1WQ2A

Neutron crystal structure of dissimilatory sulfite reductase d (dsrd)
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
70
structure length
65
Chain Sequence
MEEAKQKVVDFLNSSKFYFNDFTDLFPDMKQREVKKILTALVNDEVLEYWSSGSTTMYGLKGAGK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystallization and preliminary neutron analysis of the dissimilatory sulfite reductase D (DsrD) protein from the sulfate-reducing bacterium Desulfovibrio vulgaris.
pubmed doi rcsb
molecule keywords Protein dsvD
molecule tags Unknown function
source organism Desulfovibrio vulgaris
total genus 20
structure length 65
sequence length 70
chains with identical sequence B
ec nomenclature
pdb deposition date 2004-09-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08679 DsrD Dissimilatory sulfite reductase D (DsrD)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1wq2A00
4L18B 3M9AA 1C0WA 3JAMZ 4HF1A 2HDCA 1VTNC 4CGZA 1PDNC 4RAZA 5E1ZB 2A3SA 3LQQA 3DF8A 3SFZA 3MWMA 1R5GA 2M8EA 3K1PA 1AWCA 4GYGA 4KFCA 4YFKF 2MH2A 2FXAA 4YFNF 2P8TA 2FBIA 4MQ9F 2V1DA 5FLXK 2D1HA 1FWZA 4LFUA 3OOPA 4RB2C 2Z33A 1XSXA 3WG9A 4EJTA 2BV6A 2A68F 3O2PE 3MQ0A 3GW2A 5H6RA 1J75A 1J59A 2FEZA 1SD4A 1B59A 1LB2A 5A2QZ 3RIRA 2GIVA 1IRGA 3HUGA 4N0BA 1U5TC 2EFQA 3ZMVA 4CZZA 3HTUA 1G3TA 4PDKA 3LA2A 2ZBKA 5LRSA 3S2WA 4Q5SF 2GZWA 5LBQA 4I01A 4HYEA 2FQ3A 1R1TA 4YG2F 2PQ8A 1ZLJA 4U0VA 2B0LA 1BIAA 1UCRA 4L9NA 3BPXA 1BIBA 3EYIA 1XDSA 4RGUA 2A61A 5KVRA 5CYVA 3MFKA 5HVQC 3SZTA 4N9HA 2FMLA 3JW4A 3HHGA 1U6GA 2V1XA 2P5LC 4HDVA 4G8XA 2HEOA 1TTYA 1SFEA 2GA2A 3F72A 1L3LA 2GQQA 3SHFA 4M72A 3BY6A 4G6QA 5JHUA 4A6DA 5CVJA 1OR7A 1Y0UA 3KP3A 4I09A 1B4AA 4IF4A 5DCFA 5F64A 3V7RA 4Y13A 3TQNA 3FXQA 2WWYA 4Q48A 2HR3A 1WKMA 2EA2A 1U5TA 4U7BA 1R58A 5AONA 2YX4A 5LHHA 2RVCA 4EVIA 2A69F 2BGCA 4JQFA 4BHBA 3GFLA 4IRIA 2QVOA 5LEKA 1YLFA 3EYYA 4JK1X 4M9ZA 2XVCA 2NRAC 2RDPA 4HQMA 3JAMK 3HSEA 3FMQA 5LHGA 3KP2A 1NHAA 2HQRA 3EETA 3IKTA 3LQRA 4UV8A 5DD8A 1Z9CA 3VOEA 3KZYA 1ONVA 1HQCA 4MNUA 1F4KA 3K1MA 3F23A 5CVUA 3KP4A 2IRFG 1UB9A 2OA4A 3WODF 3WGIA 2DK5A 3F21A 4R79A 3C7JA 1PP7U 2CGPA 3WTXC 2MBFA 3ECOA 2W57A 1TLHB 3ISPA 2NYXA 1BJAA 1H9GA 1ZH5A 5E17F 3EDPA 3CLOA 1LQ1A 3HYIA 1U78A 5LEJA 3T5XA 2FE3A 5FB2A 2F5DA 1J5YA 2OQRA 4KIFA 4RS8A 1T38A 1R5HA 4Q47A 1D8JA 3P9IA 3K2ZA 5D4RA 4XLNF 2QQAA 3V8JA 5D8KB 3C3WA 5HOOA 4A12A 4HOBA 2PG4A 2ADUA 3H3UA 1IN6A 2CO5A 2DT5A 1R1UA 1P4AA 1WSUA 4IHSA 3BDDA 3KP7A 3I53A 4I02A 3RKXA 3RDIA 1XN7A 3I0TA 2R3SA 4HAMA 2DBBA 3IHUA 1TW2A 1GHCA 3C1DA 3QU6A 3CTAA 1D3YA 3FX3A 4OMYA 1YW8A 1J0RA 4MHGA 2ISZA 3IKVA 2E1NA 3E6CC 3AAFA 3Q9VA 3F8FA 2ACJA 1LDDA 3FZVA 1USSA 1JHHA 4KIBA 3WTTC 2Y0MA 3WU1B 1CGPA 4IRGA 5J8CA 3CO6C 1I6XA 4RAYA 2A5YB 4QWQA 2DK8A 2CYYA 4CXFA 5H20A 2GA1A 4KYWA 3JTGA 4WWCA 3E5UA 3JTHA 5EEGA 2E7WA 5FD6A 4LD5A 2IA0A 4WK8F 3ERED 1W7PB 1LEAA 5EEHA 2MA3A 2IJLA 3E5XA 2FRHA 3BZ6A 1ZARA 1K78A 3TDZC 2KIFA 2QLZA 1ZG3A 2UWMA 3O6BB 2OU2A 5FGMA 1HSTA 2PMUA 2OAZA 2FNAA 2ZMEB 1B6AA 5FLXZ 4LLGF 4U88A 3QP5A 1XB4A 4MTEA 5D5UB 3L7WA 1ON1A 2MH9A 2DQRA 2RC4A 3CUQB 1HW5A 3DP7A 1W7PA 2EK5A 1OYIA 2NNNA 3MEXA 4MTDA 3H92A 5L3BA 1MJBA 1QZZA 2F5FA 1TBXA 3ZPLA 2FSWA 2RKHA 1FSHA 2RNJA 4O5VA 4GCVA 2FF4A 1BC7C 1IN4A 1D5VA 4GXOA 3TO9A 2P6TA 3I59A 5HLIA 3I64A 1ZGJA 3E6MA 2K7LA 3ZN1A 3E3VA 3OV8A 3DKWA 4WCGA 3GXOA 4ZZDA 2ZMEA 2M87A 1JGSA 2KIMA 4A5NA 1G3SA 4A0ZA 1O7LA 3QP6A 4KT5C 2L54A 4LJZF 1BI2A 3SQNA 5HLGA 4DNCA 1QGPA 3WTYC 4IHTA 1BOAA 4IJAA 1BI1A 1F9NA 3ELKA 4LK1F 2HTJA 1KYWA 4BHPA 5E18F 1I5ZA 4NHJA 1D8KA 4ESJA 1TQMA 3VFZA 4M73A 3K69A 4ENJA 2DI3A 1MGTA 2JPCA 2RQPA 1K7AA 4UHTA 3T0YA 2XROA 1IUYA 4P9FA 1IF1A 3RYPA 1KGSA 1Z91A 1SMTA 2OBPA 2Z99A 4G9YA 3R60A 4ZYEA 2YX7A 1JHFA 4HF0A 5J8FA 4KA4A 4P9UA 3F8CA 4XRFA 4FX0A 1WRJA 2LNBA 1KQ8A 4LK0F 2M45A 1T39A 4H0EA 1USTA 1KYZA 4OIOF 1ZHFA 3E6BA 2M1BA 2HWVA 1ZG1A 3M8EA 2QWWA 2IVMA 3K0LA 3U9GA 3V8LA 3WGHA 1YYVA 3BROA 3T8RA 1HSJA 3M1EA 2O61A 3V8KA 2ISYA 1LEBA 4M6XA 5DEQA 4LG0A 2L3DA 1RZ4A 1FBQA 5K5QA 4UVCA 3ZQ7A 2NAZA 2XASA 4KN7X 1DUXC 4B09A 3WTVC 2VC0A 1IN7A 1LDKB 4OOIA 4AWXB 2CQKA 5AIQA 3RI4A 4UVBA 4PCQA 3LWFA 1T98A 1U3EM 5E1WA 1H9TA 4G7HF 5CVIA 1I1SA 2JT1A 1O7FA 2K4JA 1J9IA 1WQ2A 1T6SA 3WTZA 3IWFA 4HV6A 3RYRA 1GVJA 5HDNA 2ELHA 3F8MA 1V3FA 3DPTA 3GYHX 4MGRA 2Y75A 3PQKA 4KN4X 3F22A 5JI6A 1OYYA 4OIPF 2XUBA 3J80Z 3RKYA 2H09A 4GYIA 1Z6TA 1I1GA 3FMSA 2VT3A 1FSEA 1XCVA 4HLXA 2EV5A 1S6LA 3B73A 1XMKA 5ICFA 2D45A 3FWEA 4CO8A 2FMYA 3RJPA 5K1YA 4IRHA 4RB1A 4HBLA 1FP1D 3TKYA 1DP7P 5TRDA 1IXCA 3V7CA 1SD5A 1XSDA 5TJJA 1OYWA 3F6OA 3WU0A 1XD7A 4BYYA 4MEXF 3HSRA 4G7OF 3I54A 4EJVA 2IA2A 2ZCWA 3I5UA 4EMSA 1STZA 2Q2EA 3HRTA 2E7XA 3KCCA 2VOOA 5BS6A 2RN7A 2HQNA 2XAHA 1DPUA 3LAJA 3CDHA 2VONA 2LDUA 4O3MA 4ON0A 2R7DA 1K6OA 2ZNZA 3IL2A 4A0YA 1Z6RA 1T2KA 2O8XA 3EQLF 3ECHA 3ZMZA 5ED4A 1W7PD 2A07F 2HYFA 1ZN2A 3KE2A 3GFJA 1SFXA 3PFIA 3M8FA 3FXRA 5JFRA 1P2FA 1P92A 1UHWA 3RPUA 4YIFA 3ZMSA 2D1VA 1RI7A 3HRSA 1FBSA 2V9VA 2Z5UA 1CF7B 3MZHA 2GAUA 3L2CA 2COMA 4CICA 3KLNA 2F2EA 3GEZA 3NRVA 1S7OA 2PLYA 1MDMB 2R7FA 4XLPF 4EGYA 1EH6A 3GUDA 3VB2A 3KP5A 1Z1DA 1IZ1A 1BM9A 5E1XA 5D5WB 4M6YA 4L5IA 4HW0A 3I58A 4Y15A 3LA7A 3I71A 1FYKA 2HTSA 4IPAA 2J5OA 1EH7A 1O3SA 4HZFA 2XAGA 4NQWA 2MD5A 2W84A 3RTRA 2STTA 1P4WA 3EUHA 1S8NA 1MDMA 1IN8A 2H6CA 3J80K 2XKOA 3QPHA 2ZO4A 1P4XA 4P55A 4MEYF 2DFIA 1K79A 2ETHA 3GZ6A 1SMYF 4AD9A 1BC8C 4MQVA 3JSOA 3WTUC 2ZNYA 5DUKA 5H6QA 1XGSA 2OZUA 5IT3A 2ZXJA 5HLHA 1KQ0A 3BWGA 5D6FA 2LF7A 3T1BA 2IP2A 2VBWA 1IXRC 3GLXA 4JBAA 1U2WA 4HDUA 2IPQX 2QQBA 2K02A 2VT2A 3CUOA 1TW3A 2DW4A 2GXBA 4LB5A 3TOBA 3HOSA 1YG2A 1UHMA 5CJ9A 4KMFA 5FFZA 3FMRA 4AIJA 2MC3A 3WTSC 1O3TA 2W24A 4GO1A 1YW9A 2QYOA 5BQTA 3PQJA 4S04A 2YPRA 1B1BA 4HLYA 2DAOA 2IW5A 5HS8A 1BI3A 2QM3A 4WXHA 1KU9A 1FYLA 3REOA 3CUQC 4BAYA 1YIOA 2O0YA 4ENNA 1HKSA 4G7ZF 1X3UA 1FPQA 2VOPA 1ZRCA 3L9FA 1KU2A 3ZMTA 1FP2A 3N4MA 5ICCA 3KP6A 1R1VA 2FBHA 2WTEA 3ZN0A 1MJ9A 2DLLA 4L0ZB 3KETA 5J6XA 2LKPA 4UUVA 1I27A 2L01A 3QU3A 3HRUA 3L09A 4I98B 4EQQA 2F5CA 3HHHA 1ODDA 2OD5A 1HW1A 3LFKA 1FOKA 1TNTA 1KA8A 2VBZA 2P6SA 1SAXA 2DPDA 4EV0A 2XV4S 5D5VB 2V6CA 1IAWA 1IN5A 2MLKA 1FT9A 1QBJA 5JR3A 4S05A 5K5RA 5E8GA 3WE2A 2V1UA 2QENA 2LF8A 4M9SA 2P7CB 1R00A 4ESFA 1O57A 2KJBA 2QQ9A 3TOAA 3E5QA 4EGZA 2BE5F 1XSVA 1LJ9A 3CUQA 5DV5A 2QZ8A 5CVVA 4F7ZA 3L00A 1JE8A 1XDUA 2BEOA 1YW7A 3FHZA 4HX4A 2L02A 5KK1A 4EM2A 1FLIA 1QQIA 3BPVA 1MZBA 4GGGA 2ESNA 4LB6B 3Q9SA 3P7NA 4WX9A 4KDPA 2DTRA 3FM5A 4I7HA 1J2XA 3QOPA 5FO5A 2QBYB 3DPLC 1XMAA 2VE8A 4R1HA 3HOTA 3MAJA 3G3ZA 1V4RA 3BJAA 3SXYA 4UNOA 1FZPB 1SD7A 1S29A 2PJPA 5HDKA 2P5VA 2CG4A 3IRRA 2XAQA 3HSFA 2YR2A 3H3ZA 2HOEA 2H94A 1R7JA 2MLGA 2G7UA 5HS9A 2PEXA 3E97A 2V79A 2QBYA 2H6BA 4XSZF 3N97A 2JPBA 4KUMA 5DCMB 4A5MA 4Q4ZF 2Q8KA 5ICGA 2GWRA 2PI0A 1G6NA 1YS6A 3WTWC 2W85A 2IA1A 1HW2A 2NNYA 4U0YA 3I4PA 1E17A 2VODA 1EV7A 1GXQA 4HX8A 4G94A 2JTVA 1ON2A 1ZRDA 2X0LA 4B8XA 2XHKA 4RGRA 2HKOA 1KQ9A 1QO0D 2EV6A 2L4MA 2P5KA 4N9IA 1REPC 2HKXA 2M5WA 4I0BA 5DYMA 4CHUA 1OPCA 1ZGAA 3LAPA 3F8BA 5LGNA 3DXJF 4M71A 4Z2YA 4P96A 1YFHA 1TNSA 2NS0A 5HS7A 2HS5A 5DUIA 1LVAA 2XAJA 5L3EA 4FT8A 4WF2A 1XGOA 4L9VA 1IW7F 2DQLA 3IC7A 1WI9A 3W6KB 1BBYA 4CDGA 3NQOA 2PFBA 1PP8F 2EB7A 1FC3A 1O3RA 3DV8A 1IXSB 4L0YB 4WXCA 3GO5A 3GF2A 2Y48A 5ICEA 2ZFWA 3C18A 4K2EA 2DPUA 3IWZA 1QZYA 2CWEA 2EFOA 5FD5A 2HYGD 3KZZA 4U7DA 3R0AA 5CLSA 1KU7A 2ZJ2A 4BH9A 1ZG5A 2P7VB 3HTSB 3CJNA 1TQPA 1XCBA 1LDJA 4EM0B 4ENKA 4I2OA 4LLNA 4RGSA 4LMYA 1XGNA 1EH8A 2EFWA 3DFGA 3ABUA 1ZLKA 1FY7A 3WE3A 1AOYA 4R8HA 4HX7A 2JSCA 3FXUA 1R22A 1WWXA 3J7AO 3NEUA 4OMZA 4OIQF 1U5TB 3ZP5A 5D6EA 3JSPA 5D5XB 3FM3A 3B02A 4L9JA 5HDGA 2EA4A 4RGXA 3D5LA 2RGVA 4QLCU 5BPDA 3MZYA 3J81Z 2WV0A 4UV9A 3GFIA 4RB0A 2K4BA 2VC1A 3HIFA 5LGTA 2VBXA 5ERIA 2G9WA 2HZTA 1ZYRF 2GXGA 5LRRA 1W4MA 3Q5FA 2VBYA 2P4WA 3KFWX 4NB5A 3QRFF 4PGGA 2CSOA 1W5TA 1TQIA 1YTYA 2H27A 3COAC 1L0OC 5L3GA 3DEUA 4WXDA 1PUEE 2Z3YA 2XRNA 3BOQA 2HGCA 3P9CA 3TDUC 2UXNA 2X4HA 1S3JA 4AIKA 2CFXA 4A6EA 1RUNA 4G6DA 4I0AA 5E20A 1CF7A 3LA3A 3RPQA 3QPTA 4UVAA 3V7SA 2FBKA 5L3DA 2K27A 5F1RA 1F1ZA 3ROUA 4ZYGA 4OIRF 1R23A 2K86A 2BYVE 4FHTA 3GFMA 5CVRA 3F6VA 2JRTA 3GZ5A 4YIIA 4KNYA 2KRFA 2TDXA 1Q1HA 3P9KA 5DD4A 3R0JA 5D8LB 1BI0A 1FBUA 3E6DA 3T8TA 2FOKA 4ETSA 1DDNA 4ZH4F 5A2QK 5BOXA 2KIUA 4LLLA 1LNWA 1H0MA 4LGWA 3M7GA 3FF5A 3BP8A 3CO7C 2XKPA 1HKQA 3LSTA 4EJUA 4ZZLA 4L5JA 1YQAA 5IT9Z 3TGNA 1O3QA 4RB3C 1HKTA 1BN5A 2PMHA 1G4DA 1KU3A 4KMUX 4XBFA 4ZYDA 3R4KA 3U2RA 5AIPA 4OU0A 1XGMA 4DQ2A 4PZJA 4IVNA 1F5TA 1ULYA 3G73A 2FU4A 4AIHA 5JVTA 3QAHA 2FA5A 3W6JB 2F5EA 4ASNA 4U0WA 4P5OA 1OMIA 3F8NA 2EFPA 5LLQA 4BXUA 2LSOA 4HV5A 4TV7A 1G3WA 1K78B 3GWZA 3RKWA 4XSXF 1MKMA 2W25A 3KEQA 3J81K 5L3FA 1OKRA 3VODA 3BJOA 2DO7A 1S7AA 5D4SA 4E70A 2PN6A 3SZPA 2PBIA 1B9MA 2JZYA 3ABTA 1ZAOA 4ZYHA 1G3YA 4EJWA 4UXNA 1ZREA 1E2XA 3BJ6A 3U1DA 2M30A 2L4AA 4BQAA 2XGXA 1YS7A 2EWNA 3I59B 5L3CA 4BHCA 1QNTA 2BBYA 3O3KA 2D2WA 4L9TA 2VE9A 2EJRA 6PAXA 4A2UA 5ILVA 2XIGA 1MJAA 2O6GE 3TO6A 5E8IA 5LHIA 2DU9A 2RV8A 2VN2A 3GVAA 2YU3A 4HF2A 1R36A 4EJOA 5BMZA 1UFMA 3K9TA 4ESBA 3ZMDA 2AS5F 1Z7UA 5F6FA 3HRMA 2Z9OA 5K5OA 3MCZA 2EFNA 2XAFA 4IXAA 2E1CA 4HA8A 2WC2A 2FNPA 2UZKA 1B9NA 5DDGA 3KLOA 2STWA 4HQEA 4A0XA 2ZKZA 3TO7A 4YFXF 3VEPA 2Q0OA 1U8RA 1HXDA 2CW0F 4KICA 5ILUA 4OINF 1GXPA 4O6JA 2IT0A 4M9XA 4D0PA 1ZRFA 3KEOA 5IT9K 3K1NA 1Z05A 2AXLA 1SFUA 5BPIA 2J5PA 2A6HF 4ENMA 1DPRA 1SD6A 2G7HA 2ESHA 2KKOA 4AVPA 2EV0A 2KJCA 3F3XA 4M74A 2VXZA 1FYMA 3R6SA 4CYDA 1RIOH 3V4GA 1T0FA 5LGUA 4LG0B 2C6YA 1FNNA 1IRFA 1W5SA 3DQVC 3ZMUA 2UXXA 1RNLA 1J7KA 3ML6A 2QUFA 4BNCA 4FX4A 3WGGA 1QPMA 1MD0A 2A6EF 1RUOA 4PGHA 2O3FA 3D0SA 1YO5C 3R61A 1FX7A 1JXSA 1A04A 5FFXA 4Y17A 5DCMA 3ULQB 5ILSA 1HBXG 3GX4X 4EM1A 2OQGA 1P6RA 4KIGA 2HFHA 2O03A 2OZ6A 2YSRA 3IRQA
chains in the Genus database with same CATH superfamily
1HF0A 4L18B 3DEWA 3M9AA 3DKXA 3KYLA 1C0WA 1DU0A 3JAMZ 4HF1A 2HDCA 1VTNC 4CGZA 3IH2A 1PDNC 4B48A 4RAZA 5E1ZB 5F1JA 3DBHB 2A3SA 3LQQA 2DA6A 3DF8A 3HPGA 3SFZA 1MSFC 3MWMA 2IAIA 3UKGA 5EEAA 3FIWA 1R5GA 2M8EA 3OYIA 3K1PA 1AWCA 4GYGA 1AKHB 4KFCA 1JKOC 4YFKF 1XX5A 2HVQA 2MH2A 2FXAA 4YFNF 4BBSJ 2P8TA 3CESA 2KMUA 4RA2A 2FBIA 2VI6A 3HUGB 2V1DA 4MQ9F 3I55I 2DN0A 2D1HA 5FLXK 1FWZA 3KPHA 1HOMA 2ZC2A 4LFUA 1ZR2A 3UNGC 5IP6A 2R5ZB 3JCUC 2HPMA 2W00A 3H1CA 3OOPA 4RB2C 2Z33A 3BG5A 3S93A 1XSXA 3WG9A 2E35A 1S9HA 5F0CA 4EJTA 1X1BA 2BV6A 4S0HB 2A68F 3O2PE 2DA3A 4XOTA 1LE8B 3MQ0A 3GW2A 4PK4A 4YIRX 1OR7C 5H6RA 4D9JA 1J75A 1Z3XA 3QWLA 1J59A 2FEZA 2EIKH 1SD4A 1B59A 1AKHA 1WHUA 5EZGA 1DGRM 2KDOA 1LB2A 5A2QZ 3RIRA 3LSMA 2GIVA 5HLTA 4FE7A 4IL6C 3PSFA 1IRGA 3HUGA 2LK2A 4N0BA 4PFPA 1U5TC 2HQAA 1T08B 1JUSA 2EFQA 3ZMVA 4CZZA 1BW5A 2CQNA 4FISA 3ZOBA 2R5ZA 3HTUA 1G3TA 2HDDA 2NXNB 2XF5A 4PDKA 3LA2A 2ZBKA 5LRSA 3S2WA 2Q2EB 5B3SH 4Q5SF 3KX2A 2GZWA 3W2WA 4JOMA 4P1WA 5LBQA 4M3BA 1YITI 4I01A 3D5SC 4HYEA 2JA6J 3QYEA 4CUGA 2FQ3A 2R4GA 4JYKA 1MMSA 1ZKGA 1R1TA 2DMQA 2PQ8A 4YG2F 3J7YJ 4Y52J 2YS9A 1ZLJA 1Z67A 4U0VA 2B0LA 3CP2A 1BIAA 1UCRA 4L9NA 3BPXA 1OQYA 4PJLA 1BIBA 3A4CA 3EYIA 4C3IJ 1XDSA 3F0CA 3K6GA 4RGUA 2A61A 5GPCA 3MD2A 3S1RJ 1RR8C 5B1BH 2P0WA 5KVRA 5IOYA 5CYVA 3MFKA 3IV5A 3BLYA 3SZTA 2DODA 5HVQC 4JX6A 1W36C 2ID3A 1BR1A 2TRTA 4N9HA 2FMLA 4NC8A 1OCPA 3JW4A 3HHGA 4BQOA 3CCRI 2JA2A 1U6GA 2V1XA 2ME0A 2E34A 2P5LC 3M8JA 2BY1A 4HG2A 2E1MB 4HDVA 2EIMH 1U0JA 2JK3A 4G8XA 1ERDA 1M1EB 3BTJA 4BXFA 3G71I 3OL3A 2R7OA 2BY2A 4IX7A 1W0UA 2GM4A 2MGQA 2HEOA 2I5UA 1TTYA 1RR7A 2CJJA 2LKSA 1SFEA 2GA2A 3F72A 1L3LA 2GQQA 3CJRB 2CV1A 5J40A 2LFBA 5EG0B 3SHFA 5LD2C 4M72A 1P7IA 1W1WE 3BY6A 2W48A 3HG9A 4G6QA 5JHUA 3K4JA 4A6DA 1ORKA 5IP7J 5CVJA 1OR7A 1Y0UA 3KP3A 2A05A 1B4AA 4I09A 4IF4A 1FTTA 5DCFA 1YX5A 2RNGA 5F64A 3V7RA 2LYCA 4LOCA 3P5JA 2X48A 4Y13A 3TQNA 1OFCX 3FXQA 2WWYA 1MW7A 2VJIA 4Q48A 5KAFC 4XN3A 1X3ZB 2HR3A 1WKMA 2EA2A 3OYNA 1U5TA 5E3LA 4U7BA 3QOEA 2B7EA 2R5YB 5FKOA 1X1AA 1R58A 5AONA 2YX4A 2RVCA 5LHHA 4EVIA 2A69F 2BGCA 4BL0B 4JQFA 4BHBA 3GFLA 2LREA 4IRIA 3GTLJ 2F6CA 2QVOA 3ABKH 5LEKA 1YLFA 3LFUA 3EYYA 2L9RA 4JK1X 1KZHA 2BW3B 4M9ZA 2XVCA 2NRAC 2RDPA 4NQWB 3IP4B 4HQMA 5J1YA 3JAMK 3HSEA 3FMQA 2OCEA 1VQ6I 2DA2A 4RDUA 5LHGA 1JKQC 4XKCA 1V5GA 3KP2A 3LOCA 1IDYA 1NHAA 2HQRA 3EETA 5B5EC 3IKTA 3TW6A 3LQRA 1RKWA 1ZELA 3TEDA 1WJAA 4UV8A 5DD8A 1Z9CA 3PUFA 3KZYA 1ONVA 1HQCA 3VOEA 3OYBA 1AHDP 4LIUA 1RETA 2CUZA 4XKVA 4MNUA 2AQEA 1F4KA 4MFDA 2VKVA 3K1MA 1X2NA 4F52A 3F23A 5CVUA 5FKLA 2KRCA 3KP4A 2IRFG 2M0CA 1UB9A 2OA4A 3WODF 1YI2I 3LSIA 4B1RA 3WGIA 3DWLE 4UB6C 4F93B 2DK5A 1D5YA 4ZC3A 1F36A 3F21A 4FETA 4R79A 2L0KA 3C7JA 1PP7U 2I10A 2CGPA 3WTXC 1GV5A 2MBFA 3ECOA 4XNFA 4HNVA 2W57A 1FEXA 1X19A 2PX9A 1TLHB 3ISPA 3K4NA 2NYXA 5H2FC 5C4JJ 1IGNA 3MKWB 3CQZJ 1BJAA 3WU2C 1H9GA 4ZDLA 3VYTB 1ZH5A 5E17F 3JRIA 1S5LC 5DM6F 3HC7A 2XPVA 3CLOA 3EDPA 3FKJA 3DLLF 1LQ1A 1IRXA 2XGDA 3HYIA 1Z7LA 1U78A 1MBHA 5LEJA 3CC4I 3T5XA 1POGA 1QA6A 2FE3A 5FB2A 5FRMA 2JA7J 1Y0NA 2F5DA 2IGMA 3C2GA 1J5YA 2OQRA 3HL2A 4KIFA 4RS8A 1T38A 1R5HA 4Q47A 1D8JA 3P9IA 3K2ZA 4ZDPA 1R71A 5GPAA 2R7QA 5D4RA 4XLNF 2VB6A 2QQAA 1VQ7I 3V8JA 2KQRA 2YU9J 5D8KB 3C3WA 5HOOA 4A12A 3H5RA 4HOBA 2PG4A 1ZQ3P 2ADUA 3M07A 1IN6A 2OUMA 1R1UA 1P4AA 2CO5A 2DT5A 3CDLA 3H3UA 3MKLA 2OJED 5C3EJ 1WSUA 4IHSA 2O7OA 5IYDJ 5GP9A 1VQPI 3BDDA 4G12A 4XLCA 3ABLH 3KP7A 3OYDA 3PO2J 1SVLA 4ZYAA 3I53A 2ME6A 3S8PA 2CUFA 4I02A 3RDIA 3RKXA 1XN7A 3I0TA 3K4KA 2R3SA 2IS4A 4UB8C 4UY8I 4HAMA 1P9QC 4XKBA 2HOSA 1TWFJ 5J1RA 1OCCH 2DA4A 4F92B 2DBBA 2JMWA 3IHUA 1TW2A 3GTOJ 1GHCA 3C1DA 3QU6A 3CTAA 1LFUP 1Y8QB 1D3YA 2CQ7A 1WCMJ 3FX3A 1WJDA 1YW8A 4OMYA 4NBQA 2XF7A 1J0RA 4B3AA 4MHGA 1VFCA 2ISZA 1T33A 4EEFG 3IKVA 2E1NA 3E6CC 3AAFA 1N75A 3H5AA 3Q9VA 3ZXSA 4ABZA 3F8FA 2ACJA 1IV8A 1LDDA 2IXSA 3FZVA 4KITB 1USSA 1JHHA 1TT0A 2Y2ZA 4KIBA 5FROA 3WTTC 3HGGA 2Y0MA 3KIOA 3WU1B 4HSRA 2HXIA 2DYSH 1H8AC 4XLAA 1CGPA 1R4NB 4IRGA 4XOPA 2R7RA 4BEHA 5J8CA 2M4GA 4IOAF 4HPQA 5M3FJ 2FQ4A 3FXJA 3Q0UA 3CO6C 1I6XA 4RAYA 2A5YB 4QWQA 2DK8A 5TGTA 4IKFA 1B8IB 2CYYA 1Z21A 4CXFA 2N8GA 5H20A 2GA1A 4KYWA 3VYSB 1UJ8A 2M7AA 3JTGA 2LG4A 4WWCA 3E5UA 3JTHA 5EEGA 5JLXA 2E7WA 4BDYA 5FD6A 4LD5A 2OV7A 2IA0A 4WK8F 3ERED 1W7PB 5E3NA 1S7EA 3FXMA 1LEAA 5EEHA 2MA3A 2V1NA 1SANA 3MKYB 5F27A 1WJEA 2DMPA 2IJLA 3E5XA 2FRHA 3OYEA 2VKEA 4CCJA 3OYCA 1XPXA 3BZ6A 3G4SI 1ZARA 1K78A 4CCMA 3TDZC 2KIFA 3H35A 2QLZA 1AU7A 1ZG3A 4GFBA 2UWMA 3O6BB 2KRHA 2OU2A 5FGMA 1HSTA 2PMUA 2OAZA 2PMZN 2FNAA 3DLAA 3KYDB 1B8IA 4RMNA 3JRDA 3L2UA 1V54H 2ZMEB 5K7HA 1E0EA 3ONQA 1DU6A 1B6AA 5FLXZ 4LLGF 4U88A 2COBA 3QP5A 4RLFA 1XB4A 1VQ5I 4MTEA 2PJRB 1SFKA 5D5UB 3L7WA 1ON1A 3CD6I 2MH9A 2DQRA 2RC4A 3CUQB 1HW5A 4D7MA 3DP7A 3I4MJ 1W7PA 2EK5A 1OYIA 2NNNA 3MEXA 1B72B 4MTDA 3TBIA 1YJNI 3OYAA 3H92A 2QSGX 5L3BA 3S16J 4V2GA 1MJBA 2EPFA 3ZQLA 1QZZA 2CUJA 2F5FA 5IP9J 3CCMI 1TBXA 3ZPLA 2FSWA 1T95A 2D5VA 4DJAA 2RKHA 4GRIA 3VYRB 5M5YJ 2RNJA 2IEKA 3SFIA 4O5VA 3G6EI 3GTQJ 1FSHA 4GCVA 2MSYA 4Y7NJ 1BR4A 2FF4A 1BC7C 4KISA 1IN4A 1D5VA 2B9SA 4GXOA 2MABA 4AIDA 2KT0A 1D0ZA 3TO9A 2A5WA 2P6TA 3I59A 2MG4A 5HLIA 3I64A 1ZGJA 3E6MA 2K7LA 3ZN1A 3E3VA 4JX5A 3OV8A 3DKWA 4WCGA 3GXOA 2DA5A 4ZZDA 2LY1A 4NC6A 2ZMEA 1RPWA 4BJTA 2M87A 3FXKA 4D5FA 1JGSA 3HKZN 2KIMA 4A5NA 4YRVA 1G3SA 4A0ZA 1O7LA 2Y69H 3Q0VA 3QP6A 4KT5C 2L54A 4LJZF 4DZPA 1NG6A 2M0MA 5LFAA 1BI2A 2HOTA 2HVSA 1B72A 3GTKJ 2Y9YA 4BQQA 3SQNA 5HLGA 5FKNA 4DNCA 4FTHA 1QGPA 3WTYC 3MMYB 1TP4A 4IHTA 1BOAA 2VJ4A 4D7NA 4IJAA 1BI1A 1F9NA 4ZTFA 3ELKA 1TWCJ 1FOWA 2HTJA 1KYWA 4LK1F 4BHPA 5E18F 1TL8A 1I5ZA 2GOMA 4NHJA 1D8KA 4ESJA 1TQMA 3VFZA 4M73A 3K69A 4CH7A 2PMZA 3W6VA 2DXIA 4ENJA 3L2WA 1QVUA 3S2DJ 2DI3A 1MGTA 5JLWA 2F4MB 3S3OA 2JPCA 3K70C 2RQPA 1K7AA 4UHTA 4M3EA 4N4NB 3T0YA 1APLC 1ETOA 1QRYA 2WAFA 3PIPF 2XROA 1IUYA 2OC6A 3PNVA 4P9FA 4XMYA 3OIOA 3HM5A 2Z16A 1ETXA 1IF1A 3H0GJ 1ETQA 3RYPA 2Y30A 1KGSA 1Q1VA 3RPUD 1Z91A 2XGEA 1SMTA 3CC7I 1ZK8A 1K4SA 2XPWA 2OBPA 2Z99A 2OTLI 1RESA 1I3AA 4MIMA 1D0XA 4G9YA 3R60A 4ZYEA 3J7ZI 2YX7A 1JHFA 4HF0A 2V7FA 5J8FA 4QIWN 4KA4A 4IEJA 4P9UA 3F8CA 4XRFA 4FX0A 4IOCF 1MMNA 1WRJA 2LNBA 1KQ8A 2EZIA 4LK0F 2M45A 2R7ZJ 1T39A 4H0EA 1USTA 1KYZA 4OIOF 1ZHFA 4A3GJ 1N78A 3G1LA 3E6BA 2M1BA 2HWVA 1ZG1A 3M8EA 4FCYA 2QWWA 3H36A 2KPMA 3OR2C 4A93J 2IVMA 4UUTA 3CMEI 3VPRA 2G0EA 3K0LA 2HOAA 3BR5A 4FE4A 1MH4A 1N25A 3U9GA 3V8LA 3WGHA 2XGCA 1YYVA 3BROA 3T8RA 1HSJA 3M1EA 1BOBA 2RREA 2KHMA 2O61A 2LKXA 2M2EA 3BR6A 3V8KA 2ISYA 1EF4A 2MFZA 1LEBA 1TZLA 4M6XA 5DEQA 4IHWA 4LG0A 2L3DA 4CZCA 1RZ4A 3W2VA 1FBQA 3H9GA 2F4IA 2CW8A 2WAQN 5K5QA 2X6YA 4UVCA 1WJBA 3BTIA 3ZQ7A 1IDZA 1MNEA 1BR2A 3JRBA 2NAZA 2XASA 4KN7X 1FIPA 1DUXC 4B09A 3WTVC 2VC0A 1IN7A 2V6EA 4M3GA 4E7KA 5B66C 1NK3P 1LDKB 4OOIA 4AWXB 2BY3A 3RSNA 2CQKA 4IO9F 5AIQA 3MVPA 3RI4A 4ZDOA 3ESWB 4UVBA 4PCQA 3LWFA 3PO3J 3F9KA 1T98A 2WADA 4PJ0C 3ZQQA 2VKDA 1U3EM 5E1WA 1V55H 3ERMA 4CA0A 3LSRA 1IJWC 3GCMA 4XKWA 1H9TA 4G7HF 2ZXIA 5CVIA 5F04A 4XN0A 1I1SA 3OL4A 2H1LA 2VXDA 3A0BC 1I39A 2CV2A 2JT1A 1O7FA 2DMTA 2K4JA 2L7ZA 1WQ2A 2WY7Q 4BY7J 1J9IA 2ZJRF 1T6SA 3WTZA 3IWFA 4HV6A 1MIJA 3RYRA 1WPKA 5F0FA 1GVJA 2V9KA 5HDNA 2ELHA 2R7VA 3F8MA 1V3FA 3DPTA 3GYHX 4MGRA 2KFDA 2Y75A 3PQKA 1XS9A 4KN4X 3F22A 5JI6A 1OYYA 4OIPF 3HPHA 2XUBA 5F08A 2FD5A 3J80Z 3RKYA 2VLAA 2H09A 3GTJJ 2QSHX 1Z77A 3BTCA 4GYIA 1Z6TA 3O8HA 1I1GA 3FMSA 2VT3A 2VKHA 1FSEA 4BU2A 3DPUA 2E19A 1XCVA 2E1MC 1WH5A 3G2BA 4HLXA 2EV5A 3ZQIA 3RZOJ 1S6LA 3B73A 4BE0A 4BXXJ 2L9NA 2DFHA 2WAQA 1XMKA 2HU9A 5ICFA 3H3VK 2VIXA 2D45A 3FWEA 4CO8A 2FMYA 2E1OA 3RJPA 5K1YA 4IRHA 3ZRGA 4RB1A 3S14J 4HBLA 3PSIA 1FP1D 1YX3A 1LE8A 3TKYA 1DP7P 5TRDA 1IXCA 3D1NI 1YHQI 3V7CA 3IUOA 3BG9A 3K4CA 2AHQA 5EZHA 1SD5A 2WY8Q 4BE2A 1XSDA 5TJJA 5B1AH 1OYWA 2CH0A 3F6OA 2VPLA 4A69C 3WU0A 1XD7A 4BYYA 4B4CA 4MEXF 4J00A 3HSRA 4G7OF 5GAHJ 1R6RA 3I54A 4EJVA 2IA2A 2ZCWA 3I5UA 4EMSA 1QVTA 1STZA 2F5VA 4AUXA 2Q2EA 3HRTA 3FBIB 1TWGJ 5IYBJ 2E7XA 3KCCA 1AA7A 2VOOA 3HXLA 5F0HA 5BS6A 1ETYA 1WI3A 4PFOA 1X2MA 4E7SA 4F91B 2RN7A 2V9PA 2Y31A 1TC3C 2HQNA 2XAHA 1DPUA 2X1DA 3LAJA 3CDHA 2VONA 1EKEA 2LDUA 2B63J 1UAAA 4O3MA 1N77A 4RM3A 3EUKL 3KYCB 2E5ZA 3WG7H 4BDZA 3GTMJ 4ON0A 2DFEA 2R7DA 1K6OA 2UV1A 2ZNZA 3IL2A 2LTPA 4A0YA 3A01B 1FOXA 2E36A 2NVTJ 1Z6RA 1HCRA 1T2KA 1IRZA 2O8XA 4B47A 1MSEC 3EQLF 3ECHA 3E1SA 4B43A 3ZMZA 5ED4A 4V2FA 1UHSA 2NOGA 1JGGA 1W7PD 2A07F 1PUFB 1HLVA 2HYFA 2XB5A 1ZN2A 3VSKA 3KE2A 4QPQA 3GFJA 1SFXA 3PFIA 1X58A 3M8FA 3L2VA 3FXRA 2HNHA 5JFRA 3S3MA 1P2FA 2BY0A 2CQQA 3LMMA 3JREA 1P92A 1UHWA 3RPUA 1G2HA 2GIZA 4A3CJ 4YIFA 3ZMSA 2JUCA 2D1VA 2EH3A 1RI7A 5EG0A 3MKZA 2XF6A 3HRSA 1X4OA 1FBSA 2ZJQF 2V9VA 2WV1A 1R4MB 2Z5UA 1CF7B 3MZHA 1JTXA 2GAUA 3L2CA 2COMA 4W97A 4H4KC 3A01A 4CICA 3KLNA 2F2EA 3GEZA 1ZTRA 3NRVA 1S7OA 2PLYA 3S3NA 1G59A 3M1CA 3HOZJ 4IHYA 2L5QA 1MDMB 4BJ6C 2R7FA 2VQLA 4XLPF 4EGYA 1Z3YA 2XSJC 1EH6A 1T56A 1PUFA 3GUDA 4JP0A 4XRMA 2LOOA 3VB2A 2VPRA 3KP5A 4NNJA 2JVHA 4U87A 1Z1DA 2R5YA 1IZ1A 1BM9A 4AYBN 2XSDC 4II3A 5E1XA 5D5WB 4M6YA 2DDBA 4L5IA 4HW0A 3I58A 4Y15A 3LA7A 3CCLI 3FDYA 4A3LJ 3K4LA 3I71A 2K5CA 1FYKA 3ZR8X 1X3WB 2HTSA 4XQFA 1R5ID 2J5OA 2V4JC 4IPAA 1EH7A 1O3SA 4BE1A 2BW3A 4HZFA 2XAGA 4NQWA 3CCUI 4Z6YA 2MD5A 3RKQA 1RRJA 3EUAA 2WBMA 2W84A 2HZDA 3RTRA 2STTA 3OOUA 1P4WA 3EUHA 1S8NA 3HEFA 1IN8A 5FLMJ 1MDMA 2H6CA 3LSGA 3J80K 1D1CA 2XKOA 3ZQCA 3QPHA 2ZO4A 1P4XA 2ZB9A 4E7ZA 4P55A 3AL0B 5EYRA 4X6AJ 1EA3A 4MEYF 1G8XA 2DFIA 2X6OA 1K79A 4YEJA 2ETHA 4B44A 1VF9A 3AFHA 3GZ6A 3JRCA 1SMYF 4AD9A 1BC8C 2KL4A 5M5XJ 3FK7A 4MQVA 3O8GA 3JSOA 3SEQA 3FISA 3WTUC 2W4SA 2ZNYA 2E60A 5DUKA 5H6QA 2DOEA 1XGSA 1J09A 1D0YA 2DOFA 2OZUA 2R92J 5IT3A 2ZXJA 3TL4X 4A3DJ 5HLHA 4X0GA 1KQ0A 5IPAA 3BWGA 5D6FA 3B6AA 4W1UA 2LF7A 3T1BA 2IP2A 2VBWA 1ETVA 2O5RA 1IXRC 3GLXA 3LL7A 4JBAA 4AYBA 1U2WA 2HDWA 4HDUA 2IPQX 2QQBA 2K02A 2VT2A 4BACA 3CCVI 3CUOA 1TW3A 2DW4A 3OSGA 4M6VA 2GXBA 3FXOA 4LB5A 3TOBA 2NS7A 4IQJA 4B3XA 3BQZA 4AC0A 3HOSA 1YG2A 1JT6A 2JWTA 3OY9A 4JX4A 1UHMA 5CJ9A 4KMFA 5FFZA 1Z0XA 3CJQB 4M3FA 3FMRA 4AIJA 2MC3A 3WTSC 3A02A 1O3TA 2W24A 4GO1A 1YW9A 2QYOA 4A3JJ 1W5CC 2K9NA 5BQTA 3PQJA 4S04A 2QF7A 2CQXA 2YPRA 3HZJA 1B1BA 2BHYA 4HLYA 2DAOA 2IW5A 1NTCA 5HS8A 3HDDA 2XDVA 4BUPA 2IGNA 2K3PA 3K70D 4BJ5C 2QKLB 4DBQA 3ZGKA 2Z2SB 3QPSA 2ZMEC 4E7IA 1BI3A 2QM3A 1NG7A 4WXHA 3OS1A 3RQIA 2OCCH 1KU9A 1FYLA 3TP0A 3REOA 3MZ8A 2M8GX 2O9LA 3CUQC 4BAYA 1YIOA 3QYFA 3BG7A 2O0YA 3I4NJ 4ENNA 1HKSA 4RLQA 3TMOA 1QU3A 3DBRB 3FHNA 1ZR4A 3CZ6A 4G7ZF 4GDFA 2KZGA 2Q1ZB 3AG2H 4E7JA 3NWTA 1X3UA 1FPQA 2VOPA 3IAM2 1ZRCA 3L9FA 4J19A 1KU2A 3OS0A 1A36A 3ZMTA 1FP2A 3N4MA 4HRIA 5ICCA 1GUUA 5E3MA 1JTYA 3KP6A 4XRSG 1R1VA 2FBHA 2WTEA 3ZN0A 2IS1A 1MJ9A 2DLLA 3OYJA 5M3MJ 4L0ZB 3KETA 5J6XA 2LKPA 4UUVA 1I27A 2L01A 3E7LA 3QU3A 2NVYJ 4IZZA 3ZQGA 3HRUA 3BCAA 2IS2A 3L09A 2OPTA 1OCTC 2P81A 4I98B 4EQQA 4F55A 2F5CA 3GMEA 5CQEA 5EF6A 2I8DA 4LITA 3AG1H 1NH3A 3OYKA 5GADJ 1X4PA 3HHHA 4PUSA 1ODDA 2OD5A 1HW1A 3K4MA 3JRGA 1ENHA 3LFKA 3BZCA 3BT9A 5EGOB 1U9OA 3TW7A 1FOKA 1GVDA 1TNTA 1X1PA 2IGKA 3ASNH 1ETKA 1LVKA 2FUG2 2KZVA 1OCZH 5GAEJ 1KA8A 1UG0A 2VBZA 5E79C 2P6SA 4CYCB 3AG3H 3S32A 1SAXA 4RBOA 3L1PA 2L7FP 2DPDA 4EV0A 5J47A 2XV4S 5D5VB 2V6CA 1IAWA 2BZTA 2X9DA 1IN5A 2MLKA 2VQGA 1FT9A 1QBJA 3Q3SA 5JR3A 4S05A 5K5RA 5E8GA 3WE2A 2E2JJ 2MW8A 3OYLA 4A3IJ 4DZJA 5CKTA 2V1UA 2QENA 2LF8A 4M9SA 2V26A 2DJNA 2VJJA 4CCOA 2P7CB 1R00A 4ESFA 1O57A 2KJBA 2QQ9A 3TOAA 1VZ0A 3E5QA 3V42A 4EGZA 2PJRA 5EGOA 4KJZA 1I3QJ 2WB1A 2BE5F 1XSVA 1WJ5A 1LJ9A 3CUQA 5DV5A 3I56I 2QZ8A 5CVVA 4HSTA 2YUSA 4F7ZA 2LD5A 3L00A 5J4YA 1VI0A 1JE8A 2FX0A 1XDUA 2BEOA 5HODA 1YW7A 3FHZA 3KZIC 4HX4A 2L02A 3A2KA 3HOUJ 5KK1A 3CF5F 3B6CA 4EM2A 1I6HJ 5TISC 1FLIA 3BPVA 1QQIA 2H8RA 2EZLA 3H5NA 1MZBA 2IGOA 4NUBA 2Y9ZA 2JA5J 4PSWA 5K7FA 4GGGA 2ESNA 4LB6B 3Q9SA 3P7NA 4WX9A 1HA8A 4KDPA 1UELB 2DTRA 3FM5A 3BC8A 4I7HA 1J2XA 3QOPA 5FO5A 2QBYB 2R7WA 3DPLC 1XMAA 3NAUA 2VE8A 4R1HA 4C3HJ 4IHXA 4HNUA 3QQAA 4V19K 3HOTA 3MAJA 3G3ZA 1H89C 3LSHA 1V4RA 2VQHA 3BJAA 2Y0SA 3I9V2 4AVZA 2BVLA 3VYUB 4EATA 3SXYA 4FQGA 4UNOA 1FZPB 1YE9A 1SD7A 1S29A 3OWTA 4CCKA 3OS2A 2PJPA 2NVXJ 1OISA 5HDKA 2P5VA 3CCQI 2CG4A 3WHCA 4CCLA 3IRRA 2Z1DA 2XAQA 2EZKA 3HSFA 2YR2A 1Y1WJ 3H3ZA 2VJ5A 3LNQA 2K9QA 2HOEA 2H94A 4KT6A 1R7JA 3PIOF 2H1KA 1A5JA 2MLGA 3HOWJ 2A6TA 2G7UA 2L9VA 5HS9A 4MFEA 2PEXA 3BCBA 3E97A 2V79A 2QBYA 2NVUB 2H6BA 4XSZF 3N97A 1E3OC 3U1KA 2X1CA 2JPBA 1FIAA 2VQCA 1S72I 3A03A 2WAEA 4KUMA 5DCMB 1YRNB 3Q0WA 2HXOA 5DTDA 4A5MA 1P7JA 4Q4ZF 2Q8KA 5ICGA 2GWRA 2PI0A 2EINH 3IAS2 1G6NA 1YS6A 3WTWC 3HB9A 2W85A 2IA1A 1HW2A 2NNYA 2K40A 4U0YA 3I4PA 4AM3A 2QGUA 2L7MP 2X1EA 4C2UA 1E17A 2MYSA 1FTZA 5FRNA 2VODA 5IY5H 1EV7A 1GLNA 1JJ6C 4IHVA 1GXQA 4HX8A 4G94A 4XONA 2QA4I 2JTVA 2MD0A 3OYGA 1FMWA 1ON2A 3JRHA 1ZRDA 2JSPA 3CLQA 4UUSB 2L9SA 5KAIC 2X0LA 4B8XA 2CUEA 2XHKA 1GV2A 4XLEA 5DS9A 4RGRA 2HKOA 2LMDA 2LH9A 1KQ9A 1QO0D 2EV6A 5HNHA 1HDDC 2L4MA 2BVMA 4L5EA 2P5KA 1E3PA 1PYVA 2X51A 2DOAA 4N9IA 4D5CA 1REPC 2HKXA 3A1YA 2M5WA 4XR6A 3AKZA 4I0BA 5DYMA 4CHUA 1OPCA 1ZGAA 1OLTA 2LR8A 3S1QJ 1SVMA 3LAPA 1A6IA 2ECBA 3F8BA 5LGNA 3DXJF 5CPRB 3JRFA 3MN2A 1R49A 3VSLA 4M71A 2CV0A 3D5RC 4UUSA 4Z2YA 1SVOA 2DT6A 3BTLA 1DGWY 4P96A 1YFHA 1O4XA 1JKRC 1TNSA 1OCRH 2NS0A 1TWAJ 5HS7A 2HS5A 5DUIA 2X6WA 1LVAA 1X1CA 2XAJA 1K6YA 5L3EA 2OTJI 4ANJA 3I3LA 3JRAA 1K61A 3W3CA 2K9MA 4FT8A 1XGOA 4WF2A 5HNFA 1JUMA 2CRGA 2F4OB 4L9VA 2LBFB 1IW7F 2EBIA 2DQLA 1MNDA 4II2A 3IC7A 4QTRA 3SEZA 1WI9A 1IC8A 3W6KB 1BBYA 3GTPJ 3S15J 2QSFX 4CDGA 1D1AA 3NQOA 2PFBA 9ANTA 4E6KG 4XRSA 1Y56A 2F48A 4LG3A 4DOZA 2NVQJ 3BR0A 1BJZA 3ZCOA 1PP8F 3K4BA 2EB7A 1FC3A 1O3RA 1TWHJ 3A0HC 3DV8A 3OMYA 1V5FA 1IXSB 2RQQA 5IYCJ 1KONA 4L0YB 2E71A 4WXCA 3GO5A 4Y3OA 3GF2A 3GTGJ 2Y48A 4Y33A 5ICEA 1MMAA 2K9LA 2ZFWA 1ACIA 3C18A 4K2EA 2DPUA 3G1MA 2QKMB 2LBFA 3IWZA 1QZYA 2CWEA 1BA5A 4DIQA 2ECCA 5EDNA 1XMXA 2EFOA 5FD5A 2HYGD 3S1NJ 3KZZA 4U7DA 3R0AA 1Y6IA 5CLSA 2LP0A 3OYMA 1KU7A 4XLHA 3GZNB 3PM1A 1IUFA 2GOXB 2ZJ2A 5EJCA 4RAFA 4BH9A 2HPIA 3PL8A 1U8BA 1ZG5A 2P7VB 4PJNA 3HTSB 3CJNA 1TQPA 3VWBA 1XCBA 2DFFA 1LDJA 4EM0B 4ENKA 2EIJH 5GTIC 2TCTA 4I2OA 1K4TA 1VQKI 4LLNA 4RGSA 1WJCA 2KDZA 4LMYA 2M7BA 3ZQFA 1XGNA 1EH8A 2EFWA 3DFGA 3K7AJ 3ABUA 3IH4A 1DP3A 1ZLKA 2E5NA 1EJ9A 2DTZA 1FY7A 1FMVA 3WE3A 1ZGWA 1AOYA 4R8HA 3U21A 4HX7A 2JSCA 3FXUA 1FOYA 1R22A 3K10A 2BHZA 1WWXA 1JKPC 3J7AO 3NEUA 2UUZA 4I99C 4OMZA 4OIQF 4ITVA 2BXYA 1U5TB 5KHDA 3EUHC 3EPZA 1T8IA 3HJEA 3ZP5A 4RAGA 1WFXA 5D6EA 3JSPA 5D5XB 3FM3A 3B02A 3W2AA 3CCEI 2DA7A 1LFPA 4L9JA 5HDGA 5C44J 3BR2A 2BOLA 2FOWA 4OAYA 4G6TB 2EA4A 4RGXA 3D5LA 2RGVA 2KIQA 1X1DA 1MMGA 2M3AA 3DBLB 4HEA2 4AU7A 4QLCU 5BPDA 1WVRA 4N4OB 2K3FA 3MZYA 1QHHD 4IQ4A 1FJLA 3N05A 3J81Z 2WV0A 3GBGA 4UV9A 3GFIA 3OYFA 3OSFA 3VDXA 3FKIJ 4RB0A 1LKXA 2DMUA 2K4BA 2VC1A 4XL9A 2CFOA 1LUJB 3HIFA 5LGTA 2VBXA 2DDAA 1SEUA 4MO7A 2ZSIB 5ERIA 2IBDA 1E3HA 2LRDA 3C2BA 2G9WA 1QHGA 1ZYRF 2HZTA 3GLLA 4ZTJA 2GXGA 3TP3A 5LRRA 3BG3A 1W4MA 2XAUA 3Q5FA 4DW6A 2VBYA 1RC9A 2P4WA 3KFWX 2XC7A 4NB5A 3H0DA 3JR9A 2DMNA 4A3BJ 3QRFF 3AL0C 3QODA 4PGGA 2CSOA 4A3EJ 4Y4RA 3CCJI 3J7AY 1W5TA 4YELA 2DA1A 1TQIA 1YTYA 2H27A 5KNLA 3COAC 5C4XJ 1OCOH 1L0OC 5L3GA 3DEUA 4WXDA 2VUMJ 1MBEA 1PUEE 3G1OA 1ETWA 2Z3YA 2XRNA 3BOQA 1HC8A 2HGCA 5KCMA 1F43A 3P9CA 3M4OJ 3TDUC 2UXNA 2X4HA 1S3JA 4AIKA 2CFXA 2DYRH 2E2IJ 4A6EA 4NDLA 1RUNA 1UZCA 4PSXA 3L2RA 5K7ZA 4G6DA 1ITYA 3H9QA 4I0AA 5E20A 3SDGA 3KEYA 1CF7A 3LA3A 2XPUA 3RPQA 2JJ7A 3QPTA 3M3YJ 4UVAA 3SZGA 3V7SA 2FBKA 5L3DA 2K27A 5F1RA 4I76A 1SAUA 1F1ZA 3ROUA 4ZYGA 4OIRF 4DBRA 1R23A 1XTAA 4FASD 2K86A 1A35A 2OF7A 1JI8A 2BYVE 4FHTA 2AQFA 3GFMA 5CVRA 3F6VA 3QPLA 2JRTA 3GZ5A 2DT7B 1Y39A 1D1BA 4YIIA 4KNYA 2KRFA 2LY9A 2TDXA 1Q1HA 3P9KA 5DD4A 3R0JA 5D8LB 1WGXA 1BI0A 4BGDA 1FBUA 3E6DA 3T8TA 1UMQA 1WH7A 3DEEA 3DKYA 3CF2A 1PJRA 2CW7A 2FOKA 3FBNB 1HDPA 4ETSA 4M3DA 2AO9A 1UG2A 1DDNA 3SJMA 2ZXWH 1QZEA 4C2TA 3CP8A 4ZH4F 1BL0A 1SFOJ 5A2QK 5BOXA 2O8KA 2KIUA 4OAZA 4XIDA 4LLLA 3DTEA 1LNWA 4DYCA 4LGWA 1H0MA 1LPQA 1VQNI 2QCOA 2ELJA 1MBGA 2X85A 1V5EA 3M7GA 1CQTA 3FF5A 1MH3A 3BP8A 3CMYA 3CO7C 2XKPA 1DQUA 2JRMA 1HKQA 3LSTA 4PJMA 2R93J 4EJUA 4ZZLA 2LVSA 4L5JA 1IV6A 3PFYA 1YQAA 5IT9Z 1XG1A 3TGNA 1O3QA 4RB3C 1HKTA 2KLOA 1BN5A 2PMHA 3OR1C 1G4DA 2HQ5A 1KU3A 4NC7A 2ELKA 4KMUX 3HBLA 4XBFA 4ZYDA 3R4KA 3U2RA 3HGYA 5AIPA 5GTHC 1Y1VJ 4BEHB 4OU0A 1XGMA 4DQ2A 4PZJA 2E2HJ 1JT0A 4IVNA 3E0JB 1F5TA 4BKXA 2HVRA 2GXAA 1ULYA 3G73A 2FU4A 4AIHA 3H9JA 2X6XA 5JVTA 3ZQHA 3QAHA 2FA5A 4XICA 3W6JB 1K83J 2F5EA 2JUGA 4ASNA 2M4KA 4U0WA 4P5OA 4DGWB 4BBRJ 1OMIA 3F8NA 3LSKA 4QSHA 2QEXI 2EFPA 5LLQA 4BXUA 2LSOA 4DYQA 2JN6A 4HV5A 4TV7A 3HOXJ 1G3WA 1K78B 2HYJA 3GWZA 3RKWA 2WB1N 4XSXF 1YIJI 1MKMA 2W25A 3KEQA 3J81K 5L3FA 1OKRA 4RM2A 2DCEA 3VODA 3UR3C 3BJOA 2DO7A 1LFBA 4XK4A 5J1UA 3PNYA 1S7AA 1SC7A 3CCYA 5FJ8J 5D4SA 4E70A 2L2OA 3HOVJ 2PN6A 3SZPA 3C2HA 2PBIA 5J3LA 1B9MA 5DM7F 3DU5A 3WHBA 2JZYA 3ABTA 4CSWA 1ZAOA 2ICWG 4QPOA 2ZSHB 4PJJA 4ZYHA 2ID6A 4E7LA 1G3YA 2Y0SN 4EJWA 2VASA 4UXNA 1ZREA 1E2XA 3OIPA 3BJ6A 3U1DA 2M30A 2L4AA 4BQAA 2HI3A 3LSPA 2XGXA 1YS7A 2EWNA 3I59B 1VNDA 3RQ4A 5L3CA 4BHCA 1QPIA 1QNTA 2ZFUA 2BBYA 1GDTA 1VQ4I 2JA8J 1OJLA 3O3KA 4F3QA 3LSJA 4C30A 4BS9A 2D2WA 4L9TA 2VE9A 1WZ2A 2EJRA 6PAXA 1XC5A 4A2UA 5ILVA 2XIGA 4BQNA 5IOZA 1A31A 1YJ9I 1MJAA 2O6GE 3TO6A 1VQLI 1T0FC 5E8IA 3FXLA 4XLFA 5LHIA 3CC2I 2DU9A 1JJ8C 2RV8A 3QYBA 4LIVA 2R7XA 2VN2A 3GVAA 2YU3A 4HF2A 2W1OA 3CMAI 1R36A 4EJOA 5JHFA 5BMZA 5M5WJ 1UFMA 3K9TA 2NOJB 4ESBA 3ZMDA 2AS5F 1YOVB 1Z7UA 2M34A 1Y8RB 3DTIA 1MBJA 5F6FA 4CYCA 3SDBA 3HRMA 3K2AA 3CCSI 2Z9OA 5K5OA 1YJWI 2LLKA 2AXTC 3MCZA 2GBYA 3OIQA 2EFNA 3SYTA 2XAFA 4IXAA 2RAEA 4C3JJ 2IS6A 2CMPA 2XB0X 2E1CA 1TT5B 4HA8A 2R7UA 1U9NA 2WC2A 2FNPA 2UZKA 1B9NA 5DDGA 1W0TA 3NARA 3KLOA 2W7NA 2STWA 2R0QC 4BY1J 4HQEA 1MMDA 3BQYA 5CQGA 4I6ZA 3RZDJ 2K85A 2ZKZA 4A0XA 3TO7A 4YFXF 4C2MJ 3VEPA 2Q0OA 1U8RA 1HXDA 2CW0F 4KICA 3NWSA 4DYRA 2FJ1A 5ILUA 3CMMA 4OWRB 2WA0A 4OINF 3BZKA 1GXPA 2VL8A 4O6JA 1VQ8I 2IT0A 4M9XA 2H8WA 4D0PA 1ZRFA 3KEOA 5BNGA 2KP6A 1VQOI 5IT9K 2BXZA 2LC2A 3K1NA 2MC4A 1VQ9I 1Z05A 3FK6A 3CDIA 3CJTB 4C9YA 2JQ7A 2AXLA 1SFUA 4D1QA 5BPIA 3DCFA 2J5PA 2A6HF 4E4HA 4ENMA 1H88C 4X1EA 1DPRA 1SD6A 4A3MJ 3S1MJ 1I50J 2EQRA 2JVGA 2G7HA 2KISA 3AG4H 2EILH 2ESHA 2KKOA 3S17J 1RKTA 3S2HJ 5JVGF 4AVPA 3IH3A 1IG7A 2EV0A 2KJCA 3BR1A 2CU7A 4ZJZA 2XRLA 3F3XA 4M74A 3X2QH 5E3OA 1IO2A 2VXZA 1FYMA 4XM3A 3R6SA 4CYDA 1RIOH 4E7HA 5GAGJ 4A3FJ 3V4GA 1T0FA 5LGUA 1GT0C 4LG0B 2QQ8A 2M9HA 2C6YA 2ZXHA 3PJRA 1FNNA 3RCOA 1IRFA 3ASOH 2ZJPF 1W5SA 1PVEA 3DU6A 2R7TA 3DQVC 3ZMUA 3HKZA 1MBKA 2UXXA 1MBFA 1RNLA 1MNMC 4J01A 2CS3A 1J7KA 3ML6A 2QUFA 4BNCA 2NS8A 4MLOA 4FX4A 3WGGA 2R7SA 1QPMA 1MD0A 2A6EF 1WJFA 3DTKA 1W36D 5FKMA 2W82A 1RUOA 4PGHA 1BW6A 4CCNA 2O3FA 3BG6A 2DJIA 2EZHA 3D0SA 1A6QA 1YO5C 3PNTA 3R61A 1FX7A 4HNTA 1JXSA 1A04A 5FKKA 3HOYJ 2LY2A 1VQMI 5FFXA 2K9SA 4Y17A 5DCMA 3ABMH 1YRNA 3ULQB 5ILSA 5FLVA 1NK2P 3OYHA 1HBXG 1JUPA 3L2QA 2GLOA 3GX4X 4XORA 4EM1A 1R9TJ 3BR3A 2OQGA 1P6RA 4A3KJ 4KIGA 3PUBA 2HFHA 2L7KA 2O03A 2OZ6A 2YSRA 5J4VA 3IRQA
chains in the Genus database with same CATH topology
4L18B 3M9AA 1C0WA 3JAMZ 4HF1A 2HDCA 1VTNC 4CGZA 1PDNC 4RAZA 5E1ZB 2A3SA 3LQQA 3DF8A 3SFZA 3MWMA 1R5GA 2M8EA 3K1PA 1AWCA 4GYGA 4KFCA 4YFKF 2MH2A 2FXAA 4YFNF 2P8TA 2FBIA 4MQ9F 2V1DA 5FLXK 2D1HA 1FWZA 4LFUA 3OOPA 4RB2C 2Z33A 1XSXA 3WG9A 4EJTA 2BV6A 2A68F 3O2PE 3MQ0A 3GW2A 5H6RA 1J75A 1J59A 2FEZA 1SD4A 1B59A 1LB2A 5A2QZ 3RIRA 2GIVA 1IRGA 3HUGA 4N0BA 1U5TC 2EFQA 3ZMVA 4CZZA 3HTUA 1G3TA 4PDKA 3LA2A 2ZBKA 5LRSA 3S2WA 4Q5SF 2GZWA 5LBQA 4I01A 4HYEA 2FQ3A 1R1TA 4YG2F 2PQ8A 1ZLJA 4U0VA 2B0LA 1BIAA 1UCRA 4L9NA 3BPXA 1BIBA 3EYIA 1XDSA 4RGUA 2A61A 5KVRA 5CYVA 3MFKA 5HVQC 3SZTA 4N9HA 2FMLA 3JW4A 3HHGA 1U6GA 2V1XA 2P5LC 4HDVA 4G8XA 2HEOA 1TTYA 1SFEA 2GA2A 3F72A 1L3LA 2GQQA 3SHFA 4M72A 3BY6A 4G6QA 5JHUA 4A6DA 5CVJA 1OR7A 1Y0UA 3KP3A 4I09A 1B4AA 4IF4A 5DCFA 5F64A 3V7RA 4Y13A 3TQNA 3FXQA 2WWYA 4Q48A 2HR3A 1WKMA 2EA2A 1U5TA 4U7BA 1R58A 5AONA 2YX4A 5LHHA 2RVCA 4EVIA 2A69F 2BGCA 4JQFA 4BHBA 3GFLA 4IRIA 2QVOA 5LEKA 1YLFA 3EYYA 4JK1X 4M9ZA 2XVCA 2NRAC 2RDPA 4HQMA 3JAMK 3HSEA 3FMQA 5LHGA 3KP2A 1NHAA 2HQRA 3EETA 3IKTA 3LQRA 4UV8A 5DD8A 1Z9CA 3VOEA 3KZYA 1ONVA 1HQCA 4MNUA 1F4KA 3K1MA 3F23A 5CVUA 3KP4A 2IRFG 1UB9A 2OA4A 3WODF 3WGIA 2DK5A 3F21A 4R79A 3C7JA 1PP7U 2CGPA 3WTXC 2MBFA 3ECOA 2W57A 1TLHB 3ISPA 2NYXA 1BJAA 1H9GA 1ZH5A 5E17F 3EDPA 3CLOA 1LQ1A 3HYIA 1U78A 5LEJA 3T5XA 2FE3A 5FB2A 2F5DA 1J5YA 2OQRA 4KIFA 4RS8A 1T38A 1R5HA 4Q47A 1D8JA 3P9IA 3K2ZA 5D4RA 4XLNF 2QQAA 3V8JA 5D8KB 3C3WA 5HOOA 4A12A 4HOBA 2PG4A 2ADUA 3H3UA 1IN6A 2CO5A 2DT5A 1R1UA 1P4AA 1WSUA 4IHSA 3BDDA 3KP7A 3I53A 4I02A 3RKXA 3RDIA 1XN7A 3I0TA 2R3SA 4HAMA 2DBBA 3IHUA 1TW2A 1GHCA 3C1DA 3QU6A 3CTAA 1D3YA 3FX3A 4OMYA 1YW8A 1J0RA 4MHGA 2ISZA 3IKVA 2E1NA 3E6CC 3AAFA 3Q9VA 3F8FA 2ACJA 1LDDA 3FZVA 1USSA 1JHHA 4KIBA 3WTTC 2Y0MA 3WU1B 1CGPA 4IRGA 5J8CA 3CO6C 1I6XA 4RAYA 2A5YB 4QWQA 2DK8A 2CYYA 4CXFA 5H20A 2GA1A 4KYWA 3JTGA 4WWCA 3E5UA 3JTHA 5EEGA 2E7WA 5FD6A 4LD5A 2IA0A 4WK8F 3ERED 1W7PB 1LEAA 5EEHA 2MA3A 2IJLA 3E5XA 2FRHA 3BZ6A 1ZARA 1K78A 3TDZC 2KIFA 2QLZA 1ZG3A 2UWMA 3O6BB 2OU2A 5FGMA 1HSTA 2PMUA 2OAZA 2FNAA 2ZMEB 1B6AA 5FLXZ 4LLGF 4U88A 3QP5A 1XB4A 4MTEA 5D5UB 3L7WA 1ON1A 2MH9A 2DQRA 2RC4A 3CUQB 1HW5A 3DP7A 1W7PA 2EK5A 1OYIA 2NNNA 3MEXA 4MTDA 3H92A 5L3BA 1MJBA 1QZZA 2F5FA 1TBXA 3ZPLA 2FSWA 2RKHA 1FSHA 2RNJA 4O5VA 4GCVA 2FF4A 1BC7C 1IN4A 1D5VA 4GXOA 3TO9A 2P6TA 3I59A 5HLIA 3I64A 1ZGJA 3E6MA 2K7LA 3ZN1A 3E3VA 3OV8A 3DKWA 4WCGA 3GXOA 4ZZDA 2ZMEA 2M87A 1JGSA 2KIMA 4A5NA 1G3SA 4A0ZA 1O7LA 3QP6A 4KT5C 2L54A 4LJZF 1BI2A 3SQNA 5HLGA 4DNCA 1QGPA 3WTYC 4IHTA 1BOAA 4IJAA 1BI1A 1F9NA 3ELKA 4LK1F 2HTJA 1KYWA 4BHPA 5E18F 1I5ZA 4NHJA 1D8KA 4ESJA 1TQMA 3VFZA 4M73A 3K69A 4ENJA 2DI3A 1MGTA 2JPCA 2RQPA 1K7AA 4UHTA 3T0YA 2XROA 1IUYA 4P9FA 1IF1A 3RYPA 1KGSA 1Z91A 1SMTA 2OBPA 2Z99A 4G9YA 3R60A 4ZYEA 2YX7A 1JHFA 4HF0A 5J8FA 4KA4A 4P9UA 3F8CA 4XRFA 4FX0A 1WRJA 2LNBA 1KQ8A 4LK0F 2M45A 1T39A 4H0EA 1USTA 1KYZA 4OIOF 1ZHFA 3E6BA 2M1BA 2HWVA 1ZG1A 3M8EA 2QWWA 2IVMA 3K0LA 3U9GA 3V8LA 3WGHA 1YYVA 3BROA 3T8RA 1HSJA 3M1EA 2O61A 3V8KA 2ISYA 1LEBA 4M6XA 5DEQA 4LG0A 2L3DA 1RZ4A 1FBQA 5K5QA 4UVCA 3ZQ7A 2NAZA 2XASA 4KN7X 1DUXC 4B09A 3WTVC 2VC0A 1IN7A 1LDKB 4OOIA 4AWXB 2CQKA 5AIQA 3RI4A 4UVBA 4PCQA 3LWFA 1T98A 1U3EM 5E1WA 1H9TA 4G7HF 5CVIA 1I1SA 2JT1A 1O7FA 2K4JA 1J9IA 1WQ2A 1T6SA 3WTZA 3IWFA 4HV6A 3RYRA 1GVJA 5HDNA 2ELHA 3F8MA 1V3FA 3DPTA 3GYHX 4MGRA 2Y75A 3PQKA 4KN4X 3F22A 5JI6A 1OYYA 4OIPF 2XUBA 3J80Z 3RKYA 2H09A 4GYIA 1Z6TA 1I1GA 3FMSA 2VT3A 1FSEA 1XCVA 4HLXA 2EV5A 1S6LA 3B73A 1XMKA 5ICFA 2D45A 3FWEA 4CO8A 2FMYA 3RJPA 5K1YA 4IRHA 4RB1A 4HBLA 1FP1D 3TKYA 1DP7P 5TRDA 1IXCA 3V7CA 1SD5A 1XSDA 5TJJA 1OYWA 3F6OA 3WU0A 1XD7A 4BYYA 4MEXF 3HSRA 4G7OF 3I54A 4EJVA 2IA2A 2ZCWA 3I5UA 4EMSA 1STZA 2Q2EA 3HRTA 2E7XA 3KCCA 2VOOA 5BS6A 2RN7A 2HQNA 2XAHA 1DPUA 3LAJA 3CDHA 2VONA 2LDUA 4O3MA 4ON0A 2R7DA 1K6OA 2ZNZA 3IL2A 4A0YA 1Z6RA 1T2KA 2O8XA 3EQLF 3ECHA 3ZMZA 5ED4A 1W7PD 2A07F 2HYFA 1ZN2A 3KE2A 3GFJA 1SFXA 3PFIA 3M8FA 3FXRA 5JFRA 1P2FA 1P92A 1UHWA 3RPUA 4YIFA 3ZMSA 2D1VA 1RI7A 3HRSA 1FBSA 2V9VA 2Z5UA 1CF7B 3MZHA 2GAUA 3L2CA 2COMA 4CICA 3KLNA 2F2EA 3GEZA 3NRVA 1S7OA 2PLYA 1MDMB 2R7FA 4XLPF 4EGYA 1EH6A 3GUDA 3VB2A 3KP5A 1Z1DA 1IZ1A 1BM9A 5E1XA 5D5WB 4M6YA 4L5IA 4HW0A 3I58A 4Y15A 3LA7A 3I71A 1FYKA 2HTSA 4IPAA 2J5OA 1EH7A 1O3SA 4HZFA 2XAGA 4NQWA 2MD5A 2W84A 3RTRA 2STTA 1P4WA 3EUHA 1S8NA 1MDMA 1IN8A 2H6CA 3J80K 2XKOA 3QPHA 2ZO4A 1P4XA 4P55A 4MEYF 2DFIA 1K79A 2ETHA 3GZ6A 1SMYF 4AD9A 1BC8C 4MQVA 3JSOA 3WTUC 2ZNYA 5DUKA 5H6QA 1XGSA 2OZUA 5IT3A 2ZXJA 5HLHA 1KQ0A 3BWGA 5D6FA 2LF7A 3T1BA 2IP2A 2VBWA 1IXRC 3GLXA 4JBAA 1U2WA 4HDUA 2IPQX 2QQBA 2K02A 2VT2A 3CUOA 1TW3A 2DW4A 2GXBA 4LB5A 3TOBA 3HOSA 1YG2A 1UHMA 5CJ9A 4KMFA 5FFZA 3FMRA 4AIJA 2MC3A 3WTSC 1O3TA 2W24A 4GO1A 1YW9A 2QYOA 5BQTA 3PQJA 4S04A 2YPRA 1B1BA 4HLYA 2DAOA 2IW5A 5HS8A 1BI3A 2QM3A 4WXHA 1KU9A 1FYLA 3REOA 3CUQC 4BAYA 1YIOA 2O0YA 4ENNA 1HKSA 4G7ZF 1X3UA 1FPQA 2VOPA 1ZRCA 3L9FA 1KU2A 3ZMTA 1FP2A 3N4MA 5ICCA 3KP6A 1R1VA 2FBHA 2WTEA 3ZN0A 1MJ9A 2DLLA 4L0ZB 3KETA 5J6XA 2LKPA 4UUVA 1I27A 2L01A 3QU3A 3HRUA 3L09A 4I98B 4EQQA 2F5CA 3HHHA 1ODDA 2OD5A 1HW1A 3LFKA 1FOKA 1TNTA 1KA8A 2VBZA 2P6SA 1SAXA 2DPDA 4EV0A 2XV4S 5D5VB 2V6CA 1IAWA 1IN5A 2MLKA 1FT9A 1QBJA 5JR3A 4S05A 5K5RA 5E8GA 3WE2A 2V1UA 2QENA 2LF8A 4M9SA 2P7CB 1R00A 4ESFA 1O57A 2KJBA 2QQ9A 3TOAA 3E5QA 4EGZA 2BE5F 1XSVA 1LJ9A 3CUQA 5DV5A 2QZ8A 5CVVA 4F7ZA 3L00A 1JE8A 1XDUA 2BEOA 1YW7A 3FHZA 4HX4A 2L02A 5KK1A 4EM2A 1FLIA 1QQIA 3BPVA 1MZBA 4GGGA 2ESNA 4LB6B 3Q9SA 3P7NA 4WX9A 4KDPA 2DTRA 3FM5A 4I7HA 1J2XA 3QOPA 5FO5A 2QBYB 3DPLC 1XMAA 2VE8A 4R1HA 3HOTA 3MAJA 3G3ZA 1V4RA 3BJAA 3SXYA 4UNOA 1FZPB 1SD7A 1S29A 2PJPA 5HDKA 2P5VA 2CG4A 3IRRA 2XAQA 3HSFA 2YR2A 3H3ZA 2HOEA 2H94A 1R7JA 2MLGA 2G7UA 5HS9A 2PEXA 3E97A 2V79A 2QBYA 2H6BA 4XSZF 3N97A 2JPBA 4KUMA 5DCMB 4A5MA 4Q4ZF 2Q8KA 5ICGA 2GWRA 2PI0A 1G6NA 1YS6A 3WTWC 2W85A 2IA1A 1HW2A 2NNYA 4U0YA 3I4PA 1E17A 2VODA 1EV7A 1GXQA 4HX8A 4G94A 2JTVA 1ON2A 1ZRDA 2X0LA 4B8XA 2XHKA 4RGRA 2HKOA 1KQ9A 1QO0D 2EV6A 2L4MA 2P5KA 4N9IA 1REPC 2HKXA 2M5WA 4I0BA 5DYMA 4CHUA 1OPCA 1ZGAA 3LAPA 3F8BA 5LGNA 3DXJF 4M71A 4Z2YA 4P96A 1YFHA 1TNSA 2NS0A 5HS7A 2HS5A 5DUIA 1LVAA 2XAJA 5L3EA 4FT8A 4WF2A 1XGOA 4L9VA 1IW7F 2DQLA 3IC7A 1WI9A 3W6KB 1BBYA 4CDGA 3NQOA 2PFBA 1PP8F 2EB7A 1FC3A 1O3RA 3DV8A 1IXSB 4L0YB 4WXCA 3GO5A 3GF2A 2Y48A 5ICEA 2ZFWA 3C18A 4K2EA 2DPUA 3IWZA 1QZYA 2CWEA 2EFOA 5FD5A 2HYGD 3KZZA 4U7DA 3R0AA 5CLSA 1KU7A 2ZJ2A 4BH9A 1ZG5A 2P7VB 3HTSB 3CJNA 1TQPA 1XCBA 1LDJA 4EM0B 4ENKA 4I2OA 4LLNA 4RGSA 4LMYA 1XGNA 1EH8A 2EFWA 3DFGA 3ABUA 1ZLKA 1FY7A 3WE3A 1AOYA 4R8HA 4HX7A 2JSCA 3FXUA 1R22A 1WWXA 3J7AO 3NEUA 4OMZA 4OIQF 1U5TB 3ZP5A 5D6EA 3JSPA 5D5XB 3FM3A 3B02A 4L9JA 5HDGA 2EA4A 4RGXA 3D5LA 2RGVA 4QLCU 5BPDA 3MZYA 3J81Z 2WV0A 4UV9A 3GFIA 4RB0A 2K4BA 2VC1A 3HIFA 5LGTA 2VBXA 5ERIA 2G9WA 2HZTA 1ZYRF 2GXGA 5LRRA 1W4MA 3Q5FA 2VBYA 2P4WA 3KFWX 4NB5A 3QRFF 4PGGA 2CSOA 1W5TA 1TQIA 1YTYA 2H27A 3COAC 1L0OC 5L3GA 3DEUA 4WXDA 1PUEE 2Z3YA 2XRNA 3BOQA 2HGCA 3P9CA 3TDUC 2UXNA 2X4HA 1S3JA 4AIKA 2CFXA 4A6EA 1RUNA 4G6DA 4I0AA 5E20A 1CF7A 3LA3A 3RPQA 3QPTA 4UVAA 3V7SA 2FBKA 5L3DA 2K27A 5F1RA 1F1ZA 3ROUA 4ZYGA 4OIRF 1R23A 2K86A 2BYVE 4FHTA 3GFMA 5CVRA 3F6VA 2JRTA 3GZ5A 4YIIA 4KNYA 2KRFA 2TDXA 1Q1HA 3P9KA 5DD4A 3R0JA 5D8LB 1BI0A 1FBUA 3E6DA 3T8TA 2FOKA 4ETSA 1DDNA 4ZH4F 5A2QK 5BOXA 2KIUA 4LLLA 1LNWA 1H0MA 4LGWA 3M7GA 3FF5A 3BP8A 3CO7C 2XKPA 1HKQA 3LSTA 4EJUA 4ZZLA 4L5JA 1YQAA 5IT9Z 3TGNA 1O3QA 4RB3C 1HKTA 1BN5A 2PMHA 1G4DA 1KU3A 4KMUX 4XBFA 4ZYDA 3R4KA 3U2RA 5AIPA 4OU0A 1XGMA 4DQ2A 4PZJA 4IVNA 1F5TA 1ULYA 3G73A 2FU4A 4AIHA 5JVTA 3QAHA 2FA5A 3W6JB 2F5EA 4ASNA 4U0WA 4P5OA 1OMIA 3F8NA 2EFPA 5LLQA 4BXUA 2LSOA 4HV5A 4TV7A 1G3WA 1K78B 3GWZA 3RKWA 4XSXF 1MKMA 2W25A 3KEQA 3J81K 5L3FA 1OKRA 3VODA 3BJOA 2DO7A 1S7AA 5D4SA 4E70A 2PN6A 3SZPA 2PBIA 1B9MA 2JZYA 3ABTA 1ZAOA 4ZYHA 1G3YA 4EJWA 4UXNA 1ZREA 1E2XA 3BJ6A 3U1DA 2M30A 2L4AA 4BQAA 2XGXA 1YS7A 2EWNA 3I59B 5L3CA 4BHCA 1QNTA 2BBYA 3O3KA 2D2WA 4L9TA 2VE9A 2EJRA 6PAXA 4A2UA 5ILVA 2XIGA 1MJAA 2O6GE 3TO6A 5E8IA 5LHIA 2DU9A 2RV8A 2VN2A 3GVAA 2YU3A 4HF2A 1R36A 4EJOA 5BMZA 1UFMA 3K9TA 4ESBA 3ZMDA 2AS5F 1Z7UA 5F6FA 3HRMA 2Z9OA 5K5OA 3MCZA 2EFNA 2XAFA 4IXAA 2E1CA 4HA8A 2WC2A 2FNPA 2UZKA 1B9NA 5DDGA 3KLOA 2STWA 4HQEA 4A0XA 2ZKZA 3TO7A 4YFXF 3VEPA 2Q0OA 1U8RA 1HXDA 2CW0F 4KICA 5ILUA 4OINF 1GXPA 4O6JA 2IT0A 4M9XA 4D0PA 1ZRFA 3KEOA 5IT9K 3K1NA 1Z05A 2AXLA 1SFUA 5BPIA 2J5PA 2A6HF 4ENMA 1DPRA 1SD6A 2G7HA 2ESHA 2KKOA 4AVPA 2EV0A 2KJCA 3F3XA 4M74A 2VXZA 1FYMA 3R6SA 4CYDA 1RIOH 3V4GA 1T0FA 5LGUA 4LG0B 2C6YA 1FNNA 1IRFA 1W5SA 3DQVC 3ZMUA 2UXXA 1RNLA 1J7KA 3ML6A 2QUFA 4BNCA 4FX4A 3WGGA 1QPMA 1MD0A 2A6EF 1RUOA 4PGHA 2O3FA 3D0SA 1YO5C 3R61A 1FX7A 1JXSA 1A04A 5FFXA 4Y17A 5DCMA 3ULQB 5ILSA 1HBXG 3GX4X 4EM1A 2OQGA 1P6RA 4KIGA 2HFHA 2O03A 2OZ6A 2YSRA 3IRQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4L18 B;  3M9A A;  1C0W A;  3JAM Z;  4HF1 A;  2HDC A;  1VTN C;  4CGZ A;  1PDN C;  4RAZ A;  5E1Z B;  2A3S A;  3LQQ A;  3DF8 A;  3SFZ A;  3MWM A;  1R5G A;  2M8E A;  3K1P A;  1AWC A;  4GYG A;  4KFC A;  4YFK F;  2MH2 A;  2FXA A;  4YFN F;  2P8T A;  2FBI A;  4MQ9 F;  2V1D A;  5FLX K;  2D1H A;  1FWZ A;  4LFU A;  3OOP A;  4RB2 C;  2Z33 A;  1XSX A;  3WG9 A;  4EJT A;  2BV6 A;  2A68 F;  3O2P E;  3MQ0 A;  3GW2 A;  5H6R A;  1J75 A;  1J59 A;  2FEZ A;  1SD4 A;  1B59 A;  1LB2 A;  5A2Q Z;  3RIR A;  2GIV A;  1IRG A;  3HUG A;  4N0B A;  1U5T C;  2EFQ A;  3ZMV A;  4CZZ A;  3HTU A;  1G3T A;  4PDK A;  3LA2 A;  2ZBK A;  5LRS A;  3S2W A;  4Q5S F;  2GZW A;  5LBQ A;  4I01 A;  4HYE A;  2FQ3 A;  1R1T A;  4YG2 F;  2PQ8 A;  1ZLJ A;  4U0V A;  2B0L A;  1BIA A;  1UCR A;  4L9N A;  3BPX A;  1BIB A;  3EYI A;  1XDS A;  4RGU A;  2A61 A;  5KVR A;  5CYV A;  3MFK A;  5HVQ C;  3SZT A;  4N9H A;  2FML A;  3JW4 A;  3HHG A;  1U6G A;  2V1X A;  2P5L C;  4HDV A;  4G8X A;  2HEO A;  1TTY A;  1SFE A;  2GA2 A;  3F72 A;  1L3L A;  2GQQ A;  3SHF A;  4M72 A;  3BY6 A;  4G6Q A;  5JHU A;  4A6D A;  5CVJ A;  1OR7 A;  1Y0U A;  3KP3 A;  4I09 A;  1B4A A;  4IF4 A;  5DCF A;  5F64 A;  3V7R A;  4Y13 A;  3TQN A;  3FXQ A;  2WWY A;  4Q48 A;  2HR3 A;  1WKM A;  2EA2 A;  1U5T A;  4U7B A;  1R58 A;  5AON A;  2YX4 A;  5LHH A;  2RVC A;  4EVI A;  2A69 F;  2BGC A;  4JQF A;  4BHB A;  3GFL A;  4IRI A;  2QVO A;  5LEK A;  1YLF A;  3EYY A;  4JK1 X;  4M9Z A;  2XVC A;  2NRA C;  2RDP A;  4HQM A;  3JAM K;  3HSE A;  3FMQ A;  5LHG A;  3KP2 A;  1NHA A;  2HQR A;  3EET A;  3IKT A;  3LQR A;  4UV8 A;  5DD8 A;  1Z9C A;  3VOE A;  3KZY A;  1ONV A;  1HQC A;  4MNU A;  1F4K A;  3K1M A;  3F23 A;  5CVU A;  3KP4 A;  2IRF G;  1UB9 A;  2OA4 A;  3WOD F;  3WGI A;  2DK5 A;  3F21 A;  4R79 A;  3C7J A;  1PP7 U;  2CGP A;  3WTX C;  2MBF A;  3ECO A;  2W57 A;  1TLH B;  3ISP A;  2NYX A;  1BJA A;  1H9G A;  1ZH5 A;  5E17 F;  3EDP A;  3CLO A;  1LQ1 A;  3HYI A;  1U78 A;  5LEJ A;  3T5X A;  2FE3 A;  5FB2 A;  2F5D A;  1J5Y A;  2OQR A;  4KIF A;  4RS8 A;  1T38 A;  1R5H A;  4Q47 A;  1D8J A;  3P9I A;  3K2Z A;  5D4R A;  4XLN F;  2QQA A;  3V8J A;  5D8K B;  3C3W A;  5HOO A;  4A12 A;  4HOB A;  2PG4 A;  2ADU A;  3H3U A;  1IN6 A;  2CO5 A;  2DT5 A;  1R1U A;  1P4A A;  1WSU A;  4IHS A;  3BDD A;  3KP7 A;  3I53 A;  4I02 A;  3RKX A;  3RDI A;  1XN7 A;  3I0T A;  2R3S A;  4HAM A;  2DBB A;  3IHU A;  1TW2 A;  1GHC A;  3C1D A;  3QU6 A;  3CTA A;  1D3Y A;  3FX3 A;  4OMY A;  1YW8 A;  1J0R A;  4MHG A;  2ISZ A;  3IKV A;  2E1N A;  3E6C C;  3AAF A;  3Q9V A;  3F8F A;  2ACJ A;  1LDD A;  3FZV A;  1USS A;  1JHH A;  4KIB A;  3WTT C;  2Y0M A;  3WU1 B;  1CGP A;  4IRG A;  5J8C A;  3CO6 C;  1I6X A;  4RAY A;  2A5Y B;  4QWQ A;  2DK8 A;  2CYY A;  4CXF A;  5H20 A;  2GA1 A;  4KYW A;  3JTG A;  4WWC A;  3E5U A;  3JTH A;  5EEG A;  2E7W A;  5FD6 A;  4LD5 A;  2IA0 A;  4WK8 F;  3ERE D;  1W7P B;  1LEA A;  5EEH A;  2MA3 A;  2IJL A;  3E5X A;  2FRH A;  3BZ6 A;  1ZAR A;  1K78 A;  3TDZ C;  2KIF A;  2QLZ A;  1ZG3 A;  2UWM A;  3O6B B;  2OU2 A;  5FGM A;  1HST A;  2PMU A;  2OAZ A;  2FNA A;  2ZME B;  1B6A A;  5FLX Z;  4LLG F;  4U88 A;  3QP5 A;  1XB4 A;  4MTE A;  5D5U B;  3L7W A;  1ON1 A;  2MH9 A;  2DQR A;  2RC4 A;  3CUQ B;  1HW5 A;  3DP7 A;  1W7P A;  2EK5 A;  1OYI A;  2NNN A;  3MEX A;  4MTD A;  3H92 A;  5L3B A;  1MJB A;  1QZZ A;  2F5F A;  1TBX A;  3ZPL A;  2FSW A;  2RKH A;  1FSH A;  2RNJ A;  4O5V A;  4GCV A;  2FF4 A;  1BC7 C;  1IN4 A;  1D5V A;  4GXO A;  3TO9 A;  2P6T A;  3I59 A;  5HLI A;  3I64 A;  1ZGJ A;  3E6M A;  2K7L A;  3ZN1 A;  3E3V A;  3OV8 A;  3DKW A;  4WCG A;  3GXO A;  4ZZD A;  2ZME A;  2M87 A;  1JGS A;  2KIM A;  4A5N A;  1G3S A;  4A0Z A;  1O7L A;  3QP6 A;  4KT5 C;  2L54 A;  4LJZ F;  1BI2 A;  3SQN A;  5HLG A;  4DNC A;  1QGP A;  3WTY C;  4IHT A;  1BOA A;  4IJA A;  1BI1 A;  1F9N A;  3ELK A;  4LK1 F;  2HTJ A;  1KYW A;  4BHP A;  5E18 F;  1I5Z A;  4NHJ A;  1D8K A;  4ESJ A;  1TQM A;  3VFZ A;  4M73 A;  3K69 A;  4ENJ A;  2DI3 A;  1MGT A;  2JPC A;  2RQP A;  1K7A A;  4UHT A;  3T0Y A;  2XRO A;  1IUY A;  4P9F A;  1IF1 A;  3RYP A;  1KGS A;  1Z91 A;  1SMT A;  2OBP A;  2Z99 A;  4G9Y A;  3R60 A;  4ZYE A;  2YX7 A;  1JHF A;  4HF0 A;  5J8F A;  4KA4 A;  4P9U A;  3F8C A;  4XRF A;  4FX0 A;  1WRJ A;  2LNB A;  1KQ8 A;  4LK0 F;  2M45 A;  1T39 A;  4H0E A;  1UST A;  1KYZ A;  4OIO F;  1ZHF A;  3E6B A;  2M1B A;  2HWV A;  1ZG1 A;  3M8E A;  2QWW A;  2IVM A;  3K0L A;  3U9G A;  3V8L A;  3WGH A;  1YYV A;  3BRO A;  3T8R A;  1HSJ A;  3M1E A;  2O61 A;  3V8K A;  2ISY A;  1LEB A;  4M6X A;  5DEQ A;  4LG0 A;  2L3D A;  1RZ4 A;  1FBQ A;  5K5Q A;  4UVC A;  3ZQ7 A;  2NAZ A;  2XAS A;  4KN7 X;  1DUX C;  4B09 A;  3WTV C;  2VC0 A;  1IN7 A;  1LDK B;  4OOI A;  4AWX B;  2CQK A;  5AIQ A;  3RI4 A;  4UVB A;  4PCQ A;  3LWF A;  1T98 A;  1U3E M;  5E1W A;  1H9T A;  4G7H F;  5CVI A;  1I1S A;  2JT1 A;  1O7F A;  2K4J A;  1J9I A;  1WQ2 A;  1T6S A;  3WTZ A;  3IWF A;  4HV6 A;  3RYR A;  1GVJ A;  5HDN A;  2ELH A;  3F8M A;  1V3F A;  3DPT A;  3GYH X;  4MGR A;  2Y75 A;  3PQK A;  4KN4 X;  3F22 A;  5JI6 A;  1OYY A;  4OIP F;  2XUB A;  3J80 Z;  3RKY A;  2H09 A;  4GYI A;  1Z6T A;  1I1G A;  3FMS A;  2VT3 A;  1FSE A;  1XCV A;  4HLX A;  2EV5 A;  1S6L A;  3B73 A;  1XMK A;  5ICF A;  2D45 A;  3FWE A;  4CO8 A;  2FMY A;  3RJP A;  5K1Y A;  4IRH A;  4RB1 A;  4HBL A;  1FP1 D;  3TKY A;  1DP7 P;  5TRD A;  1IXC A;  3V7C A;  1SD5 A;  1XSD A;  5TJJ A;  1OYW A;  3F6O A;  3WU0 A;  1XD7 A;  4BYY A;  4MEX F;  3HSR A;  4G7O F;  3I54 A;  4EJV A;  2IA2 A;  2ZCW A;  3I5U A;  4EMS A;  1STZ A;  2Q2E A;  3HRT A;  2E7X A;  3KCC A;  2VOO A;  5BS6 A;  2RN7 A;  2HQN A;  2XAH A;  1DPU A;  3LAJ A;  3CDH A;  2VON A;  2LDU A;  4O3M A;  4ON0 A;  2R7D A;  1K6O A;  2ZNZ A;  3IL2 A;  4A0Y A;  1Z6R A;  1T2K A;  2O8X A;  3EQL F;  3ECH A;  3ZMZ A;  5ED4 A;  1W7P D;  2A07 F;  2HYF A;  1ZN2 A;  3KE2 A;  3GFJ A;  1SFX A;  3PFI A;  3M8F A;  3FXR A;  5JFR A;  1P2F A;  1P92 A;  1UHW A;  3RPU A;  4YIF A;  3ZMS A;  2D1V A;  1RI7 A;  3HRS A;  1FBS A;  2V9V A;  2Z5U A;  1CF7 B;  3MZH A;  2GAU A;  3L2C A;  2COM A;  4CIC A;  3KLN A;  2F2E A;  3GEZ A;  3NRV A;  1S7O A;  2PLY A;  1MDM B;  2R7F A;  4XLP F;  4EGY A;  1EH6 A;  3GUD A;  3VB2 A;  3KP5 A;  1Z1D A;  1IZ1 A;  1BM9 A;  5E1X A;  5D5W B;  4M6Y A;  4L5I A;  4HW0 A;  3I58 A;  4Y15 A;  3LA7 A;  3I71 A;  1FYK A;  2HTS A;  4IPA A;  2J5O A;  1EH7 A;  1O3S A;  4HZF A;  2XAG A;  4NQW A;  2MD5 A;  2W84 A;  3RTR A;  2STT A;  1P4W A;  3EUH A;  1S8N A;  1MDM A;  1IN8 A;  2H6C A;  3J80 K;  2XKO A;  3QPH A;  2ZO4 A;  1P4X A;  4P55 A;  4MEY F;  2DFI A;  1K79 A;  2ETH A;  3GZ6 A;  1SMY F;  4AD9 A;  1BC8 C;  4MQV A;  3JSO A;  3WTU C;  2ZNY A;  5DUK A;  5H6Q A;  1XGS A;  2OZU A;  5IT3 A;  2ZXJ A;  5HLH A;  1KQ0 A;  3BWG A;  5D6F A;  2LF7 A;  3T1B A;  2IP2 A;  2VBW A;  1IXR C;  3GLX A;  4JBA A;  1U2W A;  4HDU A;  2IPQ X;  2QQB A;  2K02 A;  2VT2 A;  3CUO A;  1TW3 A;  2DW4 A;  2GXB A;  4LB5 A;  3TOB A;  3HOS A;  1YG2 A;  1UHM A;  5CJ9 A;  4KMF A;  5FFZ A;  3FMR A;  4AIJ A;  2MC3 A;  3WTS C;  1O3T A;  2W24 A;  4GO1 A;  1YW9 A;  2QYO A;  5BQT A;  3PQJ A;  4S04 A;  2YPR A;  1B1B A;  4HLY A;  2DAO A;  2IW5 A;  5HS8 A;  1BI3 A;  2QM3 A;  4WXH A;  1KU9 A;  1FYL A;  3REO A;  3CUQ C;  4BAY A;  1YIO A;  2O0Y A;  4ENN A;  1HKS A;  4G7Z F;  1X3U A;  1FPQ A;  2VOP A;  1ZRC A;  3L9F A;  1KU2 A;  3ZMT A;  1FP2 A;  3N4M A;  5ICC A;  3KP6 A;  1R1V A;  2FBH A;  2WTE A;  3ZN0 A;  1MJ9 A;  2DLL A;  4L0Z B;  3KET A;  5J6X A;  2LKP A;  4UUV A;  1I27 A;  2L01 A;  3QU3 A;  3HRU A;  3L09 A;  4I98 B;  4EQQ A;  2F5C A;  3HHH A;  1ODD A;  2OD5 A;  1HW1 A;  3LFK A;  1FOK A;  1TNT A;  1KA8 A;  2VBZ A;  2P6S A;  1SAX A;  2DPD A;  4EV0 A;  2XV4 S;  5D5V B;  2V6C A;  1IAW A;  1IN5 A;  2MLK A;  1FT9 A;  1QBJ A;  5JR3 A;  4S05 A;  5K5R A;  5E8G A;  3WE2 A;  2V1U A;  2QEN A;  2LF8 A;  4M9S A;  2P7C B;  1R00 A;  4ESF A;  1O57 A;  2KJB A;  2QQ9 A;  3TOA A;  3E5Q A;  4EGZ A;  2BE5 F;  1XSV A;  1LJ9 A;  3CUQ A;  5DV5 A;  2QZ8 A;  5CVV A;  4F7Z A;  3L00 A;  1JE8 A;  1XDU A;  2BEO A;  1YW7 A;  3FHZ A;  4HX4 A;  2L02 A;  5KK1 A;  4EM2 A;  1FLI A;  1QQI A;  3BPV A;  1MZB A;  4GGG A;  2ESN A;  4LB6 B;  3Q9S A;  3P7N A;  4WX9 A;  4KDP A;  2DTR A;  3FM5 A;  4I7H A;  1J2X A;  3QOP A;  5FO5 A;  2QBY B;  3DPL C;  1XMA A;  2VE8 A;  4R1H A;  3HOT A;  3MAJ A;  3G3Z A;  1V4R A;  3BJA A;  3SXY A;  4UNO A;  1FZP B;  1SD7 A;  1S29 A;  2PJP A;  5HDK A;  2P5V A;  2CG4 A;  3IRR A;  2XAQ A;  3HSF A;  2YR2 A;  3H3Z A;  2HOE A;  2H94 A;  1R7J A;  2MLG A;  2G7U A;  5HS9 A;  2PEX A;  3E97 A;  2V79 A;  2QBY A;  2H6B A;  4XSZ F;  3N97 A;  2JPB A;  4KUM A;  5DCM B;  4A5M A;  4Q4Z F;  2Q8K A;  5ICG A;  2GWR A;  2PI0 A;  1G6N A;  1YS6 A;  3WTW C;  2W85 A;  2IA1 A;  1HW2 A;  2NNY A;  4U0Y A;  3I4P A;  1E17 A;  2VOD A;  1EV7 A;  1GXQ A;  4HX8 A;  4G94 A;  2JTV A;  1ON2 A;  1ZRD A;  2X0L A;  4B8X A;  2XHK A;  4RGR A;  2HKO A;  1KQ9 A;  1QO0 D;  2EV6 A;  2L4M A;  2P5K A;  4N9I A;  1REP C;  2HKX A;  2M5W A;  4I0B A;  5DYM A;  4CHU A;  1OPC A;  1ZGA A;  3LAP A;  3F8B A;  5LGN A;  3DXJ F;  4M71 A;  4Z2Y A;  4P96 A;  1YFH A;  1TNS A;  2NS0 A;  5HS7 A;  2HS5 A;  5DUI A;  1LVA A;  2XAJ A;  5L3E A;  4FT8 A;  4WF2 A;  1XGO A;  4L9V A;  1IW7 F;  2DQL A;  3IC7 A;  1WI9 A;  3W6K B;  1BBY A;  4CDG A;  3NQO A;  2PFB A;  1PP8 F;  2EB7 A;  1FC3 A;  1O3R A;  3DV8 A;  1IXS B;  4L0Y B;  4WXC A;  3GO5 A;  3GF2 A;  2Y48 A;  5ICE A;  2ZFW A;  3C18 A;  4K2E A;  2DPU A;  3IWZ A;  1QZY A;  2CWE A;  2EFO A;  5FD5 A;  2HYG D;  3KZZ A;  4U7D A;  3R0A A;  5CLS A;  1KU7 A;  2ZJ2 A;  4BH9 A;  1ZG5 A;  2P7V B;  3HTS B;  3CJN A;  1TQP A;  1XCB A;  1LDJ A;  4EM0 B;  4ENK A;  4I2O A;  4LLN A;  4RGS A;  4LMY A;  1XGN A;  1EH8 A;  2EFW A;  3DFG A;  3ABU A;  1ZLK A;  1FY7 A;  3WE3 A;  1AOY A;  4R8H A;  4HX7 A;  2JSC A;  3FXU A;  1R22 A;  1WWX A;  3J7A O;  3NEU A;  4OMZ A;  4OIQ F;  1U5T B;  3ZP5 A;  5D6E A;  3JSP A;  5D5X B;  3FM3 A;  3B02 A;  4L9J A;  5HDG A;  2EA4 A;  4RGX A;  3D5L A;  2RGV A;  4QLC U;  5BPD A;  3MZY A;  3J81 Z;  2WV0 A;  4UV9 A;  3GFI A;  4RB0 A;  2K4B A;  2VC1 A;  3HIF A;  5LGT A;  2VBX A;  5ERI A;  2G9W A;  2HZT A;  1ZYR F;  2GXG A;  5LRR A;  1W4M A;  3Q5F A;  2VBY A;  2P4W A;  3KFW X;  4NB5 A;  3QRF F;  4PGG A;  2CSO A;  1W5T A;  1TQI A;  1YTY A;  2H27 A;  3COA C;  1L0O C;  5L3G A;  3DEU A;  4WXD A;  1PUE E;  2Z3Y A;  2XRN A;  3BOQ A;  2HGC A;  3P9C A;  3TDU C;  2UXN A;  2X4H A;  1S3J A;  4AIK A;  2CFX A;  4A6E A;  1RUN A;  4G6D A;  4I0A A;  5E20 A;  1CF7 A;  3LA3 A;  3RPQ A;  3QPT A;  4UVA A;  3V7S A;  2FBK A;  5L3D A;  2K27 A;  5F1R A;  1F1Z A;  3ROU A;  4ZYG A;  4OIR F;  1R23 A;  2K86 A;  2BYV E;  4FHT A;  3GFM A;  5CVR A;  3F6V A;  2JRT A;  3GZ5 A;  4YII A;  4KNY A;  2KRF A;  2TDX A;  1Q1H A;  3P9K A;  5DD4 A;  3R0J A;  5D8L B;  1BI0 A;  1FBU A;  3E6D A;  3T8T A;  2FOK A;  4ETS A;  1DDN A;  4ZH4 F;  5A2Q K;  5BOX A;  2KIU A;  4LLL A;  1LNW A;  1H0M A;  4LGW A;  3M7G A;  3FF5 A;  3BP8 A;  3CO7 C;  2XKP A;  1HKQ A;  3LST A;  4EJU A;  4ZZL A;  4L5J A;  1YQA A;  5IT9 Z;  3TGN A;  1O3Q A;  4RB3 C;  1HKT A;  1BN5 A;  2PMH A;  1G4D A;  1KU3 A;  4KMU X;  4XBF A;  4ZYD A;  3R4K A;  3U2R A;  5AIP A;  4OU0 A;  1XGM A;  4DQ2 A;  4PZJ A;  4IVN A;  1F5T A;  1ULY A;  3G73 A;  2FU4 A;  4AIH A;  5JVT A;  3QAH A;  2FA5 A;  3W6J B;  2F5E A;  4ASN A;  4U0W A;  4P5O A;  1OMI A;  3F8N A;  2EFP A;  5LLQ A;  4BXU A;  2LSO A;  4HV5 A;  4TV7 A;  1G3W A;  1K78 B;  3GWZ A;  3RKW A;  4XSX F;  1MKM A;  2W25 A;  3KEQ A;  3J81 K;  5L3F A;  1OKR A;  3VOD A;  3BJO A;  2DO7 A;  1S7A A;  5D4S A;  4E70 A;  2PN6 A;  3SZP A;  2PBI A;  1B9M A;  2JZY A;  3ABT A;  1ZAO A;  4ZYH A;  1G3Y A;  4EJW A;  4UXN A;  1ZRE A;  1E2X A;  3BJ6 A;  3U1D A;  2M30 A;  2L4A A;  4BQA A;  2XGX A;  1YS7 A;  2EWN A;  3I59 B;  5L3C A;  4BHC A;  1QNT A;  2BBY A;  3O3K A;  2D2W A;  4L9T A;  2VE9 A;  2EJR A;  6PAX A;  4A2U A;  5ILV A;  2XIG A;  1MJA A;  2O6G E;  3TO6 A;  5E8I A;  5LHI A;  2DU9 A;  2RV8 A;  2VN2 A;  3GVA A;  2YU3 A;  4HF2 A;  1R36 A;  4EJO A;  5BMZ A;  1UFM A;  3K9T A;  4ESB A;  3ZMD A;  2AS5 F;  1Z7U A;  5F6F A;  3HRM A;  2Z9O A;  5K5O A;  3MCZ A;  2EFN A;  2XAF A;  4IXA A;  2E1C A;  4HA8 A;  2WC2 A;  2FNP A;  2UZK A;  1B9N A;  5DDG A;  3KLO A;  2STW A;  4HQE A;  4A0X A;  2ZKZ A;  3TO7 A;  4YFX F;  3VEP A;  2Q0O A;  1U8R A;  1HXD A;  2CW0 F;  4KIC A;  5ILU A;  4OIN F;  1GXP A;  4O6J A;  2IT0 A;  4M9X A;  4D0P A;  1ZRF A;  3KEO A;  5IT9 K;  3K1N A;  1Z05 A;  2AXL A;  1SFU A;  5BPI A;  2J5P A;  2A6H F;  4ENM A;  1DPR A;  1SD6 A;  2G7H A;  2ESH A;  2KKO A;  4AVP A;  2EV0 A;  2KJC A;  3F3X A;  4M74 A;  2VXZ A;  1FYM A;  3R6S A;  4CYD A;  1RIO H;  3V4G A;  1T0F A;  5LGU A;  4LG0 B;  2C6Y A;  1FNN A;  1IRF A;  1W5S A;  3DQV C;  3ZMU A;  2UXX A;  1RNL A;  1J7K A;  3ML6 A;  2QUF A;  4BNC A;  4FX4 A;  3WGG A;  1QPM A;  1MD0 A;  2A6E F;  1RUO A;  4PGH A;  2O3F A;  3D0S A;  1YO5 C;  3R61 A;  1FX7 A;  1JXS A;  1A04 A;  5FFX A;  4Y17 A;  5DCM A;  3ULQ B;  5ILS A;  1HBX G;  3GX4 X;  4EM1 A;  2OQG A;  1P6R A;  4KIG A;  2HFH A;  2O03 A;  2OZ6 A;  2YSR A;  3IRQ A; 
#chains in the Genus database with same CATH topology
 1HF0 A;  4L18 B;  3DEW A;  3M9A A;  3DKX A;  3KYL A;  1C0W A;  1DU0 A;  3JAM Z;  4HF1 A;  2HDC A;  1VTN C;  4CGZ A;  3IH2 A;  1PDN C;  4B48 A;  4RAZ A;  5E1Z B;  5F1J A;  3DBH B;  2A3S A;  3LQQ A;  2DA6 A;  3DF8 A;  3HPG A;  3SFZ A;  1MSF C;  3MWM A;  2IAI A;  3UKG A;  5EEA A;  3FIW A;  1R5G A;  2M8E A;  3OYI A;  3K1P A;  1AWC A;  4GYG A;  1AKH B;  4KFC A;  1JKO C;  4YFK F;  1XX5 A;  2HVQ A;  2MH2 A;  2FXA A;  4YFN F;  4BBS J;  2P8T A;  3CES A;  2KMU A;  4RA2 A;  2FBI A;  2VI6 A;  3HUG B;  2V1D A;  4MQ9 F;  3I55 I;  2DN0 A;  2D1H A;  5FLX K;  1FWZ A;  3KPH A;  1HOM A;  2ZC2 A;  4LFU A;  1ZR2 A;  3UNG C;  5IP6 A;  2R5Z B;  3JCU C;  2HPM A;  2W00 A;  3H1C A;  3OOP A;  4RB2 C;  2Z33 A;  3BG5 A;  3S93 A;  1XSX A;  3WG9 A;  2E35 A;  1S9H A;  5F0C A;  4EJT A;  1X1B A;  2BV6 A;  4S0H B;  2A68 F;  3O2P E;  2DA3 A;  4XOT A;  1LE8 B;  3MQ0 A;  3GW2 A;  4PK4 A;  4YIR X;  1OR7 C;  5H6R A;  4D9J A;  1J75 A;  1Z3X A;  3QWL A;  1J59 A;  2FEZ A;  2EIK H;  1SD4 A;  1B59 A;  1AKH A;  1WHU A;  5EZG A;  1DGR M;  2KDO A;  1LB2 A;  5A2Q Z;  3RIR A;  3LSM A;  2GIV A;  5HLT A;  4FE7 A;  4IL6 C;  3PSF A;  1IRG A;  3HUG A;  2LK2 A;  4N0B A;  4PFP A;  1U5T C;  2HQA A;  1T08 B;  1JUS A;  2EFQ A;  3ZMV A;  4CZZ A;  1BW5 A;  2CQN A;  4FIS A;  3ZOB A;  2R5Z A;  3HTU A;  1G3T A;  2HDD A;  2NXN B;  2XF5 A;  4PDK A;  3LA2 A;  2ZBK A;  5LRS A;  3S2W A;  2Q2E B;  5B3S H;  4Q5S F;  3KX2 A;  2GZW A;  3W2W A;  4JOM A;  4P1W A;  5LBQ A;  4M3B A;  1YIT I;  4I01 A;  3D5S C;  4HYE A;  2JA6 J;  3QYE A;  4CUG A;  2FQ3 A;  2R4G A;  4JYK A;  1MMS A;  1ZKG A;  1R1T A;  2DMQ A;  2PQ8 A;  4YG2 F;  3J7Y J;  4Y52 J;  2YS9 A;  1ZLJ A;  1Z67 A;  4U0V A;  2B0L A;  3CP2 A;  1BIA A;  1UCR A;  4L9N A;  3BPX A;  1OQY A;  4PJL A;  1BIB A;  3A4C A;  3EYI A;  4C3I J;  1XDS A;  3F0C A;  3K6G A;  4RGU A;  2A61 A;  5GPC A;  3MD2 A;  3S1R J;  1RR8 C;  5B1B H;  2P0W A;  5KVR A;  5IOY A;  5CYV A;  3MFK A;  3IV5 A;  3BLY A;  3SZT A;  2DOD A;  5HVQ C;  4JX6 A;  1W36 C;  2ID3 A;  1BR1 A;  2TRT A;  4N9H A;  2FML A;  4NC8 A;  1OCP A;  3JW4 A;  3HHG A;  4BQO A;  3CCR I;  2JA2 A;  1U6G A;  2V1X A;  2ME0 A;  2E34 A;  2P5L C;  3M8J A;  2BY1 A;  4HG2 A;  2E1M B;  4HDV A;  2EIM H;  1U0J A;  2JK3 A;  4G8X A;  1ERD A;  1M1E B;  3BTJ A;  4BXF A;  3G71 I;  3OL3 A;  2R7O A;  2BY2 A;  4IX7 A;  1W0U A;  2GM4 A;  2MGQ A;  2HEO A;  2I5U A;  1TTY A;  1RR7 A;  2CJJ A;  2LKS A;  1SFE A;  2GA2 A;  3F72 A;  1L3L A;  2GQQ A;  3CJR B;  2CV1 A;  5J40 A;  2LFB A;  5EG0 B;  3SHF A;  5LD2 C;  4M72 A;  1P7I A;  1W1W E;  3BY6 A;  2W48 A;  3HG9 A;  4G6Q A;  5JHU A;  3K4J A;  4A6D A;  1ORK A;  5IP7 J;  5CVJ A;  1OR7 A;  1Y0U A;  3KP3 A;  2A05 A;  1B4A A;  4I09 A;  4IF4 A;  1FTT A;  5DCF A;  1YX5 A;  2RNG A;  5F64 A;  3V7R A;  2LYC A;  4LOC A;  3P5J A;  2X48 A;  4Y13 A;  3TQN A;  1OFC X;  3FXQ A;  2WWY A;  1MW7 A;  2VJI A;  4Q48 A;  5KAF C;  4XN3 A;  1X3Z B;  2HR3 A;  1WKM A;  2EA2 A;  3OYN A;  1U5T A;  5E3L A;  4U7B A;  3QOE A;  2B7E A;  2R5Y B;  5FKO A;  1X1A A;  1R58 A;  5AON A;  2YX4 A;  2RVC A;  5LHH A;  4EVI A;  2A69 F;  2BGC A;  4BL0 B;  4JQF A;  4BHB A;  3GFL A;  2LRE A;  4IRI A;  3GTL J;  2F6C A;  2QVO A;  3ABK H;  5LEK A;  1YLF A;  3LFU A;  3EYY A;  2L9R A;  4JK1 X;  1KZH A;  2BW3 B;  4M9Z A;  2XVC A;  2NRA C;  2RDP A;  4NQW B;  3IP4 B;  4HQM A;  5J1Y A;  3JAM K;  3HSE A;  3FMQ A;  2OCE A;  1VQ6 I;  2DA2 A;  4RDU A;  5LHG A;  1JKQ C;  4XKC A;  1V5G A;  3KP2 A;  3LOC A;  1IDY A;  1NHA A;  2HQR A;  3EET A;  5B5E C;  3IKT A;  3TW6 A;  3LQR A;  1RKW A;  1ZEL A;  3TED A;  1WJA A;  4UV8 A;  5DD8 A;  1Z9C A;  3PUF A;  3KZY A;  1ONV A;  1HQC A;  3VOE A;  3OYB A;  1AHD P;  4LIU A;  1RET A;  2CUZ A;  4XKV A;  4MNU A;  2AQE A;  1F4K A;  4MFD A;  2VKV A;  3K1M A;  1X2N A;  4F52 A;  3F23 A;  5CVU A;  5FKL A;  2KRC A;  3KP4 A;  2IRF G;  2M0C A;  1UB9 A;  2OA4 A;  3WOD F;  1YI2 I;  3LSI A;  4B1R A;  3WGI A;  3DWL E;  4UB6 C;  4F93 B;  2DK5 A;  1D5Y A;  4ZC3 A;  1F36 A;  3F21 A;  4FET A;  4R79 A;  2L0K A;  3C7J A;  1PP7 U;  2I10 A;  2CGP A;  3WTX C;  1GV5 A;  2MBF A;  3ECO A;  4XNF A;  4HNV A;  2W57 A;  1FEX A;  1X19 A;  2PX9 A;  1TLH B;  3ISP A;  3K4N A;  2NYX A;  5H2F C;  5C4J J;  1IGN A;  3MKW B;  3CQZ J;  1BJA A;  3WU2 C;  1H9G A;  4ZDL A;  3VYT B;  1ZH5 A;  5E17 F;  3JRI A;  1S5L C;  5DM6 F;  3HC7 A;  2XPV A;  3CLO A;  3EDP A;  3FKJ A;  3DLL F;  1LQ1 A;  1IRX A;  2XGD A;  3HYI A;  1Z7L A;  1U78 A;  1MBH A;  5LEJ A;  3CC4 I;  3T5X A;  1POG A;  1QA6 A;  2FE3 A;  5FB2 A;  5FRM A;  2JA7 J;  1Y0N A;  2F5D A;  2IGM A;  3C2G A;  1J5Y A;  2OQR A;  3HL2 A;  4KIF A;  4RS8 A;  1T38 A;  1R5H A;  4Q47 A;  1D8J A;  3P9I A;  3K2Z A;  4ZDP A;  1R71 A;  5GPA A;  2R7Q A;  5D4R A;  4XLN F;  2VB6 A;  2QQA A;  1VQ7 I;  3V8J A;  2KQR A;  2YU9 J;  5D8K B;  3C3W A;  5HOO A;  4A12 A;  3H5R A;  4HOB A;  2PG4 A;  1ZQ3 P;  2ADU A;  3M07 A;  1IN6 A;  2OUM A;  1R1U A;  1P4A A;  2CO5 A;  2DT5 A;  3CDL A;  3H3U A;  3MKL A;  2OJE D;  5C3E J;  1WSU A;  4IHS A;  2O7O A;  5IYD J;  5GP9 A;  1VQP I;  3BDD A;  4G12 A;  4XLC A;  3ABL H;  3KP7 A;  3OYD A;  3PO2 J;  1SVL A;  4ZYA A;  3I53 A;  2ME6 A;  3S8P A;  2CUF A;  4I02 A;  3RDI A;  3RKX A;  1XN7 A;  3I0T A;  3K4K A;  2R3S A;  2IS4 A;  4UB8 C;  4UY8 I;  4HAM A;  1P9Q C;  4XKB A;  2HOS A;  1TWF J;  5J1R A;  1OCC H;  2DA4 A;  4F92 B;  2DBB A;  2JMW A;  3IHU A;  1TW2 A;  3GTO J;  1GHC A;  3C1D A;  3QU6 A;  3CTA A;  1LFU P;  1Y8Q B;  1D3Y A;  2CQ7 A;  1WCM J;  3FX3 A;  1WJD A;  1YW8 A;  4OMY A;  4NBQ A;  2XF7 A;  1J0R A;  4B3A A;  4MHG A;  1VFC A;  2ISZ A;  1T33 A;  4EEF G;  3IKV A;  2E1N A;  3E6C C;  3AAF A;  1N75 A;  3H5A A;  3Q9V A;  3ZXS A;  4ABZ A;  3F8F A;  2ACJ A;  1IV8 A;  1LDD A;  2IXS A;  3FZV A;  4KIT B;  1USS A;  1JHH A;  1TT0 A;  2Y2Z A;  4KIB A;  5FRO A;  3WTT C;  3HGG A;  2Y0M A;  3KIO A;  3WU1 B;  4HSR A;  2HXI A;  2DYS H;  1H8A C;  4XLA A;  1CGP A;  1R4N B;  4IRG A;  4XOP A;  2R7R A;  4BEH A;  5J8C A;  2M4G A;  4IOA F;  4HPQ A;  5M3F J;  2FQ4 A;  3FXJ A;  3Q0U A;  3CO6 C;  1I6X A;  4RAY A;  2A5Y B;  4QWQ A;  2DK8 A;  5TGT A;  4IKF A;  1B8I B;  2CYY A;  1Z21 A;  4CXF A;  2N8G A;  5H20 A;  2GA1 A;  4KYW A;  3VYS B;  1UJ8 A;  2M7A A;  3JTG A;  2LG4 A;  4WWC A;  3E5U A;  3JTH A;  5EEG A;  5JLX A;  2E7W A;  4BDY A;  5FD6 A;  4LD5 A;  2OV7 A;  2IA0 A;  4WK8 F;  3ERE D;  1W7P B;  5E3N A;  1S7E A;  3FXM A;  1LEA A;  5EEH A;  2MA3 A;  2V1N A;  1SAN A;  3MKY B;  5F27 A;  1WJE A;  2DMP A;  2IJL A;  3E5X A;  2FRH A;  3OYE A;  2VKE A;  4CCJ A;  3OYC A;  1XPX A;  3BZ6 A;  3G4S I;  1ZAR A;  1K78 A;  4CCM A;  3TDZ C;  2KIF A;  3H35 A;  2QLZ A;  1AU7 A;  1ZG3 A;  4GFB A;  2UWM A;  3O6B B;  2KRH A;  2OU2 A;  5FGM A;  1HST A;  2PMU A;  2OAZ A;  2PMZ N;  2FNA A;  3DLA A;  3KYD B;  1B8I A;  4RMN A;  3JRD A;  3L2U A;  1V54 H;  2ZME B;  5K7H A;  1E0E A;  3ONQ A;  1DU6 A;  1B6A A;  5FLX Z;  4LLG F;  4U88 A;  2COB A;  3QP5 A;  4RLF A;  1XB4 A;  1VQ5 I;  4MTE A;  2PJR B;  1SFK A;  5D5U B;  3L7W A;  1ON1 A;  3CD6 I;  2MH9 A;  2DQR A;  2RC4 A;  3CUQ B;  1HW5 A;  4D7M A;  3DP7 A;  3I4M J;  1W7P A;  2EK5 A;  1OYI A;  2NNN A;  3MEX A;  1B72 B;  4MTD A;  3TBI A;  1YJN I;  3OYA A;  3H92 A;  2QSG X;  5L3B A;  3S16 J;  4V2G A;  1MJB A;  2EPF A;  3ZQL A;  1QZZ A;  2CUJ A;  2F5F A;  5IP9 J;  3CCM I;  1TBX A;  3ZPL A;  2FSW A;  1T95 A;  2D5V A;  4DJA A;  2RKH A;  4GRI A;  3VYR B;  5M5Y J;  2RNJ A;  2IEK A;  3SFI A;  4O5V A;  3G6E I;  3GTQ J;  1FSH A;  4GCV A;  2MSY A;  4Y7N J;  1BR4 A;  2FF4 A;  1BC7 C;  4KIS A;  1IN4 A;  1D5V A;  2B9S A;  4GXO A;  2MAB A;  4AID A;  2KT0 A;  1D0Z A;  3TO9 A;  2A5W A;  2P6T A;  3I59 A;  2MG4 A;  5HLI A;  3I64 A;  1ZGJ A;  3E6M A;  2K7L A;  3ZN1 A;  3E3V A;  4JX5 A;  3OV8 A;  3DKW A;  4WCG A;  3GXO A;  2DA5 A;  4ZZD A;  2LY1 A;  4NC6 A;  2ZME A;  1RPW A;  4BJT A;  2M87 A;  3FXK A;  4D5F A;  1JGS A;  3HKZ N;  2KIM A;  4A5N A;  4YRV A;  1G3S A;  4A0Z A;  1O7L A;  2Y69 H;  3Q0V A;  3QP6 A;  4KT5 C;  2L54 A;  4LJZ F;  4DZP A;  1NG6 A;  2M0M A;  5LFA A;  1BI2 A;  2HOT A;  2HVS A;  1B72 A;  3GTK J;  2Y9Y A;  4BQQ A;  3SQN A;  5HLG A;  5FKN A;  4DNC A;  4FTH A;  1QGP A;  3WTY C;  3MMY B;  1TP4 A;  4IHT A;  1BOA A;  2VJ4 A;  4D7N A;  4IJA A;  1BI1 A;  1F9N A;  4ZTF A;  3ELK A;  1TWC J;  1FOW A;  2HTJ A;  1KYW A;  4LK1 F;  4BHP A;  5E18 F;  1TL8 A;  1I5Z A;  2GOM A;  4NHJ A;  1D8K A;  4ESJ A;  1TQM A;  3VFZ A;  4M73 A;  3K69 A;  4CH7 A;  2PMZ A;  3W6V A;  2DXI A;  4ENJ A;  3L2W A;  1QVU A;  3S2D J;  2DI3 A;  1MGT A;  5JLW A;  2F4M B;  3S3O A;  2JPC A;  3K70 C;  2RQP A;  1K7A A;  4UHT A;  4M3E A;  4N4N B;  3T0Y A;  1APL C;  1ETO A;  1QRY A;  2WAF A;  3PIP F;  2XRO A;  1IUY A;  2OC6 A;  3PNV A;  4P9F A;  4XMY A;  3OIO A;  3HM5 A;  2Z16 A;  1ETX A;  1IF1 A;  3H0G J;  1ETQ A;  3RYP A;  2Y30 A;  1KGS A;  1Q1V A;  3RPU D;  1Z91 A;  2XGE A;  1SMT A;  3CC7 I;  1ZK8 A;  1K4S A;  2XPW A;  2OBP A;  2Z99 A;  2OTL I;  1RES A;  1I3A A;  4MIM A;  1D0X A;  4G9Y A;  3R60 A;  4ZYE A;  3J7Z I;  2YX7 A;  1JHF A;  4HF0 A;  2V7F A;  5J8F A;  4QIW N;  4KA4 A;  4IEJ A;  4P9U A;  3F8C A;  4XRF A;  4FX0 A;  4IOC F;  1MMN A;  1WRJ A;  2LNB A;  1KQ8 A;  2EZI A;  4LK0 F;  2M45 A;  2R7Z J;  1T39 A;  4H0E A;  1UST A;  1KYZ A;  4OIO F;  1ZHF A;  4A3G J;  1N78 A;  3G1L A;  3E6B A;  2M1B A;  2HWV A;  1ZG1 A;  3M8E A;  4FCY A;  2QWW A;  3H36 A;  2KPM A;  3OR2 C;  4A93 J;  2IVM A;  4UUT A;  3CME I;  3VPR A;  2G0E A;  3K0L A;  2HOA A;  3BR5 A;  4FE4 A;  1MH4 A;  1N25 A;  3U9G A;  3V8L A;  3WGH A;  2XGC A;  1YYV A;  3BRO A;  3T8R A;  1HSJ A;  3M1E A;  1BOB A;  2RRE A;  2KHM A;  2O61 A;  2LKX A;  2M2E A;  3BR6 A;  3V8K A;  2ISY A;  1EF4 A;  2MFZ A;  1LEB A;  1TZL A;  4M6X A;  5DEQ A;  4IHW A;  4LG0 A;  2L3D A;  4CZC A;  1RZ4 A;  3W2V A;  1FBQ A;  3H9G A;  2F4I A;  2CW8 A;  2WAQ N;  5K5Q A;  2X6Y A;  4UVC A;  1WJB A;  3BTI A;  3ZQ7 A;  1IDZ A;  1MNE A;  1BR2 A;  3JRB A;  2NAZ A;  2XAS A;  4KN7 X;  1FIP A;  1DUX C;  4B09 A;  3WTV C;  2VC0 A;  1IN7 A;  2V6E A;  4M3G A;  4E7K A;  5B66 C;  1NK3 P;  1LDK B;  4OOI A;  4AWX B;  2BY3 A;  3RSN A;  2CQK A;  4IO9 F;  5AIQ A;  3MVP A;  3RI4 A;  4ZDO A;  3ESW B;  4UVB A;  4PCQ A;  3LWF A;  3PO3 J;  3F9K A;  1T98 A;  2WAD A;  4PJ0 C;  3ZQQ A;  2VKD A;  1U3E M;  5E1W A;  1V55 H;  3ERM A;  4CA0 A;  3LSR A;  1IJW C;  3GCM A;  4XKW A;  1H9T A;  4G7H F;  2ZXI A;  5CVI A;  5F04 A;  4XN0 A;  1I1S A;  3OL4 A;  2H1L A;  2VXD A;  3A0B C;  1I39 A;  2CV2 A;  2JT1 A;  1O7F A;  2DMT A;  2K4J A;  2L7Z A;  1WQ2 A;  2WY7 Q;  4BY7 J;  1J9I A;  2ZJR F;  1T6S A;  3WTZ A;  3IWF A;  4HV6 A;  1MIJ A;  3RYR A;  1WPK A;  5F0F A;  1GVJ A;  2V9K A;  5HDN A;  2ELH A;  2R7V A;  3F8M A;  1V3F A;  3DPT A;  3GYH X;  4MGR A;  2KFD A;  2Y75 A;  3PQK A;  1XS9 A;  4KN4 X;  3F22 A;  5JI6 A;  1OYY A;  4OIP F;  3HPH A;  2XUB A;  5F08 A;  2FD5 A;  3J80 Z;  3RKY A;  2VLA A;  2H09 A;  3GTJ J;  2QSH X;  1Z77 A;  3BTC A;  4GYI A;  1Z6T A;  3O8H A;  1I1G A;  3FMS A;  2VT3 A;  2VKH A;  1FSE A;  4BU2 A;  3DPU A;  2E19 A;  1XCV A;  2E1M C;  1WH5 A;  3G2B A;  4HLX A;  2EV5 A;  3ZQI A;  3RZO J;  1S6L A;  3B73 A;  4BE0 A;  4BXX J;  2L9N A;  2DFH A;  2WAQ A;  1XMK A;  2HU9 A;  5ICF A;  3H3V K;  2VIX A;  2D45 A;  3FWE A;  4CO8 A;  2FMY A;  2E1O A;  3RJP A;  5K1Y A;  4IRH A;  3ZRG A;  4RB1 A;  3S14 J;  4HBL A;  3PSI A;  1FP1 D;  1YX3 A;  1LE8 A;  3TKY A;  1DP7 P;  5TRD A;  1IXC A;  3D1N I;  1YHQ I;  3V7C A;  3IUO A;  3BG9 A;  3K4C A;  2AHQ A;  5EZH A;  1SD5 A;  2WY8 Q;  4BE2 A;  1XSD A;  5TJJ A;  5B1A H;  1OYW A;  2CH0 A;  3F6O A;  2VPL A;  4A69 C;  3WU0 A;  1XD7 A;  4BYY A;  4B4C A;  4MEX F;  4J00 A;  3HSR A;  4G7O F;  5GAH J;  1R6R A;  3I54 A;  4EJV A;  2IA2 A;  2ZCW A;  3I5U A;  4EMS A;  1QVT A;  1STZ A;  2F5V A;  4AUX A;  2Q2E A;  3HRT A;  3FBI B;  1TWG J;  5IYB J;  2E7X A;  3KCC A;  1AA7 A;  2VOO A;  3HXL A;  5F0H A;  5BS6 A;  1ETY A;  1WI3 A;  4PFO A;  1X2M A;  4E7S A;  4F91 B;  2RN7 A;  2V9P A;  2Y31 A;  1TC3 C;  2HQN A;  2XAH A;  1DPU A;  2X1D A;  3LAJ A;  3CDH A;  2VON A;  1EKE A;  2LDU A;  2B63 J;  1UAA A;  4O3M A;  1N77 A;  4RM3 A;  3EUK L;  3KYC B;  2E5Z A;  3WG7 H;  4BDZ A;  3GTM J;  4ON0 A;  2DFE A;  2R7D A;  1K6O A;  2UV1 A;  2ZNZ A;  3IL2 A;  2LTP A;  4A0Y A;  3A01 B;  1FOX A;  2E36 A;  2NVT J;  1Z6R A;  1HCR A;  1T2K A;  1IRZ A;  2O8X A;  4B47 A;  1MSE C;  3EQL F;  3ECH A;  3E1S A;  4B43 A;  3ZMZ A;  5ED4 A;  4V2F A;  1UHS A;  2NOG A;  1JGG A;  1W7P D;  2A07 F;  1PUF B;  1HLV A;  2HYF A;  2XB5 A;  1ZN2 A;  3VSK A;  3KE2 A;  4QPQ A;  3GFJ A;  1SFX A;  3PFI A;  1X58 A;  3M8F A;  3L2V A;  3FXR A;  2HNH A;  5JFR A;  3S3M A;  1P2F A;  2BY0 A;  2CQQ A;  3LMM A;  3JRE A;  1P92 A;  1UHW A;  3RPU A;  1G2H A;  2GIZ A;  4A3C J;  4YIF A;  3ZMS A;  2JUC A;  2D1V A;  2EH3 A;  1RI7 A;  5EG0 A;  3MKZ A;  2XF6 A;  3HRS A;  1X4O A;  1FBS A;  2ZJQ F;  2V9V A;  2WV1 A;  1R4M B;  2Z5U A;  1CF7 B;  3MZH A;  1JTX A;  2GAU A;  3L2C A;  2COM A;  4W97 A;  4H4K C;  3A01 A;  4CIC A;  3KLN A;  2F2E A;  3GEZ A;  1ZTR A;  3NRV A;  1S7O A;  2PLY A;  3S3N A;  1G59 A;  3M1C A;  3HOZ J;  4IHY A;  2L5Q A;  1MDM B;  4BJ6 C;  2R7F A;  2VQL A;  4XLP F;  4EGY A;  1Z3Y A;  2XSJ C;  1EH6 A;  1T56 A;  1PUF A;  3GUD A;  4JP0 A;  4XRM A;  2LOO A;  3VB2 A;  2VPR A;  3KP5 A;  4NNJ A;  2JVH A;  4U87 A;  1Z1D A;  2R5Y A;  1IZ1 A;  1BM9 A;  4AYB N;  2XSD C;  4II3 A;  5E1X A;  5D5W B;  4M6Y A;  2DDB A;  4L5I A;  4HW0 A;  3I58 A;  4Y15 A;  3LA7 A;  3CCL I;  3FDY A;  4A3L J;  3K4L A;  3I71 A;  2K5C A;  1FYK A;  3ZR8 X;  1X3W B;  2HTS A;  4XQF A;  1R5I D;  2J5O A;  2V4J C;  4IPA A;  1EH7 A;  1O3S A;  4BE1 A;  2BW3 A;  4HZF A;  2XAG A;  4NQW A;  3CCU I;  4Z6Y A;  2MD5 A;  3RKQ A;  1RRJ A;  3EUA A;  2WBM A;  2W84 A;  2HZD A;  3RTR A;  2STT A;  3OOU A;  1P4W A;  3EUH A;  1S8N A;  3HEF A;  1IN8 A;  5FLM J;  1MDM A;  2H6C A;  3LSG A;  3J80 K;  1D1C A;  2XKO A;  3ZQC A;  3QPH A;  2ZO4 A;  1P4X A;  2ZB9 A;  4E7Z A;  4P55 A;  3AL0 B;  5EYR A;  4X6A J;  1EA3 A;  4MEY F;  1G8X A;  2DFI A;  2X6O A;  1K79 A;  4YEJ A;  2ETH A;  4B44 A;  1VF9 A;  3AFH A;  3GZ6 A;  3JRC A;  1SMY F;  4AD9 A;  1BC8 C;  2KL4 A;  5M5X J;  3FK7 A;  4MQV A;  3O8G A;  3JSO A;  3SEQ A;  3FIS A;  3WTU C;  2W4S A;  2ZNY A;  2E60 A;  5DUK A;  5H6Q A;  2DOE A;  1XGS A;  1J09 A;  1D0Y A;  2DOF A;  2OZU A;  2R92 J;  5IT3 A;  2ZXJ A;  3TL4 X;  4A3D J;  5HLH A;  4X0G A;  1KQ0 A;  5IPA A;  3BWG A;  5D6F A;  3B6A A;  4W1U A;  2LF7 A;  3T1B A;  2IP2 A;  2VBW A;  1ETV A;  2O5R A;  1IXR C;  3GLX A;  3LL7 A;  4JBA A;  4AYB A;  1U2W A;  2HDW A;  4HDU A;  2IPQ X;  2QQB A;  2K02 A;  2VT2 A;  4BAC A;  3CCV I;  3CUO A;  1TW3 A;  2DW4 A;  3OSG A;  4M6V A;  2GXB A;  3FXO A;  4LB5 A;  3TOB A;  2NS7 A;  4IQJ A;  4B3X A;  3BQZ A;  4AC0 A;  3HOS A;  1YG2 A;  1JT6 A;  2JWT A;  3OY9 A;  4JX4 A;  1UHM A;  5CJ9 A;  4KMF A;  5FFZ A;  1Z0X A;  3CJQ B;  4M3F A;  3FMR A;  4AIJ A;  2MC3 A;  3WTS C;  3A02 A;  1O3T A;  2W24 A;  4GO1 A;  1YW9 A;  2QYO A;  4A3J J;  1W5C C;  2K9N A;  5BQT A;  3PQJ A;  4S04 A;  2QF7 A;  2CQX A;  2YPR A;  3HZJ A;  1B1B A;  2BHY A;  4HLY A;  2DAO A;  2IW5 A;  1NTC A;  5HS8 A;  3HDD A;  2XDV A;  4BUP A;  2IGN A;  2K3P A;  3K70 D;  4BJ5 C;  2QKL B;  4DBQ A;  3ZGK A;  2Z2S B;  3QPS A;  2ZME C;  4E7I A;  1BI3 A;  2QM3 A;  1NG7 A;  4WXH A;  3OS1 A;  3RQI A;  2OCC H;  1KU9 A;  1FYL A;  3TP0 A;  3REO A;  3MZ8 A;  2M8G X;  2O9L A;  3CUQ C;  4BAY A;  1YIO A;  3QYF A;  3BG7 A;  2O0Y A;  3I4N J;  4ENN A;  1HKS A;  4RLQ A;  3TMO A;  1QU3 A;  3DBR B;  3FHN A;  1ZR4 A;  3CZ6 A;  4G7Z F;  4GDF A;  2KZG A;  2Q1Z B;  3AG2 H;  4E7J A;  3NWT A;  1X3U A;  1FPQ A;  2VOP A;  3IAM 2;  1ZRC A;  3L9F A;  4J19 A;  1KU2 A;  3OS0 A;  1A36 A;  3ZMT A;  1FP2 A;  3N4M A;  4HRI A;  5ICC A;  1GUU A;  5E3M A;  1JTY A;  3KP6 A;  4XRS G;  1R1V A;  2FBH A;  2WTE A;  3ZN0 A;  2IS1 A;  1MJ9 A;  2DLL A;  3OYJ A;  5M3M J;  4L0Z B;  3KET A;  5J6X A;  2LKP A;  4UUV A;  1I27 A;  2L01 A;  3E7L A;  3QU3 A;  2NVY J;  4IZZ A;  3ZQG A;  3HRU A;  3BCA A;  2IS2 A;  3L09 A;  2OPT A;  1OCT C;  2P81 A;  4I98 B;  4EQQ A;  4F55 A;  2F5C A;  3GME A;  5CQE A;  5EF6 A;  2I8D A;  4LIT A;  3AG1 H;  1NH3 A;  3OYK A;  5GAD J;  1X4P A;  3HHH A;  4PUS A;  1ODD A;  2OD5 A;  1HW1 A;  3K4M A;  3JRG A;  1ENH A;  3LFK A;  3BZC A;  3BT9 A;  5EGO B;  1U9O A;  3TW7 A;  1FOK A;  1GVD A;  1TNT A;  1X1P A;  2IGK A;  3ASN H;  1ETK A;  1LVK A;  2FUG 2;  2KZV A;  1OCZ H;  5GAE J;  1KA8 A;  1UG0 A;  2VBZ A;  5E79 C;  2P6S A;  4CYC B;  3AG3 H;  3S32 A;  1SAX A;  4RBO A;  3L1P A;  2L7F P;  2DPD A;  4EV0 A;  5J47 A;  2XV4 S;  5D5V B;  2V6C A;  1IAW A;  2BZT A;  2X9D A;  1IN5 A;  2MLK A;  2VQG A;  1FT9 A;  1QBJ A;  3Q3S A;  5JR3 A;  4S05 A;  5K5R A;  5E8G A;  3WE2 A;  2E2J J;  2MW8 A;  3OYL A;  4A3I J;  4DZJ A;  5CKT A;  2V1U A;  2QEN A;  2LF8 A;  4M9S A;  2V26 A;  2DJN A;  2VJJ A;  4CCO A;  2P7C B;  1R00 A;  4ESF A;  1O57 A;  2KJB A;  2QQ9 A;  3TOA A;  1VZ0 A;  3E5Q A;  3V42 A;  4EGZ A;  2PJR A;  5EGO A;  4KJZ A;  1I3Q J;  2WB1 A;  2BE5 F;  1XSV A;  1WJ5 A;  1LJ9 A;  3CUQ A;  5DV5 A;  3I56 I;  2QZ8 A;  5CVV A;  4HST A;  2YUS A;  4F7Z A;  2LD5 A;  3L00 A;  5J4Y A;  1VI0 A;  1JE8 A;  2FX0 A;  1XDU A;  2BEO A;  5HOD A;  1YW7 A;  3FHZ A;  3KZI C;  4HX4 A;  2L02 A;  3A2K A;  3HOU J;  5KK1 A;  3CF5 F;  3B6C A;  4EM2 A;  1I6H J;  5TIS C;  1FLI A;  3BPV A;  1QQI A;  2H8R A;  2EZL A;  3H5N A;  1MZB A;  2IGO A;  4NUB A;  2Y9Z A;  2JA5 J;  4PSW A;  5K7F A;  4GGG A;  2ESN A;  4LB6 B;  3Q9S A;  3P7N A;  4WX9 A;  1HA8 A;  4KDP A;  1UEL B;  2DTR A;  3FM5 A;  3BC8 A;  4I7H A;  1J2X A;  3QOP A;  5FO5 A;  2QBY B;  2R7W A;  3DPL C;  1XMA A;  3NAU A;  2VE8 A;  4R1H A;  4C3H J;  4IHX A;  4HNU A;  3QQA A;  4V19 K;  3HOT A;  3MAJ A;  3G3Z A;  1H89 C;  3LSH A;  1V4R A;  2VQH A;  3BJA A;  2Y0S A;  3I9V 2;  4AVZ A;  2BVL A;  3VYU B;  4EAT A;  3SXY A;  4FQG A;  4UNO A;  1FZP B;  1YE9 A;  1SD7 A;  1S29 A;  3OWT A;  4CCK A;  3OS2 A;  2PJP A;  2NVX J;  1OIS A;  5HDK A;  2P5V A;  3CCQ I;  2CG4 A;  3WHC A;  4CCL A;  3IRR A;  2Z1D A;  2XAQ A;  2EZK A;  3HSF A;  2YR2 A;  1Y1W J;  3H3Z A;  2VJ5 A;  3LNQ A;  2K9Q A;  2HOE A;  2H94 A;  4KT6 A;  1R7J A;  3PIO F;  2H1K A;  1A5J A;  2MLG A;  3HOW J;  2A6T A;  2G7U A;  2L9V A;  5HS9 A;  4MFE A;  2PEX A;  3BCB A;  3E97 A;  2V79 A;  2QBY A;  2NVU B;  2H6B A;  4XSZ F;  3N97 A;  1E3O C;  3U1K A;  2X1C A;  2JPB A;  1FIA A;  2VQC A;  1S72 I;  3A03 A;  2WAE A;  4KUM A;  5DCM B;  1YRN B;  3Q0W A;  2HXO A;  5DTD A;  4A5M A;  1P7J A;  4Q4Z F;  2Q8K A;  5ICG A;  2GWR A;  2PI0 A;  2EIN H;  3IAS 2;  1G6N A;  1YS6 A;  3WTW C;  3HB9 A;  2W85 A;  2IA1 A;  1HW2 A;  2NNY A;  2K40 A;  4U0Y A;  3I4P A;  4AM3 A;  2QGU A;  2L7M P;  2X1E A;  4C2U A;  1E17 A;  2MYS A;  1FTZ A;  5FRN A;  2VOD A;  5IY5 H;  1EV7 A;  1GLN A;  1JJ6 C;  4IHV A;  1GXQ A;  4HX8 A;  4G94 A;  4XON A;  2QA4 I;  2JTV A;  2MD0 A;  3OYG A;  1FMW A;  1ON2 A;  3JRH A;  1ZRD A;  2JSP A;  3CLQ A;  4UUS B;  2L9S A;  5KAI C;  2X0L A;  4B8X A;  2CUE A;  2XHK A;  1GV2 A;  4XLE A;  5DS9 A;  4RGR A;  2HKO A;  2LMD A;  2LH9 A;  1KQ9 A;  1QO0 D;  2EV6 A;  5HNH A;  1HDD C;  2L4M A;  2BVM A;  4L5E A;  2P5K A;  1E3P A;  1PYV A;  2X51 A;  2DOA A;  4N9I A;  4D5C A;  1REP C;  2HKX A;  3A1Y A;  2M5W A;  4XR6 A;  3AKZ A;  4I0B A;  5DYM A;  4CHU A;  1OPC A;  1ZGA A;  1OLT A;  2LR8 A;  3S1Q J;  1SVM A;  3LAP A;  1A6I A;  2ECB A;  3F8B A;  5LGN A;  3DXJ F;  5CPR B;  3JRF A;  3MN2 A;  1R49 A;  3VSL A;  4M71 A;  2CV0 A;  3D5R C;  4UUS A;  4Z2Y A;  1SVO A;  2DT6 A;  3BTL A;  1DGW Y;  4P96 A;  1YFH A;  1O4X A;  1JKR C;  1TNS A;  1OCR H;  2NS0 A;  1TWA J;  5HS7 A;  2HS5 A;  5DUI A;  2X6W A;  1LVA A;  1X1C A;  2XAJ A;  1K6Y A;  5L3E A;  2OTJ I;  4ANJ A;  3I3L A;  3JRA A;  1K61 A;  3W3C A;  2K9M A;  4FT8 A;  1XGO A;  4WF2 A;  5HNF A;  1JUM A;  2CRG A;  2F4O B;  4L9V A;  2LBF B;  1IW7 F;  2EBI A;  2DQL A;  1MND A;  4II2 A;  3IC7 A;  4QTR A;  3SEZ A;  1WI9 A;  1IC8 A;  3W6K B;  1BBY A;  3GTP J;  3S15 J;  2QSF X;  4CDG A;  1D1A A;  3NQO A;  2PFB A;  9ANT A;  4E6K G;  4XRS A;  1Y56 A;  2F48 A;  4LG3 A;  4DOZ A;  2NVQ J;  3BR0 A;  1BJZ A;  3ZCO A;  1PP8 F;  3K4B A;  2EB7 A;  1FC3 A;  1O3R A;  1TWH J;  3A0H C;  3DV8 A;  3OMY A;  1V5F A;  1IXS B;  2RQQ A;  5IYC J;  1KON A;  4L0Y B;  2E71 A;  4WXC A;  3GO5 A;  4Y3O A;  3GF2 A;  3GTG J;  2Y48 A;  4Y33 A;  5ICE A;  1MMA A;  2K9L A;  2ZFW A;  1ACI A;  3C18 A;  4K2E A;  2DPU A;  3G1M A;  2QKM B;  2LBF A;  3IWZ A;  1QZY A;  2CWE A;  1BA5 A;  4DIQ A;  2ECC A;  5EDN A;  1XMX A;  2EFO A;  5FD5 A;  2HYG D;  3S1N J;  3KZZ A;  4U7D A;  3R0A A;  1Y6I A;  5CLS A;  2LP0 A;  3OYM A;  1KU7 A;  4XLH A;  3GZN B;  3PM1 A;  1IUF A;  2GOX B;  2ZJ2 A;  5EJC A;  4RAF A;  4BH9 A;  2HPI A;  3PL8 A;  1U8B A;  1ZG5 A;  2P7V B;  4PJN A;  3HTS B;  3CJN A;  1TQP A;  3VWB A;  1XCB A;  2DFF A;  1LDJ A;  4EM0 B;  4ENK A;  2EIJ H;  5GTI C;  2TCT A;  4I2O A;  1K4T A;  1VQK I;  4LLN A;  4RGS A;  1WJC A;  2KDZ A;  4LMY A;  2M7B A;  3ZQF A;  1XGN A;  1EH8 A;  2EFW A;  3DFG A;  3K7A J;  3ABU A;  3IH4 A;  1DP3 A;  1ZLK A;  2E5N A;  1EJ9 A;  2DTZ A;  1FY7 A;  1FMV A;  3WE3 A;  1ZGW A;  1AOY A;  4R8H A;  3U21 A;  4HX7 A;  2JSC A;  3FXU A;  1FOY A;  1R22 A;  3K10 A;  2BHZ A;  1WWX A;  1JKP C;  3J7A O;  3NEU A;  2UUZ A;  4I99 C;  4OMZ A;  4OIQ F;  4ITV A;  2BXY A;  1U5T B;  5KHD A;  3EUH C;  3EPZ A;  1T8I A;  3HJE A;  3ZP5 A;  4RAG A;  1WFX A;  5D6E A;  3JSP A;  5D5X B;  3FM3 A;  3B02 A;  3W2A A;  3CCE I;  2DA7 A;  1LFP A;  4L9J A;  5HDG A;  5C44 J;  3BR2 A;  2BOL A;  2FOW A;  4OAY A;  4G6T B;  2EA4 A;  4RGX A;  3D5L A;  2RGV A;  2KIQ A;  1X1D A;  1MMG A;  2M3A A;  3DBL B;  4HEA 2;  4AU7 A;  4QLC U;  5BPD A;  1WVR A;  4N4O B;  2K3F A;  3MZY A;  1QHH D;  4IQ4 A;  1FJL A;  3N05 A;  3J81 Z;  2WV0 A;  3GBG A;  4UV9 A;  3GFI A;  3OYF A;  3OSF A;  3VDX A;  3FKI J;  4RB0 A;  1LKX A;  2DMU A;  2K4B A;  2VC1 A;  4XL9 A;  2CFO A;  1LUJ B;  3HIF A;  5LGT A;  2VBX A;  2DDA A;  1SEU A;  4MO7 A;  2ZSI B;  5ERI A;  2IBD A;  1E3H A;  2LRD A;  3C2B A;  2G9W A;  1QHG A;  1ZYR F;  2HZT A;  3GLL A;  4ZTJ A;  2GXG A;  3TP3 A;  5LRR A;  3BG3 A;  1W4M A;  2XAU A;  3Q5F A;  4DW6 A;  2VBY A;  1RC9 A;  2P4W A;  3KFW X;  2XC7 A;  4NB5 A;  3H0D A;  3JR9 A;  2DMN A;  4A3B J;  3QRF F;  3AL0 C;  3QOD A;  4PGG A;  2CSO A;  4A3E J;  4Y4R A;  3CCJ I;  3J7A Y;  1W5T A;  4YEL A;  2DA1 A;  1TQI A;  1YTY A;  2H27 A;  5KNL A;  3COA C;  5C4X J;  1OCO H;  1L0O C;  5L3G A;  3DEU A;  4WXD A;  2VUM J;  1MBE A;  1PUE E;  3G1O A;  1ETW A;  2Z3Y A;  2XRN A;  3BOQ A;  1HC8 A;  2HGC A;  5KCM A;  1F43 A;  3P9C A;  3M4O J;  3TDU C;  2UXN A;  2X4H A;  1S3J A;  4AIK A;  2CFX A;  2DYR H;  2E2I J;  4A6E A;  4NDL A;  1RUN A;  1UZC A;  4PSX A;  3L2R A;  5K7Z A;  4G6D A;  1ITY A;  3H9Q A;  4I0A A;  5E20 A;  3SDG A;  3KEY A;  1CF7 A;  3LA3 A;  2XPU A;  3RPQ A;  2JJ7 A;  3QPT A;  3M3Y J;  4UVA A;  3SZG A;  3V7S A;  2FBK A;  5L3D A;  2K27 A;  5F1R A;  4I76 A;  1SAU A;  1F1Z A;  3ROU A;  4ZYG A;  4OIR F;  4DBR A;  1R23 A;  1XTA A;  4FAS D;  2K86 A;  1A35 A;  2OF7 A;  1JI8 A;  2BYV E;  4FHT A;  2AQF A;  3GFM A;  5CVR A;  3F6V A;  3QPL A;  2JRT A;  3GZ5 A;  2DT7 B;  1Y39 A;  1D1B A;  4YII A;  4KNY A;  2KRF A;  2LY9 A;  2TDX A;  1Q1H A;  3P9K A;  5DD4 A;  3R0J A;  5D8L B;  1WGX A;  1BI0 A;  4BGD A;  1FBU A;  3E6D A;  3T8T A;  1UMQ A;  1WH7 A;  3DEE A;  3DKY A;  3CF2 A;  1PJR A;  2CW7 A;  2FOK A;  3FBN B;  1HDP A;  4ETS A;  4M3D A;  2AO9 A;  1UG2 A;  1DDN A;  3SJM A;  2ZXW H;  1QZE A;  4C2T A;  3CP8 A;  4ZH4 F;  1BL0 A;  1SFO J;  5A2Q K;  5BOX A;  2O8K A;  2KIU A;  4OAZ A;  4XID A;  4LLL A;  3DTE A;  1LNW A;  4DYC A;  4LGW A;  1H0M A;  1LPQ A;  1VQN I;  2QCO A;  2ELJ A;  1MBG A;  2X85 A;  1V5E A;  3M7G A;  1CQT A;  3FF5 A;  1MH3 A;  3BP8 A;  3CMY A;  3CO7 C;  2XKP A;  1DQU A;  2JRM A;  1HKQ A;  3LST A;  4PJM A;  2R93 J;  4EJU A;  4ZZL A;  2LVS A;  4L5J A;  1IV6 A;  3PFY A;  1YQA A;  5IT9 Z;  1XG1 A;  3TGN A;  1O3Q A;  4RB3 C;  1HKT A;  2KLO A;  1BN5 A;  2PMH A;  3OR1 C;  1G4D A;  2HQ5 A;  1KU3 A;  4NC7 A;  2ELK A;  4KMU X;  3HBL A;  4XBF A;  4ZYD A;  3R4K A;  3U2R A;  3HGY A;  5AIP A;  5GTH C;  1Y1V J;  4BEH B;  4OU0 A;  1XGM A;  4DQ2 A;  4PZJ A;  2E2H J;  1JT0 A;  4IVN A;  3E0J B;  1F5T A;  4BKX A;  2HVR A;  2GXA A;  1ULY A;  3G73 A;  2FU4 A;  4AIH A;  3H9J A;  2X6X A;  5JVT A;  3ZQH A;  3QAH A;  2FA5 A;  4XIC A;  3W6J B;  1K83 J;  2F5E A;  2JUG A;  4ASN A;  2M4K A;  4U0W A;  4P5O A;  4DGW B;  4BBR J;  1OMI A;  3F8N A;  3LSK A;  4QSH A;  2QEX I;  2EFP A;  5LLQ A;  4BXU A;  2LSO A;  4DYQ A;  2JN6 A;  4HV5 A;  4TV7 A;  3HOX J;  1G3W A;  1K78 B;  2HYJ A;  3GWZ A;  3RKW A;  2WB1 N;  4XSX F;  1YIJ I;  1MKM A;  2W25 A;  3KEQ A;  3J81 K;  5L3F A;  1OKR A;  4RM2 A;  2DCE A;  3VOD A;  3UR3 C;  3BJO A;  2DO7 A;  1LFB A;  4XK4 A;  5J1U A;  3PNY A;  1S7A A;  1SC7 A;  3CCY A;  5FJ8 J;  5D4S A;  4E70 A;  2L2O A;  3HOV J;  2PN6 A;  3SZP A;  3C2H A;  2PBI A;  5J3L A;  1B9M A;  5DM7 F;  3DU5 A;  3WHB A;  2JZY A;  3ABT A;  4CSW A;  1ZAO A;  2ICW G;  4QPO A;  2ZSH B;  4PJJ A;  4ZYH A;  2ID6 A;  4E7L A;  1G3Y A;  2Y0S N;  4EJW A;  2VAS A;  4UXN A;  1ZRE A;  1E2X A;  3OIP A;  3BJ6 A;  3U1D A;  2M30 A;  2L4A A;  4BQA A;  2HI3 A;  3LSP A;  2XGX A;  1YS7 A;  2EWN A;  3I59 B;  1VND A;  3RQ4 A;  5L3C A;  4BHC A;  1QPI A;  1QNT A;  2ZFU A;  2BBY A;  1GDT A;  1VQ4 I;  2JA8 J;  1OJL A;  3O3K A;  4F3Q A;  3LSJ A;  4C30 A;  4BS9 A;  2D2W A;  4L9T A;  2VE9 A;  1WZ2 A;  2EJR A;  6PAX A;  1XC5 A;  4A2U A;  5ILV A;  2XIG A;  4BQN A;  5IOZ A;  1A31 A;  1YJ9 I;  1MJA A;  2O6G E;  3TO6 A;  1VQL I;  1T0F C;  5E8I A;  3FXL A;  4XLF A;  5LHI A;  3CC2 I;  2DU9 A;  1JJ8 C;  2RV8 A;  3QYB A;  4LIV A;  2R7X A;  2VN2 A;  3GVA A;  2YU3 A;  4HF2 A;  2W1O A;  3CMA I;  1R36 A;  4EJO A;  5JHF A;  5BMZ A;  5M5W J;  1UFM A;  3K9T A;  2NOJ B;  4ESB A;  3ZMD A;  2AS5 F;  1YOV B;  1Z7U A;  2M34 A;  1Y8R B;  3DTI A;  1MBJ A;  5F6F A;  4CYC A;  3SDB A;  3HRM A;  3K2A A;  3CCS I;  2Z9O A;  5K5O A;  1YJW I;  2LLK A;  2AXT C;  3MCZ A;  2GBY A;  3OIQ A;  2EFN A;  3SYT A;  2XAF A;  4IXA A;  2RAE A;  4C3J J;  2IS6 A;  2CMP A;  2XB0 X;  2E1C A;  1TT5 B;  4HA8 A;  2R7U A;  1U9N A;  2WC2 A;  2FNP A;  2UZK A;  1B9N A;  5DDG A;  1W0T A;  3NAR A;  3KLO A;  2W7N A;  2STW A;  2R0Q C;  4BY1 J;  4HQE A;  1MMD A;  3BQY A;  5CQG A;  4I6Z A;  3RZD J;  2K85 A;  2ZKZ A;  4A0X A;  3TO7 A;  4YFX F;  4C2M J;  3VEP A;  2Q0O A;  1U8R A;  1HXD A;  2CW0 F;  4KIC A;  3NWS A;  4DYR A;  2FJ1 A;  5ILU A;  3CMM A;  4OWR B;  2WA0 A;  4OIN F;  3BZK A;  1GXP A;  2VL8 A;  4O6J A;  1VQ8 I;  2IT0 A;  4M9X A;  2H8W A;  4D0P A;  1ZRF A;  3KEO A;  5BNG A;  2KP6 A;  1VQO I;  5IT9 K;  2BXZ A;  2LC2 A;  3K1N A;  2MC4 A;  1VQ9 I;  1Z05 A;  3FK6 A;  3CDI A;  3CJT B;  4C9Y A;  2JQ7 A;  2AXL A;  1SFU A;  4D1Q A;  5BPI A;  3DCF A;  2J5P A;  2A6H F;  4E4H A;  4ENM A;  1H88 C;  4X1E A;  1DPR A;  1SD6 A;  4A3M J;  3S1M J;  1I50 J;  2EQR A;  2JVG A;  2G7H A;  2KIS A;  3AG4 H;  2EIL H;  2ESH A;  2KKO A;  3S17 J;  1RKT A;  3S2H J;  5JVG F;  4AVP A;  3IH3 A;  1IG7 A;  2EV0 A;  2KJC A;  3BR1 A;  2CU7 A;  4ZJZ A;  2XRL A;  3F3X A;  4M74 A;  3X2Q H;  5E3O A;  1IO2 A;  2VXZ A;  1FYM A;  4XM3 A;  3R6S A;  4CYD A;  1RIO H;  4E7H A;  5GAG J;  4A3F J;  3V4G A;  1T0F A;  5LGU A;  1GT0 C;  4LG0 B;  2QQ8 A;  2M9H A;  2C6Y A;  2ZXH A;  3PJR A;  1FNN A;  3RCO A;  1IRF A;  3ASO H;  2ZJP F;  1W5S A;  1PVE A;  3DU6 A;  2R7T A;  3DQV C;  3ZMU A;  3HKZ A;  1MBK A;  2UXX A;  1MBF A;  1RNL A;  1MNM C;  4J01 A;  2CS3 A;  1J7K A;  3ML6 A;  2QUF A;  4BNC A;  2NS8 A;  4MLO A;  4FX4 A;  3WGG A;  2R7S A;  1QPM A;  1MD0 A;  2A6E F;  1WJF A;  3DTK A;  1W36 D;  5FKM A;  2W82 A;  1RUO A;  4PGH A;  1BW6 A;  4CCN A;  2O3F A;  3BG6 A;  2DJI A;  2EZH A;  3D0S A;  1A6Q A;  1YO5 C;  3PNT A;  3R61 A;  1FX7 A;  4HNT A;  1JXS A;  1A04 A;  5FKK A;  3HOY J;  2LY2 A;  1VQM I;  5FFX A;  2K9S A;  4Y17 A;  5DCM A;  3ABM H;  1YRN A;  3ULQ B;  5ILS A;  5FLV A;  1NK2 P;  3OYH A;  1HBX G;  1JUP A;  3L2Q A;  2GLO A;  3GX4 X;  4XOR A;  4EM1 A;  1R9T J;  3BR3 A;  2OQG A;  1P6R A;  4A3K J;  4KIG A;  3PUB A;  2HFH A;  2L7K A;  2O03 A;  2OZ6 A;  2YSR A;  5J4V A;  3IRQ A; 
#chains in the Genus database with same CATH homology
 4L18 B;  3M9A A;  1C0W A;  3JAM Z;  4HF1 A;  2HDC A;  1VTN C;  4CGZ A;  1PDN C;  4RAZ A;  5E1Z B;  2A3S A;  3LQQ A;  3DF8 A;  3SFZ A;  3MWM A;  1R5G A;  2M8E A;  3K1P A;  1AWC A;  4GYG A;  4KFC A;  4YFK F;  2MH2 A;  2FXA A;  4YFN F;  2P8T A;  2FBI A;  4MQ9 F;  2V1D A;  5FLX K;  2D1H A;  1FWZ A;  4LFU A;  3OOP A;  4RB2 C;  2Z33 A;  1XSX A;  3WG9 A;  4EJT A;  2BV6 A;  2A68 F;  3O2P E;  3MQ0 A;  3GW2 A;  5H6R A;  1J75 A;  1J59 A;  2FEZ A;  1SD4 A;  1B59 A;  1LB2 A;  5A2Q Z;  3RIR A;  2GIV A;  1IRG A;  3HUG A;  4N0B A;  1U5T C;  2EFQ A;  3ZMV A;  4CZZ A;  3HTU A;  1G3T A;  4PDK A;  3LA2 A;  2ZBK A;  5LRS A;  3S2W A;  4Q5S F;  2GZW A;  5LBQ A;  4I01 A;  4HYE A;  2FQ3 A;  1R1T A;  4YG2 F;  2PQ8 A;  1ZLJ A;  4U0V A;  2B0L A;  1BIA A;  1UCR A;  4L9N A;  3BPX A;  1BIB A;  3EYI A;  1XDS A;  4RGU A;  2A61 A;  5KVR A;  5CYV A;  3MFK A;  5HVQ C;  3SZT A;  4N9H A;  2FML A;  3JW4 A;  3HHG A;  1U6G A;  2V1X A;  2P5L C;  4HDV A;  4G8X A;  2HEO A;  1TTY A;  1SFE A;  2GA2 A;  3F72 A;  1L3L A;  2GQQ A;  3SHF A;  4M72 A;  3BY6 A;  4G6Q A;  5JHU A;  4A6D A;  5CVJ A;  1OR7 A;  1Y0U A;  3KP3 A;  4I09 A;  1B4A A;  4IF4 A;  5DCF A;  5F64 A;  3V7R A;  4Y13 A;  3TQN A;  3FXQ A;  2WWY A;  4Q48 A;  2HR3 A;  1WKM A;  2EA2 A;  1U5T A;  4U7B A;  1R58 A;  5AON A;  2YX4 A;  5LHH A;  2RVC A;  4EVI A;  2A69 F;  2BGC A;  4JQF A;  4BHB A;  3GFL A;  4IRI A;  2QVO A;  5LEK A;  1YLF A;  3EYY A;  4JK1 X;  4M9Z A;  2XVC A;  2NRA C;  2RDP A;  4HQM A;  3JAM K;  3HSE A;  3FMQ A;  5LHG A;  3KP2 A;  1NHA A;  2HQR A;  3EET A;  3IKT A;  3LQR A;  4UV8 A;  5DD8 A;  1Z9C A;  3VOE A;  3KZY A;  1ONV A;  1HQC A;  4MNU A;  1F4K A;  3K1M A;  3F23 A;  5CVU A;  3KP4 A;  2IRF G;  1UB9 A;  2OA4 A;  3WOD F;  3WGI A;  2DK5 A;  3F21 A;  4R79 A;  3C7J A;  1PP7 U;  2CGP A;  3WTX C;  2MBF A;  3ECO A;  2W57 A;  1TLH B;  3ISP A;  2NYX A;  1BJA A;  1H9G A;  1ZH5 A;  5E17 F;  3EDP A;  3CLO A;  1LQ1 A;  3HYI A;  1U78 A;  5LEJ A;  3T5X A;  2FE3 A;  5FB2 A;  2F5D A;  1J5Y A;  2OQR A;  4KIF A;  4RS8 A;  1T38 A;  1R5H A;  4Q47 A;  1D8J A;  3P9I A;  3K2Z A;  5D4R A;  4XLN F;  2QQA A;  3V8J A;  5D8K B;  3C3W A;  5HOO A;  4A12 A;  4HOB A;  2PG4 A;  2ADU A;  3H3U A;  1IN6 A;  2CO5 A;  2DT5 A;  1R1U A;  1P4A A;  1WSU A;  4IHS A;  3BDD A;  3KP7 A;  3I53 A;  4I02 A;  3RKX A;  3RDI A;  1XN7 A;  3I0T A;  2R3S A;  4HAM A;  2DBB A;  3IHU A;  1TW2 A;  1GHC A;  3C1D A;  3QU6 A;  3CTA A;  1D3Y A;  3FX3 A;  4OMY A;  1YW8 A;  1J0R A;  4MHG A;  2ISZ A;  3IKV A;  2E1N A;  3E6C C;  3AAF A;  3Q9V A;  3F8F A;  2ACJ A;  1LDD A;  3FZV A;  1USS A;  1JHH A;  4KIB A;  3WTT C;  2Y0M A;  3WU1 B;  1CGP A;  4IRG A;  5J8C A;  3CO6 C;  1I6X A;  4RAY A;  2A5Y B;  4QWQ A;  2DK8 A;  2CYY A;  4CXF A;  5H20 A;  2GA1 A;  4KYW A;  3JTG A;  4WWC A;  3E5U A;  3JTH A;  5EEG A;  2E7W A;  5FD6 A;  4LD5 A;  2IA0 A;  4WK8 F;  3ERE D;  1W7P B;  1LEA A;  5EEH A;  2MA3 A;  2IJL A;  3E5X A;  2FRH A;  3BZ6 A;  1ZAR A;  1K78 A;  3TDZ C;  2KIF A;  2QLZ A;  1ZG3 A;  2UWM A;  3O6B B;  2OU2 A;  5FGM A;  1HST A;  2PMU A;  2OAZ A;  2FNA A;  2ZME B;  1B6A A;  5FLX Z;  4LLG F;  4U88 A;  3QP5 A;  1XB4 A;  4MTE A;  5D5U B;  3L7W A;  1ON1 A;  2MH9 A;  2DQR A;  2RC4 A;  3CUQ B;  1HW5 A;  3DP7 A;  1W7P A;  2EK5 A;  1OYI A;  2NNN A;  3MEX A;  4MTD A;  3H92 A;  5L3B A;  1MJB A;  1QZZ A;  2F5F A;  1TBX A;  3ZPL A;  2FSW A;  2RKH A;  1FSH A;  2RNJ A;  4O5V A;  4GCV A;  2FF4 A;  1BC7 C;  1IN4 A;  1D5V A;  4GXO A;  3TO9 A;  2P6T A;  3I59 A;  5HLI A;  3I64 A;  1ZGJ A;  3E6M A;  2K7L A;  3ZN1 A;  3E3V A;  3OV8 A;  3DKW A;  4WCG A;  3GXO A;  4ZZD A;  2ZME A;  2M87 A;  1JGS A;  2KIM A;  4A5N A;  1G3S A;  4A0Z A;  1O7L A;  3QP6 A;  4KT5 C;  2L54 A;  4LJZ F;  1BI2 A;  3SQN A;  5HLG A;  4DNC A;  1QGP A;  3WTY C;  4IHT A;  1BOA A;  4IJA A;  1BI1 A;  1F9N A;  3ELK A;  4LK1 F;  2HTJ A;  1KYW A;  4BHP A;  5E18 F;  1I5Z A;  4NHJ A;  1D8K A;  4ESJ A;  1TQM A;  3VFZ A;  4M73 A;  3K69 A;  4ENJ A;  2DI3 A;  1MGT A;  2JPC A;  2RQP A;  1K7A A;  4UHT A;  3T0Y A;  2XRO A;  1IUY A;  4P9F A;  1IF1 A;  3RYP A;  1KGS A;  1Z91 A;  1SMT A;  2OBP A;  2Z99 A;  4G9Y A;  3R60 A;  4ZYE A;  2YX7 A;  1JHF A;  4HF0 A;  5J8F A;  4KA4 A;  4P9U A;  3F8C A;  4XRF A;  4FX0 A;  1WRJ A;  2LNB A;  1KQ8 A;  4LK0 F;  2M45 A;  1T39 A;  4H0E A;  1UST A;  1KYZ A;  4OIO F;  1ZHF A;  3E6B A;  2M1B A;  2HWV A;  1ZG1 A;  3M8E A;  2QWW A;  2IVM A;  3K0L A;  3U9G A;  3V8L A;  3WGH A;  1YYV A;  3BRO A;  3T8R A;  1HSJ A;  3M1E A;  2O61 A;  3V8K A;  2ISY A;  1LEB A;  4M6X A;  5DEQ A;  4LG0 A;  2L3D A;  1RZ4 A;  1FBQ A;  5K5Q A;  4UVC A;  3ZQ7 A;  2NAZ A;  2XAS A;  4KN7 X;  1DUX C;  4B09 A;  3WTV C;  2VC0 A;  1IN7 A;  1LDK B;  4OOI A;  4AWX B;  2CQK A;  5AIQ A;  3RI4 A;  4UVB A;  4PCQ A;  3LWF A;  1T98 A;  1U3E M;  5E1W A;  1H9T A;  4G7H F;  5CVI A;  1I1S A;  2JT1 A;  1O7F A;  2K4J A;  1J9I A;  1WQ2 A;  1T6S A;  3WTZ A;  3IWF A;  4HV6 A;  3RYR A;  1GVJ A;  5HDN A;  2ELH A;  3F8M A;  1V3F A;  3DPT A;  3GYH X;  4MGR A;  2Y75 A;  3PQK A;  4KN4 X;  3F22 A;  5JI6 A;  1OYY A;  4OIP F;  2XUB A;  3J80 Z;  3RKY A;  2H09 A;  4GYI A;  1Z6T A;  1I1G A;  3FMS A;  2VT3 A;  1FSE A;  1XCV A;  4HLX A;  2EV5 A;  1S6L A;  3B73 A;  1XMK A;  5ICF A;  2D45 A;  3FWE A;  4CO8 A;  2FMY A;  3RJP A;  5K1Y A;  4IRH A;  4RB1 A;  4HBL A;  1FP1 D;  3TKY A;  1DP7 P;  5TRD A;  1IXC A;  3V7C A;  1SD5 A;  1XSD A;  5TJJ A;  1OYW A;  3F6O A;  3WU0 A;  1XD7 A;  4BYY A;  4MEX F;  3HSR A;  4G7O F;  3I54 A;  4EJV A;  2IA2 A;  2ZCW A;  3I5U A;  4EMS A;  1STZ A;  2Q2E A;  3HRT A;  2E7X A;  3KCC A;  2VOO A;  5BS6 A;  2RN7 A;  2HQN A;  2XAH A;  1DPU A;  3LAJ A;  3CDH A;  2VON A;  2LDU A;  4O3M A;  4ON0 A;  2R7D A;  1K6O A;  2ZNZ A;  3IL2 A;  4A0Y A;  1Z6R A;  1T2K A;  2O8X A;  3EQL F;  3ECH A;  3ZMZ A;  5ED4 A;  1W7P D;  2A07 F;  2HYF A;  1ZN2 A;  3KE2 A;  3GFJ A;  1SFX A;  3PFI A;  3M8F A;  3FXR A;  5JFR A;  1P2F A;  1P92 A;  1UHW A;  3RPU A;  4YIF A;  3ZMS A;  2D1V A;  1RI7 A;  3HRS A;  1FBS A;  2V9V A;  2Z5U A;  1CF7 B;  3MZH A;  2GAU A;  3L2C A;  2COM A;  4CIC A;  3KLN A;  2F2E A;  3GEZ A;  3NRV A;  1S7O A;  2PLY A;  1MDM B;  2R7F A;  4XLP F;  4EGY A;  1EH6 A;  3GUD A;  3VB2 A;  3KP5 A;  1Z1D A;  1IZ1 A;  1BM9 A;  5E1X A;  5D5W B;  4M6Y A;  4L5I A;  4HW0 A;  3I58 A;  4Y15 A;  3LA7 A;  3I71 A;  1FYK A;  2HTS A;  4IPA A;  2J5O A;  1EH7 A;  1O3S A;  4HZF A;  2XAG A;  4NQW A;  2MD5 A;  2W84 A;  3RTR A;  2STT A;  1P4W A;  3EUH A;  1S8N A;  1MDM A;  1IN8 A;  2H6C A;  3J80 K;  2XKO A;  3QPH A;  2ZO4 A;  1P4X A;  4P55 A;  4MEY F;  2DFI A;  1K79 A;  2ETH A;  3GZ6 A;  1SMY F;  4AD9 A;  1BC8 C;  4MQV A;  3JSO A;  3WTU C;  2ZNY A;  5DUK A;  5H6Q A;  1XGS A;  2OZU A;  5IT3 A;  2ZXJ A;  5HLH A;  1KQ0 A;  3BWG A;  5D6F A;  2LF7 A;  3T1B A;  2IP2 A;  2VBW A;  1IXR C;  3GLX A;  4JBA A;  1U2W A;  4HDU A;  2IPQ X;  2QQB A;  2K02 A;  2VT2 A;  3CUO A;  1TW3 A;  2DW4 A;  2GXB A;  4LB5 A;  3TOB A;  3HOS A;  1YG2 A;  1UHM A;  5CJ9 A;  4KMF A;  5FFZ A;  3FMR A;  4AIJ A;  2MC3 A;  3WTS C;  1O3T A;  2W24 A;  4GO1 A;  1YW9 A;  2QYO A;  5BQT A;  3PQJ A;  4S04 A;  2YPR A;  1B1B A;  4HLY A;  2DAO A;  2IW5 A;  5HS8 A;  1BI3 A;  2QM3 A;  4WXH A;  1KU9 A;  1FYL A;  3REO A;  3CUQ C;  4BAY A;  1YIO A;  2O0Y A;  4ENN A;  1HKS A;  4G7Z F;  1X3U A;  1FPQ A;  2VOP A;  1ZRC A;  3L9F A;  1KU2 A;  3ZMT A;  1FP2 A;  3N4M A;  5ICC A;  3KP6 A;  1R1V A;  2FBH A;  2WTE A;  3ZN0 A;  1MJ9 A;  2DLL A;  4L0Z B;  3KET A;  5J6X A;  2LKP A;  4UUV A;  1I27 A;  2L01 A;  3QU3 A;  3HRU A;  3L09 A;  4I98 B;  4EQQ A;  2F5C A;  3HHH A;  1ODD A;  2OD5 A;  1HW1 A;  3LFK A;  1FOK A;  1TNT A;  1KA8 A;  2VBZ A;  2P6S A;  1SAX A;  2DPD A;  4EV0 A;  2XV4 S;  5D5V B;  2V6C A;  1IAW A;  1IN5 A;  2MLK A;  1FT9 A;  1QBJ A;  5JR3 A;  4S05 A;  5K5R A;  5E8G A;  3WE2 A;  2V1U A;  2QEN A;  2LF8 A;  4M9S A;  2P7C B;  1R00 A;  4ESF A;  1O57 A;  2KJB A;  2QQ9 A;  3TOA A;  3E5Q A;  4EGZ A;  2BE5 F;  1XSV A;  1LJ9 A;  3CUQ A;  5DV5 A;  2QZ8 A;  5CVV A;  4F7Z A;  3L00 A;  1JE8 A;  1XDU A;  2BEO A;  1YW7 A;  3FHZ A;  4HX4 A;  2L02 A;  5KK1 A;  4EM2 A;  1FLI A;  1QQI A;  3BPV A;  1MZB A;  4GGG A;  2ESN A;  4LB6 B;  3Q9S A;  3P7N A;  4WX9 A;  4KDP A;  2DTR A;  3FM5 A;  4I7H A;  1J2X A;  3QOP A;  5FO5 A;  2QBY B;  3DPL C;  1XMA A;  2VE8 A;  4R1H A;  3HOT A;  3MAJ A;  3G3Z A;  1V4R A;  3BJA A;  3SXY A;  4UNO A;  1FZP B;  1SD7 A;  1S29 A;  2PJP A;  5HDK A;  2P5V A;  2CG4 A;  3IRR A;  2XAQ A;  3HSF A;  2YR2 A;  3H3Z A;  2HOE A;  2H94 A;  1R7J A;  2MLG A;  2G7U A;  5HS9 A;  2PEX A;  3E97 A;  2V79 A;  2QBY A;  2H6B A;  4XSZ F;  3N97 A;  2JPB A;  4KUM A;  5DCM B;  4A5M A;  4Q4Z F;  2Q8K A;  5ICG A;  2GWR A;  2PI0 A;  1G6N A;  1YS6 A;  3WTW C;  2W85 A;  2IA1 A;  1HW2 A;  2NNY A;  4U0Y A;  3I4P A;  1E17 A;  2VOD A;  1EV7 A;  1GXQ A;  4HX8 A;  4G94 A;  2JTV A;  1ON2 A;  1ZRD A;  2X0L A;  4B8X A;  2XHK A;  4RGR A;  2HKO A;  1KQ9 A;  1QO0 D;  2EV6 A;  2L4M A;  2P5K A;  4N9I A;  1REP C;  2HKX A;  2M5W A;  4I0B A;  5DYM A;  4CHU A;  1OPC A;  1ZGA A;  3LAP A;  3F8B A;  5LGN A;  3DXJ F;  4M71 A;  4Z2Y A;  4P96 A;  1YFH A;  1TNS A;  2NS0 A;  5HS7 A;  2HS5 A;  5DUI A;  1LVA A;  2XAJ A;  5L3E A;  4FT8 A;  4WF2 A;  1XGO A;  4L9V A;  1IW7 F;  2DQL A;  3IC7 A;  1WI9 A;  3W6K B;  1BBY A;  4CDG A;  3NQO A;  2PFB A;  1PP8 F;  2EB7 A;  1FC3 A;  1O3R A;  3DV8 A;  1IXS B;  4L0Y B;  4WXC A;  3GO5 A;  3GF2 A;  2Y48 A;  5ICE A;  2ZFW A;  3C18 A;  4K2E A;  2DPU A;  3IWZ A;  1QZY A;  2CWE A;  2EFO A;  5FD5 A;  2HYG D;  3KZZ A;  4U7D A;  3R0A A;  5CLS A;  1KU7 A;  2ZJ2 A;  4BH9 A;  1ZG5 A;  2P7V B;  3HTS B;  3CJN A;  1TQP A;  1XCB A;  1LDJ A;  4EM0 B;  4ENK A;  4I2O A;  4LLN A;  4RGS A;  4LMY A;  1XGN A;  1EH8 A;  2EFW A;  3DFG A;  3ABU A;  1ZLK A;  1FY7 A;  3WE3 A;  1AOY A;  4R8H A;  4HX7 A;  2JSC A;  3FXU A;  1R22 A;  1WWX A;  3J7A O;  3NEU A;  4OMZ A;  4OIQ F;  1U5T B;  3ZP5 A;  5D6E A;  3JSP A;  5D5X B;  3FM3 A;  3B02 A;  4L9J A;  5HDG A;  2EA4 A;  4RGX A;  3D5L A;  2RGV A;  4QLC U;  5BPD A;  3MZY A;  3J81 Z;  2WV0 A;  4UV9 A;  3GFI A;  4RB0 A;  2K4B A;  2VC1 A;  3HIF A;  5LGT A;  2VBX A;  5ERI A;  2G9W A;  2HZT A;  1ZYR F;  2GXG A;  5LRR A;  1W4M A;  3Q5F A;  2VBY A;  2P4W A;  3KFW X;  4NB5 A;  3QRF F;  4PGG A;  2CSO A;  1W5T A;  1TQI A;  1YTY A;  2H27 A;  3COA C;  1L0O C;  5L3G A;  3DEU A;  4WXD A;  1PUE E;  2Z3Y A;  2XRN A;  3BOQ A;  2HGC A;  3P9C A;  3TDU C;  2UXN A;  2X4H A;  1S3J A;  4AIK A;  2CFX A;  4A6E A;  1RUN A;  4G6D A;  4I0A A;  5E20 A;  1CF7 A;  3LA3 A;  3RPQ A;  3QPT A;  4UVA A;  3V7S A;  2FBK A;  5L3D A;  2K27 A;  5F1R A;  1F1Z A;  3ROU A;  4ZYG A;  4OIR F;  1R23 A;  2K86 A;  2BYV E;  4FHT A;  3GFM A;  5CVR A;  3F6V A;  2JRT A;  3GZ5 A;  4YII A;  4KNY A;  2KRF A;  2TDX A;  1Q1H A;  3P9K A;  5DD4 A;  3R0J A;  5D8L B;  1BI0 A;  1FBU A;  3E6D A;  3T8T A;  2FOK A;  4ETS A;  1DDN A;  4ZH4 F;  5A2Q K;  5BOX A;  2KIU A;  4LLL A;  1LNW A;  1H0M A;  4LGW A;  3M7G A;  3FF5 A;  3BP8 A;  3CO7 C;  2XKP A;  1HKQ A;  3LST A;  4EJU A;  4ZZL A;  4L5J A;  1YQA A;  5IT9 Z;  3TGN A;  1O3Q A;  4RB3 C;  1HKT A;  1BN5 A;  2PMH A;  1G4D A;  1KU3 A;  4KMU X;  4XBF A;  4ZYD A;  3R4K A;  3U2R A;  5AIP A;  4OU0 A;  1XGM A;  4DQ2 A;  4PZJ A;  4IVN A;  1F5T A;  1ULY A;  3G73 A;  2FU4 A;  4AIH A;  5JVT A;  3QAH A;  2FA5 A;  3W6J B;  2F5E A;  4ASN A;  4U0W A;  4P5O A;  1OMI A;  3F8N A;  2EFP A;  5LLQ A;  4BXU A;  2LSO A;  4HV5 A;  4TV7 A;  1G3W A;  1K78 B;  3GWZ A;  3RKW A;  4XSX F;  1MKM A;  2W25 A;  3KEQ A;  3J81 K;  5L3F A;  1OKR A;  3VOD A;  3BJO A;  2DO7 A;  1S7A A;  5D4S A;  4E70 A;  2PN6 A;  3SZP A;  2PBI A;  1B9M A;  2JZY A;  3ABT A;  1ZAO A;  4ZYH A;  1G3Y A;  4EJW A;  4UXN A;  1ZRE A;  1E2X A;  3BJ6 A;  3U1D A;  2M30 A;  2L4A A;  4BQA A;  2XGX A;  1YS7 A;  2EWN A;  3I59 B;  5L3C A;  4BHC A;  1QNT A;  2BBY A;  3O3K A;  2D2W A;  4L9T A;  2VE9 A;  2EJR A;  6PAX A;  4A2U A;  5ILV A;  2XIG A;  1MJA A;  2O6G E;  3TO6 A;  5E8I A;  5LHI A;  2DU9 A;  2RV8 A;  2VN2 A;  3GVA A;  2YU3 A;  4HF2 A;  1R36 A;  4EJO A;  5BMZ A;  1UFM A;  3K9T A;  4ESB A;  3ZMD A;  2AS5 F;  1Z7U A;  5F6F A;  3HRM A;  2Z9O A;  5K5O A;  3MCZ A;  2EFN A;  2XAF A;  4IXA A;  2E1C A;  4HA8 A;  2WC2 A;  2FNP A;  2UZK A;  1B9N A;  5DDG A;  3KLO A;  2STW A;  4HQE A;  4A0X A;  2ZKZ A;  3TO7 A;  4YFX F;  3VEP A;  2Q0O A;  1U8R A;  1HXD A;  2CW0 F;  4KIC A;  5ILU A;  4OIN F;  1GXP A;  4O6J A;  2IT0 A;  4M9X A;  4D0P A;  1ZRF A;  3KEO A;  5IT9 K;  3K1N A;  1Z05 A;  2AXL A;  1SFU A;  5BPI A;  2J5P A;  2A6H F;  4ENM A;  1DPR A;  1SD6 A;  2G7H A;  2ESH A;  2KKO A;  4AVP A;  2EV0 A;  2KJC A;  3F3X A;  4M74 A;  2VXZ A;  1FYM A;  3R6S A;  4CYD A;  1RIO H;  3V4G A;  1T0F A;  5LGU A;  4LG0 B;  2C6Y A;  1FNN A;  1IRF A;  1W5S A;  3DQV C;  3ZMU A;  2UXX A;  1RNL A;  1J7K A;  3ML6 A;  2QUF A;  4BNC A;  4FX4 A;  3WGG A;  1QPM A;  1MD0 A;  2A6E F;  1RUO A;  4PGH A;  2O3F A;  3D0S A;  1YO5 C;  3R61 A;  1FX7 A;  1JXS A;  1A04 A;  5FFX A;  4Y17 A;  5DCM A;  3ULQ B;  5ILS A;  1HBX G;  3GX4 X;  4EM1 A;  2OQG A;  1P6R A;  4KIG A;  2HFH A;  2O03 A;  2OZ6 A;  2YSR A;  3IRQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...