF8B 3E8BA 4JI5B 4GLXA 2Y69C 1YF2A 5JJNB 1EZJA 3ABKB 4ZI7A 1WP8A 1XL6A 2X6CA 3LNNA 3SYQA 3ZJZA 1P7BA 4DV0O 3AG1C 3FFQA 5JH7B 4GKKO 3SPHA 3HKEB 1NR1A 4J42A 2RDCA 1K3EA 1SA0A 3STZC 2JJ2G 1N4CA 2M7WA 2JEXA 4QNHB 3T4DA 3ETGA 3W7WA 3ZS8C 2DYRB 3B09A 3CCJV 2OT5A 1PM9A 4WBNB 2XASA 1L0NH 1SKVA 5KHIA 4LWSB 3ZMUA 3QO7A 4W4KA 3C3TA 1IZ3A 1RPOA 2QM4A 4PI0A 1RP3B 1PV0A 4Z2WA 1PNKA 4D6TH 3CMAV 2CDYA 4AQYO 4X1YA 4DV1O 1M57C 3HKDB 4FLVA 1Q8IA 3TGUH 2JEUA 3AG7A 1WB8A 1YTFB 3OTOO 2YIBD 3JCUZ 1QNMA 1YDXA 1OCOC 1VQKV 5LA6A 2ODMA 1KKCA 2YC0A 3QNEA 1FXKC 5L3DA 5IE9A 1OHHG 3CX5F 4PDVA 2RNBA 3K79A 4I50A 1GO3F 1BT8A 1PL4A 3Q4HB 1UPGA 1AI6A 4O4IB 3D3QA 3B40A 4IL6Z 5B1OA 2K9PA 3BVOA 4MVOA 1FXVA 2MW2B 4HYOA 5LYJA 5IYBO 4JZ2A 4QE7A 2A7WA 2JJ1G 3D3IA 4X8AA 2AXTZ 3IJ4A 4W4LA 4LFAO 2HG5C 2Q7GA 4CC5A 1V9PA 3UO3A 3CCUV 1Q6UA 4NVPA 4IIJA 2YIDA 3VQXA 4X65B 2WLMA 5ITZB 2WA4A 2Q68A 4H44B 1BQZA 3JARB 3KCXA 3K06A 1FXKA 2D2CB 4Z1VA 4QE9A 2DWEC 2HFEC 4FFBA 4DYLA 3ZBHA 1KD1W 2XT9A 2F23A 1ZAUA 2Q6AA 2QJ1A 4ZIBA 3OMAB 4LFCB 3NR7A 4I9WA 4BR6A 1XHXA 2EINC 4UCRA 4FLWA 4J11A 4JYCA 5L3EA 1OV9A 1BMFG 4KHPO 4RWUA 3RBZA 1XEQA 2XNDG 1X59A 5L3BA 1N0NA 4R50A 1B6QA 3N2GA 2L6LA 2HEPA 2W0XA 2FKXA 1AROP 4DV6B 4X1KB 1IX9A 3M99B 3B77A 3BABA 1YCIA 4MVZA 1V55C 4PA4A 3RVYA 1PKXA 3H1LH 2QM7A 3IC7A 2BOBC 4BIOA 1FFTB 1LNQA 1N32B 2OTJV 1VQNV 4P9PA 5B1AB 3DC5A 5H5NA 3JAKA 1DGSA 4EFBA 2Q9LA 1R3KC 3HKDA 4U3JA 2Q0AA 1NTMH 5B66Z 4LF9B 1LUVA 1E1RG 4UCVA 4WBNA 1THZA 2ZD9A 1AR5A 4DV6O 4E4EA 2VQFO 4RO2A 2KB1A 4DR4O 4MS2A 3E35A 2IU0A 5FLXN 4OPHA 4NTXA 1XREA 1VQ6V 3EXAA 2C2AA 1COWG 4FM0A 2AZ2A 5B1NA 2WLNA 4LBEC 5EIBD 5J2TB 2UXNA 3HKCB 4MW3A 1XMOB 4O4HA 2JVDA 3ZRWB 5BZBA 3FKSG 3IFXA 3IAYA 1S5HC 3B8MA 3JD2A 1TAEA 4Q6GA 3DXRA 3P3PA 5E79Z 4BIUA 3M8AA 3JAWA 1KKDA 4JI7O 5DECA 2P06A 2VRZA 3DTUB 4KUMA 2GBOA 1ZWIC 2PTMA 1A32A 1PL0A 1JX9A 4J80A 2GTSA 4B3MO 4FMTA 1R6TA 4X65O 3SPJA 3K0GA 3OEHG 4QPJA 4CZZA 1EN5A 2ZIOA 1YXBA 3S3XA 1SA0B 2P5OA 2AW9A 3JAKB 4E2LA 4K3AA 2VQFB 5IJ9A 1OCZC 3P30A 4DR3B 5IT9N 2YXLA 4I50B 2YEVA 3AK3A 1S3JA 1EN6A 3H9VA 3CCVV 1G1XB 3A2FA 1DF4A 1W2BU 2LQTA 1TGOA 3OUSA 1GK9A 1TVKA 2B9ZA 2UXCB 1ZL8A 1Q90D 1N33O 3GWKC 4PDMA 1H2SB 3G80A 4TUYA 2JIZG 3G67A 2DQ3A 2V4DA 4K8ZA 4K8XA 1LUWA 1YI2V 3H1JH 1VIBA 2ITDC 1H2MA 5C93A 2WLIB 2IJIA 1ZTEA 3ZHRA 2DOSA 4ZHQB 4LP8A 4H13B 4DV3B 2HJFC 2QKAA 1O9HA 1P84F 1QR9A 2LO1A 2UUAO 3FYEB 4O2BB 3JARA 4DR5B 4CH3A 3RYFA 1HR0B 1SQXH 2EINB 2ZNJA 1PNLA 2QWRB 5KUMA 1Q7YW 3FX7A 2JRIA 4KHPB 4BIZA 5KMGA 1JOYA 1BS3A 3G71V 3NXSA 1SZXA 5EYPB 3K0DA 4I0XA 4PJ0Z 3AG2C 4UCUA 2N74A 5FPRA 3ETDA 1B3QA 4P9OA 2CAZC 2NNUA 4OPAA 3LSSA 3HKCA 2XAFA 2GTAA 4I7ZB 4NYKA 4OXSA 1NZ6A 4DXWA 4FLTA 2M6YA 2NR5A 1DLBA 2BTOA 1F4NA 1K4CC 3K04A 4DV0B 1KQSU 2Q7EA 5JQGB 1SF9A 1RSOB 4AI8A 2BSKB 3CCEV 5FPOA 2F4VO 4GCZA 4LH7A 2EILC 4PA3A 4LF8O 1TVKB 1ZLZA 4X64B 2KSDA 4Q20A 2HR3A 4MT8A 5B1BB 5KX5A 4O4HB 5JCOA 5JWPA 5EZYB 1XBLA 5EBLC 4WFBV 3BAAA 4EEQA 3ABKC 1JJOA 1GTOA 4DV2O 5CA3A 3G4SV 5JJEB 4I4TB 2R9AA 4EFEA 3EHBB 2OYQA 1FJGB 4GX5A 2QKCA 3RN4A 2F66C 5CBHA 1UFIA 3ZHQA 1OCZB 3OM3B 2X6BA 3JD1A 2V1DA 3UO2A 4EB6B 3VBBA 1XNQO 2XHBA 1MG1A 3L74H 3ZEDA 2ZNIA 3RYHA 2QTOA 1GM7A 3LUTB 4NB5A 2IH3C 3LDEA 1WA8B 2WSSG 5JJJB 3SJBC 4PDRA 1XNRB 3FYIB 3G6EV 1ENVA 3SR2C 2R72A 2ZE6A 5HFLA 5BXZA 3ETEA 4J7ZA 1HW7A 1EFRG 3B8NA 4L87A 2ZDIA 3ASNB 3WG7C 4GUNA 3CYOA 1OCRC 1Y6XA 2H94A 5GW7A 1GM9A 2EBOA 4ABMA 4LF7O 3OEEG 3CRAA 3L71H 4JI4O 4I55B 4YIOA 1IBKO 2A0LA 4MVRA 1RPRA 1OCRB 5KAFZ 2HVKC 2E3CA 3FB6C 1ROPA 5CA0B 3N2KA 1GN6A 2QSAA 4P2ZA 4R6ZA 2F95B 3ZMZA 2HVJC 4UXNA 4TV9A 3JD4A 4JI5O 4TV8B 4ZKIA 3E89A 5CA1A 1GAXA 3TJTA 1VP7A 5IJ9B 4WFHA 4DR1O 5H6QA 1HNZO 3RYFB 3E22B 3U11A 2PF4E 4UUJC 4UV9A 5E1AC 4R7CA 1U96A 4FVMA 3ABTA 3ZIAG 3CSXA 2Q69A 2KQXA 1Y74B 1VF6A 4JI6O 5DEDA 4YY3B 1BE3H 1BHBA 1H2KA 4JYAO 3CCQV 4G28B 2OCCC 1VQ4V 1NH2B 3FB7C 1MA1A 3BY6A 1ZUQA 1X4TA 3OUFA 4HNAB 2P6JA 1S72V 1W0JG 3Q4HA 1HDJA 3CRCA 4L8JA 1MNGA 3FB8C 1V54B 2ZT9B 5IJ0A 5GTIZ 2OWOA 1GMGA 2EZPA 4X1YB 4LNUB 1M56B 4LF6B 2YS8A 1FFXB 3ICXA 3LDCA 4A5UB 1XMQB 5GONB 1V55B 1FJGO 4JPRA 4JYAB 4WFGA 4LF5O 1XI1A 4IHJB 4LWSA 2Q4PA 4JI6B 3JASA 1FYJA 1ORQC 5EBMC 3JD3A 4YJ2B 3ABMB 4EB6A 1VQPV 4NTWA 3ABLB 1VQOV 2QWPB 4FFKA 3OW2U 1L1FA 4XDKA 3K57A 3VQVA 4TV9B 3UM7A 2FMLA 1SETA 2F4VB 1M5IA 5LXTA 2PYJA 3H01A 3SYPA 4MSWC 3F7YC 3MHSC 1Q86W 1SERA 4GT1A 1BL8A 4I5SA 4K35A 3ZHUA 2E74B 4YHHO 3GB7C 1QLNA 2Q7HA 2ZR3A 4B7KA 3MAQA 3RWRD 5EIBC 1F4MA 1J95A 2IM9A 1AILA 3AK1A 4XBFA 4DV7O 4FZ1A 1S76D 1IDSA 1L8DA 4X9QA 2QDOA 5FNVB 5KX5B 2YDEA 1TA8A 1MMMA 1HWYA 3BFRA 4X1IB 4GKJB 4X66O 4ZOLA 3D36C 3CCLV 2HJDA
chains in the Genus database with same CATH topology
3N27A 4FZ0A 1WP7A 3S3XA 2QTSA 2FB5A 4NYKA 2L35A 1WP8A 4FZ1A 3IJ4A 4NTXA 4NTYA 4NTWA 3S3WA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3N27 A;  4FZ0 A;  1WP7 A;  3S3X A;  2QTS A;  2FB5 A;  4NYK A;  2L35 A;  1WP8 A;  4FZ1 A;  3IJ4 A;  4NTX A;  4NTY A;  4NTW A;  3S3W A; 
#chains in the Genus database with same CATH topology
 2WLL B;  1RM1 B;  3AG4 C;  1TUE B;  2Q8V A;  1XNR O;  3STL C;  3KG2 A;  3OGI B;  3CRR A;  2ZR2 A;  4JAU A;  2P22 C;  2BSK A;  1I5X A;  2UXD B;  3ETQ A;  2FYU H;  4B3S O;  2UUA B;  3CJH B;  4UCO A;  3ZHS A;  1LR1 A;  2E75 B;  1YJ9 V;  2Q0O C;  1H2G A;  2Y48 A;  3ZMS A;  1EZV H;  1YIT V;  2UXB O;  1JMK C;  4O2A A;  5FL7 G;  2NLJ C;  3I5D A;  1XOU A;  1XDC A;  3AK2 A;  3JAS B;  2FB5 A;  1AR4 A;  2YIC A;  3OMI B;  2P7T C;  1OCO B;  3A8T A;  4H0L B;  4I4T A;  4NXM O;  1H2N A;  1TUB B;  2UXC O;  4BW5 A;  3ASO C;  4EKW A;  2ITC C;  3HB3 B;  2AGA A;  1BGY H;  1FD9 A;  1KP2 A;  1RFY A;  4CBC A;  3OE7 G;  4JTA B;  1KEC A;  4LNU A;  2UU9 O;  3MHH C;  2JGD B;  5B3S C;  2FL4 A;  2PI5 A;  3S3W A;  3T2M A;  1Y67 A;  1V54 C;  3T1Y B;  5KUK A;  4DR3 O;  3JAW B;  3A0H Z;  3E8H A;  3DXR B;  4JI0 B;  3W7S A;  2EZO A;  2PGG A;  5L3C A;  1R73 A;  4N23 A;  4HZ3 A;  1IBL O;  4MVS A;  3QTC A;  3ABU A;  1Q82 W;  3OR6 C;  1VF6 C;  1H2L A;  3CC2 V;  3E22 A;  1F7Y A;  1NI8 A;  1Y76 B;  1NT2 B;  3D8C A;  1AR1 B;  1SZT A;  1QCE A;  4GKJ O;  3TET A;  1H8H G;  3UT5 B;  2PY5 A;  5LXT B;  4DR6 B;  1R6N A;  5LP6 A;  1R3J C;  3ZMV A;  4X89 A;  5LHG A;  4MVU A;  1SQF A;  3BPZ A;  5EZY A;  1VAR A;  2ARH A;  2EJ7 A;  5D5Q A;  2Y69 B;  2ZE5 A;  3RYI A;  5J2U B;  4D7S A;  5KAI Z;  1I94 O;  1EN4 A;  5HFM A;  4O2A B;  2UXX A;  5IJ0 B;  1KU9 A;  5KMG B;  2DMX A;  3UKM A;  1PD3 A;  4DUY O;  4UV8 A;  5EBW C;  1B04 A;  4FZ0 A;  1MZE A;  4DR5 O;  4NTY A;  4WF9 V;  5A9G A;  3H1H H;  3T1C A;  4QIW F;  3E86 A;  4X62 B;  2MK3 A;  1I08 A;  1M1K W;  5JVD A;  2WA3 A;  2ADQ B;  4JF3 A;  5KHH A;  2P67 A;  4O4J A;  4O4L A;  1MZF A;  3BCC H;  5B1A C;  1JVM A;  2P4V A;  3K3W A;  3ABM C;  3WU2 Z;  5K1X A;  1DK1 A;  2EUL A;  4PA7 A;  3CPW U;  3E8F A;  5JQG A;  3CD6 V;  1JFF A;  2XAH A;  1N33 B;  2RCV A;  2EIL B;  4LR3 A;  1NJI W;  4PA9 A;  1OZ0 A;  1K34 A;  2ZKO A;  1AI4 A;  1PNM A;  1SQG A;  2UUC O;  3DGE A;  4TQF A;  3O9O A;  4GX0 A;  2GV9 A;  1QQC A;  3B4S A;  3OT7 A;  2F43 G;  4YJ2 A;  5BR8 O;  4JYB A;  2A9H A;  3D36 A;  2ILM A;  4MVQ A;  1Z2G A;  3E83 A;  1YIJ V;  1I0H A;  1QLE C;  4I9Q A;  1SQQ H;  3ASO B;  4DV5 B;  2WLK A;  5KHJ A;  1NR7 A;  3SYA A;  4DR7 O;  5TIS Z;  2VWK A;  3T1H O;  4H33 A;  4MTO A;  1K8A W;  1ZX3 A;  1HNZ B;  2WLJ A;  2LW7 A;  4GZR B;  3K03 A;  1IVS A;  4DV5 O;  3DC6 A;  3JSL A;  1ZSP A;  3IC9 A;  2QWN B;  3VOU A;  1GN4 A;  2YXY A;  4FLY A;  1HNX O;  4GX1 A;  2YXH A;  2VQE O;  2HHH O;  2CH7 B;  1NH2 D;  3CRM A;  1DTO A;  1R1B A;  4FLZ A;  1J5E O;  4DR4 B;  3CCR V;  4H37 A;  3CE2 A;  1WNS A;  1ZL8 B;  2QM8 A;  1OCC B;  4JI3 B;  3N27 A;  1IBK B;  1VQM V;  2CUG A;  3ZCC A;  1K73 W;  2HKO A;  2P90 A;  3CB2 A;  4FIP C;  4LF9 O;  2IJK A;  2VWJ A;  1RSO A;  3W7T A;  1D5A A;  3EFF K;  2EJR A;  1WLE A;  2AHZ A;  3QO8 A;  1SS3 A;  3I55 V;  2A06 H;  4KP4 A;  3WB2 A;  1CP9 A;  3C3S A;  3W7X A;  2YUA A;  5LGN A;  4DW0 A;  5CA0 A;  3CRQ A;  4FK5 C;  4DW1 A;  2QGN A;  3C90 A;  2E5L O;  4JV5 O;  5LYJ B;  2OIE A;  3A0B Z;  3BHP A;  4IYH A;  2LP7 A;  1R3L C;  3K5L A;  4GYC B;  4X62 O;  3LDD A;  4U7N A;  5H6R A;  2P4K A;  4J10 A;  1NU1 H;  1VMG A;  2DN9 A;  1GKF A;  1N32 O;  3OTO B;  4DK1 A;  3P32 A;  1B06 A;  2YI9 A;  5IWA O;  1KYO F;  3SYO A;  1BCC H;  3QO5 A;  5JCO C;  4X1K A;  4DUY B;  2B1G A;  2X0L A;  1M93 A;  4JTD B;  3SPG A;  3X2Q C;  1MOF A;  1M9N A;  3AG4 B;  5H2F Z;  2DW4 A;  3K5O A;  1R6K A;  1N36 B;  5LMN O;  3WB1 A;  2LGQ A;  4JI8 O;  3EVK A;  1IXB A;  5K1P A;  4GX2 A;  5LGU A;  3QG5 A;  4LFC O;  2Q5Z A;  4N21 A;  3LSQ A;  1HP8 A;  5JVD B;  3R65 A;  2A79 B;  1Z5V A;  1G6U A;  3AEI A;  2RN9 A;  3JAM N;  1SRY A;  1AB3 A;  3SDL A;  2QEX V;  4U3F H;  1GN2 A;  3B2E E;  3I56 V;  5B1B C;  4DR6 O;  1D5N A;  2XAG A;  3HPL C;  1KUQ A;  2DE0 X;  3CCM V;  5J9P C;  1P49 A;  3CME V;  3P3N A;  4MTX A;  4GKK B;  4UVB A;  1OCC C;  3U10 A;  1VQ5 V;  2OCC B;  2BE3 A;  1JR9 A;  4G2K A;  2R70 A;  2Q73 A;  1M56 C;  3TCU A;  1QLE B;  3CS5 A;  1H8E G;  1KBH A;  2JGU A;  3ZHT A;  1L0L H;  3OR7 C;  4ZBM A;  1MAB G;  2N04 A;  3RT3 C;  4IIJ B;  1K9M W;  4TSF G;  1XQ8 A;  4J7J A;  2JK5 C;  1VF5 B;  1PPJ H;  3ZN1 A;  3U0Z A;  3ZRW A;  3W7U A;  4JI2 B;  1P7G A;  4DO2 A;  4QJF B;  2EX3 A;  3SJQ C;  3HKB B;  5KA6 A;  1KB9 F;  2HLD G;  1BSM A;  3RYH B;  3RVZ A;  4U7O A;  5KHG A;  1QU7 A;  1Q6I A;  1JFF B;  3M7M X;  3SJC C;  4DRX A;  2YIA A;  4IGG A;  1HR0 O;  3TXQ A;  1K5S A;  3E2E A;  1BZK A;  2HP8 A;  4JI8 B;  2DJV A;  5LMN B;  2PI4 A;  1N36 O;  4O2B A;  2QKS A;  4CC6 A;  1AJN A;  3PJS K;  4FLU A;  2E76 B;  1N34 O;  5LGT A;  4NKG B;  5LP6 C;  4DV3 O;  1PP9 H;  1VEW A;  2EIK C;  4WCE V;  4MW8 A;  4AQY B;  5IWA B;  2KG7 A;  3IGA C;  1AI5 A;  1NVP B;  2CH7 A;  2IW5 A;  3QVN A;  1XIL A;  1YZB A;  1WP7 A;  1WPB A;  2A3Q A;  5DN6 G;  2ZQM A;  2H3O A;  3WB0 A;  2Y0P A;  2YI8 A;  4X20 B;  4JV5 B;  2GHY A;  1Y76 A;  3CEI A;  1AP6 A;  5BMV A;  1D2D A;  2GUZ B;  2Z3Y A;  4CH5 A;  4PEL A;  1FXH A;  4CH4 A;  1J5E B;  3THO A;  1JPX A;  4C7U A;  3UQ8 A;  3OFN G;  3JAL A;  3OD4 A;  1FFX A;  1M4U A;  5IYC O;  5B3S B;  2WLL A;  4J41 A;  4PDL A;  4HBN A;  1K97 A;  2Y0I A;  5IY5 C;  4DUZ O;  3RYC B;  2LGW A;  4B3M B;  3SPC A;  2HHH B;  2VQE B;  3T1H B;  2B5U A;  2YEV B;  4IYI A;  1I5Y A;  1YJN V;  3KKY A;  5LOV B;  5EC1 C;  3CWB H;  3ABL C;  4ICG A;  3AG2 B;  2JS3 A;  5A2Q N;  2IJJ A;  2ZIM A;  2ETN A;  4RQF A;  2XAJ A;  2LW1 A;  2Y4U A;  1IBM B;  5BR8 B;  3OMN B;  5IDJ A;  3LNM B;  2EIM B;  4ZOL B;  2WAM A;  1SQV H;  2Q67 A;  1SQB H;  4I0X B;  4FM2 A;  4CS2 A;  1WAZ A;  4TT3 G;  1WA8 A;  1CEZ A;  1NTK H;  4FJC C;  4JZG A;  1YHQ V;  4F6E A;  3ZHV A;  4P30 A;  2ADP A;  2KG7 B;  4FLX A;  2EIM C;  1FKA O;  2ZXW B;  1Y4M A;  4LF6 O;  1CXZ B;  1R3I C;  4WFA V;  1JJ2 U;  3FB5 C;  1H38 A;  2JGD A;  2YSU B;  4JGS A;  3OGC C;  2DYS C;  4LH6 A;  4BWA A;  1YVW A;  4F6R A;  2ZXW C;  3RW0 A;  1N0J A;  1DF5 A;  2PYL A;  4RAI A;  3K5M A;  3GVM A;  4PHZ A;  4Z1M G;  4WFF A;  2E5L B;  3QF7 A;  1F51 A;  4FM1 A;  4NXN B;  3K08 A;  1S5J A;  4YY3 O;  2XTA A;  4JYY A;  1GH6 A;  2DYR C;  2B1I A;  3VQW A;  1VQ8 V;  2EIK B;  1GRJ A;  4JI3 O;  1WJZ A;  5LBQ A;  5LP6 B;  4AIL C;  4F4L A;  2OCH A;  3TXS A;  4OX9 O;  2GSM B;  3JCZ A;  4LCU C;  2WLI A;  1N8R W;  1Q81 W;  2AHY A;  1WN7 A;  2QR4 A;  1Q3E A;  3BA8 A;  4DK0 A;  1E79 G;  4BW9 A;  1HNX B;  1YSC A;  1MSD A;  1O9G A;  5J2U A;  3SYC A;  4B08 A;  3ZN0 A;  3CCS V;  1NBM G;  4JI1 O;  1I94 B;  3KZI Z;  1IUR A;  5L3G A;  4LF7 B;  3ZRS A;  3AG3 C;  2W6I G;  3VQY A;  4YXW G;  2F1M A;  2WLH A;  3ASN C;  4D7T A;  3A0R A;  4DR7 B;  1S0V A;  5KHK A;  2CTW A;  1NQT A;  1YEW A;  3RYC A;  3JYC A;  1S5L Z;  2F93 B;  4CS3 A;  1IBL B;  3O65 A;  2GDS A;  1M57 B;  3K5N A;  2EIJ C;  3FAV A;  4G27 B;  1WPX A;  1KMI Z;  2QE7 G;  3ZRV A;  4B3R B;  4O4I A;  2V7Q G;  1URF A;  1HNW B;  2R9R B;  1K4D C;  5JH7 A;  3JSN A;  5KLV H;  1TUB A;  1M90 W;  5EK0 A;  3RFR A;  2UUC B;  4TV8 A;  2UU9 B;  1EBO A;  2BTQ B;  3HKB A;  3CC7 V;  5LL6 Y;  1XNQ B;  4LFA B;  5CB4 B;  4JI0 O;  1NS1 A;  2BCC H;  3K9S A;  4K0K B;  1CPY A;  4NXM B;  3BA9 A;  2UUB B;  3RYI B;  3K58 A;  4ASU G;  4XDJ A;  2UUB O;  2Y4T A;  1MSW D;  2IBZ H;  2GUZ A;  5DM6 V;  2UXB B;  3JAT B;  1GM8 A;  2JDI G;  3OTF A;  1KP3 A;  3FD9 A;  2CE4 A;  4JAV A;  2IU3 A;  3UCS C;  3MDS A;  1NKD A;  4F6R B;  4UCT A;  1K92 A;  4B3S B;  3DSQ A;  4PA6 A;  2CTQ A;  2UXD O;  4PD4 F;  1U97 A;  3L9D A;  1I7F A;  4DV1 B;  4PI2 A;  1VQL V;  5J2T A;  4DV4 B;  2CTP A;  5FNV A;  4B3R O;  4U3J B;  4LC1 A;  3E8G A;  4MTF A;  5CA1 B;  4KXR A;  1XUQ A;  1SC5 B;  4J9Z B;  3JD0 A;  2OTL V;  1AJQ A;  2ZE8 A;  1G8M A;  3T4Z A;  4DR2 B;  4LF4 O;  1Y74 A;  3GWO A;  2QWQ B;  3R66 A;  5IYD O;  1YJW V;  5LMU B;  3H1K H;  1NVP D;  2ZM6 O;  5LOV A;  3CXH F;  3HR0 A;  4UVC A;  2ZM6 B;  4KFM A;  5F2V O;  5LMU O;  2XOK G;  1JCH A;  2RQ6 A;  3CP1 A;  4HNA A;  4X66 B;  4DR2 O;  4LF4 B;  3FAV B;  4YHH B;  2YIB A;  2LJ2 A;  5LHI A;  1VF7 A;  1S77 D;  5CBF A;  4RUF A;  5GTH Z;  1P4R A;  4DV7 B;  1QHT A;  4DV4 O;  2L35 A;  4B7E A;  2H8P C;  5L3F A;  3TK1 A;  1Q5O A;  4JTC B;  4AHC A;  4OX9 B;  1JA8 A;  4O4L B;  4NR1 A;  2VS0 A;  4I55 A;  3G6B A;  3SGI A;  3X2Q B;  2FTK A;  3APO A;  2PZS A;  1Q6H A;  1W0K G;  1AJP A;  1QVG U;  4B3T B;  3OAA G;  1K7D A;  4TWK A;  2NN4 A;  3K59 A;  3T1Y O;  3HKE A;  3WG7 B;  2N05 A;  2G38 A;  3JAT A;  2LFS A;  1XHZ A;  5CMU A;  5C8Y A;  2Z5U A;  3AG3 B;  1K33 A;  4KL1 A;  2Z0A A;  3KCY A;  4TUY B;  4LFB O;  3WFV A;  4NXN O;  2DQ0 A;  2CK3 G;  1XMQ O;  2CGN A;  5EC2 C;  2DWD C;  2EIJ B;  3K9A A;  4XDL A;  2CGO A;  3L73 H;  2BTQ A;  2LFR A;  2KKW A;  1WB7 A;  5CB4 A;  4LF5 B;  1OJH A;  1G4Y B;  5CN0 A;  4K0K O;  1HNW O;  4X88 A;  3L70 H;  1Z5W A;  4IT5 A;  5B5E Z;  3CHX A;  5H9C A;  1FPO A;  1QR8 A;  1Y66 A;  2X6A A;  5KA5 A;  4UCS A;  2O57 A;  4UB6 Z;  1GN3 A;  4J7K A;  3L72 H;  4DRX B;  3PN1 A;  4YJ3 B;  3APQ A;  1Q43 A;  2W6J G;  4OGQ B;  4MTG A;  2XUM A;  3L75 H;  4X1I A;  3J80 N;  3SJA C;  2WWW A;  3F5T A;  3BEH A;  1K5Q A;  2WPD G;  1IXM A;  1BQ0 A;  1RM1 C;  2W0F C;  5IYZ B;  3CXC U;  3H1I H;  2ZIN A;  4JI7 B;  4UB8 Z;  2RMK B;  2D3O W;  1SQP H;  4IHJ A;  1JQ0 A;  1QVF U;  3J7A U;  4MVM A;  3F7V C;  2IH1 C;  4WFE A;  5BY1 A;  4UFZ A;  5IY5 B;  4DR1 B;  1XMO O;  1VQ9 V;  1US6 A;  2QTS A;  3SPI A;  2OIG A;  4DUZ B;  4JI1 B;  2ATK C;  4JI4 B;  5CBG A;  1UJW B;  3ZX6 A;  2XAQ A;  4TOI A;  2CTR A;  3CC4 V;  1T5E A;  5BMV B;  3N2G B;  1YTF D;  3ML0 A;  2IJH A;  4R8C A;  1AI7 A;  4TQD A;  5LHH A;  4ZI7 B;  1FXK B;  4JAS A;  4JAA A;  4RUE A;  3JAL B;  3J81 N;  2QWO B;  3BRC A;  2PUS A;  4CS4 A;  2JS5 A;  5AG2 A;  2RJZ A;  2ZE7 A;  3ZMT A;  4CH6 A;  3LSU A;  2K1E A;  1AP5 A;  3AG1 B;  2ZDI C;  5ITZ A;  2QA4 V;  4FPP A;  3MD0 A;  1AVM A;  4X20 A;  2AZ0 A;  4PV1 B;  4HAM A;  1EM1 A;  1NTZ H;  5EYP A;  4YIP A;  3F5W C;  1E1Q G;  2ZCE A;  4QPK A;  4QGP A;  1N34 B;  4J9Y B;  2X7R B;  4BAY A;  1W59 A;  3CJH A;  4FFB B;  3ZRX A;  1BHA A;  4RQE A;  3N2K B;  3UT5 A;  4UVA A;  2DYS B;  5LA6 B;  1QBZ A;  1F23 A;  1SES A;  4O4J B;  5IYZ A;  4LFB B;  3RGB A;  1FS0 G;  4DV2 B;  5C8Y B;  1VQ7 V;  1XL4 A;  4JI2 O;  5GON A;  2R9I A;  1IBM O;  4ZHQ A;  4B3T O;  1FAF A;  2BOC C;  1KC8 W;  4YJ3 A;  4X64 O;  5D5P A;  4LF8 B;  3E8B A;  4JI5 B;  4GLX A;  2Y69 C;  1YF2 A;  5JJN B;  1EZJ A;  3ABK B;  4ZI7 A;  1WP8 A;  1XL6 A;  2X6C A;  3LNN A;  3SYQ A;  3ZJZ A;  1P7B A;  4DV0 O;  3AG1 C;  3FFQ A;  5JH7 B;  4GKK O;  3SPH A;  3HKE B;  1NR1 A;  4J42 A;  2RDC A;  1K3E A;  1SA0 A;  3STZ C;  2JJ2 G;  1N4C A;  2M7W A;  2JEX A;  4QNH B;  3T4D A;  3ETG A;  3W7W A;  3ZS8 C;  2DYR B;  3B09 A;  3CCJ V;  2OT5 A;  1PM9 A;  4WBN B;  2XAS A;  1L0N H;  1SKV A;  5KHI A;  4LWS B;  3ZMU A;  3QO7 A;  4W4K A;  3C3T A;  1IZ3 A;  1RPO A;  2QM4 A;  4PI0 A;  1RP3 B;  1PV0 A;  4Z2W A;  1PNK A;  4D6T H;  3CMA V;  2CDY A;  4AQY O;  4X1Y A;  4DV1 O;  1M57 C;  3HKD B;  4FLV A;  1Q8I A;  3TGU H;  2JEU A;  3AG7 A;  1WB8 A;  1YTF B;  3OTO O;  2YIB D;  3JCU Z;  1QNM A;  1YDX A;  1OCO C;  1VQK V;  5LA6 A;  2ODM A;  1KKC A;  2YC0 A;  3QNE A;  1FXK C;  5L3D A;  5IE9 A;  1OHH G;  3CX5 F;  4PDV A;  2RNB A;  3K79 A;  4I50 A;  1GO3 F;  1BT8 A;  1PL4 A;  3Q4H B;  1UPG A;  1AI6 A;  4O4I B;  3D3Q A;  3B40 A;  4IL6 Z;  5B1O A;  2K9P A;  3BVO A;  4MVO A;  1FXV A;  2MW2 B;  4HYO A;  5LYJ A;  5IYB O;  4JZ2 A;  4QE7 A;  2A7W A;  2JJ1 G;  3D3I A;  4X8A A;  2AXT Z;  3IJ4 A;  4W4L A;  4LFA O;  2HG5 C;  2Q7G A;  4CC5 A;  1V9P A;  3UO3 A;  3CCU V;  1Q6U A;  4NVP A;  4IIJ A;  2YID A;  3VQX A;  4X65 B;  2WLM A;  5ITZ B;  2WA4 A;  2Q68 A;  4H44 B;  1BQZ A;  3JAR B;  3KCX A;  3K06 A;  1FXK A;  2D2C B;  4Z1V A;  4QE9 A;  2DWE C;  2HFE C;  4FFB A;  4DYL A;  3ZBH A;  1KD1 W;  2XT9 A;  2F23 A;  1ZAU A;  2Q6A A;  2QJ1 A;  4ZIB A;  3OMA B;  4LFC B;  3NR7 A;  4I9W A;  4BR6 A;  1XHX A;  2EIN C;  4UCR A;  4FLW A;  4J11 A;  4JYC A;  5L3E A;  1OV9 A;  1BMF G;  4KHP O;  4RWU A;  3RBZ A;  1XEQ A;  2XND G;  1X59 A;  5L3B A;  1N0N A;  4R50 A;  1B6Q A;  3N2G A;  2L6L A;  2HEP A;  2W0X A;  2FKX A;  1ARO P;  4DV6 B;  4X1K B;  1IX9 A;  3M99 B;  3B77 A;  3BAB A;  1YCI A;  4MVZ A;  1V55 C;  4PA4 A;  3RVY A;  1PKX A;  3H1L H;  2QM7 A;  3IC7 A;  2BOB C;  4BIO A;  1FFT B;  1LNQ A;  1N32 B;  2OTJ V;  1VQN V;  4P9P A;  5B1A B;  3DC5 A;  5H5N A;  3JAK A;  1DGS A;  4EFB A;  2Q9L A;  1R3K C;  3HKD A;  4U3J A;  2Q0A A;  1NTM H;  5B66 Z;  4LF9 B;  1LUV A;  1E1R G;  4UCV A;  4WBN A;  1THZ A;  2ZD9 A;  1AR5 A;  4DV6 O;  4E4E A;  2VQF O;  4RO2 A;  2KB1 A;  4DR4 O;  4MS2 A;  3E35 A;  2IU0 A;  5FLX N;  4OPH A;  4NTX A;  1XRE A;  1VQ6 V;  3EXA A;  2C2A A;  1COW G;  4FM0 A;  2AZ2 A;  5B1N A;  2WLN A;  4LBE C;  5EIB D;  5J2T B;  2UXN A;  3HKC B;  4MW3 A;  1XMO B;  4O4H A;  2JVD A;  3ZRW B;  5BZB A;  3FKS G;  3IFX A;  3IAY A;  1S5H C;  3B8M A;  3JD2 A;  1TAE A;  4Q6G A;  3DXR A;  3P3P A;  5E79 Z;  4BIU A;  3M8A A;  3JAW A;  1KKD A;  4JI7 O;  5DEC A;  2P06 A;  2VRZ A;  3DTU B;  4KUM A;  2GBO A;  1ZWI C;  2PTM A;  1A32 A;  1PL0 A;  1JX9 A;  4J80 A;  2GTS A;  4B3M O;  4FMT A;  1R6T A;  4X65 O;  3SPJ A;  3K0G A;  3OEH G;  4QPJ A;  4CZZ A;  1EN5 A;  2ZIO A;  1YXB A;  3S3X A;  1SA0 B;  2P5O A;  2AW9 A;  3JAK B;  4E2L A;  4K3A A;  2VQF B;  5IJ9 A;  1OCZ C;  3P30 A;  4DR3 B;  5IT9 N;  2YXL A;  4I50 B;  2YEV A;  3AK3 A;  1S3J A;  1EN6 A;  3H9V A;  3CCV V;  1G1X B;  3A2F A;  1DF4 A;  1W2B U;  2LQT A;  1TGO A;  3OUS A;  1GK9 A;  1TVK A;  2B9Z A;  2UXC B;  1ZL8 A;  1Q90 D;  1N33 O;  3GWK C;  4PDM A;  1H2S B;  3G80 A;  4TUY A;  2JIZ G;  3G67 A;  2DQ3 A;  2V4D A;  4K8Z A;  4K8X A;  1LUW A;  1YI2 V;  3H1J H;  1VIB A;  2ITD C;  1H2M A;  5C93 A;  2WLI B;  2IJI A;  1ZTE A;  3ZHR A;  2DOS A;  4ZHQ B;  4LP8 A;  4H13 B;  4DV3 B;  2HJF C;  2QKA A;  1O9H A;  1P84 F;  1QR9 A;  2LO1 A;  2UUA O;  3FYE B;  4O2B B;  3JAR A;  4DR5 B;  4CH3 A;  3RYF A;  1HR0 B;  1SQX H;  2EIN B;  2ZNJ A;  1PNL A;  2QWR B;  5KUM A;  1Q7Y W;  3FX7 A;  2JRI A;  4KHP B;  4BIZ A;  5KMG A;  1JOY A;  1BS3 A;  3G71 V;  3NXS A;  1SZX A;  5EYP B;  3K0D A;  4I0X A;  4PJ0 Z;  3AG2 C;  4UCU A;  2N74 A;  5FPR A;  3ETD A;  1B3Q A;  4P9O A;  2CAZ C;  2NNU A;  4OPA A;  3LSS A;  3HKC A;  2XAF A;  2GTA A;  4I7Z B;  4NYK A;  4OXS A;  1NZ6 A;  4DXW A;  4FLT A;  2M6Y A;  2NR5 A;  1DLB A;  2BTO A;  1F4N A;  1K4C C;  3K04 A;  4DV0 B;  1KQS U;  2Q7E A;  5JQG B;  1SF9 A;  1RSO B;  4AI8 A;  2BSK B;  3CCE V;  5FPO A;  2F4V O;  4GCZ A;  4LH7 A;  2EIL C;  4PA3 A;  4LF8 O;  1TVK B;  1ZLZ A;  4X64 B;  2KSD A;  4Q20 A;  2HR3 A;  4MT8 A;  5B1B B;  5KX5 A;  4O4H B;  5JCO A;  5JWP A;  5EZY B;  1XBL A;  5EBL C;  4WFB V;  3BAA A;  4EEQ A;  3ABK C;  1JJO A;  1GTO A;  4DV2 O;  5CA3 A;  3G4S V;  5JJE B;  4I4T B;  2R9A A;  4EFE A;  3EHB B;  2OYQ A;  1FJG B;  4GX5 A;  2QKC A;  3RN4 A;  2F66 C;  5CBH A;  1UFI A;  3ZHQ A;  1OCZ B;  3OM3 B;  2X6B A;  3JD1 A;  2V1D A;  3UO2 A;  4EB6 B;  3VBB A;  1XNQ O;  2XHB A;  1MG1 A;  3L74 H;  3ZED A;  2ZNI A;  3RYH A;  2QTO A;  1GM7 A;  3LUT B;  4NB5 A;  2IH3 C;  3LDE A;  1WA8 B;  2WSS G;  5JJJ B;  3SJB C;  4PDR A;  1XNR B;  3FYI B;  3G6E V;  1ENV A;  3SR2 C;  2R72 A;  2ZE6 A;  5HFL A;  5BXZ A;  3ETE A;  4J7Z A;  1HW7 A;  1EFR G;  3B8N A;  4L87 A;  2ZDI A;  3ASN B;  3WG7 C;  4GUN A;  3CYO A;  1OCR C;  1Y6X A;  2H94 A;  5GW7 A;  1GM9 A;  2EBO A;  4ABM A;  4LF7 O;  3OEE G;  3CRA A;  3L71 H;  4JI4 O;  4I55 B;  4YIO A;  1IBK O;  2A0L A;  4MVR A;  1RPR A;  1OCR B;  5KAF Z;  2HVK C;  2E3C A;  3FB6 C;  1ROP A;  5CA0 B;  3N2K A;  1GN6 A;  2QSA A;  4P2Z A;  4R6Z A;  2F95 B;  3ZMZ A;  2HVJ C;  4UXN A;  4TV9 A;  3JD4 A;  4JI5 O;  4TV8 B;  4ZKI A;  3E89 A;  5CA1 A;  1GAX A;  3TJT A;  1VP7 A;  5IJ9 B;  4WFH A;  4DR1 O;  5H6Q A;  1HNZ O;  3RYF B;  3E22 B;  3U11 A;  2PF4 E;  4UUJ C;  4UV9 A;  5E1A C;  4R7C A;  1U96 A;  4FVM A;  3ABT A;  3ZIA G;  3CSX A;  2Q69 A;  2KQX A;  1Y74 B;  1VF6 A;  4JI6 O;  5DED A;  4YY3 B;  1BE3 H;  1BHB A;  1H2K A;  4JYA O;  3CCQ V;  4G28 B;  2OCC C;  1VQ4 V;  1NH2 B;  3FB7 C;  1MA1 A;  3BY6 A;  1ZUQ A;  1X4T A;  3OUF A;  4HNA B;  2P6J A;  1S72 V;  1W0J G;  3Q4H A;  1HDJ A;  3CRC A;  4L8J A;  1MNG A;  3FB8 C;  1V54 B;  2ZT9 B;  5IJ0 A;  5GTI Z;  2OWO A;  1GMG A;  2EZP A;  4X1Y B;  4LNU B;  1M56 B;  4LF6 B;  2YS8 A;  1FFX B;  3ICX A;  3LDC A;  4A5U B;  1XMQ B;  5GON B;  1V55 B;  1FJG O;  4JPR A;  4JYA B;  4WFG A;  4LF5 O;  1XI1 A;  4IHJ B;  4LWS A;  2Q4P A;  4JI6 B;  3JAS A;  1FYJ A;  1ORQ C;  5EBM C;  3JD3 A;  4YJ2 B;  3ABM B;  4EB6 A;  1VQP V;  4NTW A;  3ABL B;  1VQO V;  2QWP B;  4FFK A;  3OW2 U;  1L1F A;  4XDK A;  3K57 A;  3VQV A;  4TV9 B;  3UM7 A;  2FML A;  1SET A;  2F4V B;  1M5I A;  5LXT A;  2PYJ A;  3H01 A;  3SYP A;  4MSW C;  3F7Y C;  3MHS C;  1Q86 W;  1SER A;  4GT1 A;  1BL8 A;  4I5S A;  4K35 A;  3ZHU A;  2E74 B;  4YHH O;  3GB7 C;  1QLN A;  2Q7H A;  2ZR3 A;  4B7K A;  3MAQ A;  3RWR D;  5EIB C;  1F4M A;  1J95 A;  2IM9 A;  1AIL A;  3AK1 A;  4XBF A;  4DV7 O;  4FZ1 A;  1S76 D;  1IDS A;  1L8D A;  4X9Q A;  2QDO A;  5FNV B;  5KX5 B;  2YDE A;  1TA8 A;  1MMM A;  1HWY A;  3BFR A;  4X1I B;  4GKJ B;  4X66 O;  4ZOL A;  3D36 C;  3CCL V;  2HJD A; 
#chains in the Genus database with same CATH homology
 3N27 A;  4FZ0 A;  1WP7 A;  3S3X A;  2QTS A;  2FB5 A;  4NYK A;  2L35 A;  1WP8 A;  4FZ1 A;  3IJ4 A;  4NTX A;  4NTY A;  4NTW A;  3S3W A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...