1WPMA

Structure of bacillus subtilis inorganic pyrophosphatase
Total Genus 115
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
115
sequence length
307
structure length
307
Chain Sequence
EKILIFGHQNPDTDTICSAIAYADLKNKLGFNAEPVRLGQVNGETQYALDYFKQESPRLVETAANEVNGVILVDHNERQQSIKDIEEVQVLEVIDHHRIANFETAEPLYYRAEPVGCTATILNKMYKENNVKIEKEIAGLMLSAIISDSLLFKSPTCTDQDVAAAKELAEIAGVDAEEYGLNMLKAGADLSKKTVEELISLDAKEFTLGSKKVEIAQVNTVDIEDVKKRQAELEAVISKVVAEKNLDLFLLVITDILENDSLALAIGNEAAKVEKAFNVTLENNTALLKGVVSRKKQVVPVLTDAMA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Studies of Metal Ions in Family II Pyrophosphatases: The Requirement for a Janus Ion
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Hydrolase
molecule keywords Manganese-dependent inorganic pyrophosphatase
total genus 115
structure length 307
sequence length 307
chains with identical sequence B
ec nomenclature ec 3.6.1.1: Inorganic diphosphatase.
pdb deposition date 2004-09-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01368 DHH DHH family
A PF02833 DHHA2 DHHA2 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.310.20 Alpha Beta Roll Diaminopimelate Epimerase; Chain A, domain 1 Diaminopimelate Epimerase; Chain A, domain 1 1wpmA02
3.90.1640.10 Alpha Beta Alpha-Beta Complex inorganic pyrophosphatase (n-terminal core) inorganic pyrophosphatase (n-terminal core) 1wpmA01
2EB0A 2ENXA 4RPAA 4LS9A 1WPNA 3W5WA 2QB6A 1K20A 2QB7A 1WPPA 2IW4A 4PY9A 2QB8A 3DEVA 2HAWA 1I74A 1K23A 1WPMA
chains in the Genus database with same CATH superfamily
4J9WA 4LG3A 1TM0A 4J9XA 4LS9A 4JCIA 1K20A 1GQZA 3EDNA 3IGHX 2HAWA 2GKEA 1W61A 1U1VA 4K8LA 4Q2HA 2OTNA 1WPMA 4LB0A 2QB8A 2AZPA 4JD7A 2YMAA 2EB0A 2Q9HA 3PW9A 4K7XA 5GL2A 4K7GB 4DUNA 1U0KA 4OA3A 1WPPA 4JUUA 5H2YA 1XUBA 2Q9JA 1U1WA 2ZXPA 4DWZA 2KPTA 5ANPA 5IWEA 1BWZA 1I74A 3WQZA 1W62A 1S7JA 3ICJA 3PTJA 5GL4A 3G98A 1QY9A 1T6KA 4IK0A 2QB6A 2ZXRA 3DEVA 1XUAA 1K23A 3EJXA 5GKXA 1YM5A 1QYAA 1IR6A 4GL6A 2QB7A 3FVEA 2IW4A 2PVZA 3EKMA 2ZXOA 3PVHA 2PW0A 4IJZA 3W5WA 2ZVFA 3G7KA 2LT2A 4Q60A 4FC5A 4PY9A 2H9FA 5H2GA 2KW7A 5GL3A 2MPBA 4RPAA 2ENXA 4JBDA 1SDJA 1U1XA 5M47A 1WPNA 5HA4A 2GKJA
chains in the Genus database with same CATH topology
4J9WA 4LG3A 1TM0A 4J9XA 4LS9A 4JCIA 1K20A 1GQZA 3EDNA 3IGHX 2HAWA 2GKEA 1W61A 1U1VA 4K8LA 4Q2HA 2OTNA 1WPMA 4LB0A 2QB8A 2AZPA 4JD7A 2YMAA 2EB0A 2Q9HA 3PW9A 4K7XA 5GL2A 4K7GB 4DUNA 1U0KA 4OA3A 1WPPA 4JUUA 5H2YA 1XUBA 2Q9JA 1U1WA 2ZXPA 4DWZA 2KPTA 5ANPA 5IWEA 1BWZA 1I74A 3WQZA 1W62A 1S7JA 3ICJA 3PTJA 5GL4A 3G98A 1QY9A 1T6KA 4IK0A 2QB6A 2ZXRA 3DEVA 1XUAA 1K23A 3EJXA 5GKXA 1YM5A 1QYAA 1IR6A 4GL6A 2QB7A 3FVEA 2IW4A 2PVZA 3EKMA 2ZXOA 3PVHA 2PW0A 4IJZA 3W5WA 2ZVFA 3G7KA 2LT2A 4Q60A 4FC5A 4PY9A 2H9FA 5H2GA 2KW7A 5GL3A 2MPBA 4RPAA 2ENXA 4JBDA 1SDJA 1U1XA 5M47A 1WPNA 5HA4A 2GKJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EB0 A;  2ENX A;  4RPA A;  4LS9 A;  1WPN A;  3W5W A;  2QB6 A;  1K20 A;  2QB7 A;  1WPP A;  2IW4 A;  4PY9 A;  2QB8 A;  3DEV A;  2HAW A;  1I74 A;  1K23 A;  1WPM A; 
#chains in the Genus database with same CATH topology
 4J9W A;  4LG3 A;  1TM0 A;  4J9X A;  4LS9 A;  4JCI A;  1K20 A;  1GQZ A;  3EDN A;  3IGH X;  2HAW A;  2GKE A;  1W61 A;  1U1V A;  4K8L A;  4Q2H A;  2OTN A;  1WPM A;  4LB0 A;  2QB8 A;  2AZP A;  4JD7 A;  2YMA A;  2EB0 A;  2Q9H A;  3PW9 A;  4K7X A;  5GL2 A;  4K7G B;  4DUN A;  1U0K A;  4OA3 A;  1WPP A;  4JUU A;  5H2Y A;  1XUB A;  2Q9J A;  1U1W A;  2ZXP A;  4DWZ A;  2KPT A;  5ANP A;  5IWE A;  1BWZ A;  1I74 A;  3WQZ A;  1W62 A;  1S7J A;  3ICJ A;  3PTJ A;  5GL4 A;  3G98 A;  1QY9 A;  1T6K A;  4IK0 A;  2QB6 A;  2ZXR A;  3DEV A;  1XUA A;  1K23 A;  3EJX A;  5GKX A;  1YM5 A;  1QYA A;  1IR6 A;  4GL6 A;  2QB7 A;  3FVE A;  2IW4 A;  2PVZ A;  3EKM A;  2ZXO A;  3PVH A;  2PW0 A;  4IJZ A;  3W5W A;  2ZVF A;  3G7K A;  2LT2 A;  4Q60 A;  4FC5 A;  4PY9 A;  2H9F A;  5H2G A;  2KW7 A;  5GL3 A;  2MPB A;  4RPA A;  2ENX A;  4JBD A;  1SDJ A;  1U1X A;  5M47 A;  1WPN A;  5HA4 A;  2GKJ A; 
#chains in the Genus database with same CATH homology
 4J9W A;  4LG3 A;  1TM0 A;  4J9X A;  4LS9 A;  4JCI A;  1K20 A;  1GQZ A;  3EDN A;  3IGH X;  2HAW A;  2GKE A;  1W61 A;  1U1V A;  4K8L A;  4Q2H A;  2OTN A;  1WPM A;  4LB0 A;  2QB8 A;  2AZP A;  4JD7 A;  2YMA A;  2EB0 A;  2Q9H A;  3PW9 A;  4K7X A;  5GL2 A;  4K7G B;  4DUN A;  1U0K A;  4OA3 A;  1WPP A;  4JUU A;  5H2Y A;  1XUB A;  2Q9J A;  1U1W A;  2ZXP A;  4DWZ A;  2KPT A;  5ANP A;  5IWE A;  1BWZ A;  1I74 A;  3WQZ A;  1W62 A;  1S7J A;  3ICJ A;  3PTJ A;  5GL4 A;  3G98 A;  1QY9 A;  1T6K A;  4IK0 A;  2QB6 A;  2ZXR A;  3DEV A;  1XUA A;  1K23 A;  3EJX A;  5GKX A;  1YM5 A;  1QYA A;  1IR6 A;  4GL6 A;  2QB7 A;  3FVE A;  2IW4 A;  2PVZ A;  3EKM A;  2ZXO A;  3PVH A;  2PW0 A;  4IJZ A;  3W5W A;  2ZVF A;  3G7K A;  2LT2 A;  4Q60 A;  4FC5 A;  4PY9 A;  2H9F A;  5H2G A;  2KW7 A;  5GL3 A;  2MPB A;  4RPA A;  2ENX A;  4JBD A;  1SDJ A;  1U1X A;  5M47 A;  1WPN A;  5HA4 A;  2GKJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...