1WPNA

Crystal structure of the n-terminal core of bacillus subtilis inorganic pyrophosphatase
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
187
structure length
187
Chain Sequence
b'EKILIFGHQNPDTDTICSAIAYADLKNKLGFNAEPVRLGQVNGETQYALDYFKQESPRLVETAANEVNGVILVDHNERQQSIKDIEEVQVLEVIDHHRIANFETAEPLYYRAEPVGCTATILNKMYKENNVKIEKEIAGLMLSAIISDSLLFKSPTCTDQDVAAAKELAEIAGVDAEEYGLNMLKAG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Manganese-dependent inorganic pyrophosphatase
publication title Structural Studies of Metal Ions in Family II Pyrophosphatases: The Requirement for a Janus Ion
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Hydrolase
total genus 73
structure length 187
sequence length 187
chains with identical sequence B
ec nomenclature ec 3.6.1.1: Inorganic diphosphatase.
pdb deposition date 2004-09-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01368 DHH DHH family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.1640.10 Alpha Beta Alpha-Beta Complex inorganic pyrophosphatase (n-terminal core) inorganic pyrophosphatase (n-terminal core) 1wpnA00
1WPMA 4RPAA 1K23A 2HAWA 1I74A 2EB0A 2IW4A 2QB6A 4PY9A 3W5WA 1WPPA 3DEVA 1WPNA 2QB8A 4LS9A 2QB7A 1K20A 2ENXA
chains in the Genus database with same CATH superfamily
1WPMA 1K23A 2HAWA 2EB0A 2ZXOA 1IR6A 4LS9A 2ZXPA 4DWZA 4FC5A 2ZXRA 4PY9A 3DEVA 2QB7A 1K20A 5GL2A 4RPAA 1I74A 5GKXA 2QB8A 5GL3A 2IW4A 2QB6A 3W5WA 1WPPA 1WPNA 2ENXA 5GL4A
chains in the Genus database with same CATH topology
1WPMA 1K23A 2HAWA 2EB0A 2ZXOA 1IR6A 4LS9A 2ZXPA 4DWZA 4FC5A 2ZXRA 4PY9A 3DEVA 2QB7A 1K20A 5GL2A 4RPAA 1I74A 5GKXA 2QB8A 5GL3A 2IW4A 2QB6A 3W5WA 1WPPA 1WPNA 2ENXA 5GL4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WPM A;  4RPA A;  1K23 A;  2HAW A;  1I74 A;  2EB0 A;  2IW4 A;  2QB6 A;  4PY9 A;  3W5W A;  1WPP A;  3DEV A;  1WPN A;  2QB8 A;  4LS9 A;  2QB7 A;  1K20 A;  2ENX A; 
#chains in the Genus database with same CATH topology
 1WPM A;  1K23 A;  2HAW A;  2EB0 A;  2ZXO A;  1IR6 A;  4LS9 A;  2ZXP A;  4DWZ A;  4FC5 A;  2ZXR A;  4PY9 A;  3DEV A;  2QB7 A;  1K20 A;  5GL2 A;  4RPA A;  1I74 A;  5GKX A;  2QB8 A;  5GL3 A;  2IW4 A;  2QB6 A;  3W5W A;  1WPP A;  1WPN A;  2ENX A;  5GL4 A; 
#chains in the Genus database with same CATH homology
 1WPM A;  1K23 A;  2HAW A;  2EB0 A;  2ZXO A;  1IR6 A;  4LS9 A;  2ZXP A;  4DWZ A;  4FC5 A;  2ZXR A;  4PY9 A;  3DEV A;  2QB7 A;  1K20 A;  5GL2 A;  4RPA A;  1I74 A;  5GKX A;  2QB8 A;  5GL3 A;  2IW4 A;  2QB6 A;  3W5W A;  1WPP A;  1WPN A;  2ENX A;  5GL4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...