1WQ5A

Crystal structure of tryptophan synthase alpha-subunit from escherichia coli
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
268
structure length
258
Chain Sequence
b'MERYESLFAQLKERKEGAFVPFVTLGDPGIEQSLKIIDTLIEAGADALELGIPFSDQNATLRAFAAGVTPAQCFEMLALIRQKHPTIPIGLLMYANLVFNKGIDEFYAQCEKVGVDSVLVADVPVEESAPFRQAALRHNVAPIFICPPNADDDLLRQIASYGRGYTYLLSRAGVTENRAALPLNHLVAKLKEYNAAPPLQGFGISAPDQVKAAIDAGAAGAISGSAIVKIIEQHINEPEKMLAALKVFVQPMKAATRS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Tryptophan synthase alpha chain
publication title Conformational Changes in the alpha-Subunit Coupled to Binding of the beta(2)-Subunit of Tryptophan Synthase from Escherichia coli: Crystal Structure of the Tryptophan Synthase alpha-Subunit Alon
pubmed doi rcsb
source organism Escherichia coli
molecule tags Lyase
total genus 91
structure length 258
sequence length 268
chains with identical sequence B
ec nomenclature ec 4.2.1.20: Tryptophan synthase.
pdb deposition date 2004-09-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00290 Trp_syntA Tryptophan synthase alpha chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 1wq5A00
5F4SA 3M6YA 1G4SA 1O95A 1XL9A 1KFBA 1ZJIA 1C9DA 3WFAA 3GIYA 3KHJA 5G4EA 4YL2A 2OMAA 3FYOA 1GTHA 1VRDA 4A2RA 4WOZA 2VFHA 2E6YA 4WUIA 4ORIA 3U2OA 3TW7A 1KM1A 2CLKA 4O18A 3NQ2A 4E2DA 1XBVA 3VI2A 3C61A 3DI0A 2J9XA 3CHVA 3I7QA 4QJ1A 3W1NA 3R12A 4XBKA 1Z42A 1YXDA 5LNUA 2CFFA 1K7FA 3HG3A 4RX0A 3OVQA 2D73A 3UY7A 3B0VC 3O07A 4DF2A 1QDSA 4O4VA 5TIMA 3UWUA 3DFQA 3FA5A 1PHWA 3HPSA 5AHMA 3W73A 1A5AA 1R2SA 3O05A 1ME9A 2QCMA 4POCA 3BO9A 3C4UA 4Z0JA 3GNDA 4IJBA 3INPA 4C1KA 1B9BA 2Q8ZA 4K8HA 4NJKA 4UUIA 4CQAA 1GPWA 1H1YA 1P1XA 1XUZA 3PY2A 3QQ0A 3F1QA 3NGJA 4WY0F 3UZ5A 3OIXA 3HGRA 5HINA 3SIZA 4AWUA 2ATMA 1ZY9A 4GC4A 5LNRA 4GRSA 2ZZ2A 3W1XA 1TPC1 1X1OA 1TPB1 3WJSA 1SSDA 1ZENA 4N2YA 1U5JA 3IVSA 5KSWA 3PSVA 2C6QA 3TKFA 1M7OA 4Z1BA 1W5OA 2JKAA 2C15A 4PEKA 1SW0A 1KLZA 1ZNNA 3BG9A 1Q6OA 1LOQA 1EPXA 1ML1A 4CLMA 4Z08A 1QAPA 2ZZ1A 1O60A 1OJXA 1TCDA 3E12A 4GXMA 5FEZA 3W74A 1RR2A 4ZMGA 2JK2A 1IGSA 2EF9A 5FESA 3A22A 3GXNA 3R13A 3GR7A 3EWYA 3KAOA 3P7YA 3ZR4A 1DBTA 1YTKA 4KWVA 3OEXA 2CWNA 5ABTA 1G7VA 1OVDA 3G18A 2NLIA 3ABQA 5AC7A 1N55A 4LUJA 1OABA 2H3BA 3P84A 1FWNA 4WY0A 3TMQA 2R8WA 3BGJA 3HIJA 2O7SA 4NXSA 1F2JA 4JTEA 2TSYA 3IIVA 2JGYA 1TYGA 3F4WA 3UWWA 1GVSA 5DXXA 2V82A 4AMAA 4JTJA 3CEPA 4E38A 4PFMA 4PTNA 3FOKA 4Z1AA 1ICPA 5CPMA 2X1UA 2G5WA 4MPQA 2DORA 4UFHA 3GXTA 3NQMA 3DHFA 4X3ZA 3WJZA 1IIHA 1B3OA 1D3HA 4O1BA 3O8AA 3G1AA 2NXIA 5U7SA 1LBMA 5CZTA 1SO6A 3L0KA 3HG5A 1UJPA 3SR7A 2B4GA 5FEPA 3JS3A 4LU0A 2QEZA 1YDVA 3QRHA 4BF9A 2A85A 4FXSA 2Y7EA 4B5NA 5F2MA 4XWUA 1FBAA 1OFDA 5U4NA 5LHEA 1XI3A 3QYQA 1R2TA 4NNCA 2Y61A 3G1FA 3W7NA 4ZL1A 1FDJA 1JJKA 3NZRA 2E5CA 3GX9A 2C0AA 3LHVA 1NF7A 5KMYA 4TO8A 3S8HA 3ATYA 3HG4A 3QH2A 4HIBA 1SZEA 5K7JA 1AMKA 1GEQA 1C8VA 2E68A 4FNPA 3ELFA 3PS7A 4O15A 1FY6A 2WSQA 3B8DA 4WD0A 2DP3A 5HQEA 4IMCA 5D03A 1UUMA 4YWIA 2ZA1A 5E0KA 4R7JA 2Z6IA 3TJLA 3IV3A 3MHUA 3MO7A 1WAUA 4I7VA 1DJQA 1AK5A 5H91A 4LS2A 3FEMA 3DKJA 1DL3A 4JTIA 3C0JA 3C2VA 4GUIA 1LLZA 5AFDA 3S5ZA 2PRMA 3EB2A 5MHBA 2QCNA 3NM3A 1O94A 4TMBA 2Q8LA 3VE9A 3KVJA 4M6QA 1K02A 5AN7A 3GK0A 3VE7A 2Y70A 2YXGA 3O16A 4JTGA 2NUXA 3NQ7A 2IQTA 1RD5A 3SFKA 4NJHA 1JVNA 2E6FA 4UTKA 4MJMA 5CG7A 2P0OA 3NPWA 1YPFA 3TE9A 1VYPX 3LHYA 3PF3A 4ZQCA 1FCUA 3IVTA 3O6DA 3L2IA 3W7IA 4KFOA 1F05A 2FPVA 2NWRA 1EEPA 3DFSA 4LVDA 3CU2A 2OT0A 3LCHA 1J2WA 3QW4B 4MLJA 3THQA 3O1NA 5CSSA 5GVJA 1T8XA 3KVMA 3TV8A 1EIXA 4O52A 1FWTA 4UR7A 4WQ6A 1AW1A 3G1HA 4LTSA 4DPPA 1KM0A 2RH9A 4DF1A 1WYIA 4LS1A 3W70A 4LC6A 1OFEA 3W2LA 2Y7GA 1WBHA 3A24A 5EL1A 1WOBA 2JGQA 3NL5A 2XN2A 2ABAA 1SO3A 1PHQA 3BV4A 1VYRA 3QSTA 2A6LA 1C29A 1SR9A 2TMDA 3JR2A 3PULA 4NNBA 4UTMA 1XFBA 3C2OA 3TA6A 4O13A 3VKJA 1MEHA 1BWLA 3W2JA 4AWTA 1Z44A 2EPHA 2DZWA 3M5YA 2Y6ZA 3TAKA 1OF8A 4LVGA 1Q3NA 2OJPA 3GKAA 4FX6M 4OE7A 3DI1A 2C18A 3HGOA 1OX6A 4IUOA 1H7RA 3O06A 3P8IA 5EMUA 3S42A 5K4ZA 3GDTA 4A2SA 1SPQA 3BPWA 5F1UA 3STFA 1OYCA 8TIMA 3NL6A 4LOCA 1F6KA 1SU5A 3HPXA 2H8ZA 2GPTA 3IIZA 4BR1A 2QKFA 4ORMA 1KW1A 5T26A 4JTTA 5KINA 5DXYA 1ICSA 4QIUA 4IX0A 2CZDA 2WNZA 2V5LA 3CTLA 3SI9A 3QW3A 2HS8A 1XCFA 5F1VA 4MVAA 4K6AA 2HSAA 2VOMA 4BI7A 1OX4B 1D9EA 3LRKA 2TRSA 1FCQA 3A23A 4ALDA 7TIMA 2YSWA 4WXYA 3N73A 2Z6JA 4CNPA 3HOJA 1W1ZA 4O4WA 3TQ0A 3MBDA 3TXVA 2DZXA 2WQPA 3UZJA 3QPYA 3LXAA 3O6YX 2X1RA 5LNVA 3DHDA 4AHPA 2G97A 3DFNA 4O54A 3T40A 4HPXA 1KTBA 5C55A 3LI1A 1HFBA 5I3GA 2RDWA 5D2XA 4TX9A 1OG0A 1JRCA 3TQKA 1RZMA 4JX4A 3DGRA 5DLCA 4OV4A 3L0NA 3PG9A 1VCFA 4NT0A 1EB3A 2QCDB 3BARA 1FX6A 1EUAA 4UFMA 1O5XA 2CW6A 5DCEA 3N3MA 5HUOA 1JRBA 2J9YA 4MY8A 1EX5A 1FXQA 2DZSA 4N6EA 3P81A 3KXQA 4ZQMA 1GJPA 1QO5A 3M43A 2B7OA 1H7OA 2QUTA 4LC8A 4ZZ9A 1VYSX 2EHHA 1DKWA 2FDSA 3GR8A 2PC4A 5EBUA 4IMEA 4I7UA 1ZAIA 1QPOA 4MZ1A 4HHPA 3W3OA 3FJLA 4HSOA 4HT3A 5I3IA 3MHFA 2H8XA 5D2VA 4FNSA 3B03A 4DPQA 3NQEA 3N2MA 5G5IA 4QM1A 3RNDA 1VLIA 5H2ZA 4U28A 1HTIA 3SW6A 1Z48A 2QCCA 1P0NA 2C13A 3H54A 5D05A 3EX6A 3G22A 4K7VA 4GJ1A 3KVLA 2Q3RA 3WK0A 4N9EA 3S6DA 5FEXA 4IXHA 5DCBA 3G1DA 5FI8A 1ZHAA 2YX0A 3HBLA 1XBZA 2C14A 2ZBTA 3DKLA 2V5BA 3V1PA 3LBMA 3RK8A 1YDOA 3TQVA 2QCFA 4UTWA 3SGZA 3W1TA 3P67A 5G2HA 3IIPA 3SJ3A 1PS9A 4K8EA 3PUOA 3KX6A 3L21A 4ONVA 3W7PA 4UTTA 1TV8A 3L5AA 3NPXA 2XN0A 3CEUA 1GVFA 1THFD 2VFFA 4QITA 1DHPA 5C5YA 1OK6A 4CNOA 4PH6A 1VR6A 2NX1A 1QMLA 1G67A 1G69A 1SZNA 1YADA 3UWYA 4JTFA 4M6PA 3O6CA 2VFGA 2VEPA 4O14A 3UYCA 5AYZA 1VCVA 1ONRA 2CLEA 5CSRA 3IIOA 2NX3A 2J9ZA 1XDMA 1JCYA 1SSGA 4CQ9A 3S0CA 1PIIA 4GUFA 4WZHA 2TPSA 2AGKA 3M5ZA 2FLIA 3VCRA 4X2RA 4A3UA 3PG8A 1S5TA 2CLFA 3RLUA 1WBJA 4Q33A 3G0UA 2WJZA 3BLEA 3OHIA 4TMCA 3DU0A 4AB4A 5C54A 2J6XA 1W5MA 3BK0A 1D3GA 2ALDA 2B7QA 2X2GA 2E6DA 4EF9A 3G3MA 4NUWA 4LNYA 1O4UA 4IQLA 2BXVA 4O16A 4L4MA 2V0TA 2OZ0A 2OT1A 3K30A 1K7EA 2YR1A 4WXZA 3NZ1A 3S1UA 3I68A 1WV2A 1L9WA 3LGEA 1F7BA 1X8FA 2QAFA 2DZUA 4M7TA 4O1CA 4K36A 4EWND 2J88A 1UUOA 2V81A 3M7WA 4CCDA 3FJ6A 3NDOA 2X30A 1VLWA 3E02A 5D2YA 3W75A 1KFCA 1ZAHA 3LTSA 5AHIA 3T44A 3WK3A 3N34A 3OG3A 4JNMA 1XDLA 4UMAA 3SZ8A 4UCGA 3C2FA 2V2DA 2E09A 5LGXA 2VKZG 4JTLA 2ZRYA 3N2XA 4BWLA 5L6UA 1T0OA 1W5NA 1YLVA 4WOQA 3W2UA 2V2CA 2VEKA 1I2OA 3RMJA 2A21A 1XKYA 2PURA 4ZQNA 1PL9A 2VFDA 3BG3A 4R33A 3IIXA 4O53A 3W1UA 3WK2A 3A21A 1V7YA 4IMDA 3W07A 3S5YA 5D33A 1OX4A 3LM7A 3N19B 1SW3A 3UQNA 3QMSA 4XTDA 1B57A 3GVGA 2A7RA 5HJLA 1QPRA 3TSBA 2QCLA 4BWLC 4GUGA 2NUWA 3W7RA 4O50A 3WJWA 3WK1A 1TPFA 1XBYA 3HPZA 3M1ZA 2ABBA 1LZOA 2OX1A 3SSJA 3TR2A 4MYXA 1ME8A 5D30A 3DAQA 1GWJA 1MEWA 4XKYB 3HJZA 2WKJA 4FO4A 5EY5A 3B05A 4R34A 1TPH1 2DZTA 4UFIA 2EAWA 4NX0A 4UTUA 1NAL1 3HGSA 1OFQA 2GQ9A 2QCDA 5FF0A 5F2IA 4IPJA 4ZQRA 1TB3A 2E77A 4DEFA 3L0GA 3W72A 3M9YA 4FEZA 3UPWA 4RCXA 1LRNA 4RZ6A 1QPQA 4JDBA 4JTKA 3STGA 1KA9F 3PVFA 3QC3A 3T7VA 3W1AA 3SGUA 5DELA 3PB0A 3R8RA 1TPDA 3LCFA 1JCMP 3TDFA 3LRLA 1KV5A 2ZRVA 3T55A 3DFOA 3KRUA 3NVTA 1T96A 1TO3A 3GYEA 2P1FA 5EPDA 3MMTA 1CI1A 3L66A 4J9JA 4N6FA 4GNJA 3L67A 1LOLA 4A21A 1BEUA 1EP1A 3D0CA 3HO8A 4AH7A 3P5ZA 3B0PA 1FCVA 3S5NA 5CPNA 1F6PA 3B0UX 4O1AA 4RZ4A 2WOQA 4OV9A 1JUKA 2NXGA 4MUZA 4P61A 2QJGA 1FUYA 1XUUA 2A0NA 4O17A 4P2VA 3BW4A 4PODA 3W7MA 4PCFA 4O0KA 2FB2A 1RV8A 4XQ6A 2PCQA 1LM1A 2RFGA 1LOSA 2NX9A 3ABSA 3TSDA 1T99A 2BLEA 2ZQ0A 1H63A 3UXAA 3FKRA 3M44A 4LWWA 4ADUA 2RDUA 1VPXA 2AAMA 2O7QA 1HO1A 1JCJA 3NL2A 2ZCGA 5L9FA 3C52A 3NQCA 3BW3A 4IWWA 3HMJG 1KV8A 2HS6A 4DBEA 4LV4A 3LCWA 1GTEA 1A53A 2JBMA 3NM1A 2GVLA 3N14A 2H6RA 5IBXA 1H50A 1ZAJA 3GZ3A 3W2NA 4JTSA 4DO6A 1TV7A 2X1SA 1AG1O 2G95A 2ISVA 3GDKA 1IIGA 4Y6GA 3I7SA 1ADOA 2YW3A 4Y9AA 4OWGA 1U83A 3AJXA 4ZQOA 1L6YA 3GLCA 3S1XA 3CIWA 4FX8A 2JKPA 4L4LA 3C2EA 1H7XA 4LUIA 1VCGA 3SY5A 3M47A 3CB8A 4XTIA 4UFLA 3S1VA 4JIQA 4TU1A 1PVNA 3UY8A 1GQNA 1FXPA 3N9SA 1L2UA 1TRDA 3TW6A 5HWMA 3USBA 4GFSA 2CLIA 4QISA 4LVBA 1PE1A 1X7FA 2NV1A 1TIMA 4Y96A 1L6WA 4O19A 3MP3A 1JUBA 2QJIA 3PBYA 2Q3OA 4QNWA 3S5OA 4MZYA 1M7PA 1DVJA 5EA9A 2CLOA 4JTUA 3BVJA 3MI2A 2E1DA 3CQ0A 2R91A 3LV6A 1TTJA 1Q6RA 5HULA 4BFAA 5FEWA 4KWWA 3W86A 3EKZA 3L5MA 5G2IA 3DXIA 3L9CA 1Q45A 1LRTA 2VEMA 4FNUA 4NX5A 3NQVA 2VENA 1ICQA 3G0XA 3NO5A 1TJPA 2GJNA 1TTPA 2WV8A 4G1KA 4CCCA 3OBKA 2OCZA 3HQ1A 3WJYA 4OHQA 4ZVJA 1QOQA 3Q58A 3NL3A 3QF0A 2QCGA 3W1RA 1OFRA 3T78A 4EIVA 1FCBA 4YMZA 3LTYA 4UXDA 1GVOA 1R47A 1TV5A 4HN4A 4PL1A 3W7JA 2ZZ5A 2ZA2A 5E93A 2V30A 2ATSA 3P61A 1G4EA 4IGHA 1KTNA 4MFEA 1RQEA 4JXCA 4DO5A 1Q6LA 3G1XA 1MEIA 3QQ1A 1OYAA 3FLUA 3GDMA 5FF2A 2YFOA 2ZRXA 3ABOA 1UASA 3G3DA 1H7NA 4S2CA 5G1TA 3IRDA 3EWXA 3LXCA 4IX2A 3W7GA 3TIMA 3P80A 5BRBA 2LLEA 5K4XA 1W5QA 4RV8A 1MSSA 5LZLA 4XBSA 3O63A 4Q4KA 4O1DA 1KM4A 1SW7A 3LX9A 5AHNA 3NAVA 4N4PA 1QO2A 4UMBA 3UNDA 1B4EA 1SZFA 2WO5A 5FF4A 3PSWA 5D04C 3STCA 3GXPA 4E2BA 2C19A 3FIGA 1LYXA 2CLHA 1WXJA 3BLFA 4QNEA 1JQXA 1KM3A 3QM3A 1H62A 4XKYA 1Y0EA 4EOUA 4UIOA 2ZDRA 1AL8A 4CCEA 5CZ0A 2YW4A 2CZEA 2FFCA 1KFEA 3LRMA 1H1ZA 6ALDA 1JULA 1BKSA 1H5YA 2Z0IA 2FTPA 3EWBX 5DN1A 2XFWA 1W3NA 3IGSA 4RKAA 4M6VA 4N02A 3O15A 4Q32A 2Y88A 1YDNA 1XC4A 4I7WA 2Y63A 3LBCA 5F4WA 1KM2A 3NQDA 5EKYA 5E1QA 4DO4A 4N4QA 1TPVA 2TYSA 2CZ5A 2DJLA 1AL7A 2QF7A 5F2GA 2V9DA 3F4NA 2Y62A 4JY8A 4DXVA 3W71A 4R53A 4UFJA 3CC1A 3EX3A 1I2PA 1K8XA 4E0CA 1K8ZA 1I45A 1NFBA 2ZFAA 3C56A 1G6CA 3YPIA 3TUUA 4AEOA 3W88A 3NR0A 4FX7A 4JEQA 5LKYA 5D32A 2C3ZA 2ZZ7A 3L5LA 5AYYA 2A6NA 1RPXA 2WSYA 3MP5A 2BTMA 3LCXA 2RHGA 3LDVA 3EX4A 3I65A 3G1YA 5K2ZA 1QFEA 1DQWA 4NJJA 4GUJA 4YXGA 4Y8FA 3M0ZA 1IXOA 4DQWA 4X22A 4S2BA 1JUEA 2GVJA 3W87A 1EUNA 2EGZA 3PBWA 3DENA 3NQFA 3NXFA 1YXYA 2E5DA 3P62A 1FDYA 4O28A 3W7KA 3CPRA 1TQXA 3RLVA 4YLWA 3LOTA 3LB0A 1W8SA 4AHQA 3TXZA 1W5PA 3W2KA 3PR2A 1EWEA 2DZVA 3KRSA 5G1YA 4YCOA 1DQXA 3EXTA 3NPUA 3S9YA 1F73A 3ZWSA 1BWKA 3ZFHA 1H7WA 1ZALA 5K9DA 2Y89A 1KTCA 2DJXA 5AHFA 2X1TA 3MI3A 1FDZA 1TRIA 4O8RA 4UFKA 3NEVA 4AAJA 1LLWA 1K8YA 3QZEA 1S5WA 4UTJA 4HNVA 3QPZA 5J5DA 3G24A 4UTWC 4NVTA 2ISSA 4KFPA 3EEGA 4O0ZA 4UR8A 2B7NA 4FIQA 2GVGA 3W1QA 1X6UA 3W22A 3C2RA 2F84A 2Y7FA 4O11A 1KFLA 2YDAA 3PB2A 4XUGA 2R14A 4BI5A 4UTTC 1P4CA 3G1SA 1WA3A 1JCXA 4C1LA 4JS3A 2A1YA 2W0UA 1SZGA 1LBLA 3IEBA 3A5FA 1OX5A 3MYOA 3OVRA 1X1ZA 3W2MA 1TSIA 3FFSA 3ZWTA 3OA3A 4CQ8A 5K3VA 3G0SA 1SO5A 1EWDA 1ZCOA 4GE8A 3ZS4A 4HSNA 1FWSA 1W54A 2CZFA 1Z41A 1KBIA 1S5VA 3NOEA 4NJGA 3W1PA 4M5PA 2WNQA 1OK4A 4FNRA 3TFCA 5AOUA 3I6RA 3UXDA 5BOOA 4RXGA 1WOAA 1VS1A 1N8FA 4M7SA 4RLIA 4K39A 4NJIA 3UD6A 1VH7A 4JICA 1LDCA 2Z1BA 3TX9A 1DORA 1J4EA 3CWOX 3LCIA 4DBDA 1WQ5A 4YCPA 1GVRA 2Z2UA 5A8GA 1LBFA 4FIRA 3THAA 3U6WA 5F2LA 2BSLA 4KKXA 5I3KA 4LRTA 3HB9A 3H55A 5DBUA 5EYWA 5I3FA 1KM6A 1TTQA 2EKCA 4H3DA 4IXXA 1L6SA 3W7HA 1GG0A 1RVGA 4HKPA 3NYZA 2VELA 3B04A 3M5VA 1I4NA 3Q2DA 5KITA 5D2WA 4AF0B 3E96A 1GZGA 5BMWA 1LCOA 2PRHA 1H61A 4A22A 3LI0A 3F03K 1YPIA 3AO0A 3NQGA 2V8ZA 3B06A 3R2GA 3W85A 3LHWA 4MOZA 3MWAA 4MIMA 4GWEA 4RZ5A 4UTIA 1B4KA 1TJRA 3W7EA 3BLIA 5IM51 2W79A 3GKFA 1IF2A 4UTHA 3OVPA 3W9ZA 2QUUA 5C2XA 2GOUA 1W3IA 1CW2A 2QCEA 4WJEA 2QR6A 1I2NA 3VNDA 3W7QA 4FXRA 1JCNA 4LVAA 5HWNA 1ME7A 3C6CA 3I7RA 1MZHA 1AW2A 1NSJA 4ICNA 4JN6A 4N9DA 5D09A 1KFJA 1LRQA 2ISWA 3U8GA 4PL2A 4MY1A 4O10A 3TJXA 3R89A 3B4UA 3Q94A 3TNOA 1HL2A 2YPIA 4OU1A 1P5BA 3S1WA 5KZDA 2ZRZA 3DFPA 1P0KA 3CIXA 3CT7A 1V5XA 4HNUA 1W0MA 1MO0A 4IMFA 1IXPA 4JR5A 3NPVA 5HR6A 1JCLA 4MZ8A 3MUXA 4CNNA 5DY3A 3NA8A 4LRSA 1VHNA 4UNLA 3IGXA 1M5WA 3TU9A 2E5BA 2ZZ4A 2A4AA 3DFTA 2Y7DA 4WX2A 2I9EA 2FPTA 3RFAA 4ADSA 1H51A 5D2TA 1VQTA 2C16A 4EVZA 2YYUA 1RQBA 3EX1A 3PUEA 1IXQA 5KZEA 1F76A 5CPOA 5DY2A 1VC4A 5LGZA 2P10A 1LORA 3UWQA 4MFDA 4NXKA 4Z0SA 4EF8A 1OFOA 1F74A 1TPUA 3UWVA 1YXCA 3LHTA 3E9AA 2Y85A 1NEYA 3R5EA 1ZFJA 4UMCA 5C6MA 2V2HA 1VZWA 2A7NA 2NUYA 2VXNA 5AHEA 5FF7A 3MJYA 1XBXA 4JY9A 1SFLA 3W6YA 4IMGA 5HUPA 1O5KA 4A29A 4LT9A 4JYDA 2CU0A 1HO4A 3NQAA 5SWUA 2A2IA 4M19A 4X9SA 4JDYA 5LSMA 1TREA 5FF3A 1TPEA 1R2RA 1KFKA 1UB3A 2NZLA 1OFPA 5KZMA 4AVFA 3W7DA 1EA0A 2BZNA 4ZQPA 3W7OA 1EP3A 3FKKA 3SECA 4MY9A 4PC8A 3BGGA 4LW7A 1NVMA 1JQVA 3TSMA 3JRKA 3PM6A 3IVUA 3LLDA 4FF7A 3UWZA 4FB7A 1DJNA 2E6AA 4KFNA 1WX0A 5G2WA 3DH7A 2DU2A 3C8FA 4FNQA 2WSRA 3CM4A 4OBTA 3KRZA 3L68A 5D38A 2YGYA 5K9XA 1AW5A 5I3JA 3GDRA 5D02A 3LLFA 3P74A 1GT8A 3EWZA 1FWRA 3E0IA 3EXSA 3MBFA 3MP4A 1QWGA 4QAIA 3HG2A 1PCWA 3CLMA 4NNAA 1A5CA 5IBXC 3T4CA 1PCKA 4Z1CA 2ZTKA 1QR7A 4W9TA 1VJIA 1LP6A 4HNNA 4NZFA 3W23A 4K38A 1E51A 2W6RA 4MLRA 3NQ8A 1XM3A 2HMCA 2ZTJA 1G4PA 1SFJA 3TROA 5TBOA 1GYLA 4UNKA 1OF6A 2I1OA 2FPYA 3FYPA 3PBUA 1XXXA 5BMXA 1LTDA 2QDGA 2GQ8A 2C1HA 3TC7A 1OYBA 4JYFA 1W56A 2F7FA 1Q6QA 2VFIA 3QJAA 3UPBA 3LHUA 1TPWA 4Z1DA 4Y90A 3ABRA 2RDTA 4JX5A 1QCWA 3MW7A 1R30A 1YTEA 5G4WA 1OHLA 2GQAA 3CWNA 5CZSA 3H53A 3QMTA 5AYXA 3ATZA 3PWAA 1GOXA 3GB6A 1OFAA 1I2RA 4TR9A 5K9CA 2NWSA 1M6JA 2H3DA 3LHZA 3G1VA 3MI6A 1VHCA 3W76A 1W37A 1DOSA 4QSHA 1YTDA 3HF3A 3QEZA 5I3HA 5BNKA 4K7YA 4U4MA 4BI6A 1VGAA 1ALDA 2WPBA 2XN1A 4FHAA 1A50A 1GG1A 4RR4A 2CLMA 1K03A 2A5HA 3LCGA 3M16A 2BX7A 5CGQA 2YZRA 1YYAA 3TAOA 1J5TA 3G8RA 4OT7A 2GJLA 1H60A 2I14A 3PUDA 2ZYFA 4LVFA 5DBTA 2AQWA 1PV8A 3GAYA 1MXSA 3NQ6A 3TC6A 4LV9A 3TFXA 4AF0A 5DCDA 4FNTA 4UTLA 1DV7A 5KTLA 6TIMA 3MHGA 4DF0A 3W1MA 2NXHA 4JYEA 3QFEA 1W3TA 2NV2A 1HUVA 3QMRA 2B7PA 3PAJA 4N9BA 3NG3A 1K7XA 4PA8A 1TTIA 2X16A 4RJEA 4N9CA 4RXFA 1FWWA 4JTHA 3BW2A 2UV8G 4RK8A 3LV5A 2CLLA 2DZPA 4NZJA 3RF9A 3EKLA 3TK7A 2H90A 3IGUA 2ZA3A 2VC6A 5D37A 2PE4A 2J24A 5F4XA 3W84A 1UCWA 4WY0B 5TQLA 3EXRA 5LHFA 2VFEA 4IPIA 4JGDA 4LY8A 1R46A 5LNSA 5AC6A 1QNVA 4GBUA 3P82A 3W1LA 3P5YA 3GDLA 4MYAA 3KVKA 4H4IA 3N9RA 5BW6A 5HWJA 1K3UA 1QPNA 2WNNA 5HR7A 1NF0A 2B0MA 4XZ9A 3PBVA 3W83A 4GUHA 3QSRA 5AB3A 1UBSA 3ANYA 3LERA 1EP2A 2BWGA 4NU7A 1GVQA 3W7LA 5AC8A 3GNNA 3V75A 3KOFA 4AXKA 2A7PA 2QAPA 2G96A 5CZJA 2QDHA 4IOTA 2VEIA 2YCEA 4UC5A 1TQJA 1G4TA 2FQIA 5A5WA 3C3NA 3TCEA 1F5ZA 4JX6A 3WJXA 3EWWA 4HNTA 2JKEA 2ZRUA 3TMLA 2QJHA 3PC0A 1IXNA 4LS0A 4MJZA 3E49A 3LCLA 1QOPA 3BG5A 1CX9A 3DZ1A 3FS2A 5CPLA 4AWSA 1KLYA 4K37A 4HPJA 1SUXA 5HMSA 3VFLA 5AHLA 4OQVA 3P60A 1W31A 2FJKA 3A5VA 4S1FA 3P8JA 3Q37A 3HGJA 2HTMA 1I2QA 1RQHA 1BTMA 3DBPA 3TH6A 3A9IA 5HNRA 1KM5A 1SQ7A 3L65A 4MKNA 1S3HA 4O57A 2ZZ6A 1JR1A 1KBJA 3KFTA 4JIPA 2PRLA 2QCHA 4O12A 1SO4A 4JD4A 2YYTA 3EWUA 4DELA 2ZRWA 1H7PA 1LROA 3W7CA 3LXBA 1A5BA 3MYPA 2GUUA 3NNTA 4ML9A 2RKXA 4BK9A 4D2JA 3LTPA 3EX2A 2QUVA 5J5RA 3GAKA 1FQ0A 1GYNA 2FIQA 4ADTA 2ZZ3A 3STEA 3M5XA 1G7UA 2J27A 4H6KA 3M41A 4OGZA 1TMHA 4TIMA 1I8JA 1OFBA 2KZHA 1HG3A 2FB3A 3G8EA 4I9AA 2R94A 2YFNA 1N7KA 5CKSA 1WDWA 4NQ1A 3RU6A 5LNWA 1A5SA 4AHOA 4QQ3A
chains in the Genus database with same CATH superfamily
1WKYA 3M6YA 1YNPA 1O95A 1XL9A 3T0TA 1WDPA 1PSCA 5JVLA 1KFBA 1M9HA 4HHLA 1ZJIA 2WNWA 1C9DA 3GIYA 2PF0A 4NIRA 5G4EA 2DEPA 1ITXA 3UJEA 4QROA 2E6YA 4WUIA 3TW7A 4PYSA 1AZ2A 3N2TA 1RVKA 4OZOA 3DI0A 3CHVA 2P76A 3R12A 1YXDA 4LYRA 2YJQA 1E6NA 3ARPA 2GGHA 3DERA 5IDIA 3ZM8A 1K7FA 3HG3A 1TUXA 4DWDA 3B0VC 4RE2A 4U5KA 3THUA 3HQOA 3TCSA 1W1IE 1QDSA 4B9YA 4IP7A 3DFQA 3CZJA 3PZOA 3WDIA 5D9PA 2QCMA 1EZ2A 1RK5A 1EXBA 2YLLA 3SN4A 2PLKA 1EYEA 3VDAA 4IJBA 1ECQA 2Q8ZA 4UUIA 3P6LA 1P1XA 1XUZA 4GIRA 1PIGA 4DZAA 3N25A 3GBEA 1C8QA 1R87A 3OQ8A 4I9MA 3KL0A 4I6VA 1ZCCA 2ZZ2A 1TPC1 2WSPA 2WW5A 2AQVA 1TPB1 3JVAA 1SSDA 1U5JA 2C6QA 3P3BA 4A8NA 1W5OA 1Q6OA 3OIHA 2JEPA 1ML1A 3KLLA 4LF2A 2D1ZA 3V0TA 5FEZA 1W3HA 2CYGA 1E15A 4XAFA 4Q7IA 2EF9A 3A22A 3BL3A 3EWYA 3P7YA 3WZ0E 3ZR4A 1DBTA 3DEQA 1YE6A 3ZJ6A 1MYRA 3IPWA 1TVLA 4AC1X 1YX1A 5A6AA 2CWNA 4CNUA 3EOSA 5AC7A 4XV0A 3CUJA 4MMWA 3PP7A 3U4FA 1W9VA 3QGAC 2TSYA 4CVWA 3WD2A 3WX7A 3RPTA 2QW5A 1UUQA 3UW6A 4H01A 4AY1A 1ICPA 2Z7GA 2G5WA 4MWAD 4UOZA 3H2NA 4ACZA 4UFHA 3AXKA 3APTA 1VPQA 2P88A 2Y2WA 3AMCA 4QR6A 3E38A 4P7LA 5U7SA 3SCVA 3HFTA 3TTYA 2DT2A 2E67A 3HG5A 3WQWA 1UJPA 4QRNA 1YDVA 4FR1A 4BF9A 5F2MA 1FBAA 5CGMA 5I06A 1ZSXA 5HMDA 5T9BG 4W87A 2E5CA 2C0AA 3G1RA 4CCZA 3OLIA 1NF7A 3AZSA 4HZMA 4PULA 4TO8A 3RLGA 2PDFA 4B9ZA 5DMYA 1GW9A 3CV6A 4QHRA 4DLFA 3ELFA 4DYKA 1QNQA 1FY6A 1ITQA 3ITXA 5D9OA 2DP3A 1DQUA 4YWIA 1UUMA 5E0KA 2J77A 1P7TB 3C0JA 5XINA 3STPA 3M6DA 3VFCA 2CC0A 2HNEA 5FOOA 3S5ZA 3EB2A 3RCMA 3TYEA 2Q8LA 4QJ5B 5E09A 1G1YA 2YXGA 3O16A 4JTGA 1XYZA 1OBAA 3AIWA 3SFKA 2D3LA 4L6OA 2FZ9A 3UZWA 4INFA 2P0OA 5ECUA 1MW3A 1VYPX 1HW6A 3AHYA 1X6NA 4ZQCA 3O6DA 4HSHA 4KFOA 4MADA 2J7FA 3QR3A 1J2WA 4IL0A 3ZIZA 1GOQA 3WQPA 4C7FA 5CSSA 1T8XA 4HMNA 3BSGA 1O12A 1R0MA 1EIXA 4O52A 1E0WA 4WQ6A 3MB9A 3S2CA 2EPLX 1FWBC 1WYIA 2DUXA 4AW7A 1KRMA 4GBDA 1OFEA 1ZB5A 4HN8A 3A24A 5EL1A 2ABAA 3H2AA 5H8MA 4BF5A 5T91A 1VYRA 3B9AA 1SR9A 4GOAA 2ISDA 1MNZA 1R3RA 3R43A 1KRCC 4NNBA 1VBHA 2J7GA 1MEHA 1L0PA 2WAGA 2J8FA 3SIMA 4BZYA 4GZIA 4JKKA 4CD4A 3E0FA 3UEQA 3DI1A 3HGOA 1OX6A 3O06A 5EMUA 1OYCA 4LOCA 4LB3A 1F6KA 4J3TA 2DIKA 5TAOA 1KW1A 4B4HA 2YCLB 5KINA 4CU8A 4L56A 1UD4A 3WNOA 4JIHA 1ICSA 2J47A 3T2OA 1LT7A 3SI9A 2V5LA 4PMQA 3QW3A 3XIMA 2J13A 1YRRA 4R7OA 4ZO6A 4FALA 4IZGA 3CUHA 1Q5MA 4X9YA 1V02E 3OOQA 4BI7A 3EZ4A 1W9XA 4XB3A 1CB7B 3HOJA 4FP1A 1MUMA 4O4WA 1QHPA 3IUHA 3TQ0A 3TXVA 2X0SA 4YJ5A 2WXDM 2WQPA 1XH0A 3UZJA 1ZTVA 3F5LA 4CN1A 3LXAA 3O6YX 1KQYA 4GVHA 5LNVA 3DHDA 1W1TA 1JNEA 4HPXA 1ECEA 3OJGA 2G3NA 2WZEA 3HQPA 4PMNA 2RDWA 4C6MA 1D7FA 2J78A 4KRZA 1JRCA 2ACQA 5I6SA 1XX1A 1PKLA 3EB4A 5DLCA 1I1XA 3L0NA 3PG9A 2J74A 4MAZA 3WKZA 1B31A 3BARA 2Z00A 1EUAA 2DVTA 4IT1A 1JRBA 4ZTXA 5BXTA 5E9XA 1FXQA 2OPJA 1T41A 4V1YA 1DWIM 4M24A 1HN1A 3KXQA 1B3XA 2W3ZA 3EPNA 4P8VA 2QUTA 1AQFA 4ZZ9A 4P5UA 1UQYA 4I7UA 1TE6A 3CO4A 3KL5A 3W3OA 2ZX5A 3EWCA 4HSOA 3MHFA 4I90A 2H8XA 4DPQA 5BOFA 2INZA 4QM1A 4MWAC 4U3CA 4QLJA 1F3TA 2AAAA 4DJFD 4U28A 2ZUMA 5AYBA 3H54A 1P0NA 2C13A 4HGXA 1CECA 1JD9A 4HK7A 1O66A 1U5VA 4ZTYA 3R6IA 3G22A 4K7VA 1P0BA 2Q3RA 4JCLA 4EX4A 1PIFA 5A6TC 5DCBA 1HKKA 1JPHA 4U3AA 3UXKA 1XBZA 3MSRA 3HMCA 2FGZA 3RK8A 5HK4A 3TQVA 4GZJA 3NTYA 2REQB 2DY3A 1OT1A 1H0GA 3H2MA 2DVUA 1XGDA 3RX2A 1XLGA 1HP4A 1HKVA 3URBA 3LM3A 1DJGA 4QITA 2CETA 5LIKX 1CGTA 2POTA 1VR6A 2NX1A 4WVXA 1G67A 4L65A 4ZB0A 2WZIA 3UWYA 3VAVA 4JTFA 2FGBA 4O14A 5AYZA 2Z2BA 5CSRA 2BOGX 1MFVA 3S0CA 1DXIA 1VEPA 3VKKA 2Y5JA 4IJRA 4GUFA 1DIKA 3TYDA 2FLIA 3AALA 4X2RA 1S5TA 2EG7A 1WBJA 4Q33A 4S3BA 3BLEA 4TMCA 3MZ2A 3BK0A 3GG8A 2B7QA 4GMEA 5C9ZA 4AIUA 4E3VA 4AZGA 1P48A 2Z1SA 2X2GA 3UBPC 1GHRA 4LNYA 2XISA 2OZ0A 4LAZA 1UKSA 3G5EA 4HJFA 4EPEC 1JCTA 3BJSA 3NZ1A 2CLPA 3LGEA 3M0YA 3EMCA 4M7TA 1GORA 4O1CA 1B2YA 4K36A 2J88A 2HPIA 4PGLA 2V81A 3M7WA 3FJ6A 3NDOA 3U7BA 1VLWA 5D2YA 1TX0A 3GO2A 3T44A 3M7SA 1KKOA 4UR9A 4HJWA 3SZ8A 4KERA 5CBIA 4YVXA 2X41A 2OLAA 3N2XA 4JPGA 4NF7A 2POZA 1W5NA 2VMFA 2V2CA 4GYKA 1I2OA 3MU7A 3RMJA 3AFBA 4LBSA 1KBBA 3W1UA 4O53A 3VILA 3WNKA 5BWFA 2OGYA 2XFYA 5A6SA 1ZBKA 5IDZA 1OG6A 3V18A 1YNYA 4F0HA 3QMSA 2VDHA 1ISWA 2XGBA 3CAWA 1UOZA 3GVGA 5HJLA 3TSBA 3FSUA 4JFUA 4PRTA 4QS5A 4I6KA 4OTKA 4BWLC 2VR5A 2NUWA 1ITUA 1XBYA 3VPLA 2DSUA 2WB5A 3TR2A 3R0UA 2HPMA 3OGRA 4AY7A 1V4YA 3V5OA 1US3A 3EPOA 3DDMA 4XKYB 1E6XM 3NWRA 4HCHA 2ZADA 3BSMA 4FO4A 3SQLA 1A3WA 4UFIA 3HGSA 1OFQA 1AH4A 3EWDA 1AA1B 4H7CA 1NH6A 4IPJA 2E77A 2V67A 3RDKA 3L0GA 3CK5A 4P7QA 4RCXA 5AVHA 1W1A1 3BCFA 4ZXLA 3IUDA 4JTKA 4WJXA 1KA9F 3GU2A 4GGHA 4AX7A 5DELA 4RNJA 1A5MC 3TR9A 3LCFA 2BB0A 1JCMP 4YHGA 4C6DA 2RUSA 1QI2A 5HANA 1KBLA 3THDA 3W6MA 3L66A 1LOLA 2O4QA 1R38A 2WLYA 1BG4A 3B0PA 3ARUA 1PKNA 3VNZA 2ODOA 1HKMA 2WOQA 4OV9A 5T9CE 3MCNA 4OECA 1JUKA 4P8UA 3WEMA 3E5BA 4PODA 1RJQA 3GTIA 3OZMA 3W7MA 3DX5A 1XIIA 2FGLA 3AHVA 1RV8A 4TX8A 2O9PA 1PX3A 2PCQA 1LM1A 2RFGA 3TSDA 1T99A 2ZQ0A 1H63A 3FKRA 3M44A 4LWWA 4KEVA 3IARA 2RDUA 1UR0A 3WQ4A 1MVYA 2FKPA 3W00A 4GG9A 1Z3NA 3M4HA 4LV4A 4WSHA 1PYMA 3NM1A 2H6RA 2XYLA 3TW9A 1H50A 3GZ3A 3W2NA 4GI9A 1V77A 3D46A 3QN3A 3VKDA 1K9DA 3SQSA 3GDBA 3AMKA 4AIBA 1IV8A 2JE8A 3AJXA 1L6YA 4FX8A 2JKPA 1H7XA 3K4WA 1VCGA 4Y8EA 4UCFA 1BSIA 1CXFA 4TU1A 1PVNA 1K4GA 2DH3A 3N9SA 4JBRA 1EJRC 3W28A 3Q4DA 1BYDA 5IRPA 2WM0A 1TRDA 2XH7A 5HWMA 4WCJA 4GFSA 2CLIA 1PE1A 4GLEA 3BOXA 2CCRA 2CITA 5XIMA 5B80A 2PODA 1KXHA 4QNWA 4C6IA 3OA5A 4MZYA 3N17A 4IUGA 4JTUA 4AY8A 3WH8A 2O9TA 3LV6A 4BFAA 1QI4A 4UNIA 3EKZA 5G2IA 1VKFA 1B54A 4B91A 1Q45A 2PZNA 2VEMA 3L4YA 3NQVA 2EPOA 1LG1A 4G6CA 3NO5A 2GJNA 1EC8A 2O4MA 3KBWA 2WV8A 1O1ZA 2PDKA 4CCCA 5I0DA 3OBKA 3WJYA 1HF6A 3WQOA 1OCBA 1S46A 3W1RA 2CHNA 1WO2A 5M3WA 3LMZA 1OFRA 3OQEA 3FA3A 4EIVA 2Q01A 3QHOA 2XTKA 2IKHA 1GVOA 1R47A 4HN4A 3W7JA 4L9YA 3P61A 4XIAA 4GVIA 4IGHA 3EOUA 4JXCA 4DO5A 2HBVA 3FLUA 3GDMA 3GIPA 3KBVA 1VIWA 3PZUA 2ZRXA 3ABOA 1IZCA 4MJ4A 1GZJA 3LGGA 4WEVX 2C0HA 4RV8A 4Q4KA 2X7WA 1VFMA 4L4OA 4IIFA 1KM4A 1SW7A 3NAVA 3BLKA 5E6YA 1R7OA 4IG2B 1B4EA 4OOZA 4OFCA 1OIMA 3PSWA 5FF4A 4GYJA 4J28A 3FIGA 2V68A 4JN7A 4AX6A 4QNEA 1X8CA 3BLFA 5GJNA 3ES8A 2GYIA 4XKYA 4UIOA 1AL8A 3DFHA 3FHQA 1EFZA 2CZEA 2FFCA 1KFEA 3NUKA 2ACRA 1JULA 4JIRA 2OVLA 4YN5A 5E70A 3IGSA 4RUBA 4JNYA 1TWWA 3ENLA 3Q67A 1MXDA 2HV5A 1KM2A 3PPCA 1A49A 5E1QA 5EKYA 3RAOA 2TYSA 3F4NA 3N6QA 2WMIA 2XM2A 3W71A 4R53A 4A3RA 4UFJA 3EX3A 3GR4A 4E0CA 1K8ZA 5HPCA 4ZEPA 3YPIA 3I6EA 2XSBA 5LXEA 3BOFA 4AEOA 1NOFA 4N7QA 4D6GA 5D32A 3VOCA 4GCAA 3L5LA 5I03A 3MTWA 1NDYA 1EKOA 1XISA 3WL0A 2A6NA 1RPXA 2BTMA 3E3HA 3O0FA 3SUSA 3LDVA 4S3KA 1ZJAA 4Q6JA 3UCCA 5K2ZA 1E0TA 2NSXA 2ZX7A 1UD3A 4X22A 3VTRA 2BVWA 1EUNA 4GQGA 4AZHA 2W4XA 2ZOXA 3L4WA 4ZO8A 3RLVA 3LB0A 3VD3A 4BA0A 6REQB 3E2VA 1VIZA 3TXZA 1KKRA 1L6GA 4LFYA 1TVNA 1J79A 2VZVA 1DQXA 3TONA 3S9YA 1F73A 3KZSA 3ZFHA 3R58A 1H7WA 4E2VA 1KTCA 5AHFA 2X1TA 1FDZA 1BAGA 1OT2A 4M82A 3NEVA 1K8YA 4YYFA 3I4EA 4LNCA 5DQPA 3QPZA 3CBWA 3PZGA 5LIYX 3RCYA 3VNKA 1CGXA 1HGWA 4UTWC 1C91A 3CT2A 3MCOA 5D9MA 1R85A 3CXOA 3R25A 4UR8A 3W1QA 1KWKA 5HOSA 2Y7FA 1KFLA 2G0WA 2R14A 4BI5A 4UTTC 2INEA 3XISA 2J7BA 4GZEA 1JCXA 4H8HA 3WQGA 3A5FA 2V5KA 1J01A 4X2PA 4KESA 3LBOA 4EXQA 1FWGC 1TSIA 4A8RA 3ZWTA 3OA3A 1RALA 2E0PA 3R0DA 4J3WA 3G0SA 5GNXA 1SO5A 2GUYA 1TV2A 5GJMA 4M80A 1GVIA 4AVOA 2R1PA 1UWUA 2CZFA 4P7NA 3WN6A 2Y24A 3C0SA 2D0HA 1S5VA 2BVDA 4GH3A 1K9EA 1PZ3A 1JGMA 3MS8A 1TA3A 3FCPA 3I6RA 2FZNA 1WOAA 2NQHA 1XYFA 2EO7A 3N2BA 4RLIA 2FTWA 1W32A 3KWXA 3WLKX 8CGTA 2PTDA 4YCPA 2Z2UA 4MB1A 5CBBA 4K1WA 1LBFA 3GYCA 4FIRA 1PDYA 2CZVA 5F2LA 4LRTA 3HB9A 3H55A 1KM6A 3ZOAA 4H3DA 1L6SA 1UPMB 4PMYA 1GG0A 1XIFA 3Q2DA 5D2WA 4AF0B 3E96A 3WEOA 4M81A 2PRHA 4A22A 2R9RA 5ABFB 3AO0A 3W85A 2IPFA 4GKLA 4M8UA 3USZA 4MOZA 3MWAA 4MIMA 3FXYA 4UTIA 2XM1A 1TJRA 2XGZA 3T9PA 2W79A 1A5OC 2QVHA 1E9IA 3ITCA 3W9ZA 2QUUA 5C2XA 3VOFA 2GOUA 4R27A 4ERIA 3WBYA 4E8GA 3MMUA 4D6FA 1LQAA 5JMUA 2WVUA 3QVQA 1MZHA 1FH8A 1NSJA 1XLDA 1KFJA 1LRQA 3GM8A 3TWAA 3R89A 3VZZA 2YXXA 4OU1A 1WE5A 4IQDA 3NURA 1S2VA 3CIXA 2ZUSA 4Y9OA 1IXPA 4JR5A 1WPCA 3NPVA 5HR6A 4MZ8A 5DY3A 4MB3A 2VR4A 3IAPA 4UNLA 1Q13A 3IGXA 1M5WA 3UG3A 4DJED 3TU9A 2E5BA 1TWIA 5HPOA 1XIBA 4ZCWA 2PGWA 3N15A 3RFAA 3UJ2A 3FAXA 1VQTA 2C16A 3L2LA 3E0LA 2AGTA 3PUEA 5KZEA 3LG3A 3VGGA 1VC4A 2PSNA 1KGUA 3UWQA 3A4WA 3UVIA 1J0IA 1NEYA 2Z1WA 2WMHA 1TMLA 2V2HA 2A7NA 2DW7A 4JY9A 2NLYA 3XINA 4HNCA 1RBOB 2O0TA 2FHCA 3TYZA 4ML4A 4U2YA 1TPEA 1NELA 4H6RA 1QWKA 1W6TA 4O1FA 1AQHA 1KFKA 3CQKA 3LYEA 4R7WA 3W7DA 2BVYA 4DAFA 3PZVA 3SECA 3V4BA 6REQA 5I5RA 1NVMA 1E6QM 1PZ2A 3IVUA 3EOOA 1BHGA 4FF7A 1REQB 4ZENA 4J3ZA 1WX0A 3QQWA 1XLHA 4OBTA 4GI4A 3KRZA 3L68A 1LWHA 5E9AA 4XAGA 3P74A 1FWCC 1PKYA 5CEWA 2PWVA 3VO0A 1VJZA 3GC5A 1E4LA 4CD7A 1QWGA 1WCGA 3N9KA 3R8GA 4W86A 3DUGA 1PCKA 4HHHA 2GQ3A 4Z1CA 2HE5A 4LUTA 4NZFA 3W23A 3OBEA 2QJMA 2HMCA 4C6BA 1GYLA 4UNKA 1OF6A 2I1OA 1J18A 1JZ8A 1DJXA 1GVEA 2VTFA 1W3KA 1KRBC 3LPPA 4US6A 3TC7A 1YNQA 2VFIA 1TPWA 3ABRA 4OVXA 1RCQA 2RDTA 3RUBL 1CGUA 4JX5A 2YB4A 1AQMA 3ATZA 3S83A 1UMLA 1GOXA 2HRWA 3ECQA 2EKGA 4KH2A 4MM1A 2BMBA 2DV0A 4IFKB 1FFQA 1M6JA 4W8BA 3G1VA 3WF1A 4H8VA 4KWSA 3UESA 1DTUA 2WCGA 1E1EA 3SN0A 1Z32X 2XN1A 3PJTA 2PA6A 4L4PA 2CLMA 3QV9A 1C9WA 3URQA 2A5HA 2BX7A 2BOEX 5CGQA 1XR2A 2YZRA 4Q8OA 3VZXA 2J25A 1V0LA 3TAOA 3G8RA 4OT7A 2XVNA 3DYPA 3GXFA 5DO8A 2ZYFA 4NHVA 1PV8A 4E8DA 1MXSA 5CC6A 2YBVA 4AF0A 7CGTA 2XH2A 3MDWA 5KTLA 1DV7A 6TIMA 4I3GA 4HBKA 2D2OA 3GZAA 4RV3A 2NV2A 2FZ8A 3EMZA 4QLLA 2B7PA 2Y5EA 1V0MA 3PAJA 3LPFA 4WLCA 4PA8A 1UA7A 1FWWA 2Z26A 3MT1A 2PDCA 3VYLA 4AD3A 1IT0A 1K70A 2Z25A 3OHMB 3RF9A 3TK7A 2VC6A 3ID7A 4IGSA 4ZR8A 3N3TA 2PE4A 2HDJA 1OIFA 1UCWA 4WY0B 2HEJA 4IPIA 4JGDA 1AODA 4KCWA 4GVFA 3ZJ8A 4MYAA 1S38A 4IM4A 5FACA 2VUNA 5HWJA 4B92A 3LD5A 2B0MA 3W83A 4MWAA 3EBVA 5AB3A 3ANYA 5A95A 4NU7A 4PUEA 3NXLA 4TTUA 3MJMA 4E3TA 4QGCA 5AC8A 3WBEA 1TJ2A 4AXKA 1WKFA 2GK1B 2QAPA 4IOTA 1UR1A 2VEIA 1DPMA 1V0NA 1XLAA 3WJXA 3EWWA 2ZRUA 3TMLA 3WMLA 2R6OA 3D47A 4MJZA 3E49A 1QOPA 1CX9A 2VYOA 3DZ1A 2NVDA 5CPLA 4AWSA 1DXEA 1KLYA 4K37A 1T40A 4HPJA 4OQVA 4EAYA 4S1FA 2HQAA 4H1ZA 4KS0A 3HGJA 1I2QA 1RQHA 1CYGA 4Q7BA 1F9CA 1YHTA 1FFRA 5HNRA 4LYKA 4C7GA 3UFYA 3U48A 1KBJA 3ARTA 3KFTA 3TVAA 4DWSC 1QW7A 3VUPA 2PRLA 2DUZA 2QCHA 4ZO9A 4JD4A 2YYTA 5HATA 4PRWA 5LYRA 2GZXA 3LXBA 3NNTA 1BXCA 3EX2A 2QUVA 5J5RA 1REQA 1FQ0A 1GYNA 3SN1A 5AYIA 2ZZ3A 2J27A 4FR6A 3GUWA 2PWUA 1I0DA 4TIMA 1OFBA 3G8EA 2FB3A 3H2FA 2R94A 3D6NA 3QTGA 4LYPA 5CKSA 3RU6A 3MDUA 3DGBA 3MMDA 2XIJA 4AHOA 4KBXA 1SJBA 2QDDA 5M2FX 4Z1YA 4CQDA 1Q4WA 3WFAA 1PYFA 3KHJA 5EBAA 4YL2A 3BC9A 1V3LA 1VRDA 2PDIA 4A2RA 2VFHA 3BH4A 1YBQB 2CLKA 4O18A 1K9TA 5TF0A 1C7SA 4E2DA 2D69A 2P50A 3CYJA 5HQMA 3C61A 5CXPA 4REQB 3ARSA 3L7RA 3ARYA 1POJA 2VRKA 3QXBA 4QJ1A 3W1NA 4E8CA 5LNUA 4NRSA 3MPGA 1QVBA 2PDYA 3O07A 4DF2A 2DSZA 5TIMA 1PHWA 4GC3A 1KC7A 3HPSA 5AHMA 2VD9A 1ME9A 4RDWA 4POCA 3C4UA 3N1AA 3ZLGA 3QHMA 3GNDA 3NZGA 3WIJA 1JYWA 3INPA 2ISFA 1B9BA 1DP0A 3A3HA 3KDNA 3UJFA 2WZHA 3OIXA 3W26A 3SIZA 1TG7A 1A0EA 3BAJA 1ZY9A 3NIYA 3WJSA 4N2YA 4I5RA 4KWOA 1Q6GA 4Z1BA 1EF2A 1UW9A 1NQKA 5MF5A 1ZNNA 3GNRA 4HA0A 2VX4A 1LOQA 4CLMA 2FH8A 2X2YA 1QAPA 1O60A 5C9RA 1PX8A 3W74A 1RR2A 4X61A 3RRXA 1TELA 4JFTA 5FESA 1GONA 5BYWA 2YCKX 2V3EA 3R13A 3SUWA 4PMVA 2XSXA 3GTFA 1BFNA 3KHDA 3IJ8A 4U10A 4KWVA 2BVTA 1FVPA 2WJEA 1OVDA 2NLIA 1N55A 1OABA 1FWNA 4WY0A 1OZQA 2R8WA 4MJ2A 4NXSA 4JTEA 2FMNA 3DG3A 3IIVA 4BQ2A 3F4WA 1XQKA 3JUGA 4M1BA 1CXEA 4JTJA 3CEPA 4E38A 3IJQA 2J8TA 3N11A 5CPMA 3OVGA 2X1UA 1EOMA 4CEXC 7XIMA 4X3ZA 4D1IA 4O1BA 3O8AA 3MC5A 1O1HA 1WZMA 3HA1A 3WQCA 1HIZA 3IK4A 1LBMA 1XD0A 1B3ZA 1SO6A 2GK1A 3WLPA 2B4GA 1J0HA 4PUKA 4LU0A 3QRHA 3OODA 2Y7EA 4XWUA 1OFDA 1HP5A 1TCMA 3AWNA 3LMYA 1XI3A 2YA1A 3OB8A 2OSWA 5LHEA 2V38A 1R2TA 3G1FA 3NZPA 1FDJA 4ES4A 4C6KA 8RUCA 2BGNE 4ATDA 3QH2A 3HG4A 5K7JA 1AMKA 4MG4A 1GEQA 3PANA 3VMOA 3M0LA 4GCXA 3U57A 3JZEA 3NGFA 2OSXA 3KLKA 1JXKA 5HQEA 3FV9A 1XRFA 1EC9A 4H9ZA 3B8WA 3TJLA 5JBFA 4EP8C 3MHUA 4V15A 1EO5A 2IPGA 1AK5A 1GHSA 3WNNA 2EPNA 1GJWA 3C2VA 3JU2A 1DJYA 1DTNA 5AFDA 2QCNA 2ZKMX 3VE9A 3KVJA 3PZMA 4M6QA 2VCCA 3ONCA 5AN7A 3VNJA 3FAWA 2IW0A 3VE7A 2Y70A 4Z2GA 2NUXA 3WQ8A 5A8QA 3MKCA 2DGAA 3R7MA 4RZBA 3A9BA 3WD1A 4M6UA 2ZIDA 4PB5A 3R1ZA 3CMJA 1V6WA 2QNEA 1CB2A 3NPWA 1YPFA 2RJGA 1ZBCA 2XDFA 4GY7A 3LHYA 1FCUA 3IVTA 2ZUWA 3LPOA 1F05A 2FPVA 2NWRA 1EEPA 1X39A 1Y5WA 3CU2A 2PTWA 1RA0A 3QW4B 1GYMA 3TQPA 1KCZA 1YBQA 5BOEA 3TV8A 1UWTA 1FWTA 1EL3A 4UR7A 3G1HA 1XF0A 3GSMA 4C6FA 4DF1A 2XG9A 5JQ9A 4XZNX 4UZSA 3W2LA 4XVEA 2JGQA 1E55A 4GX8A 3BV4A 2A6LA 4RE0A 1E71M 1S2WA 2ZVIA 1XFBA 3TA6A 4QP0A 1BWLA 1TWDA 3S4TA 2INFA 4CNTA 2PDNA 1UH2A 2Z24A 4KIEA 1UZDA 4LVGA 4S38A 1Y8BA 2Z1KA 4OE7A 1XLCA 4NZ5A 3P8IA 1XV8A 2GVEA 3B9EA 3BPWA 3A3XA 8TIMA 4HPGA 2RGLA 2W63A 3HPXA 5IFTA 3ZT7A 2GPTA 3BUVA 3E6EA 2A3EA 5T26A 2DSVA 4JTTA 3UR5A 2ZUUA 1ODUA 1P43A 4EANA 4QIUA 2WNZA 3CTLA 3UXLA 3HJEA 3CAVA 2WZMA 4MVAA 1PTGA 2HSAA 3MUAA 3TJIA 2VOMA 3AYRA 3GH7A 3MY9A 3LRKA 1IT7A 4ZB5A 1OY0A 3ZMRA 1EEXA 7TIMA 3NSXA 2QUNA 2Z6JA 4CNPA 1Z69A 3QPYA 3LNMA 2NQ5A 5C9XA 3VMPA 4PTDA 4WIWA 4GABA 4W85A 1NWUA 2G97A 3DFNA 3RLHA 4MB4A 3LI1A 1HFBA 1VP5A 2WCSA 2PU0A 1OG0A 4JX4A 4EPDC 2A3LA 2P53A 4NT0A 3P0WA 2QCDB 3QY6A 5CJ5A 1GGOA 2BXYA 4JQAA 3KP1A 1UR9A 2VNCA 3AIEA 4DUOA 2J9YA 4MY8A 1XYCA 1EX5A 3QC0A 4IFRA 2DZSA 4N6EA 3O2LA 3CB3A 5FA5A 2VWSA 1VYSX 2YXOA 1DKWA 6TAAA 4IMEA 4F8XA 1QPOA 4MZ1A 4D8ZA 1EJ7L 2YCIX 3FJLA 1HZYA 2PP0A 4FNSA 5FJOA 3NQEA 5J04A 7REQB 1JGIA 2XSAA 1LLOA 3WD3A 2VI0A 3BICA 3SW6A 4Y2WA 2QCCA 2QPUA 4OIFA 1D3CA 4UB9A 1Q85A 3WLSA 3VIKA 1QXLA 3THCA 3KVLA 3WK0A 5C2CA 4IXHA 5FJRA 3G1DA 1WKDA 1T5AA 3VX1A 3CV1A 4WK9A 2YX0A 4F0MA 2OQLA 3WH7A 3EKGA 1RXOB 3FVMA 2V5BA 1IZJA 3I10A 5C7VA 1XC6A 4CU7A 1H2JA 5FL0A 1YDOA 1H3GA 4XSMA 2BY2A 1K4HA 4UTWA 2OZ3A 2PDLA 1BQGA 4TX6A 2C8NA 4ATWA 2ZUNA 3P67A 5G2HA 2E8ZA 3IIPA 3O9NA 3SJ3A 1PS9A 4K8EA 5FJUA 3AXXA 3KX6A 3L21A 3M07A 4ONVA 5BU9A 3VCNA 2F8QA 4UTTA 1BTCA 4R88A 2Z2AA 4I9JA 3NPXA 2XN0A 3CEUA 2VFFA 1W9UA 1DHPA 1QHZA 1OK6A 4CNOA 4PH6A 4AZ6A 2WHLA 1F3WA 3WLMA 2VEPA 3UYCA 4GY0A 1ADDA 4CNSA 1PO9A 2W91A 1ONRA 4MKVA 4MTVA 1VPYA 3IIOA 4Y9PA 2X8RA 1JZ7A 2VGGA 2PI6A 1GVYA 3ZQ9A 3QKEA 5D8WA 3LZ3A 2G41A 3M5ZA 3VCRA 2CLFA 1FWEC 3SCPA 3OHIA 2J6XA 5EMLA 2DIEA 2AQOA 4F3HA 2E6DA 1XS2A 4BF7A 1Z6KA 1ISXA 1O4UA 1W17A 4M29A 2BXVA 4O16A 2VC9A 4XAZA 2OT1A 2WQDA 1Y65A 2CIPA 3MSGA 3ZR6A 3I68A 3CL8A 5JBEA 4IHCA 2CBUA 4CCDA 2AKZA 3AMDA 1Y5VA 3GIQA 2X30A 3V3WA 4NP7A 5GNYA 2VT0A 5AHIA 1CWYA 2AL1A 4ICMA 4B16A 3B9OA 2E09A 5LGXA 2VKZG 2PTZA 4JTLA 4ZO7A 1RSCA 1XSKA 3A13A 2VEGA 1XLLA 1UA3A 4I8DA 3BZJA 4AG0A 1YLVA 4WKFA 5GJPA 3MV01 1RD6A 3QFWA 1IT8A 4ZQNA 3E74A 5M17A 4P8XA 4ZFMA 4A3QA 3DHUA 3A21A 4JEJA 1V7YA 4JTQA 2P0IA 3LM7A 3N19B 7PTDA 1SW3A 1UZ1A 4XTDA 1B57A 2PDXA 3APYA 1ZBVA 4IMAA 1IR2A 4FAMA 1F8MA 3SFWA 5HNUA 3WJWA 3WK1A 1TPFA 3EDFA 4R5EA 4F2TA 3OZYA 5HJYA 2J7DA 1LZOA 1VBGA 2ESCA 3V16A 1UR3M 2VJXA 3KRBA 1TR9A 4K3ZA 5D30A 1R5YA 3P14A 3GW0A 4KGJA 5DF0A 8XIAA 3MCMA 3VGEA 2JQXA 5CLWA 4L5ZA 1TPH1 4UTUA 1NAL1 2QCDA 1BXBA 2HNHA 5FF0A 4EAMA 1HJWA 1RY0A 2ZUTA 4ZQRA 3AS0A 3UPWA 2WJFA 4MDPA 4RZ6A 1B3WA 4JCMA 3QC3A 4GQ0A 5G1MA 2WVTA 2PZ0A 4IIEA 4DBUA 3SUUA 3H2CA 4DUXA 4NY2A 1KV5A 3OP2A 4AD4A 4QDWA 1CBGA 1RPKA 2DT1A 3KRUA 5EPDA 1A4MA 2ZC1A 1CI1A 4J9JA 3L67A 4A21A 5PTDA 4NI3A 3D0CA 1JPDX 4DWSB 3L4XA 4AH7A 4TTGA 3P5ZA 3S5NA 1H5VA 3F2BA 3K13A 1ODZA 4O1AA 2CPUA 1V0KA 1V3MA 2QJGA 1FUYA 1E70M 3AMLA 1DHKA 4O17A 4P2VA 3WQVA 4D8AA 2DPEA 2E9MA 4XZBA 2HROA 2NX9A 2R24A 4W5UA 3UXAA 4BJHA 3U2EA 3QPEA 2O7QA 3NL2A 3MQTA 5L9FA 3BW3A 1SR0A 5H8PA 4YIWA 4DBEA 3RHGA 3GXMA 3LCWA 3NO3A 1GTEA 2GVLA 4DRSA 4LH8A 3VD9A 2ON3A 1F61A 5EFFA 2Z1XA 4HPNA 1P6CA 1B5TA 3KBSA 4DO6A 4KCVA 2CHOA 3S3GA 2ISVA 3ALFA 2JF6A 4G2DA 1IIGA 4Y6GA 1QNRA 4Y9AA 5EMJA 2PU1A 3WBAA 3S1XA 2XZ7A 3I3EA 4O1EA 1F07A 3R11A 3SEPA 3CUFA 4PSPA 3M47A 3M0JA 2F61A 3CB8A 4XTIA 5LIUX 5BXSA 4UFLA 2BY3A 4KT2A 1V02A 1QI5A 2VVSA 3VK5A 4PUNA 2YOCA 3TW6A 2HXUA 4LVBA 1ADSA 3O0KA 4L9XA 1WZAA 1TIMA 4Y96A 1L6WA 3PBYA 4BEQA 1QPKA 5I07A 4F4RA 2P8BA 3BVJA 3L4VA 4HU4A 1ZP3A 1KCKA 2E1DA 3CQ0A 1TTJA 1Q6RA 5FEWA 2GWNA 4KWWA 3L5MA 4HB7A 4JHMA 3CL7A 3L9CA 5H8UA 3ARZA 5HXMA 4XVDA 3C5QA 4FNUA 4B2DD 2BODX 1QBAA 1ENUA 3U7VA 1TTPA 2VDGA 2VM8A 4G1KA 1X6LA 2UY3A 3PFRA 4ZVJA 1QOQA 3ZLHA 4QTGA 4Z2JA 1UH4A 2BHUA 3FSTA 3ARWA 3CHDA 3T78A 4YMZA 1FWIC 4UXDA 3WH5A 4PL1A 1JAEA 2XIBA 3T0AA 5FAGA 5E93A 2V30A 3VX0A 2ATSA 1G4EA 2RGMA 4MFEA 3ANUA 1Q6LA 2BHZA 1FHLA 3IK2A 3GTXA 2WMJA 2FZDA 1T8QA 1U30A 2XUCA 1H7NA 4H83A 5G1TA 1J0KA 1M65A 4IX2A 5FJPA 3W7GA 3L4TA 1EPVA 3UGVA 4LXFA 1MQRA 1RLDA 5K4XA 1W5QA 4AFYA 1QI0A 4PUMA 4XBSA 5LZLA 3NVDA 4O1DA 4HCLA 5AHNA 1OGBA 4P7OA 1PUDA 2D3NA 3GXIA 4TV6A 5D04C 3STCA 4ZOBA 4LCSA 1ZL1A 4D8LA 3CQJA 1YMYA 1JQXA 4AZCA 1KM3A 1XG3A 3QM3A 4EOUA 4ZOAA 2ZDRA 3VC6A 1AD1A 2YW4A 5HNNA 4LAOA 1HX0A 1H5YA 3ZZ1A 4ROPA 1UP2A 1Q66A 2FTPA 3EWBX 4KEZA 3S2LA 1W3NA 3AXIA 1NFPA 1UYQA 4RKAA 3FY1A 3O6AA 2HVMA 1XC4A 1NTHA 4I7WA 3LBCA 4RW5A 1PZ1A 2OX4A 2CZ5A 2QF7A 5F2GA 1S2UA 4U5IA 3AJ7A 2WMFA 3ARVA 2QQ6A 2FTYA 3GC4A 3TZFA 3I6TA 2BNJA 4K8GA 3TUUA 1LL4A 4DWSA 2PEVA 5BCAA 2A3CA 3CHFA 1VFUA 3ERPA 5AYYA 1JPKA 4MNJA 2GDVA 3H4WA 2RHGA 4TQTA 3G1YA 4DJDA 1DQWA 3T1GA 4XD6A 1UPPA 3DC8A 2OGJA 4F0KA 4YXGA 3M0ZA 5CPTA 1IXOA 4DQWA 4S2BA 1JUEA 1W2PA 1W9DM 3CH0A 3DENA 1JFHA 3EDEA 2E5DA 1C3FA 4JNZA 5AZ0A 4KWUA 1FWFC 1EJSC 3P62A 4ZBCA 3ME3A 3CYVA 1TQXA 2OEKA 3CWHA 3LOTA 1LT8A 1KFWA 4E5TA 1UH3A 4AHQA 2QJJA 1E6PA 2DZVA 3KRSA 4CU6A 2QVNA 4EKJA 3T0DA 3BJFA 3K46A 3ZWSA 1NFGA 5K9DA 2A3HA 4QAWA 3VKBA 3VOHA 2I57A 1TRIA 1IEVA 3Q65A 2VDIA 3AWOA 3QZEA 5B7YA 3VD5A 2P3ZA 5FIPA 5J5DA 4XUYA 5A6JA 1K8CA 4NVTA 1LUCA 2GSEA 2ISSA 5DX7A 1ISZA 1QASA 1I75A 1CLVA 1JL8A 4FIQA 2QPXA 3C2RA 2F84A 4XUGA 2YDAA 3PB2A 4J3XA 1XLJA 2OKOA 1AFSA 1XYBA 1L2QA 1SZGA 3IEBA 3ORWA 4HYWA 3B0XA 1UG6A 2EQDA 3W2MA 1YDYA 3O3RA 3CZEA 3KS6A 4KCUA 4LGXA 2Y8UA 1NWRA 4CQ8A 5K3VA 5CSYA 1C93A 5JBDA 4AIEA 1XLBA 3LPGA 4NSBA 1W54A 1SJCA 1Z41A 1JI2A 2Y5SA 4HK5A 2WWCA 4V28A 3NOEA 2W27A 4DUWA 3V7PA 3W1PA 1A80A 4HNOA 2WNQA 4FNRA 4XKMA 5AOUA 1NQ6A 5GPRA 1VS1A 1AVAA 1A47A 1N8FA 3E5PA 3A6OA 3F7JA 3A3WA 4LANA 1T6MA 4PUJA 5D9NA 2Z1BA 1RCXB 5I79A 3EEZA 5TD4A 3ZLFA 2GJXB 3EPMA 1J4EA 1UZHA 3CWOX 3LCIA 2X40A 3HPFA 4UWMA 3HU7A 1GVRA 2ADAA 3U6WA 5I00A 1GK8A 3VKCA 2OQYA 4O0QA 5I3KA 1XH1A 5DBUA 5I3FA 4TV5A 3GE7A 3AIUA 3AYVA 3B04A 4PEEA 5KITA 4XIMA 1UIOA 1D8WA 1Q6DA 1BVNP 4IGNA 4FA3A 3WDHA 3K4AA 2WWDA 4KPLA 4W89A 5BZAA 5BMWA 1LCOA 1H61A 1M7JA 3NDYA 1UKOA 1FP9A 1YPIA 4LB4A 4S3DA 6A3HA 2V8ZA 4F0SA 4U2ZA 1UWAA 4QS6A 2QMJA 4GWEA 3W7EA 3BLIA 5IM51 3W24A 1S1PA 1IF2A 3OVPA 4R9OA 5HBFA 3CIVA 2FFIA 4G7EB 1I2NA 3R94A 1LF1A 1JCNA 3SUVA 1F3XA 1ME7A 3C6CA 3LUTA 1W9BM 1AW2A 4N9DA 1Z9AA 3BV7A 4MY1A 4O10A 4XAPA 4YPJA 3TJXA 4V27A 4C1NA 2YPIA 4ZODA 4W88A 4HMEA 3S1WA 2ZRZA 1P0KA 4BQ3A 1V5XA 2XINA 1W0MA 1AZ1A 1XW8A 3B9DA 4H04A 4J3SA 2GSHA 2H9AB 3NA8A 3NDZA 4GPNA 4H41A 2F2KA 3B0YA 1RA5A 4MGGA 2A4AA 3DFTA 2FZMA 1TWZA 4WX2A 3WO8A 1LG2A 2I56A 2FPTA 2I9EA 2WKLA 3LNPA 3V35A 1H51A 1OB0A 5D2TA 3TOPA 2YYUA 1RQBA 3E0VA 3UR8A 1HL9A 5CPOA 1LORA 4EF8A 4NXKA 1OFOA 1F74A 1YEYA 1YXCA 1MRQA 1ZFJA 9XIMA 4UMCA 2J79A 1QI3A 2NUYA 2VXNA 3MJYA 1SFLA 1X98A 3W6YA 4LT9A 2CU0A 1HO4A 4M19A 1JPMA 4NG3A 4ZSUA 3N18A 2EEXA 3IWPA 1L6FA 2Z1VA 1N2VA 2IKGA 2TAAA 3RJYA 1UB3A 2NZLA 4C6LA 4AVFA 1BKHA 2BZNA 4ZQPA 3W7OA 3FKKA 4PC8A 2QIIA 3T81A 1G01A 4LW7A 3VDCA 3JRKA 4MPKA 1JYVA 2AOSA 5D4YA 4D6JA 3UWZA 1E56A 2HVNA 1VFOA 3K4DA 2DZBA 3BAXA 3POHA 3ZVHB 4IPLA 4IQEA 2DU2A 3C8FA 4YVPA 2YGYA 5K9XA 5HJXA 1PTAA 3UERA 3GDRA 5D02A 2QZRA 3GH4A 4F0RA 1I9CB 4F40A 3EWZA 5ECVA 1FWRA 3MBFA 3B8SA 3MP4A 1VD6A 1MQQA 1ZZMA 3GG0A 1O68A 3CLMA 5IBXC 4NI8A 2PGRA 1V03A 2ZTKA 4W9TA 1VJIA 1LP6A 1HNYA 3CZKA 4K38A 2W6RA 4MLRA 2PWGA 2YKKA 1G4PA 3TROA 5TBOA 4JKLA 2FPYA 3FYPA 1FHUA 2PGEA 7TAAA 4F9DA 2QDGA 2GQ8A 1J0JA 4HYRA 4GKTA 4JTRA 1OYBA 4JYFA 9RUBA 1XSIA 4LAKA 1M7XA 3UPBA 1QOXA 1W1YA 1QCWA 3MW7A 1R30A 1YTEA 2ZE0A 3H53A 1RHCA 3QMTA 3APGA 4KEUA 1ESWA 3CJPA 5A6LA 2J7HA 1GOMA 4MB5A 4JFVA 2DT0A 5K9CA 2NWSA 1E1CB 4ZE4A 2H3DA 1W37A 2VZUA 2YA2A 3HF3A 5BNKA 2YLAA 3AUJA 4IH3A 1MI3A 1VGAA 3KCOA 5B7ZA 1A50A 1A0CA 4ZA0A 2GJXA 1K03A 1V3KA 3F4DA 2PC8A 3GVVA 3UG5A 3GNOA 5KEZA 1Q2RA 4I5XA 3TTEA 3BE7A 4RW3A 1EQCA 3SBFA 2GJLA 5DBTA 3GAYA 2CKSA 4FZIA 4LAUA 3IGHX 4AISA 3BMXA 4UTLA 5IOBA 3LEPA 3S2NA 5A2BA 3W1MA 2ANUA 4JYEA 2BY0A 3QFEA 4L6DA 3VGDA 3II1A 1JDCA 3QMRA 3WLNA 1MDRA 1XGEA 4N9BA 1ONXA 1K7XA 1TTIA 1FH7A 2X16A 4RJEA 2PBOA 2PLCA 2CLLA 5DMLA 4AYGA 2V5JA 2ASHA 1O6IA 5FD0A 4W8AA 1JYNA 1CENA 4GINA 3IGUA 2ZA3A 3OGVA 5D37A 2XJ7A 2J24A 2GUBA 5TQLA 3DN5A 2VFEA 3BLPX 1M68A 1R46A 3VUSA 5LNSA 5AC6A 1QNVA 3W1LA 3BAIA 3P5YA 1R7AA 3N9RA 5CPQA 1C8XA 1NY1A 1XIDA 2C91A 3WCZA 1E72M 1QPNA 3PBGA 4GK8A 4HZ6A 3VOGA 3CNYA 3AHZA 3PBVA 3QSRA 4LYQA 1UBSA 4YTSA 3M0HA 1EP2A 2BWGA 3SO7A 1GVQA 3VIIA 3AS1A 3GNNA 4AWEA 4WGXA 1QUMA 2J6VA 2A7PA 2G96A 3WL1A 1TQJA 2FQIA 4WSJA 5A5WA 1PX4A 2HWGA 4CD8A 1JDDA 3AMGA 4LS0A 3AZRA 1CIUA 1MWOA 3FS2A 4IL2A 2GDQA 4PBFA 2FJKA 3A5VA 4FLOA 5A6BA 3UETA 2PB1A 3P8JA 3TH6A 4IICA 3WUEA 5CAKA 2F6XA 1KM5A 1QW9A 3AS3A 1S3HA 1JR1A 3BMVA 1VJSA 3K5XA 2E25A 2WVSA 3IANA 2OQHA 3RPDA 1JFXA 1EGMA 1LROA 3W7CA 1P7TA 3WH6A 4XD5A 1J9YA 2RKXA 4PCSA 1EF3A 4GI6A 4NKCA 4D2JA 3TYBA 5FKYA 3VVGA 2FIQA 4HMCA 3BDKA 3S9ZA 1GUVA 3FNDA 3ZVHA 1G7UA 1CGVA 3DFYA 4HQVA 2VRQA 3M41A 3FGCB 5LA2A 1I8JA 4RE3A 4I9AA 1X96A 1NP2A 1A5SA 5E0FA 4QQ3A 1G4SA 4C65A 3WNMA 2V63A 4J7RA 5CBJA 2OMAA 4WOZA 2JEQA 2QGHA 1TJ1A 1V3IA 1KM1A 2XVGA 3MSDA 2ZXDA 1CXHA 3NQ2A 2J9XA 3VMNA 1E6RA 4C91A 1UZ4A 5JIWA 4ENLA 3HFYA 2CFFA 3KE0A 2NV9A 1Q6CA 4RX0A 3WQFA 3UY7A 4XISA 4MF4A 4YYCA 5EB8A 3UWUA 3PPHA 3FA5A 3AISA 3CUXA 2QLYA 3CPUA 1E6SM 1DIEA 4NZ1A 2WJDA 1VENA 1E1CA 4Z0JA 3AIBA 1UKQA 3ZT5A 4IF2A 1JDFA 5KETA 5HMEA 3WF2A 1UIPA 4K8HA 4NJKA 1GPWA 1H1YA 4AD2A 3PY2A 3U2CA 3QQ0A 3NGJA 1XDJA 3UZ5A 5HINA 3S47A 2XPKA 4GC4A 5LNRA 2PDUA 1CXIA 4GRSA 3W1XA 1X1OA 3EOLA 2A3AA 3N04A 5A2CA 3RRAA 1ZENA 3LZ5A 2EXOA 2IS7A 1PAMA 1EYWA 3PSVA 2HK1A 3W25A 3Q45A 1M7OA 2YCLA 3WF4A 4JOMA 2JKAA 2Q6ZA 2I7GA 1SW0A 1EPXA 2NT1A 1EZWA 4LBRA 4IPNB 1OJXA 1TCDA 3E12A 4GXMA 1E3ZA 2HVOA 4NRRA 3BJTA 1LQ0A 3BCJA 3PJWA 4XD3A 3GXNA 4H9YA 3KAOA 2Z29A 1YTKA 3NYDA 3KWSA 3L4UA 1KCXA 2PDBA 2CBJA 1E0XA 5ABTA 1DJWA 3G18A 1WDQA 4LY4A 3ABQA 4LUJA 3P84A 2PUZA 3TMQA 3BGJA 1E9YB 3HIJA 2O7SA 3MUZ1 1J5SA 1TYGA 2JGYA 1QBBA 3DOPA 3KZPA 4C6OA 4AMAA 3KP0A 2VWTA 1E3XA 3MANA 4Z1AA 4GVGA 1TVPA 2HK0A 4MPQA 2DORA 4FOKA 5EMKA 1UHVA 4MNLA 2QUMA 3TLQA 3GXTA 3F5KA 1UR4A 2WHKA 3WJZA 1IIHA 1B3OA 3VOIA 3G1AA 2NXIA 4PMDA 5E0CA 3T6CA 3GQYA 4GH1A 3N6JA 3AI0A 3M46A 1KXTA 3SR7A 3CQIA 3JS3A 1ZS2A 3CQHA 2TODA 2W62A 4YTTA 1U1JA 3RM4A 4FXSA 4B5NA 4IGMA 5HNTA 3NSMA 5IHSA 5U4NA 4JTCA 5D8ZA 4XK2A 2VZOA 1RP8A 3REQB 2J75A 1ZUAX 2Y61A 3ITVA 3EB3A 4AU0A 4ZL1A 1JJKA 3LHVA 4HTBA 3ATYA 2GFTA 3NCOA 2VRJA 2BXZA 4FNPA 3PS7A 2PLMA 3TTQA 4JQ1A 4O15A 2PP3A 2WSQA 3B8DA 4IMCA 2YBTA 4H00A 1UC4A 2ZA1A 3WD0A 3TEVA 2R1KA 4GISA 2QV4A 1DEDA 1JAKA 2FHFA 2OZTA 1FTXA 3W37A 3FEMA 1NWTA 4JTIA 1C90A 4LPCA 4QJ4B 1T7LA 4GUIA 1LLZA 4EPBC 4DXXA 4G56A 4HNLA 2PRMA 4IP4A 3MWCA 2REQA 1GKRA 1BPLB 3N13A 3FGCA 3GK0A 4IISA 5BRQA 2DW6A 2J8GA 3RN6A 3QHNA 3NQ7A 1MZRA 4WHBA 2IQTA 3E2QA 2X05A 2E6FA 4UTKA 2NVAA 1VF8A 3WQEA 5CG7A 3RCNA 2NQLA 3TE9A 3PF3A 1ZGDA 2V5DA 3MZNA 3DHPA 3D5HA 3DFSA 3LCHA 1UMYA 3OYXA 4MLJA 3THQA 3BLOA 4JZ5A 1Z89A 3KVMA 3TJ4A 3RGTA 3VM7A 3UNTA 1AW1A 1S2AA 1UP3A 1KM0A 2RH9A 4LS1A 2PWEA 4RPQA 3NL5A 4G5DA 1SO3A 1PHQA 5KZ6A 3RJXA 2X7VA 4H19A 4N42A 1TWSA 4PUWA 6XIAA 4TVUA 4UTMA 3C2OA 4O13A 2PDGA 2D0FA 3PZQA 2XH4A 2EPHA 2DZWA 5DT7A 1JZ5A 7ENLA 4QDPA 2WBKA 2Y6ZA 3TAKA 1OF8A 2Z27A 1Q3NA 2OJPA 3WUFA 1UP0A 3GKAA 4GHRA 1ZJHA 2C18A 3S42A 5K4ZA 4A2SA 5F1UA 3STFA 1F8IA 3CUZA 1S3TC 4S23A 2XH0A 4QE1A 3S6TA 2H8ZA 3KL3A 4LBUA 3EAUA 4ORMA 2X0HA 4B90A 1S2TA 3WUGA 1M03A 4DVOA 4FSAA 5DXYA 3KOWA 2HS8A 3QV7A 2G3FA 4UQAA 3U4AA 1XCFA 5F1VA 2QF8A 4K6AA 3UZXA 3PWGA 2TRSA 1VFHA 3GFXA 4V2XA 4WXYA 4PMUA 3N73A 3WSUA 4FLSA 2DZXA 1O5QA 4JQ3A 5DRCA 2X1RA 4AHPA 4O54A 1RBLA 3PPFA 4HA4A 3SCRA 5I3GA 2OU4A 1NARA 4FXJA 4TVCA 3ZJ7A 4TX9A 3QR0A 3KOXA 5DANA 4D6CA 3DGRA 1UD2A 1VCFA 5DT5A 4ACZB 1FX6A 4ZOEA 2PDWA 2OEMA 1XHGA 2CW6A 3A47A 3N3MA 5ENLA 3TA9A 2PTXA 2BG5A 3ICJA 1WXYA 3WMCA 3P81A 5AVNA 3KTCA 4ZQMA 3M43A 2B7OA 4AIOA 3J7HA 4LC8A 1HJUA 2EHHA 3TN6A 2WVVB 2PC4A 5EBUA 2O56A 1ZAIA 4HHPA 4HT3A 3PJUA 5D2VA 3REQA 3N2MA 4LAMA 4K68A 4LQ1A 2YZ5A 1QK0A 1P1MA 3RNDA 1VLIA 5H2ZA 4X0NA 1Z48A 4BQ4A 3EA1A 2IPWA 4B5UA 5CSUA 2GGEA 3AU6A 1EO7A 3ONBA 5D05A 3EX6A 5J8LA 2WBGA 3S6DA 2PGFA 5FEXA 4IFOA 4AVNA 3H4GA 4B4FA 3CL6A 1MFUA 4GI8A 5I78A 4C6JA 2VQTA 5LA1A 1B0IA 5FAJA 1MUCA 3PPGA 3AXHA 2F6UA 5I09A 2QCFA 2DQWA 3PFMA 3SGZA 3MV11 3W1TA 1VB9A 3WD4A 4GIEA 4OBSA 3PUOA 3ZYZA 1DE5A 4J2PA 1TV8A 3ABXA 3L5AA 3WEZA 3IJ7A 1GVFA 1THFD 1UR2A 3U3HA 3U9IA 1BGAA 2ZX6A 3C2YA 5CJNA 1SZNA 1YADA 1EH9A 4W7VA 9CGTA 2VFGA 1EHAA 1XPGA 2E28A 1UR8A 2CLEA 3G2GA 3C3UA 4QE4A 2OELA 2NX3A 2BBFA 1XDMA 4YU1A 3DC0A 1JCYA 4CQ9A 2GJRA 4WZHA 1V6VA 1Q63A 2TPSA 1ZPTA 3WBWA 5I24A 2AGKA 3S5SA 1A3HA 4XSLA 1A3XA 1BYAA 4GNKB 1J2BA 3DU0A 4QCEA 1D3GA 2ALDA 4D6HA 4C6NA 3M0XA 4Y9NA 5CC3A 1UWQA 3G3MA 1BSLA 1OWQA 4E4FA 3MMWA 3ZXWA 3K30A 8XIMA 1K7EA 2YR1A 4WXZA 3SRDA 4GQBA 3S1UA 1L9WA 1K6AA 1X8FA 5M1TA 4JTAA 4B2DA 4EWND 1UUOA 4PMZA 1WDSA 3E02A 1XLKA 2J7EA 3OG3A 4JNMA 4WKHA 4UMAA 4UCGA 3BTNA 4IJCA 4UQBA 2GWGA 4DM2A 3KM8A 2Q09A 2ZRYA 3FW6A 2BY1A 5L6UA 4WOQA 4HD5A 2VEKA 2J4GA 1E4IA 1WNOA 1XKYA 4DBWA 2R82A 4R33A 4J2MA 1CPUA 1R86A 3IIXA 4FXFA 4LALA 3WK2A 4DYJA 4IMDA 5I23A 1MXGA 5D33A 3SY1A 4CN4A 4EXBA 5CAHA 1EJTC 3UR7A 5HA7A 1QPRA 3UG4A 1KXQA 1I60A 2QCLA 1X38A 4GUGA 4C5YA 3EYPA 3HPZA 3M1ZA 4IG2A 3SSJA 4MYXA 1J96A 2V3DA 1QHOA 3VOJA 2DSWA 1IYXA 1LJYA 1MEWA 2CXGA 5C2GA 2F38A 1HQTA 4DZHA 3HJZA 4KRTA 2WKJA 4DIAA 5EY5A 1QNSA 2CBVA 4NX0A 3NFUA 2GDUA 2GQ9A 2GGIA 3HZ3A 2HE8A 5F2IA 1F4HA 4M3PA 3T05A 4DEFA 2AMGA 4QLKA 2XVKA 1VBJA 3PNUA 1WB0A 4GGBA 4JDBA 3STGA 2VHLA 3SGUA 4FLQA 1OCNA 1TPDA 4PE8A 4XG1A 1RP9A 1EXPA 1S2CA 1R9XA 3LRLA 1QNPA 1ZQ5A 3T55A 1CXLA 2WVVA 2D2GA 4PCPA 3NVTA 1T96A 2CESA 3GYEA 3W82A 1U2YA 2IPJA 2XIMA 3NO1A 3BQ5A 2OKTA 1BEUA 4DWSD 1W2VA 1FCVA 3N4EA 2PWDA 1F6PA 3HV8A 2NXGA 4MUZA 1XUUA 3GG7A 4W93A 3PTKA 3CO8A 3BW4A 3NEHA 4E6MA 4PCFA 5REQB 4DJDD 1IEQA 3T07A 4Z42C 3AS2A 4ILSA 4A8LA 1LOSA 3ABSA 2BLEA 5CGTA 1VPXA 2AAMA 4PRRA 1HO1A 1ZLPA 1JCJA 2ZCGA 3NQCA 1A5LC 4IWWA 3HMJG 4GFIA 1KV8A 2HS6A 3MVTA 2Q71A 4E2OA 4RDVA 2G3MA 4TOQA 3COTA 3GH5A 1KO0A 3PWIA 5CG0A 4ECLA 5IBXA 2ZWZA 4Q22A 4JTSA 3QKZA 1AG1O 2G95A 3GDKA 1JNDA 2PDJA