1WPMA

Structure of bacillus subtilis inorganic pyrophosphatase
Total Genus 115
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
115
sequence length
307
structure length
307
Chain Sequence
EKILIFGHQNPDTDTICSAIAYADLKNKLGFNAEPVRLGQVNGETQYALDYFKQESPRLVETAANEVNGVILVDHNERQQSIKDIEEVQVLEVIDHHRIANFETAEPLYYRAEPVGCTATILNKMYKENNVKIEKEIAGLMLSAIISDSLLFKSPTCTDQDVAAAKELAEIAGVDAEEYGLNMLKAGADLSKKTVEELISLDAKEFTLGSKKVEIAQVNTVDIEDVKKRQAELEAVISKVVAEKNLDLFLLVITDILENDSLALAIGNEAAKVEKAFNVTLENNTALLKGVVSRKKQVVPVLTDAMA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Studies of Metal Ions in Family II Pyrophosphatases: The Requirement for a Janus Ion
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Hydrolase
molecule keywords Manganese-dependent inorganic pyrophosphatase
total genus 115
structure length 307
sequence length 307
chains with identical sequence B
ec nomenclature ec 3.6.1.1: Inorganic diphosphatase.
pdb deposition date 2004-09-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01368 DHH DHH family
A PF02833 DHHA2 DHHA2 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.310.20 Alpha Beta Roll Diaminopimelate Epimerase; Chain A, domain 1 Diaminopimelate Epimerase; Chain A, domain 1 1wpmA02
3.90.1640.10 Alpha Beta Alpha-Beta Complex inorganic pyrophosphatase (n-terminal core) inorganic pyrophosphatase (n-terminal core) 1wpmA01
2IW4A 1WPMA 2ENXA 2EB0A 1WPPA 2HAWA 1K23A 2QB6A 2QB8A 4RPAA 1WPNA 4LS9A 4PY9A 1I74A 2QB7A 3DEVA 1K20A 3W5WA
chains in the Genus database with same CATH superfamily
1W62A 2EB0A 1BWZA 2QB6A 4JD7A 4LS9A 1IR6A 2Q9HA 4K7GB 2ZVFA 5GL2A 4JUUA 1U1VA 1K20A 2ENXA 5M47A 1K23A 2MPBA 2OTNA 1SDJA 3WQZA 2GKEA 3G98A 3DEVA 4DUNA 1WPPA 1XUAA 1GQZA 4GL6A 1U0KA 4IJZA 3EKMA 5IWEA 2ZXPA 2PVZA 2LT2A 2QB7A 3EDNA 5ANPA 1WPMA 5GL3A 1WPNA 4LB0A 1I74A 2GKJA 1S7JA 5GL4A 1XUBA 2AZPA 4FC5A 5HA4A 1T6KA 2QB8A 3ICJA 4Q2HA 5H2YA 3W5WA 2Q9JA 2ZXOA 4PY9A 4J9WA 1U1XA 4JCIA 3PTJA 2HAWA 4LG3A 2ZXRA 2PW0A 4RPAA 4IK0A 4J9XA 1U1WA 1QYAA 5H2GA 4JBDA 4DWZA 4K8LA 3EJXA 2KW7A 1YM5A 1TM0A 4K7XA 3PVHA 2IW4A 2H9FA 4OA3A 3G7KA 5GKXA 2YMAA 1W61A 1QY9A 3PW9A 2KPTA 3IGHX 4Q60A 3FVEA
chains in the Genus database with same CATH topology
1W62A 2EB0A 1BWZA 2QB6A 4JD7A 4LS9A 1IR6A 2Q9HA 4K7GB 2ZVFA 5GL2A 4JUUA 1U1VA 1K20A 2ENXA 5M47A 1K23A 2MPBA 2OTNA 1SDJA 3WQZA 2GKEA 3G98A 3DEVA 4DUNA 1WPPA 1XUAA 1GQZA 4GL6A 1U0KA 4IJZA 3EKMA 5IWEA 2ZXPA 2PVZA 2LT2A 2QB7A 3EDNA 5ANPA 1WPMA 5GL3A 1WPNA 4LB0A 1I74A 2GKJA 1S7JA 5GL4A 1XUBA 2AZPA 4FC5A 5HA4A 1T6KA 2QB8A 3ICJA 4Q2HA 5H2YA 3W5WA 2Q9JA 2ZXOA 4PY9A 4J9WA 1U1XA 4JCIA 3PTJA 2HAWA 4LG3A 2ZXRA 2PW0A 4RPAA 4IK0A 4J9XA 1U1WA 1QYAA 5H2GA 4JBDA 4DWZA 4K8LA 3EJXA 2KW7A 1YM5A 1TM0A 4K7XA 3PVHA 2IW4A 2H9FA 4OA3A 3G7KA 5GKXA 2YMAA 1W61A 1QY9A 3PW9A 2KPTA 3IGHX 4Q60A 3FVEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2IW4 A;  1WPM A;  2ENX A;  2EB0 A;  1WPP A;  2HAW A;  1K23 A;  2QB6 A;  2QB8 A;  4RPA A;  1WPN A;  4LS9 A;  4PY9 A;  1I74 A;  2QB7 A;  3DEV A;  1K20 A;  3W5W A; 
#chains in the Genus database with same CATH topology
 1W62 A;  2EB0 A;  1BWZ A;  2QB6 A;  4JD7 A;  4LS9 A;  1IR6 A;  2Q9H A;  4K7G B;  2ZVF A;  5GL2 A;  4JUU A;  1U1V A;  1K20 A;  2ENX A;  5M47 A;  1K23 A;  2MPB A;  2OTN A;  1SDJ A;  3WQZ A;  2GKE A;  3G98 A;  3DEV A;  4DUN A;  1WPP A;  1XUA A;  1GQZ A;  4GL6 A;  1U0K A;  4IJZ A;  3EKM A;  5IWE A;  2ZXP A;  2PVZ A;  2LT2 A;  2QB7 A;  3EDN A;  5ANP A;  1WPM A;  5GL3 A;  1WPN A;  4LB0 A;  1I74 A;  2GKJ A;  1S7J A;  5GL4 A;  1XUB A;  2AZP A;  4FC5 A;  5HA4 A;  1T6K A;  2QB8 A;  3ICJ A;  4Q2H A;  5H2Y A;  3W5W A;  2Q9J A;  2ZXO A;  4PY9 A;  4J9W A;  1U1X A;  4JCI A;  3PTJ A;  2HAW A;  4LG3 A;  2ZXR A;  2PW0 A;  4RPA A;  4IK0 A;  4J9X A;  1U1W A;  1QYA A;  5H2G A;  4JBD A;  4DWZ A;  4K8L A;  3EJX A;  2KW7 A;  1YM5 A;  1TM0 A;  4K7X A;  3PVH A;  2IW4 A;  2H9F A;  4OA3 A;  3G7K A;  5GKX A;  2YMA A;  1W61 A;  1QY9 A;  3PW9 A;  2KPT A;  3IGH X;  4Q60 A;  3FVE A; 
#chains in the Genus database with same CATH homology
 1W62 A;  2EB0 A;  1BWZ A;  2QB6 A;  4JD7 A;  4LS9 A;  1IR6 A;  2Q9H A;  4K7G B;  2ZVF A;  5GL2 A;  4JUU A;  1U1V A;  1K20 A;  2ENX A;  5M47 A;  1K23 A;  2MPB A;  2OTN A;  1SDJ A;  3WQZ A;  2GKE A;  3G98 A;  3DEV A;  4DUN A;  1WPP A;  1XUA A;  1GQZ A;  4GL6 A;  1U0K A;  4IJZ A;  3EKM A;  5IWE A;  2ZXP A;  2PVZ A;  2LT2 A;  2QB7 A;  3EDN A;  5ANP A;  1WPM A;  5GL3 A;  1WPN A;  4LB0 A;  1I74 A;  2GKJ A;  1S7J A;  5GL4 A;  1XUB A;  2AZP A;  4FC5 A;  5HA4 A;  1T6K A;  2QB8 A;  3ICJ A;  4Q2H A;  5H2Y A;  3W5W A;  2Q9J A;  2ZXO A;  4PY9 A;  4J9W A;  1U1X A;  4JCI A;  3PTJ A;  2HAW A;  4LG3 A;  2ZXR A;  2PW0 A;  4RPA A;  4IK0 A;  4J9X A;  1U1W A;  1QYA A;  5H2G A;  4JBD A;  4DWZ A;  4K8L A;  3EJX A;  2KW7 A;  1YM5 A;  1TM0 A;  4K7X A;  3PVH A;  2IW4 A;  2H9F A;  4OA3 A;  3G7K A;  5GKX A;  2YMA A;  1W61 A;  1QY9 A;  3PW9 A;  2KPT A;  3IGH X;  4Q60 A;  3FVE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...