1WP7A

Crystal structure of nipah virus fusion core
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
76
structure length
64
Chain Sequence
NINKLKSSIESTNEAVVKLQETAEKTVYVLTALQDISSQISSMNQSLQQSKDYIKEAQRLLDTV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords fusion protein
publication title Crystal structure of Nipah Virus fusion core
rcsb
source organism Nipah virus
molecule tags Viral protein
total genus 33
structure length 64
sequence length 76
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2004-08-31
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.770 Mainly Alpha Orthogonal Bundle Helix Hairpins YojJ-like 1wp7A00
2FB5A 1WP7A 4FZ1A 4NTXA 3N27A 1WP8A 2QTSA 3S3XA 4NTYA 4FZ0A 4NTWA 3IJ4A 2L35A 4NYKA 3S3WA
chains in the Genus database with same CATH superfamily
4O4JA 1BE3H 2HLDG 5IYBO 1FXKA 3FB7C 5LOVB 3WFVA 3ZRSA 1GRJA 2IJHA 4X65B 5ITZA 4F6RA 2QWRB 4HAMA 3E8HA 5JJJB 2H8PC 5FPOA 3TGUH 5CBFA 3HKCB 2BTOA 3SR2C 4JI7O 1VQLV 2XAHA 3GB7C 3RVZA 5KHJA 1K3EA 5FLXN 5J2UB 2PI4A 3R66A 2IH1C 4R6ZA 5LA6A 1P49A 1EFRG 4CS2A 4LWSA 3IC9A 2AHZA 2JGDA 3QF7A 2LFRA 4PA7A 5B66Z 5KAIZ 1HR0B 1FJGB 3G4SV 2ZE7A 4OX9B 4X65O 1VQOV 5B1AC 2AHYA 5LHGA 2RMKB 2F4VB 2XAQA 3IAYA 3PN1A 2GTSA 1EZJA 4H13B 1M5IA 1GK9A 3JD0A 4DR7B 5C8YB 2K1EA 4DR1B 2W0FC 2A06H 5JQGB 1R6TA 1XMQB 4QPKA 2LW1A 5CB4B 3H1LH 3ASOC 3SYAA 2R9AA 2LW7A 3FB6C 2Q7EA 4GLXA 1FFXB 3RT3C 1JR9A 2QKSA 3E8GA 1HR0O 2BTQA 2QM4A 4OX9O 1BSMA 2F4VO 3OR6C 1K5QA 3P30A 4FFKA 4R8CA 1RFYA 1PP9H 1U96A 3ZX6A 4TV9A 1NH2D 1X59A 1YZBA 1N8RW 2JRIA 4DR7O 4I50A 4O2BB 1N0NA 4CC6A 4DR1O 3FAVB 4PA9A 1XMQO 3SDLA 3EXAA 4R50A 3SPHA 3K79A 2WA4A 2Q9LA 3RBZA 2Q0OC 4YXWG 4LC1A 4UCVA 1Z5VA 4DR2B 1T5EA 1AP6A 3W7TA 4OGQB 3WU2Z 3CEIA 1UPGA 3JCUZ 4HNAB 3VOUA 2E5LB 5FPRA 2EIMC 2QM7A 4DW1A 3BHPA 4TUYA 1EN4A 3BA9A 2R70A 3JALB 3ZMVA 3I5DA 3OMIB 1BQ0A 1ZWIC 4DV6B 1NVPB 3ZEDA 4O4HB 3N2KA 1URFA 3CB2A 1QLEB 4DR2O 3K5LA 1H8HG 2JJ2G 5GONB 2GV9A 2E5LO 2ARHA 2ZCEA 1Q81W 1O9HA 1F4MA 3H1HH 3RYCB 2LJ2A 3SPGA 1M56B 3LDDA 1WNSA 4FZ1A 4ZBMA 3W7SA 4YJ2B 4BAYA 3RFRA 4DV6O 2BSKB 4LNUB 5IYZB 2DQ0A 3ABMC 4Z1MG 1VQNV 3K58A 3IC7A 2WLMA 4JYYA 5L3FA 5H6QA 4QNHB 3APQA 3EVKA 3AK2A 1YHQV 3BPZA 1GN2A 1NBMG 4NXMB 4I0XB 2DJVA 4QIWF 4Q6GA 3CHXA 1AI7A 1GN4A 5IY5C 5KMGA 4MW3A 1F7YA 1I0HA 4MVMA 3OMNB 1RM1C 4WFBV 4PDLA 1PKXA 1FD9A 2OTJV 4YJ2A 3L73H 4ICGA 4FLVA 5CBHA 5EZYB 2ODMA 2FKXA 1XOUA 4PDVA 1QNMA 4GT1A 3KCXA 1KP3A 2YIDA 1B3QA 2ZIOA 1YXBA 2DMXA 4B3SB 4LH7A 1X4TA 4GX0A 3ZN0A 4X1IB 3W7UA 4JI5B 1Q8IA 5CA1B 3LUTB 5L3BA 3GWKC 2NLJC 3L70H 4H0LB 4JTAB 5GTHZ 4J7JA 3D36C 1F23A 3JAKA 2WLIB 4BIZA 1GN6A 5F2VO 1UFIA 2EIKB 5K1XA 3M99B 2EJRA 5JWPA 1AI4A 4B3SO 2YEVA 3H1JH 1G4YB 3L75H 4JI5O 1GMGA 4UB8Z 2CDYA 2VQEB 2OYQA 2XUMA 1YEWA 5AG2A 4Z2WA 1XNRB 2PY5A 1QR9A 2X6CA 1JOYA 3RYIA 4WCEV 3E83A 3KCYA 5CA3A 3MHSC 4L87A 2M6YA 1MSDA 1SQXH 2YXHA 4OXSA 2YIBD 3O65A 2WA3A 1OCRC 4A5UB 2DYRB 4N21A 4ZI7B 4JI4B 4GZRB 1KUQA 1KKCA 1YDXA 3K03A 1GO3F 2VQEO 3OGCC 2JEXA 1KBHA 1P7BA 2IJKA 1RSOB 4I55B 3ABLC 1M93A 4IYHA 1M57C 1XNRO 1WPBA 3JASA 4FLZA 3VBBA 2WLNA 4NTWA 3IJ4A 3RWRD 4TOIA 4XDLA 4U3JB 2PYLA 2LGWA 1GM9A 1GTOA 2HFEC 2L35A 1CPYA 4GCZA 3ZHQA 2XTAA 3FYEB 1VF5B 5KHHA 4JI4O 2IW5A 3K5NA 4DK0A 5DM6V 4HZ3A 2WLHA 2GUZA 2CTQA 3A0BZ 4I5SA 1BQZA 4FFBA 1XREA 1YI2V 4KFMA 1XHXA 1FYJA 2QKAA 2ZDIA 2OTLV 3APOA 3AG1B 1MA1A 1QLEC 1RSOA 2V7QG 1N4CA 3ETGA 3AG2C 3J7AU 3X2QB 4I4TA 2EIJB 2QWQB 1JVMA 2YXLA 2AGAA 4GKKB 4LF9B 2JIZG 1TVKB 1N36B 3LDCA 4GX1A 4MW8A 4NR1A 2A0LA 1NZ6A 2Q4PA 4X8AA 3AK1A 3VQYA 4TQFA 2AXTZ 4DO2A 3CC7V 1Y76A 1OCCB 1HNXB 2UXCB 2BCCH 2XNDG 3G80A 4UV8A 3OTFA 2UXBB 2AW9A 1K97A 4Q20A 1VQ7V 3DTUB 5B1BB 3LSSA 4LFAB 1HNWB 2F1MA 4GKKO 4LF9O 1N36O 3R65A 5EIBC 4YJ3A 5H9CA 1NTKH 3M7MX 1Y74B 1G6UA 1KB9F 1KC8W 4GYCB 3JSLA 4JI3B 4AI8A 4QJFB 1Z5WA 3JATB 4DW0A 4FM0A 2OCCB 4RAIA 2EZPA 5KHGA 3DC5A 4GKJB 4UB6Z 3CJHA 5LP6B 4X62B 1TAEA 4DV1B 4KL1A 4O4IB 1HNXO 2UXCO 4B7KA 5LGTA 3D3QA 1WP7A 2H3OA 3I55V 2UXBO 1VQPV 4FM1A 2ZM6B 1HNWO 4LFAO 1PNKA 3OM3B 3KZIZ 3JAWB 1WAZA 3THOA 4J9ZB 3F5WC 1MZEA 1NT2B 4JI3O 2RJZA 3CCVV 2BOCC 4LF5B 1DTOA 4UV9A 2HJFC 2JGUA 1WN7A 4GKJO 5IJ0A 2QDOA 4FLWA 2YIBA 4X62O 1YVWA 4DV1O 4NVPA 4WFGA 4NTXA 4ZOLA 2P4VA 1EM1A 3ZRWA 3N2GA 1G1XB 5BXZA 2YUAA 2RDCA 2ZM6O 3W7XA 1AB3A 4H44B 4IL6Z 1A32A 2RQ6A 4GUNA 2XHBA 4O4JB 2ADPA 1O9GA 4MTFA 1G8MA 1FXKB 4LF5O 2IH3C 3ML0A 3NXSA 5ITZB 2BOBC 2QM8A 3D3IA 1OCZB 4F6RB 2XAGA 4IHJA 2N74A 3SPJA 4MTGA 3ZBHA 4UCTA 1R3KC 2VWJA 3ABKC 3CMAV 4CH6A 5LA6B 2JVDA 1S3JA 2P7TC 4MTOA 1V55B 3SPCA 4LWSB 3U11A 3DSQA 1SQBH 2YC0A 3ZIAG 1SA0A 2R72A 2JGDB 2KQXA 3MAQA 4FM2A 3CCSV 1AI5A 2Q68A 2XOKG 3AG7A 1XL6A 4PA6A 4BWAA 2HG5C 2P90A 4EB6A 2F66C 1IBKB 2Q7HA 3K04A 5CA0A 2W0XA 1Y6XA 2Q5ZA 2PTMA 3FB8C 5DEDA 3SJQC 2LFSA 1AJNA 4LP8A 5LXTA 2HJDA 1SZTA 3UQ8A 1ZTEA 4BR6A 1M4UA 4JI0B 4NTYA 2YICA 4CH3A 3F7YC 1V54C 1VF7A 5DECA 2BTQB 3K9AA 2ZD9A 1H8EG 4OPHA 4YIOA 3BVOA 3OFNG 2HR3A 1IBKO 4N23A 3H1KH 2Z5UA 1OCOB 5FL7G 1KQSU 1S77D 3JD1A 4TV9B 2Q67A 5FNVA 5LHIA 4UVCA 5KA6A 4D6TH 1L0NH 4X1KB 1B06A 2P67A 4H33A 1KYOF 4I50B 2HKOA 1HW7A 4JZ2A 5IDJA 1Q90D 3CCUV 3G6EV 3VQWA 1EZVH 2CK3G 4JV5B 2C2AA 3UM7A 4JI0O 4DR5B 2QSAA 2WPDG 3F7VC 4BW5A 3K5OA 3CRQA 1ORQC 3ZHVA 3CS5A 2EBOA 1H2KA 3LNNA 1BT8A 1SETA 4HBNA 1IZ3A 1LR1A 1FJGO 4LFCB 3UT5A 3CRAA 3RN4A 3BA8A 4TUYB 3E86A 4FLUA 5TISZ 1W59A 3CCLV 1XHZA 4JV5O 2PZSA 2CAZC 1MZFA 2WWWA 4DR5O 1FXVA 3OGIB 2QTSA 5B1BC 3SPIA 4X1KA 5IE9A 1QLNA 3N2KB 1COWG 2RNBA 3BABA 3B09A 2QTOA 2E75B 2RN9A 2VS0A 3FB5C 2B1IA 4UUJC 5EYPA 1ZUQA 2IJJA 2OCCC 1S0VA 4X89A 4WFFA 4PJ0Z 4LFCO 2FMLA 1VQ9V 1R3JC 3CXHF 4U7OA 2ZXWC 4J7ZA 4K35A 3BCCH 1QBZA 4K3AA 3RVYA 1Q86W 3CRRA 3E22A 2JEUA 4RWUA 2ZNJA 2W6JG 2EULA 2HVKC 3ZRXA 3U10A 1WPXA 4KP4A 1CP9A 2IU3A 2CE4A 1K34A 3CWBH 5E1AC 5LMNB 4X88A 1KU9A 1B6QA 1AROP 1VQ4V 4GX5A 5KMGB 4FPPA 2GTAA 3TXSA 4DV0B 3WG7C 4ABMA 4MVOA 1XILA 5H6RA 5J2TA 1K9MW 3CCRV 4K8ZA 4O2AB 1JCHA 3E89A 3JSNA 1OJHA 1XEQA 1FS0G 1FXKC 4JTDB 2NNUA 5LMNO 1ROPA 1DF5A 2P22C 5JJEB 1OCZC 4JI2B 5K1PA 3K57A 1EBOA 4FLXA 3OUSA 1XQ8A 1KMIZ 1I7FA 1JMKC 4DV0O 4IT5A 1XMOB 3FYIB 3P3PA 3RGBA 3T4ZA 1TUBA 4I9WA 2ZE8A 2EINB 1BZKA 1AVMA 2CUGA 1JPXA 1NH2B 4DUYB 2DYSC 2B5UA 1YTFD 1WA8A 1YF2A 1S72V 5H2FZ 3QTCA 1IURA 4H37A 1JFFA 1ZSPA 4IYIA 4AQYB 3JAKB 4JI2O 1L8DA 3N27A 4O2AA 3HKBB 2OWOA 1D2DA 4AILC 3HKDB 3JCZA 3Q4HB 3TK1A 2YEVB 1XMOO 4R7CA 4JZGA 4NXMO 5LYJA 2HP8A 3C3TA 1TUEB 5B1NA 1QU7A 3B8MA 5IT9N 3HR0A 1YJNV 4JYAB 3ZHTA 2MW2B 4UXNA 2ZE5A 3C90A 3TXQA 4X64B 4DUYO 2PI5A 3RYIB 3D8CA 1ZX3A 4AQYO 3HKEA 4WBNA 2Q7GA 2NR5A 3HPLC 1TA8A 3ZS8C 3SJBC 1OCOC 1MSWD 4JAUA 3B2EE 2EJ7A 4HYOA 3HKBA 5KLVH 1I5YA 2A7WA 1J95A 1VIBA 5EK0A 3HKDA 2OT5A 3Q4HA 5LGNA 4JYAO 3ASNB 4X64O 3JASB 2QA4V 4X9QA 5EBMC 2AZ0A 2B1GA 3J80N 3CC4V 2Y4UA 2N04A 3K9SA 2YI9A 3FD9A 2DWEC 2X7RB 4PV1B 1VF6C 1ZAUA 2GUZB 3QO8A 4FFBB 1JQ0A 1ZL8A 4TV8A 2R9RB 2X6BA 1H2MA 4D7SA 3SJCC 1MMMA 1IVSA 5E79Z 1MABG 4I4TB 1IXMA 5B3SB 1QHTA 3L71H 2PYJA 4JI1B 1YSCA 1K4DC 3DXRA 5IJ9A 4PI0A 4DRXA 3DC6A 1EN5A 3FX7A 3K0DA 3OEHG 2IM9A 3B40A 2YDEA 5KHIA 1J5EB 1Y76B 3QO5A 2E74B 2UUBB 1QCEA 4P9OA 1SF9A 3RYHA 1S5LZ 4I9QA 4DK1A 1PV0A 1WJZA 4EKWA 1H2LA 4E4EA 4JI1O 3BEHA 2KKWA 4YJ3B 3FFQA 5GTIZ 5IYDO 2HEPA 1YCIA 5J9PC 1MOFA 1NTMH 4IIJA 1Z2GA 1W0KG 3KKYA 1AR1B 1U97A 4EFEA 3L9DA 2DOSA 3CJHB 1M56C 1J5EO 3G6BA 2FTKA 1VQKV 2CH7A 3GVMA 2ATKC 2R9IA 2WSSG 3QG5A 2UUBO 2OIEA 5L3DA 3P32A 1AILA 4JTCB 3UO3A 2PF4E 5JJNB 3RYFB 1Q7YW 2Y4TA 3OTOB 3ABUA 4CH4A 3ZRVA 3U0ZA 1N0JA 2CTWA 1SERA 3ASOB 3BY6A 3LSQA 2IU0A 2DWDC 1AR5A 1NTZH 4QE9A 5IJ0B 4P9PA 3IFXA 2ZKOA 3HB3B 1BS3A 1E79G 2YI8A 2JS3A 4ZOLB 4F6EA 4JAVA 3ZRWB 3J81N 3N2GB 4QGPA 1UJWB 5LHHA 1PD3A 2WLJA 3NR7A 2P5OA 1WP8A 3OTOO 4UCUA 2N05A 1KD1W 4PHZA 2JS5A 1I5XA 3K3WA 2QWNB 2XT9A 3OAAG 3RYFA 4LR3A 4X20A 1E1RG 2HHHB 3OT7A 3AK3A 2YIAA 4DUZB 1XDCA 3OR7C 4IHJB 1K33A 1S76D 1VP7A 1HWYA 2P06A 1VEWA 1IBMB 1JJOA 5HFMA 3AG3B 2EIMB 2KSDA 4U3FH 2QGNA 4JGSA 4TWKA 1Q5OA 5L3GA 1Q6UA 1BGYH 2X6AA 4MS2A 2Q69A 1SA0B 3LSUA 4FLYA 1PNLA 2ZT9B 3ETDA 3UCSC 4J11A 1I94B 2ZINA 3CYOA 3CCEV 2KB1A 3OD4A 4LBEC 2HHHO 4DV4B 4DUZO 4EB6B 3K5MA 2EIKC 1H38A 1OV9A 5CA0B 5KHKA 1IBMO 2LQTA 4CZZA 3CSXA 1NI8A 2VQFB 5D5QA 3A8TA 1VMGA 5LXTB 1W2BU 4LF4B 2DQ3A 2UUCB 5LL6Y 4BIUA 2E76B 1JX9A 4JAAA 1WB8A 1M1KW 5BMVA 2Q73A 5JCOC 3TJTA 2A3QA 4JPRA 3CPWU 4D7TA 1XNQB 1I94O 4UCSA 2QKCA 3ABMB 4G27B 4B08A 3JD3A 2CTPA 4UCOA 2A79B 2ILMA 4DV4O 3I56V 2DYRC 5FNVB 2VQFO 5KX5A 1THZA 3VQXA 2ZDIC 4J10A 2O57A 1K92A 4LF4O 1CXZB 2UUCO 3T1YB 3JYCA 3B77A 5IY5B 3W7WA 1Q82W 2Q6AA 2VWKA 1RM1B 1XNQO 2Y48A 5CN0A 2F93B 1ZLZA 1K73W 1D5AA 1P84F 1L0LH 3BFRA 3CRCA 3ZN1A 1QQCA 2Y69B 3UT5B 1R73A 3K59A 1NR1A 1BHBA 1NQTA 5JH7B 3GWOA 4KXRA 1BMFG 1SKVA 3B8NA 1D5NA 1LNQA 4FK5C 5H5NA 3T1YO 3ZMSA 1FAFA 2F23A 1K7DA 3BRCA 1P7GA 2F95B 2Q8VA 3AG1C 1H2SB 3OW2U 3ZMZA 1NVPD 4DV7B 2M7WA 1V9PA 2Y0PA 3M8AA 5CBGA 4PDMA 4B3RB 3X2QC 5EYPB 1VQ8V 4B7EA 2EIJC 4E2LA 1SRYA 1FKAO 5LBQA 1MG1A 1WB7A 1M9NA 4B3TB 1RPOA 1YJ9V 2QJ1A 4PD4F 1H2GA 5LOVA 1ENVA 1HNZB 3E22B 4ASUG 1PNMA 3HKCA 1OCCC 5JH7A 4DV7O 3K08A 3AG4B 3L74H 4MVZA 1QR8A 3SGIA 4B3RO 2CGOA 2MK3A 1KKDA 5J2UA 2QWOB 1EN6A 1Q3EA 3ZHRA 1N33B 5KA5A 1AI6A 3E8BA 3E8FA 1OZ0A 1QVFU 5EIBD 1SQFA 4G2KA 3JD2A 2PGGA 4B3TO 1AP5A 3QNEA 1RP3B 1OCRB 4CBCA 2WLKA 4UCRA 5EBLC 1HNZO 4BW9A 2YSUB 3D36A 4NB5A 5LP6C 5J2TB 3H9VA 4RO2A 3ZMUA 1NS1A 2PUSA 1F4NA 3T2MA 1R1BA 3ABLB 2D3OW 1SESA 2X0LA 4DYLA 1M57B 1VQ5V 4TSFG 3LNMB 4PDRA 5C8YA 1N33O 4RUEA 1DK1A 1NKDA 4TQDA 5JQGA 3P3NA 1PPJH 5CB4A 4W4KA 1YIJV 4OPAA 1FFXA 1DLBA 3AG3C 2EZOA 3CCJV 3E2EA 5GW7A 1TUBB 3EHBB 4LF8B 2D2CB 3PJSK 1SC5B 3BAAA 4O4LB 1VF6A 2UU9B 4BIOA 1XBLA 1I08A 2ZR3A 1B04A 4L8JA 3SYCA 1WA8B 2DN9A 4CS4A 4O2BA 3CMEV 1JFFB 2EILB 3FAVA 4GX2A 4C7UA 1PL0A 5L3EA 3CP1A 2XASA 5DN6G 3AG2B 1AR4A 2IBZH 4F4LA 4AHCA 2YXYA 3CD6V 1YITV 4U7NA 4NKGB 4LF8O 4XDJA 4QE7A 3CXCU 5LYJB 2DW4A 3WB0A 4HNAA 2UU9O 3MDSA 5C93A 2RCVA 1FXHA 4PELA 3WB2A 4O4LA 3A0HZ 2ITDC 4Z1VA 1K4CC 1V55C 3ZJZA 3JALA 3HKEB 5BR8B 1Q6IA 2L6LA 4WBNB 2JK5C 3WB1A 2WLLB 4UVBA 3T1CA 1SQVH 4JASA 2LO1A 2QEXV 4O4HA 4LH6A 4J41A 4XBFA 4MVRA 3CRMA 2DE0X 3MHHC 4K8XA 4MVQA 1FPOA 4J42A 1PM9A 2LP7A 3LDEA 5GONA 4TT3G 1XL4A 2W6IG 2Y0IA 4JYBA 5IYCO 1GAXA 3RYCA 1R3LC 4MSWC 4ZIBA 4ZKIA 5A2QN 3DGEA 5BR8O 1HP8A 5EC2C 4WFEA 2BSKA 4LNUA 1Y67A 2P6JA 2Z3YA 5IYZA 4YIPA 2Y69C 3UO2A 1W0JG 1GH6A 4LF6B 3JARB 2WLLA 3G67A 1F51A 5B5EZ 2ITCC 1LUVA 1GN3A 1ZL8B 4TV8B 3H1IH 1IXBA 4I0XA 3FKSG 5BZBA 2GHYA 3STLC 4XDKA 3T1HB 1E1QG 1MNGA 5IWAB 2F43G 3MD0A 1GM8A 3L72H 3E35A 1IX9A 1SQPH 1JJ2U 1CEZA 3C3SA 3DXRB 4NYKA 5CMUA 5IJ9B 4X1YB 4DRXB 3CE2A 1K8AW 1LUWA 4RQEA 4LF6O 3UKMA 1R6NA 1AJPA 5EZYA 3OEEG 1M90W 1DF4A 2UXNA 1Q43A 4JI6B 3ZCCA 4DR6B 3G71V 2OCHA 3ICXA 3JARA 3AG4C 2XAJA 5KUMA 3T1HO 3RYHB 3O9OA 4X1IA 2E3CA 5IWAO 1KP2A 4MT8A 4MVSA 2VRZA 3ABKB 5CA1A 2GSMB 1RPRA 4RUFA 4J9YB 2P4KA 4JF3A 4NXNB 4UVAA 2FYUH 3VQVA 2ADQB 2XAFA 2K9PA 1YTFB 4IIJB 1S5JA 2AZ2A 4X1YA 3SYPA 4JI6O 4G28B 3ZHUA 4DR6O 3F5TA 2WLIA 4CH5A 5EBWC 4FZ0A 2CH7B 3B4SA 5A9GA 4YY3B 3JD4A 4DV5B 1NR7A 2ETNA 3K0GA 4FVMA 1DGSA 4MTXA 3SJAC 2ZE6A 2IJIA 2YS8A 4NXNO 3RW0A 5JCOA 4CC5A 3SYQA 2LGQA 3ABTA 1V54B 2CTRA 3ZHSA 4K0KB 5KUKA 4ZHQB 1TGOA 2HVJC 2UXDB 1K5SA 4YY3O 3S3XA 4DV5O 2QE7G 4ZI7A 1SQGA 4DV3B 2ZNIA 1BHAA 5B1AB 4JI8B 2EILC 1XI1A 4UFZA 4I55A 1IBLB 1NU1H 2UUAB 3OMAB 3K06A 4PA4A 4MVUA 4FLTA 2V4DA 3QVNA 1OHHG 4X20B 3OUFA 2GDSA 1R3IC 3ETEA 4U3JA 4EFBA 3A2FA 2ZR2A 4W4LA 4K0KO 4DR4B 3CCQV 3H01A 3SYOA 5D5PA 4PA3A 2UXDO 2A9HA 2H94A 3ETQA 1S5HC 1KECA 4WFHA 2EINC 4DV3O 4ZHQA 4JI8O 1Y4MA 3EFFK 1P4RA 3S3WA 1IBLO 4P30A 2UUAO 1Y66A 5EC1C 4PI2A 1N32B 4P2ZA 1SS3A 4EEQA 2CGNA 2Z0AA 3QO7A 5BY1A 1Q6HA 3ZMTA 2V1DA 4DR4O 4QPJA 4B3MB 3TCUA 2FB5A 2EX3A 1L1FA 2KG7B 2JJ1G 5JVDB 1BCCH 5KAFZ 1TVKA 4FMTA 1YJWV 2OIGA 1H2NA 2ZQMA 2ZXWB 4DR3B 4X66B 3JAMN 5BMVB 2ZIMA 1VQMV 1N32O 1VARA 4IGGA 2BE3A 5HFLA 2NN4A 4WF9V 1QVGU 2QR4A 2JDIG 4B3MO 1SZXA 1SQQH 1IDSA 5KX5B 4FIPC 1VQ6V 3A0RA 1Y74A 5LMUB 1FFTB 2KG7A 4DR3O 3JATA 5B1OA 5JVDA 4X66O 2Q0AA 3ASNC 4LF7B 4YHHB 4DV2B 3WG7B 5LP6A 1N34B 1AJQA 4LCUC 3T4DA 4KUMA 1WLEA 4O4IA 4J80A 4JYCA 2UXXA 1NJIW 4LFBB 1HDJA 3OE7G 3CCMV 4KHPB 4CS3A 1US6A 4WFAV 2GBOA 3CC2V 3JAWA 4DXWA 5LGUA 5LMUO 3AEIA 1GM7A 1XUQA 4I7ZB 2WAMA 3IGAC 4LF7O 3STZC 2FL4A 1BL8A 4J7KA 4YHHO 1JA8A 4DV2O 3KG2A 1N34O 4FJCC 3CX5F 1PL4A 4JI7B 1R6KA 3TETA 4LFBO 2QWPB 5B3SC 2DYSB 1GKFA 2G38A 4KHPO 5L3CA 2B9ZA 4RQFA
chains in the Genus database with same CATH topology
2FB5A 1WP7A 4FZ1A 4NTXA 3N27A 1WP8A 2QTSA 3S3XA 4NTYA 4FZ0A 4NTWA 3IJ4A 2L35A 4NYKA 3S3WA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FB5 A;  1WP7 A;  4FZ1 A;  4NTX A;  3N27 A;  1WP8 A;  2QTS A;  3S3X A;  4NTY A;  4FZ0 A;  4NTW A;  3IJ4 A;  2L35 A;  4NYK A;  3S3W A; 
#chains in the Genus database with same CATH topology
 4O4J A;  1BE3 H;  2HLD G;  5IYB O;  1FXK A;  3FB7 C;  5LOV B;  3WFV A;  3ZRS A;  1GRJ A;  2IJH A;  4X65 B;  5ITZ A;  4F6R A;  2QWR B;  4HAM A;  3E8H A;  5JJJ B;  2H8P C;  5FPO A;  3TGU H;  5CBF A;  3HKC B;  2BTO A;  3SR2 C;  4JI7 O;  1VQL V;  2XAH A;  3GB7 C;  3RVZ A;  5KHJ A;  1K3E A;  5FLX N;  5J2U B;  2PI4 A;  3R66 A;  2IH1 C;  4R6Z A;  5LA6 A;  1P49 A;  1EFR G;  4CS2 A;  4LWS A;  3IC9 A;  2AHZ A;  2JGD A;  3QF7 A;  2LFR A;  4PA7 A;  5B66 Z;  5KAI Z;  1HR0 B;  1FJG B;  3G4S V;  2ZE7 A;  4OX9 B;  4X65 O;  1VQO V;  5B1A C;  2AHY A;  5LHG A;  2RMK B;  2F4V B;  2XAQ A;  3IAY A;  3PN1 A;  2GTS A;  1EZJ A;  4H13 B;  1M5I A;  1GK9 A;  3JD0 A;  4DR7 B;  5C8Y B;  2K1E A;  4DR1 B;  2W0F C;  2A06 H;  5JQG B;  1R6T A;  1XMQ B;  4QPK A;  2LW1 A;  5CB4 B;  3H1L H;  3ASO C;  3SYA A;  2R9A A;  2LW7 A;  3FB6 C;  2Q7E A;  4GLX A;  1FFX B;  3RT3 C;  1JR9 A;  2QKS A;  3E8G A;  1HR0 O;  2BTQ A;  2QM4 A;  4OX9 O;  1BSM A;  2F4V O;  3OR6 C;  1K5Q A;  3P30 A;  4FFK A;  4R8C A;  1RFY A;  1PP9 H;  1U96 A;  3ZX6 A;  4TV9 A;  1NH2 D;  1X59 A;  1YZB A;  1N8R W;  2JRI A;  4DR7 O;  4I50 A;  4O2B B;  1N0N A;  4CC6 A;  4DR1 O;  3FAV B;  4PA9 A;  1XMQ O;  3SDL A;  3EXA A;  4R50 A;  3SPH A;  3K79 A;  2WA4 A;  2Q9L A;  3RBZ A;  2Q0O C;  4YXW G;  4LC1 A;  4UCV A;  1Z5V A;  4DR2 B;  1T5E A;  1AP6 A;  3W7T A;  4OGQ B;  3WU2 Z;  3CEI A;  1UPG A;  3JCU Z;  4HNA B;  3VOU A;  2E5L B;  5FPR A;  2EIM C;  2QM7 A;  4DW1 A;  3BHP A;  4TUY A;  1EN4 A;  3BA9 A;  2R70 A;  3JAL B;  3ZMV A;  3I5D A;  3OMI B;  1BQ0 A;  1ZWI C;  4DV6 B;  1NVP B;  3ZED A;  4O4H B;  3N2K A;  1URF A;  3CB2 A;  1QLE B;  4DR2 O;  3K5L A;  1H8H G;  2JJ2 G;  5GON B;  2GV9 A;  2E5L O;  2ARH A;  2ZCE A;  1Q81 W;  1O9H A;  1F4M A;  3H1H H;  3RYC B;  2LJ2 A;  3SPG A;  1M56 B;  3LDD A;  1WNS A;  4FZ1 A;  4ZBM A;  3W7S A;  4YJ2 B;  4BAY A;  3RFR A;  4DV6 O;  2BSK B;  4LNU B;  5IYZ B;  2DQ0 A;  3ABM C;  4Z1M G;  1VQN V;  3K58 A;  3IC7 A;  2WLM A;  4JYY A;  5L3F A;  5H6Q A;  4QNH B;  3APQ A;  3EVK A;  3AK2 A;  1YHQ V;  3BPZ A;  1GN2 A;  1NBM G;  4NXM B;  4I0X B;  2DJV A;  4QIW F;  4Q6G A;  3CHX A;  1AI7 A;  1GN4 A;  5IY5 C;  5KMG A;  4MW3 A;  1F7Y A;  1I0H A;  4MVM A;  3OMN B;  1RM1 C;  4WFB V;  4PDL A;  1PKX A;  1FD9 A;  2OTJ V;  4YJ2 A;  3L73 H;  4ICG A;  4FLV A;  5CBH A;  5EZY B;  2ODM A;  2FKX A;  1XOU A;  4PDV A;  1QNM A;  4GT1 A;  3KCX A;  1KP3 A;  2YID A;  1B3Q A;  2ZIO A;  1YXB A;  2DMX A;  4B3S B;  4LH7 A;  1X4T A;  4GX0 A;  3ZN0 A;  4X1I B;  3W7U A;  4JI5 B;  1Q8I A;  5CA1 B;  3LUT B;  5L3B A;  3GWK C;  2NLJ C;  3L70 H;  4H0L B;  4JTA B;  5GTH Z;  4J7J A;  3D36 C;  1F23 A;  3JAK A;  2WLI B;  4BIZ A;  1GN6 A;  5F2V O;  1UFI A;  2EIK B;  5K1X A;  3M99 B;  2EJR A;  5JWP A;  1AI4 A;  4B3S O;  2YEV A;  3H1J H;  1G4Y B;  3L75 H;  4JI5 O;  1GMG A;  4UB8 Z;  2CDY A;  2VQE B;  2OYQ A;  2XUM A;  1YEW A;  5AG2 A;  4Z2W A;  1XNR B;  2PY5 A;  1QR9 A;  2X6C A;  1JOY A;  3RYI A;  4WCE V;  3E83 A;  3KCY A;  5CA3 A;  3MHS C;  4L87 A;  2M6Y A;  1MSD A;  1SQX H;  2YXH A;  4OXS A;  2YIB D;  3O65 A;  2WA3 A;  1OCR C;  4A5U B;  2DYR B;  4N21 A;  4ZI7 B;  4JI4 B;  4GZR B;  1KUQ A;  1KKC A;  1YDX A;  3K03 A;  1GO3 F;  2VQE O;  3OGC C;  2JEX A;  1KBH A;  1P7B A;  2IJK A;  1RSO B;  4I55 B;  3ABL C;  1M93 A;  4IYH A;  1M57 C;  1XNR O;  1WPB A;  3JAS A;  4FLZ A;  3VBB A;  2WLN A;  4NTW A;  3IJ4 A;  3RWR D;  4TOI A;  4XDL A;  4U3J B;  2PYL A;  2LGW A;  1GM9 A;  1GTO A;  2HFE C;  2L35 A;  1CPY A;  4GCZ A;  3ZHQ A;  2XTA A;  3FYE B;  1VF5 B;  5KHH A;  4JI4 O;  2IW5 A;  3K5N A;  4DK0 A;  5DM6 V;  4HZ3 A;  2WLH A;  2GUZ A;  2CTQ A;  3A0B Z;  4I5S A;  1BQZ A;  4FFB A;  1XRE A;  1YI2 V;  4KFM A;  1XHX A;  1FYJ A;  2QKA A;  2ZDI A;  2OTL V;  3APO A;  3AG1 B;  1MA1 A;  1QLE C;  1RSO A;  2V7Q G;  1N4C A;  3ETG A;  3AG2 C;  3J7A U;  3X2Q B;  4I4T A;  2EIJ B;  2QWQ B;  1JVM A;  2YXL A;  2AGA A;  4GKK B;  4LF9 B;  2JIZ G;  1TVK B;  1N36 B;  3LDC A;  4GX1 A;  4MW8 A;  4NR1 A;  2A0L A;  1NZ6 A;  2Q4P A;  4X8A A;  3AK1 A;  3VQY A;  4TQF A;  2AXT Z;  4DO2 A;  3CC7 V;  1Y76 A;  1OCC B;  1HNX B;  2UXC B;  2BCC H;  2XND G;  3G80 A;  4UV8 A;  3OTF A;  2UXB B;  2AW9 A;  1K97 A;  4Q20 A;  1VQ7 V;  3DTU B;  5B1B B;  3LSS A;  4LFA B;  1HNW B;  2F1M A;  4GKK O;  4LF9 O;  1N36 O;  3R65 A;  5EIB C;  4YJ3 A;  5H9C A;  1NTK H;  3M7M X;  1Y74 B;  1G6U A;  1KB9 F;  1KC8 W;  4GYC B;  3JSL A;  4JI3 B;  4AI8 A;  4QJF B;  1Z5W A;  3JAT B;  4DW0 A;  4FM0 A;  2OCC B;  4RAI A;  2EZP A;  5KHG A;  3DC5 A;  4GKJ B;  4UB6 Z;  3CJH A;  5LP6 B;  4X62 B;  1TAE A;  4DV1 B;  4KL1 A;  4O4I B;  1HNX O;  2UXC O;  4B7K A;  5LGT A;  3D3Q A;  1WP7 A;  2H3O A;  3I55 V;  2UXB O;  1VQP V;  4FM1 A;  2ZM6 B;  1HNW O;  4LFA O;  1PNK A;  3OM3 B;  3KZI Z;  3JAW B;  1WAZ A;  3THO A;  4J9Z B;  3F5W C;  1MZE A;  1NT2 B;  4JI3 O;  2RJZ A;  3CCV V;  2BOC C;  4LF5 B;  1DTO A;  4UV9 A;  2HJF C;  2JGU A;  1WN7 A;  4GKJ O;  5IJ0 A;  2QDO A;  4FLW A;  2YIB A;  4X62 O;  1YVW A;  4DV1 O;  4NVP A;  4WFG A;  4NTX A;  4ZOL A;  2P4V A;  1EM1 A;  3ZRW A;  3N2G A;  1G1X B;  5BXZ A;  2YUA A;  2RDC A;  2ZM6 O;  3W7X A;  1AB3 A;  4H44 B;  4IL6 Z;  1A32 A;  2RQ6 A;  4GUN A;  2XHB A;  4O4J B;  2ADP A;  1O9G A;  4MTF A;  1G8M A;  1FXK B;  4LF5 O;  2IH3 C;  3ML0 A;  3NXS A;  5ITZ B;  2BOB C;  2QM8 A;  3D3I A;  1OCZ B;  4F6R B;  2XAG A;  4IHJ A;  2N74 A;  3SPJ A;  4MTG A;  3ZBH A;  4UCT A;  1R3K C;  2VWJ A;  3ABK C;  3CMA V;  4CH6 A;  5LA6 B;  2JVD A;  1S3J A;  2P7T C;  4MTO A;  1V55 B;  3SPC A;  4LWS B;  3U11 A;  3DSQ A;  1SQB H;  2YC0 A;  3ZIA G;  1SA0 A;  2R72 A;  2JGD B;  2KQX A;  3MAQ A;  4FM2 A;  3CCS V;  1AI5 A;  2Q68 A;  2XOK G;  3AG7 A;  1XL6 A;  4PA6 A;  4BWA A;  2HG5 C;  2P90 A;  4EB6 A;  2F66 C;  1IBK B;  2Q7H A;  3K04 A;  5CA0 A;  2W0X A;  1Y6X A;  2Q5Z A;  2PTM A;  3FB8 C;  5DED A;  3SJQ C;  2LFS A;  1AJN A;  4LP8 A;  5LXT A;  2HJD A;  1SZT A;  3UQ8 A;  1ZTE A;  4BR6 A;  1M4U A;  4JI0 B;  4NTY A;  2YIC A;  4CH3 A;  3F7Y C;  1V54 C;  1VF7 A;  5DEC A;  2BTQ B;  3K9A A;  2ZD9 A;  1H8E G;  4OPH A;  4YIO A;  3BVO A;  3OFN G;  2HR3 A;  1IBK O;  4N23 A;  3H1K H;  2Z5U A;  1OCO B;  5FL7 G;  1KQS U;  1S77 D;  3JD1 A;  4TV9 B;  2Q67 A;  5FNV A;  5LHI A;  4UVC A;  5KA6 A;  4D6T H;  1L0N H;  4X1K B;  1B06 A;  2P67 A;  4H33 A;  1KYO F;  4I50 B;  2HKO A;  1HW7 A;  4JZ2 A;  5IDJ A;  1Q90 D;  3CCU V;  3G6E V;  3VQW A;  1EZV H;  2CK3 G;  4JV5 B;  2C2A A;  3UM7 A;  4JI0 O;  4DR5 B;  2QSA A;  2WPD G;  3F7V C;  4BW5 A;  3K5O A;  3CRQ A;  1ORQ C;  3ZHV A;  3CS5 A;  2EBO A;  1H2K A;  3LNN A;  1BT8 A;  1SET A;  4HBN A;  1IZ3 A;  1LR1 A;  1FJG O;  4LFC B;  3UT5 A;  3CRA A;  3RN4 A;  3BA8 A;  4TUY B;  3E86 A;  4FLU A;  5TIS Z;  1W59 A;  3CCL V;  1XHZ A;  4JV5 O;  2PZS A;  2CAZ C;  1MZF A;  2WWW A;  4DR5 O;  1FXV A;  3OGI B;  2QTS A;  5B1B C;  3SPI A;  4X1K A;  5IE9 A;  1QLN A;  3N2K B;  1COW G;  2RNB A;  3BAB A;  3B09 A;  2QTO A;  2E75 B;  2RN9 A;  2VS0 A;  3FB5 C;  2B1I A;  4UUJ C;  5EYP A;  1ZUQ A;  2IJJ A;  2OCC C;  1S0V A;  4X89 A;  4WFF A;  4PJ0 Z;  4LFC O;  2FML A;  1VQ9 V;  1R3J C;  3CXH F;  4U7O A;  2ZXW C;  4J7Z A;  4K35 A;  3BCC H;  1QBZ A;  4K3A A;  3RVY A;  1Q86 W;  3CRR A;  3E22 A;  2JEU A;  4RWU A;  2ZNJ A;  2W6J G;  2EUL A;  2HVK C;  3ZRX A;  3U10 A;  1WPX A;  4KP4 A;  1CP9 A;  2IU3 A;  2CE4 A;  1K34 A;  3CWB H;  5E1A C;  5LMN B;  4X88 A;  1KU9 A;  1B6Q A;  1ARO P;  1VQ4 V;  4GX5 A;  5KMG B;  4FPP A;  2GTA A;  3TXS A;  4DV0 B;  3WG7 C;  4ABM A;  4MVO A;  1XIL A;  5H6R A;  5J2T A;  1K9M W;  3CCR V;  4K8Z A;  4O2A B;  1JCH A;  3E89 A;  3JSN A;  1OJH A;  1XEQ A;  1FS0 G;  1FXK C;  4JTD B;  2NNU A;  5LMN O;  1ROP A;  1DF5 A;  2P22 C;  5JJE B;  1OCZ C;  4JI2 B;  5K1P A;  3K57 A;  1EBO A;  4FLX A;  3OUS A;  1XQ8 A;  1KMI Z;  1I7F A;  1JMK C;  4DV0 O;  4IT5 A;  1XMO B;  3FYI B;  3P3P A;  3RGB A;  3T4Z A;  1TUB A;  4I9W A;  2ZE8 A;  2EIN B;  1BZK A;  1AVM A;  2CUG A;  1JPX A;  1NH2 B;  4DUY B;  2DYS C;  2B5U A;  1YTF D;  1WA8 A;  1YF2 A;  1S72 V;  5H2F Z;  3QTC A;  1IUR A;  4H37 A;  1JFF A;  1ZSP A;  4IYI A;  4AQY B;  3JAK B;  4JI2 O;  1L8D A;  3N27 A;  4O2A A;  3HKB B;  2OWO A;  1D2D A;  4AIL C;  3HKD B;  3JCZ A;  3Q4H B;  3TK1 A;  2YEV B;  1XMO O;  4R7C A;  4JZG A;  4NXM O;  5LYJ A;  2HP8 A;  3C3T A;  1TUE B;  5B1N A;  1QU7 A;  3B8M A;  5IT9 N;  3HR0 A;  1YJN V;  4JYA B;  3ZHT A;  2MW2 B;  4UXN A;  2ZE5 A;  3C90 A;  3TXQ A;  4X64 B;  4DUY O;  2PI5 A;  3RYI B;  3D8C A;  1ZX3 A;  4AQY O;  3HKE A;  4WBN A;  2Q7G A;  2NR5 A;  3HPL C;  1TA8 A;  3ZS8 C;  3SJB C;  1OCO C;  1MSW D;  4JAU A;  3B2E E;  2EJ7 A;  4HYO A;  3HKB A;  5KLV H;  1I5Y A;  2A7W A;  1J95 A;  1VIB A;  5EK0 A;  3HKD A;  2OT5 A;  3Q4H A;  5LGN A;  4JYA O;  3ASN B;  4X64 O;  3JAS B;  2QA4 V;  4X9Q A;  5EBM C;  2AZ0 A;  2B1G A;  3J80 N;  3CC4 V;  2Y4U A;  2N04 A;  3K9S A;  2YI9 A;  3FD9 A;  2DWE C;  2X7R B;  4PV1 B;  1VF6 C;  1ZAU A;  2GUZ B;  3QO8 A;  4FFB B;  1JQ0 A;  1ZL8 A;  4TV8 A;  2R9R B;  2X6B A;  1H2M A;  4D7S A;  3SJC C;  1MMM A;  1IVS A;  5E79 Z;  1MAB G;  4I4T B;  1IXM A;  5B3S B;  1QHT A;  3L71 H;  2PYJ A;  4JI1 B;  1YSC A;  1K4D C;  3DXR A;  5IJ9 A;  4PI0 A;  4DRX A;  3DC6 A;  1EN5 A;  3FX7 A;  3K0D A;  3OEH G;  2IM9 A;  3B40 A;  2YDE A;  5KHI A;  1J5E B;  1Y76 B;  3QO5 A;  2E74 B;  2UUB B;  1QCE A;  4P9O A;  1SF9 A;  3RYH A;  1S5L Z;  4I9Q A;  4DK1 A;  1PV0 A;  1WJZ A;  4EKW A;  1H2L A;  4E4E A;  4JI1 O;  3BEH A;  2KKW A;  4YJ3 B;  3FFQ A;  5GTI Z;  5IYD O;  2HEP A;  1YCI A;  5J9P C;  1MOF A;  1NTM H;  4IIJ A;  1Z2G A;  1W0K G;  3KKY A;  1AR1 B;  1U97 A;  4EFE A;  3L9D A;  2DOS A;  3CJH B;  1M56 C;  1J5E O;  3G6B A;  2FTK A;  1VQK V;  2CH7 A;  3GVM A;  2ATK C;  2R9I A;  2WSS G;  3QG5 A;  2UUB O;  2OIE A;  5L3D A;  3P32 A;  1AIL A;  4JTC B;  3UO3 A;  2PF4 E;  5JJN B;  3RYF B;  1Q7Y W;  2Y4T A;  3OTO B;  3ABU A;  4CH4 A;  3ZRV A;  3U0Z A;  1N0J A;  2CTW A;  1SER A;  3ASO B;  3BY6 A;  3LSQ A;  2IU0 A;  2DWD C;  1AR5 A;  1NTZ H;  4QE9 A;  5IJ0 B;  4P9P A;  3IFX A;  2ZKO A;  3HB3 B;  1BS3 A;  1E79 G;  2YI8 A;  2JS3 A;  4ZOL B;  4F6E A;  4JAV A;  3ZRW B;  3J81 N;  3N2G B;  4QGP A;  1UJW B;  5LHH A;  1PD3 A;  2WLJ A;  3NR7 A;  2P5O A;  1WP8 A;  3OTO O;  4UCU A;  2N05 A;  1KD1 W;  4PHZ A;  2JS5 A;  1I5X A;  3K3W A;  2QWN B;  2XT9 A;  3OAA G;  3RYF A;  4LR3 A;  4X20 A;  1E1R G;  2HHH B;  3OT7 A;  3AK3 A;  2YIA A;  4DUZ B;  1XDC A;  3OR7 C;  4IHJ B;  1K33 A;  1S76 D;  1VP7 A;  1HWY A;  2P06 A;  1VEW A;  1IBM B;  1JJO A;  5HFM A;  3AG3 B;  2EIM B;  2KSD A;  4U3F H;  2QGN A;  4JGS A;  4TWK A;  1Q5O A;  5L3G A;  1Q6U A;  1BGY H;  2X6A A;  4MS2 A;  2Q69 A;  1SA0 B;  3LSU A;  4FLY A;  1PNL A;  2ZT9 B;  3ETD A;  3UCS C;  4J11 A;  1I94 B;  2ZIN A;  3CYO A;  3CCE V;  2KB1 A;  3OD4 A;  4LBE C;  2HHH O;  4DV4 B;  4DUZ O;  4EB6 B;  3K5M A;  2EIK C;  1H38 A;  1OV9 A;  5CA0 B;  5KHK A;  1IBM O;  2LQT A;  4CZZ A;  3CSX A;  1NI8 A;  2VQF B;  5D5Q A;  3A8T A;  1VMG A;  5LXT B;  1W2B U;  4LF4 B;  2DQ3 A;  2UUC B;  5LL6 Y;  4BIU A;  2E76 B;  1JX9 A;  4JAA A;  1WB8 A;  1M1K W;  5BMV A;  2Q73 A;  5JCO C;  3TJT A;  2A3Q A;  4JPR A;  3CPW U;  4D7T A;  1XNQ B;  1I94 O;  4UCS A;  2QKC A;  3ABM B;  4G27 B;  4B08 A;  3JD3 A;  2CTP A;  4UCO A;  2A79 B;  2ILM A;  4DV4 O;  3I56 V;  2DYR C;  5FNV B;  2VQF O;  5KX5 A;  1THZ A;  3VQX A;  2ZDI C;  4J10 A;  2O57 A;  1K92 A;  4LF4 O;  1CXZ B;  2UUC O;  3T1Y B;  3JYC A;  3B77 A;  5IY5 B;  3W7W A;  1Q82 W;  2Q6A A;  2VWK A;  1RM1 B;  1XNQ O;  2Y48 A;  5CN0 A;  2F93 B;  1ZLZ A;  1K73 W;  1D5A A;  1P84 F;  1L0L H;  3BFR A;  3CRC A;  3ZN1 A;  1QQC A;  2Y69 B;  3UT5 B;  1R73 A;  3K59 A;  1NR1 A;  1BHB A;  1NQT A;  5JH7 B;  3GWO A;  4KXR A;  1BMF G;  1SKV A;  3B8N A;  1D5N A;  1LNQ A;  4FK5 C;  5H5N A;  3T1Y O;  3ZMS A;  1FAF A;  2F23 A;  1K7D A;  3BRC A;  1P7G A;  2F95 B;  2Q8V A;  3AG1 C;  1H2S B;  3OW2 U;  3ZMZ A;  1NVP D;  4DV7 B;  2M7W A;  1V9P A;  2Y0P A;  3M8A A;  5CBG A;  4PDM A;  4B3R B;  3X2Q C;  5EYP B;  1VQ8 V;  4B7E A;  2EIJ C;  4E2L A;  1SRY A;  1FKA O;  5LBQ A;  1MG1 A;  1WB7 A;  1M9N A;  4B3T B;  1RPO A;  1YJ9 V;  2QJ1 A;  4PD4 F;  1H2G A;  5LOV A;  1ENV A;  1HNZ B;  3E22 B;  4ASU G;  1PNM A;  3HKC A;  1OCC C;  5JH7 A;  4DV7 O;  3K08 A;  3AG4 B;  3L74 H;  4MVZ A;  1QR8 A;  3SGI A;  4B3R O;  2CGO A;  2MK3 A;  1KKD A;  5J2U A;  2QWO B;  1EN6 A;  1Q3E A;  3ZHR A;  1N33 B;  5KA5 A;  1AI6 A;  3E8B A;  3E8F A;  1OZ0 A;  1QVF U;  5EIB D;  1SQF A;  4G2K A;  3JD2 A;  2PGG A;  4B3T O;  1AP5 A;  3QNE A;  1RP3 B;  1OCR B;  4CBC A;  2WLK A;  4UCR A;  5EBL C;  1HNZ O;  4BW9 A;  2YSU B;  3D36 A;  4NB5 A;  5LP6 C;  5J2T B;  3H9V A;  4RO2 A;  3ZMU A;  1NS1 A;  2PUS A;  1F4N A;  3T2M A;  1R1B A;  3ABL B;  2D3O W;  1SES A;  2X0L A;  4DYL A;  1M57 B;  1VQ5 V;  4TSF G;  3LNM B;  4PDR A;  5C8Y A;  1N33 O;  4RUE A;  1DK1 A;  1NKD A;  4TQD A;  5JQG A;  3P3N A;  1PPJ H;  5CB4 A;  4W4K A;  1YIJ V;  4OPA A;  1FFX A;  1DLB A;  3AG3 C;  2EZO A;  3CCJ V;  3E2E A;  5GW7 A;  1TUB B;  3EHB B;  4LF8 B;  2D2C B;  3PJS K;  1SC5 B;  3BAA A;  4O4L B;  1VF6 A;  2UU9 B;  4BIO A;  1XBL A;  1I08 A;  2ZR3 A;  1B04 A;  4L8J A;  3SYC A;  1WA8 B;  2DN9 A;  4CS4 A;  4O2B A;  3CME V;  1JFF B;  2EIL B;  3FAV A;  4GX2 A;  4C7U A;  1PL0 A;  5L3E A;  3CP1 A;  2XAS A;  5DN6 G;  3AG2 B;  1AR4 A;  2IBZ H;  4F4L A;  4AHC A;  2YXY A;  3CD6 V;  1YIT V;  4U7N A;  4NKG B;  4LF8 O;  4XDJ A;  4QE7 A;  3CXC U;  5LYJ B;  2DW4 A;  3WB0 A;  4HNA A;  2UU9 O;  3MDS A;  5C93 A;  2RCV A;  1FXH A;  4PEL A;  3WB2 A;  4O4L A;  3A0H Z;  2ITD C;  4Z1V A;  1K4C C;  1V55 C;  3ZJZ A;  3JAL A;  3HKE B;  5BR8 B;  1Q6I A;  2L6L A;  4WBN B;  2JK5 C;  3WB1 A;  2WLL B;  4UVB A;  3T1C A;  1SQV H;  4JAS A;  2LO1 A;  2QEX V;  4O4H A;  4LH6 A;  4J41 A;  4XBF A;  4MVR A;  3CRM A;  2DE0 X;  3MHH C;  4K8X A;  4MVQ A;  1FPO A;  4J42 A;  1PM9 A;  2LP7 A;  3LDE A;  5GON A;  4TT3 G;  1XL4 A;  2W6I G;  2Y0I A;  4JYB A;  5IYC O;  1GAX A;  3RYC A;  1R3L C;  4MSW C;  4ZIB A;  4ZKI A;  5A2Q N;  3DGE A;  5BR8 O;  1HP8 A;  5EC2 C;  4WFE A;  2BSK A;  4LNU A;  1Y67 A;  2P6J A;  2Z3Y A;  5IYZ A;  4YIP A;  2Y69 C;  3UO2 A;  1W0J G;  1GH6 A;  4LF6 B;  3JAR B;  2WLL A;  3G67 A;  1F51 A;  5B5E Z;  2ITC C;  1LUV A;  1GN3 A;  1ZL8 B;  4TV8 B;  3H1I H;  1IXB A;  4I0X A;  3FKS G;  5BZB A;  2GHY A;  3STL C;  4XDK A;  3T1H B;  1E1Q G;  1MNG A;  5IWA B;  2F43 G;  3MD0 A;  1GM8 A;  3L72 H;  3E35 A;  1IX9 A;  1SQP H;  1JJ2 U;  1CEZ A;  3C3S A;  3DXR B;  4NYK A;  5CMU A;  5IJ9 B;  4X1Y B;  4DRX B;  3CE2 A;  1K8A W;  1LUW A;  4RQE A;  4LF6 O;  3UKM A;  1R6N A;  1AJP A;  5EZY A;  3OEE G;  1M90 W;  1DF4 A;  2UXN A;  1Q43 A;  4JI6 B;  3ZCC A;  4DR6 B;  3G71 V;  2OCH A;  3ICX A;  3JAR A;  3AG4 C;  2XAJ A;  5KUM A;  3T1H O;  3RYH B;  3O9O A;  4X1I A;  2E3C A;  5IWA O;  1KP2 A;  4MT8 A;  4MVS A;  2VRZ A;  3ABK B;  5CA1 A;  2GSM B;  1RPR A;  4RUF A;  4J9Y B;  2P4K A;  4JF3 A;  4NXN B;  4UVA A;  2FYU H;  3VQV A;  2ADQ B;  2XAF A;  2K9P A;  1YTF B;  4IIJ B;  1S5J A;  2AZ2 A;  4X1Y A;  3SYP A;  4JI6 O;  4G28 B;  3ZHU A;  4DR6 O;  3F5T A;  2WLI A;  4CH5 A;  5EBW C;  4FZ0 A;  2CH7 B;  3B4S A;  5A9G A;  4YY3 B;  3JD4 A;  4DV5 B;  1NR7 A;  2ETN A;  3K0G A;  4FVM A;  1DGS A;  4MTX A;  3SJA C;  2ZE6 A;  2IJI A;  2YS8 A;  4NXN O;  3RW0 A;  5JCO A;  4CC5 A;  3SYQ A;  2LGQ A;  3ABT A;  1V54 B;  2CTR A;  3ZHS A;  4K0K B;  5KUK A;  4ZHQ B;  1TGO A;  2HVJ C;  2UXD B;  1K5S A;  4YY3 O;  3S3X A;  4DV5 O;  2QE7 G;  4ZI7 A;  1SQG A;  4DV3 B;  2ZNI A;  1BHA A;  5B1A B;  4JI8 B;  2EIL C;  1XI1 A;  4UFZ A;  4I55 A;  1IBL B;  1NU1 H;  2UUA B;  3OMA B;  3K06 A;  4PA4 A;  4MVU A;  4FLT A;  2V4D A;  3QVN A;  1OHH G;  4X20 B;  3OUF A;  2GDS A;  1R3I C;  3ETE A;  4U3J A;  4EFB A;  3A2F A;  2ZR2 A;  4W4L A;  4K0K O;  4DR4 B;  3CCQ V;  3H01 A;  3SYO A;  5D5P A;  4PA3 A;  2UXD O;  2A9H A;  2H94 A;  3ETQ A;  1S5H C;  1KEC A;  4WFH A;  2EIN C;  4DV3 O;  4ZHQ A;  4JI8 O;  1Y4M A;  3EFF K;  1P4R A;  3S3W A;  1IBL O;  4P30 A;  2UUA O;  1Y66 A;  5EC1 C;  4PI2 A;  1N32 B;  4P2Z A;  1SS3 A;  4EEQ A;  2CGN A;  2Z0A A;  3QO7 A;  5BY1 A;  1Q6H A;  3ZMT A;  2V1D A;  4DR4 O;  4QPJ A;  4B3M B;  3TCU A;  2FB5 A;  2EX3 A;  1L1F A;  2KG7 B;  2JJ1 G;  5JVD B;  1BCC H;  5KAF Z;  1TVK A;  4FMT A;  1YJW V;  2OIG A;  1H2N A;  2ZQM A;  2ZXW B;  4DR3 B;  4X66 B;  3JAM N;  5BMV B;  2ZIM A;  1VQM V;  1N32 O;  1VAR A;  4IGG A;  2BE3 A;  5HFL A;  2NN4 A;  4WF9 V;  1QVG U;  2QR4 A;  2JDI G;  4B3M O;  1SZX A;  1SQQ H;  1IDS A;  5KX5 B;  4FIP C;  1VQ6 V;  3A0R A;  1Y74 A;  5LMU B;  1FFT B;  2KG7 A;  4DR3 O;  3JAT A;  5B1O A;  5JVD A;  4X66 O;  2Q0A A;  3ASN C;  4LF7 B;  4YHH B;  4DV2 B;  3WG7 B;  5LP6 A;  1N34 B;  1AJQ A;  4LCU C;  3T4D A;  4KUM A;  1WLE A;  4O4I A;  4J80 A;  4JYC A;  2UXX A;  1NJI W;  4LFB B;  1HDJ A;  3OE7 G;  3CCM V;  4KHP B;  4CS3 A;  1US6 A;  4WFA V;  2GBO A;  3CC2 V;  3JAW A;  4DXW A;  5LGU A;  5LMU O;  3AEI A;  1GM7 A;  1XUQ A;  4I7Z B;  2WAM A;  3IGA C;  4LF7 O;  3STZ C;  2FL4 A;  1BL8 A;  4J7K A;  4YHH O;  1JA8 A;  4DV2 O;  3KG2 A;  1N34 O;  4FJC C;  3CX5 F;  1PL4 A;  4JI7 B;  1R6K A;  3TET A;  4LFB O;  2QWP B;  5B3S C;  2DYS B;  1GKF A;  2G38 A;  4KHP O;  5L3C A;  2B9Z A;  4RQF A; 
#chains in the Genus database with same CATH homology
 2FB5 A;  1WP7 A;  4FZ1 A;  4NTX A;  3N27 A;  1WP8 A;  2QTS A;  3S3X A;  4NTY A;  4FZ0 A;  4NTW A;  3IJ4 A;  2L35 A;  4NYK A;  3S3W A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...