1WPMA

Structure of bacillus subtilis inorganic pyrophosphatase
Total Genus 115
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
115
sequence length
307
structure length
307
Chain Sequence
b'EKILIFGHQNPDTDTICSAIAYADLKNKLGFNAEPVRLGQVNGETQYALDYFKQESPRLVETAANEVNGVILVDHNERQQSIKDIEEVQVLEVIDHHRIANFETAEPLYYRAEPVGCTATILNKMYKENNVKIEKEIAGLMLSAIISDSLLFKSPTCTDQDVAAAKELAEIAGVDAEEYGLNMLKAGADLSKKTVEELISLDAKEFTLGSKKVEIAQVNTVDIEDVKKRQAELEAVISKVVAEKNLDLFLLVITDILENDSLALAIGNEAAKVEKAFNVTLENNTALLKGVVSRKKQVVPVLTDAMA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Manganese-dependent inorganic pyrophosphatase
molecule tags Hydrolase
source organism Bacillus subtilis
publication title Structural Studies of Metal Ions in Family II Pyrophosphatases: The Requirement for a Janus Ion
pubmed doi rcsb
total genus 115
structure length 307
sequence length 307
chains with identical sequence B
ec nomenclature ec 3.6.1.1: Inorganic diphosphatase.
pdb deposition date 2004-09-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01368 DHH DHH family
A PF02833 DHHA2 DHHA2 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.310.20 Alpha Beta Roll Diaminopimelate Epimerase; Chain A, domain 1 Diaminopimelate Epimerase; Chain A, domain 1 1wpmA02
3.90.1640.10 Alpha Beta Alpha-Beta Complex inorganic pyrophosphatase (n-terminal core) inorganic pyrophosphatase (n-terminal core) 1wpmA01
1K20A 2ENXA 4LS9A 2QB8A 1I74A 1WPNA 3W5WA 1K23A 2QB7A 4RPAA 2HAWA 2QB6A 3DEVA 2EB0A 4PY9A 2IW4A 1WPPA 1WPMA
chains in the Genus database with same CATH superfamily
4JCIA 2Q9JA 1GQZA 3W5WA 2KW7A 3EDNA 3G7KA 1U1XA 2OTNA 1W62A 4JD7A 1U1VA 2ZXRA 4J9XA 3WQZA 3FVEA 3EKMA 2ZXPA 1W61A 1QYAA 4LS9A 2QB8A 1I74A 4RPAA 2EB0A 5M47A 2IW4A 1K20A 1IR6A 1U1WA 5H2GA 2H9FA 5HA4A 2Q9HA 1XUBA 4Q60A 1T6KA 5H2YA 2QB7A 5IWEA 5ANPA 4GL6A 5GL2A 1WPPA 4IJZA 2LT2A 5GL4A 1WPNA 4LG3A 4J9WA 2ZXOA 2YMAA 4JUUA 2PVZA 5GL3A 3ICJA 2AZPA 5GKXA 4OA3A 4DWZA 1YM5A 1U0KA 3DEVA 3IGHX 4Q2HA 4JBDA 2QB6A 3PW9A 3PTJA 2ENXA 4FC5A 1K23A 2GKJA 2ZVFA 1WPMA 4LB0A 4IK0A 2HAWA 1XUAA 4PY9A 3G98A 1S7JA 3EJXA 2PW0A 2MPBA 4K7GB 4K8LA 1QY9A 2KPTA 1BWZA 1TM0A 1SDJA 4K7XA 4DUNA 2GKEA 3PVHA
chains in the Genus database with same CATH topology
4JCIA 2Q9JA 1GQZA 3W5WA 2KW7A 3EDNA 3G7KA 1U1XA 2OTNA 1W62A 4JD7A 1U1VA 2ZXRA 4J9XA 3WQZA 3FVEA 3EKMA 2ZXPA 1W61A 1QYAA 4LS9A 2QB8A 1I74A 4RPAA 2EB0A 5M47A 2IW4A 1K20A 1IR6A 1U1WA 5H2GA 2H9FA 5HA4A 2Q9HA 1XUBA 4Q60A 1T6KA 5H2YA 2QB7A 5IWEA 5ANPA 4GL6A 5GL2A 1WPPA 4IJZA 2LT2A 5GL4A 1WPNA 4LG3A 4J9WA 2ZXOA 2YMAA 4JUUA 2PVZA 5GL3A 3ICJA 2AZPA 5GKXA 4OA3A 4DWZA 1YM5A 1U0KA 3DEVA 3IGHX 4Q2HA 4JBDA 2QB6A 3PW9A 3PTJA 2ENXA 4FC5A 1K23A 2GKJA 2ZVFA 1WPMA 4LB0A 4IK0A 2HAWA 1XUAA 4PY9A 3G98A 1S7JA 3EJXA 2PW0A 2MPBA 4K7GB 4K8LA 1QY9A 2KPTA 1BWZA 1TM0A 1SDJA 4K7XA 4DUNA 2GKEA 3PVHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1K20 A;  2ENX A;  4LS9 A;  2QB8 A;  1I74 A;  1WPN A;  3W5W A;  1K23 A;  2QB7 A;  4RPA A;  2HAW A;  2QB6 A;  3DEV A;  2EB0 A;  4PY9 A;  2IW4 A;  1WPP A;  1WPM A; 
#chains in the Genus database with same CATH topology
 4JCI A;  2Q9J A;  1GQZ A;  3W5W A;  2KW7 A;  3EDN A;  3G7K A;  1U1X A;  2OTN A;  1W62 A;  4JD7 A;  1U1V A;  2ZXR A;  4J9X A;  3WQZ A;  3FVE A;  3EKM A;  2ZXP A;  1W61 A;  1QYA A;  4LS9 A;  2QB8 A;  1I74 A;  4RPA A;  2EB0 A;  5M47 A;  2IW4 A;  1K20 A;  1IR6 A;  1U1W A;  5H2G A;  2H9F A;  5HA4 A;  2Q9H A;  1XUB A;  4Q60 A;  1T6K A;  5H2Y A;  2QB7 A;  5IWE A;  5ANP A;  4GL6 A;  5GL2 A;  1WPP A;  4IJZ A;  2LT2 A;  5GL4 A;  1WPN A;  4LG3 A;  4J9W A;  2ZXO A;  2YMA A;  4JUU A;  2PVZ A;  5GL3 A;  3ICJ A;  2AZP A;  5GKX A;  4OA3 A;  4DWZ A;  1YM5 A;  1U0K A;  3DEV A;  3IGH X;  4Q2H A;  4JBD A;  2QB6 A;  3PW9 A;  3PTJ A;  2ENX A;  4FC5 A;  1K23 A;  2GKJ A;  2ZVF A;  1WPM A;  4LB0 A;  4IK0 A;  2HAW A;  1XUA A;  4PY9 A;  3G98 A;  1S7J A;  3EJX A;  2PW0 A;  2MPB A;  4K7G B;  4K8L A;  1QY9 A;  2KPT A;  1BWZ A;  1TM0 A;  1SDJ A;  4K7X A;  4DUN A;  2GKE A;  3PVH A; 
#chains in the Genus database with same CATH homology
 4JCI A;  2Q9J A;  1GQZ A;  3W5W A;  2KW7 A;  3EDN A;  3G7K A;  1U1X A;  2OTN A;  1W62 A;  4JD7 A;  1U1V A;  2ZXR A;  4J9X A;  3WQZ A;  3FVE A;  3EKM A;  2ZXP A;  1W61 A;  1QYA A;  4LS9 A;  2QB8 A;  1I74 A;  4RPA A;  2EB0 A;  5M47 A;  2IW4 A;  1K20 A;  1IR6 A;  1U1W A;  5H2G A;  2H9F A;  5HA4 A;  2Q9H A;  1XUB A;  4Q60 A;  1T6K A;  5H2Y A;  2QB7 A;  5IWE A;  5ANP A;  4GL6 A;  5GL2 A;  1WPP A;  4IJZ A;  2LT2 A;  5GL4 A;  1WPN A;  4LG3 A;  4J9W A;  2ZXO A;  2YMA A;  4JUU A;  2PVZ A;  5GL3 A;  3ICJ A;  2AZP A;  5GKX A;  4OA3 A;  4DWZ A;  1YM5 A;  1U0K A;  3DEV A;  3IGH X;  4Q2H A;  4JBD A;  2QB6 A;  3PW9 A;  3PTJ A;  2ENX A;  4FC5 A;  1K23 A;  2GKJ A;  2ZVF A;  1WPM A;  4LB0 A;  4IK0 A;  2HAW A;  1XUA A;  4PY9 A;  3G98 A;  1S7J A;  3EJX A;  2PW0 A;  2MPB A;  4K7G B;  4K8L A;  1QY9 A;  2KPT A;  1BWZ A;  1TM0 A;  1SDJ A;  4K7X A;  4DUN A;  2GKE A;  3PVH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...