1WQ7A

Crystal structure of biotin-(acetyl-coa-carboxylase) ligase from pyrococcus horikoshii ot3
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
235
structure length
229
Chain Sequence
MLGLKTSIIGRRVIYFQEITSTNEFAKTSYLEEGTVIVADKQTMGHGESPEGGLWLSIVLSPKVPQKDLPKIVFLGAVGVVETLKEFSIDGRIKWPNDVLVNYKKIAGVLVEGKGDKIVLGIGLNVNNKVPNGATSMKLELGSEVPLLSVFRSLITNLDRLYLNFLKNPMDILNLVRDNMILGVRVKILGDGSFEGIAEDIDDFGRLIIRLDSGEVKKVIYGDVSLRFL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords biotin--[acetyl-CoA-carboxylase] ligase
publication title Crystal Structures of Biotin Protein Ligase from Pyrococcus horikoshii OT3 and its Complexes: Structural Basis of Biotin Activation
pubmed doi rcsb
source organism Pyrococcus horikoshii
molecule tags Ligase
total genus 76
structure length 229
sequence length 235
chains with identical sequence B
ec nomenclature ec 6.3.4.15: Biotin--[biotin carboxyl-carrier protein] ligase.
pdb deposition date 2004-09-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02237 BPL_C Biotin protein ligase C terminal domain
A PF03099 BPL_LplA_LipB Biotin/lipoate A/B protein ligase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 1wq7A02
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 1wq7A01
1KMMA 2ALYA 3TEHA 4C92A 2DXUA 5GAN5 1B76A 2ZNJA 4M78D 3I7FA 1M8VA 2RM4A 3HFVA 5LJ3j 1J5WA 3BJUA 2VC8A 4PNOA 1NYRA 4C8QG 4C92C 5LJ5j 2QHTA 3G1ZA 5GAOp 4EMHA 1HTTA 5GAMh 1EIYB 4LNSA 4C92E 4P3OA 2DU5A 2C7IA 4PJOD 3TUPA 5GANh 2YLBA 1JJCA 1I5LA 4M77G 3UH0A 1W66A 4TWAA 4YRJA 4AH6A 4TVAA 1X54A 4M7DD 1B8AA 4CS4A 4J15A 2ZXFA 4E51A 5LJ3g 3SB2A 5K1XA 5KNNA 2DTOA 3HFZA 4UPAA 2ZGWA 2DVEA 1QE0A 5LJ5g 3PZCA 1U1SA 2AMCB 1C0AA 3QUIA 4M7AE 4M7AF 3UGTA 3HXVA 3P8YA 4G84A 1Z7NA 4WJ3M 4XTVA 5K1PA 4C8QB 4YRGA 1WQWA 4P74A 1EVKA 4WF2A 3BFMA 4XU3A 1D3BA 2VXFA 1E22A 3HFOA 2IY5A 3BDUA 4RCCA 4P73A 1ASZA 4M75A 4DQ2A 2QTXA 4YRLA 4M77B 1Y96B 4P74C 2RHQA 3L4GB 4K88A 1E24A 4UP9A 3NENA 2Q7HA 4YRCA 4WJ4A 3A5ZA 4P73C 2ZT7A 4M75C 4HT8A 3JCMX 5LJ5h 1H4TA 2DZ9A 3MF1A 3RGLA 4YRKA 4M78A 1I8FA 3RKWA 3VQYA 1B70B 4F7UB 1WQ7A 5GAN6 4EO4A 2RHSA 3M4PA 4YRSA 3RACA 3AHUA 1G5HA 5GAMj 4M78C 1L0WA 2YHTA 4PJOA 3SWNB 1SERA 1X56A 5GANj 4M78E 4M7AD 5ELNA 3V7RA 1H4SA 11ASA 4XU0A 4P75C 1I4K1 4XEMA 4ZTZB 3JB9I 4PJOC 2Q5IA 4L87A 3JB9G 2CJBA 4PJOE 4F7UF 1X2HA 5LJ3f 5GAN2 4M7DA 3VU3C 1GGMA 4C92G 2AKWA 3E9HA 5LJ5f 3V8LA 3HXWA 4BWAA 4KR3A 3VQWA 1G51A 2C8MA 4XTZA 2E41A 4YRQA 5GAOn 1WPYA 3GIBA 1HK9A 1BBUA 4M7DC 1SRYA 4H2XB 4XTWA 1B34B 5GAMg 2ZZGA 5F5WA 4P72A 2CJ9A 4M7DE 5GMKe 3EFRA 1YB3A 3MF2A 1VQZA 2EJ9A 4NOYA 2DTIA 5GAOl 4PHCA 2HNIA 1USYA 4BW9A 2ZINA 4P72C 1LYLA 4OLFA 1LNXA 4KQEA 1LJOA 4HT9A 3A7RA 3MEYA 5GAN3 4P3PA 4HVCA 2QHUA 1USYC 2EWNA 1I81A 1KQ1A 3QO7A 2ALYB 3PCOA 4HWSA 3TEHB 1X01A 4C92B 1TH7A 4YPFA 2ARTA 4JUVA 3JCMd 4YROA 5ELOA 1ASYA 3JCMV 3JCMe 1RIQA 3HRIA 2QHSA 4MMKA 5LJ3d 1KQ2A 2ZIMA 1EIYA 3HY0A 4CH5A 2YLCA 3FIFA 4HWOA 2E3CA 5LJ3e 3NEMA 4M7AA 3HXXA 3V7SA 4XTUA 4XTXA 4M75G 4WI1A 1JJCB 3RESA 2E65A 1BIBA 4M7AC 2ZZFA 2ARUA 1EOVA 3HRKA 3W3SA 1U1TA 1Z7MA 3QNEA 4TVAB 4P3NA 5C53B 4OP0A 1NJ6A 3M4QA 3RKXA 4M78G 1PYSA 3CMQA 5GAMf 5I21A 3HFZB 5C51B 3REXA 5GANf 3A5YA 1WYDA 4HWPA 1IL2A 2DDZA 2ODRD 4XTYA 1ADJA 4J5YA 4YREA 4J6WA 5GAN4 4PJOG 4MMLA 4X9DA 3ERRA 1HC7A 4CH4A 1D3BB 3NETA 4YCUA 2IY5B 4EMGA 3RKYA 3PGGA 4HA8A 4M75B 4C8QF 4C8QE 4EX5A 1JRIA 4RQEA 2RB6A 2E10A 2RHQB 3IKMB 4YCVA 1X2GA 4H2VA 3JCMh 3VBBA 4PG3A 4M7DG 1HXDA 1ADYA 3JCMJ 4P75A 4M77F 3ICAA 3V8JA 2CIMA 4F7UA 1KMNA 4YYEA 5GAN8 1N9RA 2DJZA 5GAOr 2DXTA 4TTVA 1NJ1A 4A53A 4EMKA 1B7YA 4TVWA 4RCBA 2ZT5A 2K57A 3P8VA 3JB9H 2DU7A 3QTCA 4PJOB 1NYQA 3P8TA 4CH6A 2ZT8A 4F7UE 5GAMd 3LSQA 4CH3A 5GANd 5GAOm 4EMKC 5GAMe 3OD1A 3DSQA 1ATIA 2J3LA 5GANe 2EL9A 2I4OA 2Q5HA 1E1OA 4JRKA 1H4QA 5GAOq 4O2DA 4C8QD 4M7DB 1NNHA 4XQ3A 3VQVA 2E64A 12ASA 2AKWB 2ZNIA 1QF6A 5GMKj 1N9WA 3HXZA 3BY7A 4YRTA 2E5AA 4YRIA 2EJGA 4NCXA 4M77D 3QHSA 3VQXA 4N0AA 3TEGA 3L2ZA 2DTHA 4XU2A 4H2TA 2Y90A 3JB9J 2VXEA 4UP8A 4K86A 4Q6GA 4YRMA 4YRPA 3R07A 4M7AG 2CJAA 5GMKl 4CS2A 1E1TA 2ODRC 2DZCA 4N0AC 4RDXA 3LC0A 3E9IA 4QVCA 5CAIA 4P71C 2ZCEA 5DY9A 2E1HA 2ZTGA 4YCWA 3RF1A 2EJFA 3QO8A 1MGQA 4NL3A 3RERA 3A7UA 1H4VB 3INZA 1YFTA 2ZT6A 4Q15A 4QVDA 5GMKi 1X55A 1LOJA 3A74A 2QHVA 2PMEA 3PCOB 3JCMQ 5LJ5d 3JB9F 5GAN7 4RQFA 4KR2A 5LJ5e 3UGQA 3FJPA 4JRIA 3V7CA 2PMFA 3IKLA 4H2UA 2DQ3A 4C92F 3WQZA 4CS3A 2P5IA 2ZZEA 4XU1A 3QSUA 3QO3A 4V2SA 1YFSA 4UP7A 4A54A 4M7AB 1EVLA 3A31A 5GMKh 3HSBA 3V8KA 2ZR3A 3JCMg 2AMCA 2G4CA 1SESA 2FYKA 3QO5A 1JBMA 1YFRA 3UFGA 4J6XA 4C8QA 4H2SA 5E3IA 3JCMb 3EFSA 1BBWA 4F7UG 4HWTA 1PYSB 1NJ8A 3HTZA 4C8QC 3BW1A 2I4LA 3A7AA 4TQDA 4M77A 1Y96A 3L4GA 4YRRA 4Y91A 4XEOA 3RL6A 2Q7EA 3JCMc 3JB9D 4ZIBA 1WLEA 2ZR2A 3JCMP 3REUA 1SETA 4M77C 4C92D 3HY1A 1BIAA 4M77E 3RIRA 1M5Q1 1B70A 2ARSA 5LJ3h 2FB7A 4YP0A 4M78B 1EQRA 1WU7A 1EFWA 3KFUA 4DPGA 3HXYA 2EAYA 1YCYA 4M75F 4M75E 2P0LA 3SWNA 1NJ2A 2RHSB 2ZIOA 3FB9A 3L1AA 2J3MA 3SWNC 2CGHA 3M4GA 4EMKB 1B7YB 4M78F 1FYFA 4YRFA 4H2WA 4TVYA 3A32A 4K87A 4G85A 3JCMf 5GMKm 2RD1A 1NJ5A 4PJOF 4HWRA 4H2XA 1B34A 2XTIA 5HGQA 2RA2A 3IG2A 3JCMW 4X5OA 4ZTUB 3NELA 4H02A 1YGBA 4JLIA 2XGTA 4H2YA 2Q7GA 4P71A 4X9CA 2DQ0A 3IALA 2DKGA 5C52B 3HXUA 3RUXA 4M75D 1KOGA 4M7DF 1H641 5GANg 3HFNA 4YDQA 4YRNA 4NL2A 4J6YA 3LSSA 2I4NA 1WNLA 2I2LA 2JN0A 1G5IA 4RMFA 1N9SA 2DEQA 4TQFA 2I4MA
chains in the Genus database with same CATH superfamily
1KMMA 3TEHA 2J05A 3G1JA 2ROTA 2K3YA 2CSIA 2ZNJA 2BE7D 4M78D 3I7FA 8ATCB 1RAIB 2VC8A 2RQTA 2E12A 2JM8A 4QW2A 4PKCC 4C8QG 4C92C 5LJ5j 3PFSA 1HTTA 2DU5A 1PKSA 3TUPA 1M1KR 3EGXB 4C0DB 1NPPA 1Q82C 4J83A 2O9SA 1WGSA 2IVWA 3CCUT 1IB8A 4M77G 3UH0A 2EYWA 2KT8A 2L8DA 3PNWC 1WA7A 2F1LA 1ZBJA 1B8AA 4CS4A 2DFUA 2KI7A 5K1XA 3WVDB 3QKJA 2ZGWA 4ORZA 5CKBA 1VQLT 1U1SA 2AMCB 3EG1A 1MV0B 4M7AF 4M7AE 4PL6A 3LWHA 4Y92A 3HXVA 4G84A 1JO8A 2ESWA 5KE2A 3HL8A 2LT4A 3CPWA 1EVKA 2GCXA 2JMCA 5KYWB 1VQ7Q 1E22A 4BI8B 2X3XD 1AWXA 4JS5A 2LRQA 1YJNQ 2HQXA 3CPFA 3C12A 4CC4B 4P74C 5J3BA 4UP9A 3L4GB 3E19A 3S3MA 5FU7B 1E24A 2PVOB 4RTUA 4P73C 3QZ9B 4M75C 4ZN3A 4LDYA 3OW2P 5LJ5h 1H4TA 2MI6A 3SEMA 5CQYA 3RGLA 4M78A 3NTIA 2HEQA 2O4XB 3G71Q 3HTRA 4ESRA 1B70B 3E9FA 3PT9A 3A8OB 2AZSA 2CT4A 1W2BP 2LJ3A 2Y4YA 1FMVA 2FHDA 1UGVA 4AFSC 3CCQA 2CZ1B 4QQ6A 3OW2A 4XAXB 5ELNA 11ASA 1AT1B 1QW1A 4PJOC 1NPRA 3A1PA 3CCSQ 4F7UF 3VU3C 4C92G 2JM9A 1O9SA 1KSWA 2KBTA 4LUDA 3GIBA 5F5WA 3QDFA 1SRYA 4H2XB 2ZZGA 2H3EB 1QP2A 1FMKA 2QQRA 1PC0A 5C0MA 5FWBA 2VGMA 4M7DE 2CJ9A 1TSFA 2QTVA 3RDVA 4ZTFA 5CK9A 2FZCB 1QCNA 2RNAA 2DRMA 4VUBA 1E6GA 2G3RA 4PHCA 2HNIA 2LVMA 3M54A 4BW9A 3C94A 2JMAA 4P72C 1HSQA 2D8JA 5IHKA 4HT9A 1S72A 3X24B 5GAN3 4HVCA 1K0SA 4J9GA 2FVUA 1USYC 1VQNA 5KYUA 5IAYA 2WSFE 1D0YA 3QO7A 3I35A 2ALYB 3LW5E 3PCOA 1AWWA 1X01A 3LWIA 5IXBA 4YPFA 3JCMd 2KY9A 1RIQA 1VIFA 3G7ZA 2PVDB 1KQ2A 2ZIMA 3HY0A 4CH5A 2E5KA 2ATCB 2NUTB 2NS6A 4HWOA 1EFNA 2FRYA 4PLIA 4BDYA 3NEMA 3HRTA 1FXXA 1WHJA 3HXXA 4E7ZA 5L23A 4M75G 2HMAA 1JJCB 2L89A 5A0DA 1M27C 2X4XA 4C0DC 1Y71A 5HY6A 2E65A 2JT4A 1U1TA 2EYYA 1YNZA 4M4ZA 4OGCA 1PYSA 5ECAA 1OQKA 1GCPA 2OTJA 5GAMf 3REXA 1TS9A 2C0IA 4ZN1A 1YJWT 2XIDA 4F04B 4YREA 4PJOG 4MMLA 2CDTA 2PQWA 1JEGA 2DBMA 3R6OA 2OAUA 3ERRA 2VWFA 1HC7A 4CH4A 4FSXA 4KRTA 4EMGA 3PGGA 4EX5A 4J9BA 2RB6A 2RHQB 4AG2C 4Z88A 1X2GA 1T3LA 3A5ZB 3MP1A 1BI1A 4E6RA 2YUQA 1VIEA 1QMCA 1MMNA 2G6FX 5FU7C 3JCMJ 4CRIA 5M9OA 2PU9B 4YYEA 1N9RA 3EG9A 1UGSB 2DXTA 1D1BA 1JJ2A 4TTVA 1D0ZA 1G8XA 3M58A 4EMKA 1B7YA 4TVWA 1PRLC 1G3SA 3TCJA 1UHFA 3QTCA 2OAWA 3P8TA 2DLPA 5I2MA 2ZT8A 1OI1A 2VASA 1UJYA 3CCQT 5GAMe 3OD1A 3DSQA 1I0CA 3H8ZA 4HCZA 5FRNA 1ATIA 2I4OA 1H4QA 1BBZA 3EG0A 4C8QD 1VQPA 1NNHA 4XQ3A 1RL2A 2ZNIA 4RTZA 3BY7A 2ENMA 2E5AA 1KJWA 1WXTA 2X4JA 4D8DA 2DL3A 4M77D 1T0HA 2YDLA 4XU2A 2D0NA 4O5VA 2KRMA 2Y90A 1KC8R 4K86A 2FPDA 4YRMA 1P92A 4R55A 1UE9A 2BTTA 2C0TA 1Y07A 3R07A 4LVKA 2EFIA 2R5MA 1WJRA 2JNGA 4QQGA 2XU8A 4QVCA 3GOXA 4BI4A 3RF1A 5IH2A 3QO8A 1H4VB 1NJIU 1YFTA 1S72T 2D6FA 1VQ5A 1K0XA 4FM4B 1VQNT 1R0BG 2RK1A 5GAN7 1J3TA 2EGCA 2HSEB 2LT1A 4HVWA 1KG1A 4JRIA 3THKA 4KGXB 3CCVQ 3IKLA 4H2UA 2DQ3A 4CS3A 3VRZA 1WIEA 3CCLA 2ZZEA 3QSUA 4V2SA 1YFSA 2FO0A 5FRMA 2LCCA 4M7AB 3VUBA 1NJIC 3DB4A 1YIJA 4RKUE 1QKWA 1LPLA 1MMDA 3CCMA 1G2BA 1MNEA 2G4CA 2FYKA 1JBMA 4B9WA 1YFRA 4C8QA 2DL4A 2V8KA 2CP7A 2CP2A 2XDBA 4H2SA 3JCMb 1RLQC 4FIBA 4DOWA 1SKUB 2CUBA 4HVVA 1VQMQ 4HCKA 3BW1A 2I4LA 4M77A 2F5TX 1GL5A 3CPWS 2OTJT 4Y91A 4LD9K 1BKBA 3RL6A 3VKIA 4D6WA 1R0CB 1WLEA 3JCMP 1UFFA 4BE0A 1KD1R 3REBB 4C92D 4QVZA 3CMAA 1UHCA 1W1FA 3J80E 2B8AA 1M5Q1 1RLPC 1YP5A 2ARSA 2ZPFB 1K9AA 4DPGA 1NE8A 3HXYA 1M9SA 2QK0A 2RHSB 1WXBA 1QKXA 4IIMA 4OMLA 2ZIOA 5CKHA 1WZOA 1VYTA 2XMFA 2Z0WA 1UTIA 3M59A 1GFDA 1K9MU 3SWNC 3M4GA 3OW2S 2KROA 2X9HA 2X3WD 1FWZA 4M78F 4YRFA 2B86A 3FRNA 2HD0A 2LX9A 3G4SQ 1G3TA 2D8HA 3JCMf 1YN8A 2JVVA 3OSVA 4JZ4A 4E7KA 2K3BA 3M9QA 5CIUA 3OYYA 4PJJA 2LCSA 1SEMA 1QVGP 3CCRA 3EFOB 2HSPA 1M4ZA 1YBYA 3IG2A 2P4RA 5CKFA 4X5OA 1K9MC 4JLIA 1VA7A 2ABLA 2K5IA 4X9CA 2DE0X 3IALA 5I2SA 1TUDA 2DKGA 1BU1A 2GFAA 5C52B 3A8HB 4M75D 1KOGA 4OB0B 5GANg 3HFNA 2KEAA 2XDDA 3CC2Q 4J6YA 3CQTA 1K8AR 5KYYB 4TQFA 4RMFA 2CUDA 1RAEB 3BDLA 2J6KA 4C92A 2DXUA 2QDLA 5GAN5 1VQ9A 2DJQA 2SRCA 4A4HA 4O6JA 4PJMA 3S3OA 1J5WA 4PNOA 1AOJA 2QI2A 1VQOA 3MP6A 2HKQB 4J9FA 2JUFA 5GAMh 4LNSA 4P3OA 3KBGA 4PJOD 1OULA 2NYSA 4EPCA 2C7IA 1M1KU 4RTYA 1BI0A 1VQ5T 4RTVA 1WHGA 3GLXA 1I5LA 1X75C 1W66A 3I55Q 4RTWA 3DKMA 5I22A 1ARKA 4TVAA 2FEIA 4QQDA 2YT6A 3CCLT 3SB2A 4IUUA 3HFZA 1M1KC 3PZCA 1NM7A 2L0AA 2DAQA 1YIJT 1Q95G 3S3NA 1OZ2A 3P8YA 1CKAA 1NEBA 4YRGA 1WQWA 3CCMT 4P74A 4WF2A 5EC7A 1D3BA 2VXFA 2QQ9A 2LNVA 3GNGA 4RCCA 4P73A 1ASZA 4M75A 2DBKA 2QTXA 2YUPA 2VVKA 4YRLA 3LH0A 2ROLA 1Y96B 2BZ8A 4JPBW 3NENA 5KYNA 3HRSA 2X51A 3CD6A 4X34A 1X43A 2P0PA 4KBMB 2PVGB 1PHTA 3QYGB 4YRKA 3MPUB 3TU4K 5FROA 3PTAA 2OJ2A 3M0QA 5GAN6 3CMAT 3RACA 5HK0A 1BCMA 2GGRA 2E5QA 2F2WA 2CP0A 4PJOA 2JTFA 1Y0MA 3CCUQ 1X56A 2DILA 2KMTA 1JJ2S 1ZBXA 4XU0A 2RJCA 1OX9A 1NLPC 4XEMA 3EG3A 4ZTZB 3IQLA 2K5FA 2QYZA 3JB9G 4MDWA 2DERA 3OYMA 1X2HA 5LJ3f 5GAN2 1GGMA 3E9HA 1VQLQ 1AWJA 1X6BA 1UDLA 4BWAA 4ANJA 2E41A 3UATA 1KQSP 2KGTA 4J9DA 4YRSA 3QWXX 4M7DC 5GAMg 4FL6A 4BD3A 4P72A 2LCLA 3MJXA 2EVRA 2DL8A 3EFRA 3CCRT 1YB3A 3I9QA 2EJ9A 4NOYA 1YJNA 1K73R 3L2WA 4HXJA 4DOVA 1USYA 2V26A 2ZINA 1DJ7B 1LYLA 1LNXA 2GBQA 3FC3A 3R6NA 1ZSGA 1WX6A 2PTKA 2EQJA 1HJDA 1KQ1A 4HWSA 3TEHB 3G6EA 2MWPA 5D7UA 3CC4A 4YROA 1C6VX 3CBOA 1UJ0A 2JTEA 3HRIA 2NUZA 1VQ9T 1VQ8Q 2O9VA 3OS2A 2VUBA 2YLCA 2EPDA 1M3AA 2DXCA 2CZ6B 5LJ3e 2KVQG 2FPEA 1AWOA 1VQOT 2QQBA 2EYZA 3MHXA 4WI1A 2EKHA 3M56A 1YJ9A 2QAZA 2ZZDA 4LN2A 3GBQA 3H0FA 3RBBB 2AT1B 2LQWA 3QNEA 1OU9A 4C0ZA 5C53B 1M1GA 1PRMC 2E3HA 2DF6A 3OYEA 3M55A 2CH4W 2QQSA 5GANf 3A5YA 4HWPA 4FT2A 4GBQA 4J5YA 4LDVA 1X6GA 5GAN4 2HL5C 4NS5A 3LYIA 2A36A 2CREA 2RQRA 3CXCP 4YCUA 1M1FA 4C5HA 4R0KA 4C8QF 4C8QE 1QVFP 4AMCA 1JRIA 1AHJB 2RO0A 3DB3A 4RG8A 2A28A 1ZSZC 1EIFA 4YCVA 1N5ZA 3IKMB 1V29B 4OMOA 2XI9A 4H2VA 3JCMh 4M7DG 2KRSA 2LJ0A 4CI0C 4P75A 4M77F 3CD6T 3ICAA 3MKDA 1UGRB 2QGFB 2X35A 5KYXA 2DJZA 1QVFA 5GAOr 1D1CA 1VOMA 4A53A 1XOVA 4FYWB 3KUFA 5KE3A 1NYQA 1W2BA 1KHIA 3UT1A 4F7UE 2DA9A 4OMMA 1G3WA 4JDSA 1TUGB 4CH3A 5GAOm 3OS0A 3E1SA 2J3LA 5GANe 2EL9A 4JRKA 3MP8A 3J81E 1Q86C 2C0OA 1B7TA 2MWOA 3VQVA 2E64A 12ASA 1YWPA 3UWNA 3HXZA 1MUZA 4A4EA 2FZKB 3TSZA 1YJWQ 4YRTA 1JQQA 4LNPA 2DM1A 1GBQA 1N8RR 3CBPA 2EJGA 3JSCA 1QWFA 2DTHA 2K5LA 1YI2T 4H2TA 4WTOB 3JB9J 2VXEA 5HKCA 1KC8U 4YRPA 2CJAA 4CS2A 1I1JA 1ZLMA 5A2QE 3OY9A 4N0AC 2ODRC 4RDXA 3L2RA 5CAIA 4P71C 1YJNT 3E2UA 5DY9A 4YCWA 1SSHA 2EJFA 2RQWA 4TVRA 3RERA 5FW9A 4KULA 1IHVA 2CP3A 2RHYA 1X55A 1LOJA 3MEWA 3PCOB 1KC8C 2ZPBB 5LJ5d 4J7FA 4KR2A 3G6ET 5FU6B 1VQ6A 3CC4T 1SG5A 1OPKA 2CKKA 3OMCA 4OMPA 3P8BB 4C92F 2XICA 4GY5A 1R8OB 4A4KA 4XU1A 3CCQQ 3QO3A 2FG0A 3QDRB 2ZAEA 1EVLA 1GXIE 1W70A 1TTHB 4N4HA 3JCMg 2KAFA 1ZUUA 3QO5A 1E6HA 1YJ9T 1QVPA 4J6XA 1OX8A 1QCFA 4II1A 3OBYA 3QJ6A 2BZXA 3P8HA 1NEGA 1BBWA 3GPLA 1K1ZA 1HYOA 4HWTA 1PYSB 1MMGA 2JJ9A 1WHLA 1AD5A 1OYXA 4KH0B 3HTZA 2ZCFB 3UF4A 2CS7A 1MNDA 4YRRA 2A3LA 2DPPB 2Q7EA 3JB9D 4Q5WA 2J6FA 3UDCA 1TU0B 1I07A 1KD1U 2ZPEB 1SETA 2IG0A 1T0JA 5LJ3h 4YP0A 1S72Q 3OYHA 4J7IA 2LQKA 4PFZA 4CC2A 1EQRA 3KFUA 2NUPA 2EIFA 4LDUA 1YITA 2XG8D 1Q86R 2EAYA 3H6ZA 4P5NA 4M75F 4M75E 1VQNQ 2P0LA 1OPLA 4PFPA 3SWNA 1H92A 1M3BA 1U3OA 2V8IA 3EGUA 2DMOA 4E7IA 4FYXB 4LVLA 3M0UA 2QA4A 1KD1C 3CCVA 2DXBA 4J8OA 5KCHA 3EG9B 3TVTA 3NMZC 3X28B 4EMKB 1B7YB 1O75A 1BI3A 1RI0A 3GNFB 4G85A 5GMKm 4CC3A 2A37A 1Y7XA 2AKLA 4DBHA 1NJ5A 3CCEQ 4PJLA 4PJOF 4HWRA 3OBWA 1B34A 2V1RA 1K4US 2XTIA 4AT1B 2VGNA 2JTMA 3QYHB 2CP5A 4ZTUB 2K6DA 1YGBA 4EDUA 2XGTA 2ZPHB 2Q7GA 5A0GA 5CCAA 2DYIA 1VQMA 2E70A 4BY6B 3CEYA 1NYFA 2OTJQ 3HXUA 2HQHA 4A4GA 2E6NA 3RUXA 3VRYA 4DA4A 3VV0A 1VQKA 1H641 2MK5A 3EGDA 2LQNA 2R57A 3HRUA 1K8AU 2I4NA 3D7SB 1WNLA 2I2LA 2JN0A 1G5IA 1IREB 1RAFB 2HQEA 2JOYA 1HD3A 3QXEB 1UGQB 1M8VA 2F5KA 2RM4A 4B9XA 2K2VA 3BJUA 2ZPGB 1IO6A 1JB0E 3CBMA 2KR3A 3X26B 1YHQA 1EIYB 1QWEA 1K8AC 4C0GA 5GANh 1UUEA 2YLBA 3ZBDA 1OZ3A 4BACA 3FLGA 3OYDA 4KUIA 4TWAA 3QBYA 4AH6A 4N4GA 2KDSA 5FU6C 2NLUA 3EG2A 3CC7A 3EHRA 1VQ6T 1X54A 4M7DD 2EGAA 4J15A 2ZXFA 4IUTA 4E51A 5LJ3g 3CMEA 5GJWB 2KT1A 4UPAA 2RMOA 1UECA 2DVEA 1QE0A 1WLPB 3BE3A 3A8LB 2A8EA 1BK2A 4DBRA 3UGTA 3WVEB 3QWYA 4OF1A 1H3HA 1Z7NA 1XQHA 4WJ3M 3FJ5A 4C8QB 3A8GB 3O8VA 2GTOA 1BI2A 2IY5A 3BDUA 2P0KA 3OYBA 1BCOA 1GRIA 2MOXA 2QDYB 4DQ2A 3CC2A 4OMNA 4RTXA 3E9GA 4M77B 1MHNA 4IUPA 4K88A 1GCQC 2KQWA 2M16A 4JLGA 2ZT7A 4HT8A 3RMQA 1Q81R 2E6ZA 2DZ9A 1KIKA 2LNHB 3MF1A 2BE9B 1I8FA 3RKWA 1Z9QA 5HCKA 3SDZA 4F7UB 1WQ7A 2BZYA 2RHSA 3AHUA 1D1AA 1G5HA 1UB4A 2ECZA 5GAMj 1L0WA 1SERA 5LL6S 1YITT 1QVFS 1U8RA 1QLYA 4M78E 3L42A 3V7RA 1H4SA 3I56Q 3I55A 2EQMA 2KRNA 2QGGA 2DD4A 2PZ1A 3JB9I 1SSFA 2QASA 4PLLA 3ZEHA 2QA4T 1UGPB 2DVJA 2LJ1A 2RJFA 3CCVT 1W2BS 2Q5IA 4L87A 2DRKA 4XK8E 2H3JA 4UC4A 4M7DA 4BE1A 1PD1A 3ZL7C 2AKWA 4PFOA 5LJ5f 3F70A 3V8LA 2DIQA 1YIJQ 3HXWA 4HCBA 4KR3A 2EBPA 3VS7A 5EG2A 4LVIA 3EFOA 3X20B 5GAOn 1VQPT 1BBUA 3CCMQ 1HK9A 4XTWA 4C5EA 4E7JA 1M90R 2QEXQ 5D6YA 1V76A 1QVGA 1KFZA 2IIMA 1JU5C 4QT7A 4ZGEB 1K73U 5GAOl 4RUGA 4OLFA 4KQEA 5D6WA 4BY6C 4P3PA 2LC4A 2AKKA 3OQ5A 1VQKT 2OTLA 1I81A 5CVIA 3M5AA 4ZGDB 4C92B 3A8MB 1TH7A 2RF0A 2ARTA 4JUVA 3CMAQ 2FPFA 1K73C 1ASYA 3QZ5B 2RJDA 3JCMe 1RAGB 2QHSA 4RTTA 4IIOA 1AZEA 1G3YA 1N6AA 1QCOA 2C06A 1YFNA 2KXDA 1VQ4A 2M0YA 1RUWA 5CQXA 5C6SA 4DBQA 3V7SA 4XTUA 4XTXA 1YHQT 2BIVA 4K11A 1X69A 1BIBA 3P8DA 4M7AC 2ZZFA 2ARUA 4FU6A 4KUDK 2YWWA 2DO3A 3CCJA 4TVAB 1N27A 4Y28E 2CP6A 1TXQA 3EH2A 4OP0A 1NJ6A 4FSSA 3CC7T 1EX4A 3CMQA 5I21A 1OOTA 2D9TA 3HFZB 7AT1B 3MEVA 3CMET 1IL2A 1PKTA 1VUBA 2QXFA 3CCRQ 2K4YA 2ODRD 3ULRB 1SRMA 1TOVA 4J6WA 1ZSZA 1IXDA 1NLOC 4X9DA 3Q1JA 1R77A 3PMIA 1D3BB 4LVJA 1MMAA 2CZ0B 3NHNA 2KSSA 4HA8A 3KXTA 4M75B 5J26A 4A63B 4RQEA 2AZVA 1Y57A 2GFUA 3M53A 2K79A 1BYMA 3MCAB 4PG3A 1D09B 1HXDA 2MAMA 2EQKA 1XJWB 2L5QA 1WI7A 3QG1A 1K76A 2CIMA 2O31A 5A0LA 1VQ9Q 4GLKA 4EIKA 1VQ8A 4F14A 4LD6A 1NJ1A 2LP5A 3M4YA 2Y4XA 2EW3A 1JXMA 1OEBA 1VQOQ 1M2VA 1G83A 2ZT5A 2K57A 3JB9H 2RJEA 1RAAB 3JV3A 4PJOB 1RAHB 5IHNA 4ATOA 5GAMd 3RR6A 3UA6A 3JRZA 1SHFA 3U23A 1TUCA 1C1AA 3M0TA 1E1OA 4Z8AA 3I55T 4JRQA 2GF7A 2EKOA 4B6MA 1Z9ZA 4L5GA 4C0FA 1M2OA 1YWOA 1QF6A 4WCIA 1VQ7A 3UPUA 1IGUA 3L2UA 2V8JA 2HZYA 4YRIA 2EYQA 1N8RU 4NCXA 1TWBA 3QHSA 3RNJA 4N0AA 2L2PA 3L2ZA 3TEGA 1KQSA 4UP8A 3OS5A 5IXFA 5HK3A 4M7AG 2EQUA 5GMKl 2KE9A 3REAB 2DZCA 2OI3A 2CT3A 3LC0A 1UG1A 1Q7YR 2O88A 3G71A 2M1HA 5CKDA 2ZCEA 1VYUA 1MGQA 2DNUA 4NL3A 3OMGA 1YCSB 2RPNA 3A7UA 4OMQA 1N8RC 5FLXE 3T9NA 3INZA 2WSCE 3PE0A 4AG1C 4QVDA 5GMKi 4JJNK 2YRVA 3A74A 3EGXA 2OTLT 4OGEA 1V1CA 4BDZA 5D6XA 1E7OA 2W0ZA 3SFMA 2P0QA 2RHUA 3JB9F 2COZA 1FX7A 4KH1B 4ELZC 4DEYA 2HBPA 3CCSA 3LGFA 2GQVA 9ATCB 1IHWA 4UP7A 5AYFA 1VQ4T 1M3CA 1XNIA 2HDAA 4FW2A 2ZR3A 2AMCA 2LDMA 1SESA 5FWCA 2ED1A 3CPWP 2RHIA 4D8KA 1PM3A 2DD5A 2KK4A 2KXCA 1CSKA 2VYTA 3ASKA 5E3IA 4JS4A 1YJWA 2GQIA 3OYFA 5KYWA 1AZGB 4F7UG 3CCJT 1NJ8A 1ZUYA 1YI2Q 4E47A 4BI3A 1AVZC 3A7AA 5I11A 2M9UA 3L4GA 2EQIA 5CO7A 4HCCA 3H0IA 3JCMc 4ZIBA 2MYSA 2ZR2A 1H3ZA 2X4YA 2DEUA 2XHCA 2P84A 3C0CA 3HY1A 2LMJA 2YRCA 4M77E 3RIRA 2O4XA 3CXCA 1SHGA 1B70A 4DEXA 4M78B 3HP9A 3OYIA 1WU7A 1RABB 3LGLA 3PIOA 1Q86U 5J39A 4BUGA 1IGQA 3G6EQ 2F2VA 3N5BB 3CC4Q 5KYXB 2XDPA 3VUZA 1GFCA 2J3MA 2CGHA 1VQ8T 3HKSA 4LDXA 4K87A 3DLMA 3EHQA 2RD1A 3MEUA 1YJ9Q 2HKNA 4JJDA 4H2XA 5HGQA 2QQAA 2RA2A 3JCMW 2DL5A 3NELA 4H02A 3I5RA 3OB9A 4H2YA 1M8MA 1RADB 1M30A 2DQ0A 3NTKA 5DM7R 1SPKA 4JJBA 4E2FB 3PVQA 2L3SA 1QVGS 1VQ7T 4M7DF 4YRNA 4NL2A 1N9SA 1Q82R 2XD0A 2ALYA 4DBFA 1NZ9A 3NPFA 5KYUB 1B76A 2YRDA 5KH6A 4AFZC 3HFVA 5LJ3j 1C0MA 1WHHA 1NYRA 3G71T 2NUTA 2QHTA 2HBWA 4IUVA 3G1ZA 5GAOp 4EMHA 3OA6A 4C92E 2FZGB 4PK4A 1S1NA 2VB6A 4IUQA 2HL3A 1D0XA 1JJCA 4OB3B 2PUKB 4L59A 1FMWA 4YRJA 3META 4RMOA 2EGEA 1OU8A 2LZ6B 2M02A 2DL7A 1CKBA 3CCST 4F16A 3CCEA 5KNNA 2DTOA 2O2OA 3KFVA 5LJ5g 1C0AA 1RI9A 3GF5A 3QUIA 4XTVA 5K1PA 1PSFA 2M51A 3VS1A 3VS6A 3BFMA 2ED0A 4XU3A 3OYKA 3HFOA 1GCQA 2AIRB 3VS0A 2RI2A 2YSQA 2E3IA 4KGZB 2RHQA 1ABQA 3URGA 2Q7HA 4YRCA 4LVMA 4C5GA 2DIGA 3A5ZA 4WJ4A 2F69A 3NFCA 4A4FA 3JCMX 2MMPA 4FCYA 1Q81U 5IT9E 4MZTA 1JJ2P 4Z02A 3VQYA 3OS1A 3OYNA 4PJNA 4FYVB 4MZPA 2NUPB 3PIPA 3O5ZA 3M4PA 4EO4A 2PNIA 4F17A 2JS2A 4CC7A 1NYGA 1U5SA 5KCOA 4M78C 2YHTA 3SWNB 4QKUA 5GANj 4M7AD 2WACA 2VV5A 1H8KA 3VS3A 2CZ7B 1Q81C 4P75C 2RQVA 1WJQA 1I4K1 3M57A 1VQ6Q 3SHWA 3NTHA 2K7AA 2CJBA 4PJOE 4OMFB 2LQ8A 1XTDA 3VYHB 3LX7A 2DETA 2L3RA 3VQWA 1G51A 2C8MA 4XTZA 3TSWA 4OB1B 4YRQA 2X4WA 1WPYA 3OYCA 1B34B 1M90U 1ACMB 1X2KA 4HT4A 2MCNA 5GMKe 2FL7A 1WHMA 2E4HA 5CR2A 2P4TA 1PCXA 1VQZA 3MF2A 4BB7A 2DTIA 2VKNA 4X1VA 1F1BB 3S6WA 2AHJB 2KYMA 3VS4A 4JRPA 1KQSS 2YUNA 1X2QA 5DLOA 4E7HA 1LJOA 3A7RA 3MEYA 3EGDB 3MQZA 4Z89A 1W6XA 2GTJA 2QHUA 2EWNA 3DLLA 1M90C 3UA7A 4YTLA 1QQJA 5L8RE 5ELOA 2DK3A 8AT1B 3QIIA 2COWA 3JCMV 1ZHIA 2LX7A 4ELYC 4J9CA 3ER0A 2CH4A 4MMKA 1UEBA 5LJ3d 1EIYA 1YITQ 3TQ7P 3FIFA 2E3CA 3QJYA 3I56A 4M7AA 3G4SA 1EZZB 4LE9A 1SRLA 4AFQC 2QA4Q 1T3SA 2L3PA 3RESA 1NG2A 2MF2A 1PG5B 3ME9A 2RHXA 3VJPA 1EOVA 2CSQA 3HRKA 3W3SA 1Z7MA 4P3NA 3A98A 2IPOB 3M4QA 2RN8A 1VQPQ 3RKXA 2DYBA 3I5SA 4M78G 3OYGA 2WSEE 2SEMA 5C51B 4FYYB 3CCET 2QEXA 1WYDA 2DDZA 2KYBA 3NGPA 4XTYA 1ZA1B 1ADJA 1B3QA 3JAME 2F2XA 2HAXA 1MV3A 2RH2A 4FW1A 3C4SA 3NETA 2IY5B 1U06A 1AEYA 2BUDA 3RKYA 2BKDN 4KT0E 4IKFA 1VQKQ 3OYAA 2D0QB 2E10A 3TREA 1SF9A 4KGVB 3VBBA 2YUOA 3PMTA 3TEEA 1PWTA 1ZUKA 2MPXC 3H41A 3CXCS 1ADYA 1LVKA 1FYNA 3V8JA 1VQ5Q 2JW4A 4RG2A 4F7UA 1KMNA 5GAN8 3QPHA 1IRXA 4ZNXA 4RCBA 4LXCA 4E7LA 3P8VA 2J06A 1YHQQ 2J6OA 2DU7A 1TG0A 4CH6A 3CCLQ 3LSQA 5GANd 5DLQE 4EMKC 3EH1A 1RACB 2Q5HA 1G5VA 1KHCA 5GAOq 4O2DA 4J9EA 3CC7Q 4N4IA 4M7DB 2AKWB 4MZMA 5GMKj 2HCKA 3CMEQ 1N9WA 2RI3A 2L3QA 1X27A 2EYXA 3L2VA 3VQXA 3OYJA 3L2QA 1VQMT 3VYGA 5KYYA 4Q6GA 2D1XA 2M0OA 2XKOC 4ME7A 5CKEA 1E1TA 2K2MA 3E9IA 1Q7YU 1IZ6A 2A08A 4LDWA 2ZTGA 1WHKA 2E1HA 2XK0A 3SD4A 2RHZA 3AT1B 1NJIR 3M0RA 2ZT6A 4Q15A 4HKEA 3CCUA 2QHVA 2PMEA 3OYLA 3JCMQ 2V1QA 4RQFA 2W10A 3PVLA 5LJ5e 1NBEB 3VS2A 1QP3A 3UGQA 3FJPA 3V7CA 2PMFA 1PD0A 1Q7YC 3WQZA 2FRWA 2P5IA 1GBRA 2A0FB 2I0NA 4J9IA 3LLRA 4A54A 1WDXA 1ZX6A 4MDXA 1VQLA 5AT1B 1X6OA 1PSEA 4FT4A 3A31A 4GLMA 3M0SA 3I56T 3G4ST 5GMKh 3HSBA 2MIOA 3V8KA 1WFWA 3FEOA 2R5AA 3VS5A 3UFGA 4JZ3A 3MEAA 3RMSA 4C5IA 3H0HA 1KK7A 3WXMB 1BB9A 3EFSA 1I5OB 4J9HA 2PUOB 2R58A 1B07A 4HVUA 3J7AF 1ZA2B 1ABOA 4C8QC 4TQDA 1Y96A 2AK5A 2A7YA 4OB2B 4XEOA 2H8HA 1OV3A 2DX1A 4AFUC 4ZGJB 2QEXT 2KNBB 4LUEA 4L6V5 2LTOA 1ZSZB 3CC2T 3REUA 3FDRA 4M77C 2K3XA 4R56A 1BIAA 2FB7A 1WYXA 2COYA 1EFWA 1PNJA 3HHTB 2RK2A 2JS0A 1A0NB 2OTLQ 1YCYA 2RI5A 1NJ2A 1VYVA 2OX7A 2RQUA 1JXOA 5GJVB 3FB9A 3MO8A 3C95A 3L1AA 5IHIA 1K9MR 3HPWA 1WXUA 1M2VB 3EAEA 3LH5A 4JJCA 1FYFA 1VQ4Q 4IURA 4H2WA 2ZPIB 4TVYA 3A32A 2YXYA 4E7SA 2NWMA 3H9NA 1ZQ1A 2J7IA 2K9GA 5IN1A 2JZ2A 2QG9B 1W4SA 1WJSA 3ZFJA 3CCJQ 2JXBA 4OVAA 3GP8A 1LCKA 4P71A 6AT1B 1YI2A 4ZTJA 3OSSC 3M0PA 4YDQA 3X25B 2CYZB 4BE2A 3LSSA 2O01E 2DEQA 1Q82U 2GNCA 3CD6Q 2I4MA
chains in the Genus database with same CATH topology
1KMMA 3TEHA 2K3YA 2ZNJA 4M78D 3I7FA 2VC8A 2E12A 4QW2A 4PKCC 4C8QG 4C92C 5LJ5j 3PFSA 1HTTA 2DU5A 3TUPA 4C0DB 1NPPA 1Q82C 4J83A 1WGSA 2IVWA 3CCUT 4M77G 3UH0A 2L8DA 3PNWC 1B8AA 4CS4A 5K1XA 3WVDB 3QKJA 2ZGWA 5CKBA 1VQLT 1U1SA 2AMCB 4M7AF 4M7AE 4PL6A 3LWHA 3HXVA 4G84A 5KE2A 3HL8A 2LT4A 3CPWA 1EVKA 2GCXA 1E22A 4BI8B 4JS5A 2LRQA 2HQXA 3CPFA 3C12A 4P74C 5J3BA 4UP9A 3L4GB 3E19A 3S3MA 5FU7B 1E24A 2PVOB 4P73C 3QZ9B 4M75C 4ZN3A 4LDYA 5LJ5h 1H4TA 2MI6A 5CQYA 3RGLA 4M78A 3NTIA 2O4XB 1B70B 3E9FA 3PT9A 3A8OB 2Y4YA 2FHDA 3CCQA 2CZ1B 4QQ6A 3OW2A 4XAXB 5ELNA 11ASA 1QW1A 4PJOC 1NPRA 4F7UF 3VU3C 4C92G 1O9SA 3GIBA 5F5WA 1SRYA 4H2XB 2ZZGA 1QP2A 2QQRA 5C0MA 2VGMA 4M7DE 2CJ9A 4ZTFA 5CK9A 4VUBA 2G3RA 4PHCA 2HNIA 2LVMA 3M54A 4BW9A 3C94A 4P72C 4HT9A 1S72A 3X24B 5GAN3 4HVCA 2FVUA 1USYC 1VQNA 5IAYA 2WSFE 3QO7A 2ALYB 3LW5E 3PCOA 1X01A 3LWIA 4YPFA 3JCMd 2KY9A 1RIQA 1VIFA 3G7ZA 2PVDB 1KQ2A 2ZIMA 3HY0A 4CH5A 2NS6A 4HWOA 4PLIA 4BDYA 3NEMA 3HRTA 1FXXA 3HXXA 4M75G 1JJCB 2L89A 5A0DA 2X4XA 4C0DC 1Y71A 5HY6A 2E65A 1U1TA 4OGCA 1PYSA 2OTJA 5GAMf 3REXA 4ZN1A 1YJWT 2XIDA 4YREA 4PJOG 4MMLA 2PQWA 3R6OA 2OAUA 3ERRA 1HC7A 4CH4A 4FSXA 4EMGA 3PGGA 4EX5A 2RB6A 2RHQB 1X2GA 3A5ZB 3MP1A 1BI1A 5FU7C 1VIEA 3JCMJ 4CRIA 5M9OA 2PU9B 4YYEA 1N9RA 1UGSB 2DXTA 4TTVA 1JJ2A 3M58A 4EMKA 1B7YA 4TVWA 1G3SA 3TCJA 3QTCA 3P8TA 5I2MA 2ZT8A 1OI1A 3CCQT 5GAMe 3OD1A 3DSQA 3H8ZA 4HCZA 5FRNA 1ATIA 2I4OA 1H4QA 4C8QD 1VQPA 1NNHA 4XQ3A 1RL2A 2ZNIA 3BY7A 2E5AA 2X4JA 4M77D 4XU2A 4O5VA 2Y90A 4K86A 4YRMA 1P92A 4R55A 1Y07A 3R07A 4LVKA 2EFIA 2R5MA 1WJRA 2JNGA 4QQGA 2XU8A 4QVCA 3GOXA 4BI4A 3RF1A 3QO8A 1H4VB 1NJIU 1YFTA 1S72T 2D6FA 1VQ5A 4FM4B 1VQNT 2RK1A 5GAN7 2LT1A 1KG1A 4JRIA 3IKLA 4H2UA 2DQ3A 4CS3A 3CCLA 2ZZEA 3QSUA 4V2SA 1YFSA 5FRMA 2LCCA 4M7AB 3VUBA 1NJIC 3DB4A 1YIJA 4RKUE 3CCMA 2G4CA 2FYKA 1JBMA 4B9WA 1YFRA 4C8QA 2V8KA 2XDBA 4H2SA 3JCMb 4FIBA 4DOWA 3BW1A 2I4LA 4M77A 2F5TX 3CPWS 2OTJT 4Y91A 4LD9K 1BKBA 3RL6A 3VKIA 4D6WA 1WLEA 3JCMP 4BE0A 4C92D 4QVZA 3CMAA 3J80E 2B8AA 1M5Q1 2ARSA 2ZPFB 4DPGA 1NE8A 3HXYA 1M9SA 2RHSB 2ZIOA 5CKHA 3M59A 1K9MU 3SWNC 3M4GA 3OW2S 1FWZA 4M78F 4YRFA 3FRNA 2HD0A 2LX9A 1G3TA 3JCMf 2JVVA 3OSVA 4E7KA 3M9QA 5CIUA 3OYYA 3CCRA 1M4ZA 1YBYA 3IG2A 5CKFA 4X5OA 1K9MC 4JLIA 2K5IA 4X9CA 3IALA 5I2SA 2DKGA 2GFAA 5C52B 3A8HB 4M75D 1KOGA 4OB0B 5GANg 3HFNA 2XDDA 4J6YA 4TQFA 4RMFA 3BDLA 4C92A 2DXUA 5GAN5 1VQ9A 4A4HA 4O6JA 3S3OA 1J5WA 4PNOA 2QI2A 1VQOA 3MP6A 2JUFA 5GAMh 4LNSA 4P3OA 3KBGA 4PJOD 2C7IA 4EPCA 1M1KU 1BI0A 1VQ5T 3GLXA 1I5LA 1X75C 1W66A 3DKMA 4TVAA 4QQDA 3CCLT 3SB2A 4IUUA 3HFZA 1M1KC 3PZCA 1YIJT 2DAQA 3S3NA 1OZ2A 3P8YA 4YRGA 1WQWA 3CCMT 4P74A 4WF2A 1D3BA 2VXFA 2QQ9A 2LNVA 3GNGA 4RCCA 4P73A 1ASZA 4M75A 2QTXA 4YRLA 3LH0A 1Y96B 3NENA 3CD6A 3HRSA 4X34A 2P0PA 4KBMB 2PVGB 3QYGB 4YRKA 3TU4K 5FROA 3PTAA 5GAN6 3CMAT 3RACA 5HK0A 2E5QA 4PJOA 2JTFA 1X56A 1JJ2S 2KMTA 1ZBXA 4XU0A 2RJCA 4XEMA 4ZTZB 2K5FA 3JB9G 4MDWA 3OYMA 1X2HA 5LJ3f 5GAN2 1GGMA 3E9HA 4BWAA 2E41A 4YRSA 4M7DC 5GAMg 4FL6A 4BD3A 4P72A 2LCLA 3CCRT 3EFRA 1YB3A 2EJ9A 4NOYA 1YJNA 3L2WA 4DOVA 1USYA 2ZINA 1DJ7B 1LYLA 1LNXA 3FC3A 2EQJA 1KQ1A 4HWSA 3TEHB 3G6EA 2MWPA 3CC4A 4YROA 3CBOA 3HRIA 1VQ9T 3OS2A 2VUBA 2YLCA 2DXCA 2CZ6B 5LJ3e 2KVQG 1VQOT 2QQBA 3MHXA 4WI1A 3M56A 1YJ9A 2ZZDA 3QNEA 4C0ZA 5C53B 1M1GA 3OYEA 3M55A 2QQSA 5GANf 3A5YA 4HWPA 4FT2A 4LDVA 4J5YA 5GAN4 4NS5A 3LYIA 4YCUA 1M1FA 4C5HA 4C8QF 4C8QE 1JRIA 1AHJB 2RO0A 3DB3A 4RG8A 1EIFA 4YCVA 3IKMB 1V29B 2XI9A 4H2VA 3JCMh 4M7DG 4CI0C 4P75A 4M77F 3CD6T 3ICAA 1UGRB 2X35A 2DJZA 1QVFA 5GAOr 4A53A 1XOVA 3KUFA 5KE3A 1NYQA 1W2BA 1KHIA 3UT1A 4F7UE 1G3WA 4JDSA 4CH3A 5GAOm 3OS0A 3E1SA 2J3LA 5GANe 2EL9A 4JRKA 3MP8A 3J81E 1Q86C 2MWOA 3VQVA 2E64A 12ASA 3UWNA 3HXZA 4A4EA 4YRTA 3CBPA 2EJGA 3JSCA 2DTHA 2K5LA 1YI2T 4H2TA 3JB9J 2VXEA 5HKCA 1KC8U 4YRPA 2CJAA 4CS2A 3OY9A 5A2QE 2ODRC 4RDXA 4N0AC 3L2RA 5CAIA 4P71C 1YJNT 5DY9A 4YCWA 2EJFA 4TVRA 3RERA 4KULA 2RHYA 1X55A 1LOJA 3MEWA 3PCOB 1KC8C 2ZPBB 5LJ5d 4J7FA 4KR2A 3G6ET 5FU6B 1VQ6A 3CC4T 2CKKA 3OMCA 3P8BB 4C92F 2XICA 4GY5A 1R8OB 4A4KA 4XU1A 3QO3A 3QDRB 1EVLA 1GXIE 4N4HA 3JCMg 2KAFA 3QO5A 1YJ9T 1QVPA 4J6XA 4II1A 3OBYA 3QJ6A 3P8HA 1BBWA 3GPLA 4HWTA 1PYSB 3HTZA 1OYXA 2ZCFB 2CS7A 4YRRA 2A3LA 2DPPB 2Q7EA 3JB9D 4Q5WA 3UDCA 1KD1U 2ZPEB 1SETA 2IG0A 5LJ3h 4YP0A 3OYHA 4J7IA 2LQKA 1EQRA 3KFUA 2EIFA 4LDUA 1YITA 2XG8D 2EAYA 3H6ZA 4P5NA 4M75F 4M75E 2P0LA 3SWNA 2V8IA 4E7IA 4LVLA 2QA4A 1KD1C 3CCVA 2DXBA 4J8OA 5KCHA 3X28B 4EMKB 1B7YB 1O75A 1BI3A 1RI0A 3GNFB 4G85A 5GMKm 1Y7XA 1NJ5A 4PJOF 4HWRA 3OBWA 1B34A 2XTIA 2VGNA 2JTMA 3QYHB 4ZTUB 1YGBA 4EDUA 2XGTA 2ZPHB 2Q7GA 5A0GA 5CCAA 1VQMA 2E70A 4BY6B 3CEYA 3HXUA 4A4GA 2E6NA 3RUXA 4DA4A 3VV0A 1VQKA 1H641 2R57A 3HRUA 1K8AU 2I4NA 1WNLA 2I2LA 2JN0A 1G5IA 1IREB 2HQEA 2JOYA 3QXEB 1UGQB 1M8VA 2F5KA 2RM4A 4B9XA 2K2VA 3BJUA 2ZPGB 1JB0E 3CBMA 3X26B 1YHQA 1EIYB 1K8AC 4C0GA 5GANh 2YLBA 3ZBDA 1OZ3A 4BACA 3FLGA 3OYDA 4KUIA 4TWAA 3QBYA 4AH6A 4N4GA 2KDSA 5FU6C 2NLUA 3CC7A 1VQ6T 1X54A 4M7DD 4J15A 2ZXFA 4IUTA 4E51A 5LJ3g 3CMEA 4UPAA 2DVEA 1QE0A 3A8LB 2A8EA 3UGTA 3WVEB 1Z7NA 4OF1A 4WJ3M 1XQHA 4C8QB 3A8GB 3O8VA 1BI2A 2IY5A 3BDUA 2P0KA 3OYBA 2QDYB 4DQ2A 3CC2A 3E9GA 4M77B 1MHNA 4IUPA 4K88A 2KQWA 2M16A 4JLGA 2ZT7A 4HT8A 3RMQA 2E6ZA 2DZ9A 3MF1A 1I8FA 3RKWA 3SDZA 4F7UB 1WQ7A 2RHSA 3AHUA 1G5HA 1UB4A 5GAMj 1L0WA 1SERA 5LL6S 1YITT 1QVFS 1U8RA 4M78E 3L42A 3V7RA 1H4SA 3I55A 2EQMA 2DD4A 3JB9I 1SSFA 3ZEHA 4PLLA 1W2BS 2QA4T 1UGPB 2RJFA 3CCVT 2Q5IA 4L87A 4XK8E 2H3JA 4UC4A 4M7DA 4BE1A 2AKWA 5LJ5f 3F70A 3V8LA 2DIQA 3HXWA 4HCBA 4KR3A 4LVIA 5EG2A 3X20B 5GAOn 1VQPT 1BBUA 1HK9A 4XTWA 4C5EA 4E7JA 5D6YA 1QVGA 4ZGEB 1K73U 5GAOl 4OLFA 4KQEA 5D6WA 4BY6C 4P3PA 2LC4A 3OQ5A 1VQKT 2OTLA 1I81A 5CVIA 3M5AA 4ZGDB 4C92B 3A8MB 1TH7A 2ARTA 4JUVA 1K73C 1ASYA 3QZ5B 2RJDA 3JCMe 2QHSA 1G3YA 1N6AA 2C06A 1VQ4A 5CQXA 5C6SA 3V7SA 4XTUA 4XTXA 1YHQT 2BIVA 1BIBA 3P8DA 4M7AC 2ZZFA 2ARUA 4FU6A 4KUDK 2DO3A 3CCJA 4TVAB 1N27A 4Y28E 4OP0A 1NJ6A 3CC7T 3CMQA 5I21A 2D9TA 3HFZB 3MEVA 3CMET 1IL2A 1VUBA 2QXFA 2K4YA 2ODRD 4J6WA 4X9DA 3Q1JA 3PMIA 1D3BB 4LVJA 2CZ0B 3KXTA 2KSSA 4HA8A 4M75B 5J26A 4RQEA 2GFUA 3M53A 1BYMA 3MCAB 4PG3A 1HXDA 2MAMA 2EQKA 2L5QA 3QG1A 2CIMA 5A0LA 4GLKA 1VQ8A 4LD6A 1NJ1A 3M4YA 2Y4XA 2ZT5A 2K57A 3JB9H 2RJEA 4PJOB 4ATOA 5GAMd 3JRZA 1E1OA 3I55T 4JRQA 2GF7A 2EKOA 4L5GA 4C0FA 1QF6A 1VQ7A 3UPUA 3L2UA 2V8JA 4YRIA 2EYQA 1N8RU 4NCXA 3QHSA 4N0AA 3TEGA 3L2ZA 1KQSA 4UP8A 3OS5A 5HK3A 4M7AG 2EQUA 5GMKl 2DZCA 3LC0A 3G71A 2M1HA 5CKDA 2ZCEA 1MGQA 4NL3A 3OMGA 3A7UA 1N8RC 5FLXE 3T9NA 3INZA 2WSCE 4QVDA 5GMKi 4JJNK 2YRVA 3A74A 2OTLT 4OGEA 4BDZA 3JB9F 5D6XA 3SFMA 2P0QA 2RHUA 1FX7A 4ELZC 2HBPA 3CCSA 3LGFA 2GQVA 4UP7A 5AYFA 1VQ4T 1XNIA 2ZR3A 2AMCA 2LDMA 1SESA 2RHIA 2DD5A 2KK4A 2VYTA 3ASKA 5E3IA 4JS4A 1YJWA 3OYFA 4F7UG 3CCJT 1NJ8A 4E47A 4BI3A 3A7AA 2M9UA 3L4GA 5CO7A 4HCCA 3JCMc 4ZIBA 2ZR2A 1H3ZA 2X4YA 2XHCA 3HY1A 4M77E 3RIRA 2O4XA 3CXCA 1B70A 4M78B 3HP9A 3OYIA 1WU7A 3LGLA 3PIOA 1Q86U 5J39A 4BUGA 3N5BB 2XDPA 3VUZA 2J3MA 2CGHA 1VQ8T 3HKSA 4LDXA 4K87A 3DLMA 2RD1A 3MEUA 4H2XA 5HGQA 2QQAA 2RA2A 3JCMW 3NELA 4H02A 3OB9A 4H2YA 2DQ0A 3NTKA 5DM7R 1QVGS 1VQ7T 4M7DF 4YRNA 4NL2A 1N9SA 2XD0A 2ALYA 1NZ9A 1B76A 5KH6A 3HFVA 5LJ3j 1NYRA 3G71T 2QHTA 4IUVA 3G1ZA 5GAOp 4EMHA 3OA6A 4C92E 4IUQA 1JJCA 4OB3B 2PUKB 4L59A 4YRJA 3META 4RMOA 3CCST 3CCEA 5KNNA 2DTOA 5LJ5g 1C0AA 3GF5A 3QUIA 4XTVA 5K1PA 1PSFA 3BFMA 4XU3A 3OYKA 3HFOA 2RI2A 2RHQA 3URGA 2Q7HA 4YRCA 4LVMA 4C5GA 2DIGA 3A5ZA 4WJ4A 2F69A 3NFCA 4A4FA 3JCMX 2MMPA 1Q81U 5IT9E 4MZTA 4Z02A 3VQYA 3OS1A 3OYNA 4EO4A 4MZPA 3PIPA 3M4PA 5KCOA 4M78C 2YHTA 3SWNB 5GANj 4M7AD 2WACA 2VV5A 2CZ7B 1Q81C 4P75C 1WJQA 1I4K1 3M57A 3NTHA 2CJBA 4PJOE 4OMFB 2LQ8A 1XTDA 3VYHB 3LX7A 2L3RA 3VQWA 1G51A 2C8MA 4XTZA 4OB1B 4YRQA 2X4WA 1WPYA 3OYCA 1B34B 1M90U 4HT4A 5GMKe 2FL7A 5CR2A 2P4TA 3MF2A 1VQZA 4BB7A 2DTIA 3S6WA 2AHJB 4JRPA 1KQSS 5DLOA 4E7HA 1LJOA 3A7RA 3MEYA 3MQZA 2QHUA 2EWNA 3DLLA 1M90C 4YTLA 5L8RE 5ELOA 2DK3A 3QIIA 3JCMV 1ZHIA 4ELYC 3ER0A 4MMKA 5LJ3d 1UEBA 1EIYA 3FIFA 2E3CA 3QJYA 3I56A 4M7AA 3G4SA 3RESA 2MF2A 3ME9A 2RHXA 3VJPA 1EOVA 3HRKA 3W3SA 1Z7MA 4P3NA 3M4QA 3RKXA 4M78G 3OYGA 2WSEE 5C51B 3CCET 2QEXA 1WYDA 2DDZA 4XTYA 1ADJA 3JAME 2HAXA 2RH2A 3C4SA 3NETA 2IY5B 2BUDA 3RKYA 2BKDN 4KT0E 4IKFA 3OYAA 2D0QB 2E10A 3TREA 3VBBA 3PMTA 1ADYA 3TEEA 3CXCS 3V8JA 4RG2A 4F7UA 1KMNA 5GAN8 3QPHA 4RCBA 4E7LA 3P8VA 2DU7A 4CH6A 3LSQA 5GANd 5DLQE 4EMKC 2Q5HA 1G5VA 1KHCA 5GAOq 4O2DA 4N4IA 4M7DB 2AKWB 4MZMA 5GMKj 1N9WA 2RI3A 3VQXA 3L2VA 3OYJA 3L2QA 1VQMT 3VYGA 4Q6GA 2M0OA 2XKOC 4ME7A 5CKEA 1E1TA 3E9IA 1Q7YU 1IZ6A 4LDWA 2ZTGA 2E1HA 2XK0A 3SD4A 2RHZA 2ZT6A 4Q15A 4HKEA 3CCUA 2QHVA 2PMEA 3OYLA 3JCMQ 4RQFA 5LJ5e 1QP3A 3UGQA 2PMFA 3FJPA 3V7CA 1Q7YC 3WQZA 2P5IA 3LLRA 4A54A 4MDXA 1VQLA 1X6OA 1PSEA 4FT4A 3A31A 3I56T 3G4ST 5GMKh 3HSBA 3V8KA 3FEOA 2R5AA 3UFGA 3MEAA 3RMSA 4C5IA 3WXMB 3EFSA 2PUOB 2R58A 3J7AF 4C8QC 4TQDA 1Y96A 2A7YA 4OB2B 4XEOA 4ZGJB 2QEXT 4L6V5 2LTOA 3CC2T 3REUA 3FDRA 4M77C 2K3XA 4R56A 1BIAA 2FB7A 1EFWA 3HHTB 2RK2A 1YCYA 2RI5A 1NJ2A 3FB9A 3MO8A 3C95A 3L1AA 3HPWA 3EAEA 1FYFA 4IURA 4H2WA 2ZPIB 4TVYA 3A32A 1ZQ1A 5IN1A 2JZ2A 1W4SA 1WJSA 3ZFJA 4OVAA 3GP8A 4P71A 1YI2A 4ZTJA 3OSSC 4YDQA 3X25B 2CYZB 4BE2A 3LSSA 2O01E 2DEQA 1Q82U 2I4MA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KMM A;  2ALY A;  3TEH A;  4C92 A;  2DXU A;  5GAN 5;  1B76 A;  2ZNJ A;  4M78 D;  3I7F A;  1M8V A;  2RM4 A;  3HFV A;  5LJ3 j;  1J5W A;  3BJU A;  2VC8 A;  4PNO A;  1NYR A;  4C8Q G;  4C92 C;  5LJ5 j;  2QHT A;  3G1Z A;  5GAO p;  4EMH A;  1HTT A;  5GAM h;  1EIY B;  4LNS A;  4C92 E;  4P3O A;  2DU5 A;  2C7I A;  4PJO D;  3TUP A;  5GAN h;  2YLB A;  1JJC A;  1I5L A;  4M77 G;  3UH0 A;  1W66 A;  4TWA A;  4YRJ A;  4AH6 A;  4TVA A;  1X54 A;  4M7D D;  1B8A A;  4CS4 A;  4J15 A;  2ZXF A;  4E51 A;  5LJ3 g;  3SB2 A;  5K1X A;  5KNN A;  2DTO A;  3HFZ A;  4UPA A;  2ZGW A;  2DVE A;  1QE0 A;  5LJ5 g;  3PZC A;  1U1S A;  2AMC B;  1C0A A;  3QUI A;  4M7A E;  4M7A F;  3UGT A;  3HXV A;  3P8Y A;  4G84 A;  1Z7N A;  4WJ3 M;  4XTV A;  5K1P A;  4C8Q B;  4YRG A;  1WQW A;  4P74 A;  1EVK A;  4WF2 A;  3BFM A;  4XU3 A;  1D3B A;  2VXF A;  1E22 A;  3HFO A;  2IY5 A;  3BDU A;  4RCC A;  4P73 A;  1ASZ A;  4M75 A;  4DQ2 A;  2QTX A;  4YRL A;  4M77 B;  1Y96 B;  4P74 C;  2RHQ A;  3L4G B;  4K88 A;  1E24 A;  4UP9 A;  3NEN A;  2Q7H A;  4YRC A;  4WJ4 A;  3A5Z A;  4P73 C;  2ZT7 A;  4M75 C;  4HT8 A;  3JCM X;  5LJ5 h;  1H4T A;  2DZ9 A;  3MF1 A;  3RGL A;  4YRK A;  4M78 A;  1I8F A;  3RKW A;  3VQY A;  1B70 B;  4F7U B;  1WQ7 A;  5GAN 6;  4EO4 A;  2RHS A;  3M4P A;  4YRS A;  3RAC A;  3AHU A;  1G5H A;  5GAM j;  4M78 C;  1L0W A;  2YHT A;  4PJO A;  3SWN B;  1SER A;  1X56 A;  5GAN j;  4M78 E;  4M7A D;  5ELN A;  3V7R A;  1H4S A;  11AS A;  4XU0 A;  4P75 C;  1I4K 1;  4XEM A;  4ZTZ B;  3JB9 I;  4PJO C;  2Q5I A;  4L87 A;  3JB9 G;  2CJB A;  4PJO E;  4F7U F;  1X2H A;  5LJ3 f;  5GAN 2;  4M7D A;  3VU3 C;  1GGM A;  4C92 G;  2AKW A;  3E9H A;  5LJ5 f;  3V8L A;  3HXW A;  4BWA A;  4KR3 A;  3VQW A;  1G51 A;  2C8M A;  4XTZ A;  2E41 A;  4YRQ A;  5GAO n;  1WPY A;  3GIB A;  1HK9 A;  1BBU A;  4M7D C;  1SRY A;  4H2X B;  4XTW A;  1B34 B;  5GAM g;  2ZZG A;  5F5W A;  4P72 A;  2CJ9 A;  4M7D E;  5GMK e;  3EFR A;  1YB3 A;  3MF2 A;  1VQZ A;  2EJ9 A;  4NOY A;  2DTI A;  5GAO l;  4PHC A;  2HNI A;  1USY A;  4BW9 A;  2ZIN A;  4P72 C;  1LYL A;  4OLF A;  1LNX A;  4KQE A;  1LJO A;  4HT9 A;  3A7R A;  3MEY A;  5GAN 3;  4P3P A;  4HVC A;  2QHU A;  1USY C;  2EWN A;  1I81 A;  1KQ1 A;  3QO7 A;  2ALY B;  3PCO A;  4HWS A;  3TEH B;  1X01 A;  4C92 B;  1TH7 A;  4YPF A;  2ART A;  4JUV A;  3JCM d;  4YRO A;  5ELO A;  1ASY A;  3JCM V;  3JCM e;  1RIQ A;  3HRI A;  2QHS A;  4MMK A;  5LJ3 d;  1KQ2 A;  2ZIM A;  1EIY A;  3HY0 A;  4CH5 A;  2YLC A;  3FIF A;  4HWO A;  2E3C A;  5LJ3 e;  3NEM A;  4M7A A;  3HXX A;  3V7S A;  4XTU A;  4XTX A;  4M75 G;  4WI1 A;  1JJC B;  3RES A;  2E65 A;  1BIB A;  4M7A C;  2ZZF A;  2ARU A;  1EOV A;  3HRK A;  3W3S A;  1U1T A;  1Z7M A;  3QNE A;  4TVA B;  4P3N A;  5C53 B;  4OP0 A;  1NJ6 A;  3M4Q A;  3RKX A;  4M78 G;  1PYS A;  3CMQ A;  5GAM f;  5I21 A;  3HFZ B;  5C51 B;  3REX A;  5GAN f;  3A5Y A;  1WYD A;  4HWP A;  1IL2 A;  2DDZ A;  2ODR D;  4XTY A;  1ADJ A;  4J5Y A;  4YRE A;  4J6W A;  5GAN 4;  4PJO G;  4MML A;  4X9D A;  3ERR A;  1HC7 A;  4CH4 A;  1D3B B;  3NET A;  4YCU A;  2IY5 B;  4EMG A;  3RKY A;  3PGG A;  4HA8 A;  4M75 B;  4C8Q F;  4C8Q E;  4EX5 A;  1JRI A;  4RQE A;  2RB6 A;  2E10 A;  2RHQ B;  3IKM B;  4YCV A;  1X2G A;  4H2V A;  3JCM h;  3VBB A;  4PG3 A;  4M7D G;  1HXD A;  1ADY A;  3JCM J;  4P75 A;  4M77 F;  3ICA A;  3V8J A;  2CIM A;  4F7U A;  1KMN A;  4YYE A;  5GAN 8;  1N9R A;  2DJZ A;  5GAO r;  2DXT A;  4TTV A;  1NJ1 A;  4A53 A;  4EMK A;  1B7Y A;  4TVW A;  4RCB A;  2ZT5 A;  2K57 A;  3P8V A;  3JB9 H;  2DU7 A;  3QTC A;  4PJO B;  1NYQ A;  3P8T A;  4CH6 A;  2ZT8 A;  4F7U E;  5GAM d;  3LSQ A;  4CH3 A;  5GAN d;  5GAO m;  4EMK C;  5GAM e;  3OD1 A;  3DSQ A;  1ATI A;  2J3L A;  5GAN e;  2EL9 A;  2I4O A;  2Q5H A;  1E1O A;  4JRK A;  1H4Q A;  5GAO q;  4O2D A;  4C8Q D;  4M7D B;  1NNH A;  4XQ3 A;  3VQV A;  2E64 A;  12AS A;  2AKW B;  2ZNI A;  1QF6 A;  5GMK j;  1N9W A;  3HXZ A;  3BY7 A;  4YRT A;  2E5A A;  4YRI A;  2EJG A;  4NCX A;  4M77 D;  3QHS A;  3VQX A;  4N0A A;  3TEG A;  3L2Z A;  2DTH A;  4XU2 A;  4H2T A;  2Y90 A;  3JB9 J;  2VXE A;  4UP8 A;  4K86 A;  4Q6G A;  4YRM A;  4YRP A;  3R07 A;  4M7A G;  2CJA A;  5GMK l;  4CS2 A;  1E1T A;  2ODR C;  2DZC A;  4N0A C;  4RDX A;  3LC0 A;  3E9I A;  4QVC A;  5CAI A;  4P71 C;  2ZCE A;  5DY9 A;  2E1H A;  2ZTG A;  4YCW A;  3RF1 A;  2EJF A;  3QO8 A;  1MGQ A;  4NL3 A;  3RER A;  3A7U A;  1H4V B;  3INZ A;  1YFT A;  2ZT6 A;  4Q15 A;  4QVD A;  5GMK i;  1X55 A;  1LOJ A;  3A74 A;  2QHV A;  2PME A;  3PCO B;  3JCM Q;  5LJ5 d;  3JB9 F;  5GAN 7;  4RQF A;  4KR2 A;  5LJ5 e;  3UGQ A;  3FJP A;  4JRI A;  3V7C A;  2PMF A;  3IKL A;  4H2U A;  2DQ3 A;  4C92 F;  3WQZ A;  4CS3 A;  2P5I A;  2ZZE A;  4XU1 A;  3QSU A;  3QO3 A;  4V2S A;  1YFS A;  4UP7 A;  4A54 A;  4M7A B;  1EVL A;  3A31 A;  5GMK h;  3HSB A;  3V8K A;  2ZR3 A;  3JCM g;  2AMC A;  2G4C A;  1SES A;  2FYK A;  3QO5 A;  1JBM A;  1YFR A;  3UFG A;  4J6X A;  4C8Q A;  4H2S A;  5E3I A;  3JCM b;  3EFS A;  1BBW A;  4F7U G;  4HWT A;  1PYS B;  1NJ8 A;  3HTZ A;  4C8Q C;  3BW1 A;  2I4L A;  3A7A A;  4TQD A;  4M77 A;  1Y96 A;  3L4G A;  4YRR A;  4Y91 A;  4XEO A;  3RL6 A;  2Q7E A;  3JCM c;  3JB9 D;  4ZIB A;  1WLE A;  2ZR2 A;  3JCM P;  3REU A;  1SET A;  4M77 C;  4C92 D;  3HY1 A;  1BIA A;  4M77 E;  3RIR A;  1M5Q 1;  1B70 A;  2ARS A;  5LJ3 h;  2FB7 A;  4YP0 A;  4M78 B;  1EQR A;  1WU7 A;  1EFW A;  3KFU A;  4DPG A;  3HXY A;  2EAY A;  1YCY A;  4M75 F;  4M75 E;  2P0L A;  3SWN A;  1NJ2 A;  2RHS B;  2ZIO A;  3FB9 A;  3L1A A;  2J3M A;  3SWN C;  2CGH A;  3M4G A;  4EMK B;  1B7Y B;  4M78 F;  1FYF A;  4YRF A;  4H2W A;  4TVY A;  3A32 A;  4K87 A;  4G85 A;  3JCM f;  5GMK m;  2RD1 A;  1NJ5 A;  4PJO F;  4HWR A;  4H2X A;  1B34 A;  2XTI A;  5HGQ A;  2RA2 A;  3IG2 A;  3JCM W;  4X5O A;  4ZTU B;  3NEL A;  4H02 A;  1YGB A;  4JLI A;  2XGT A;  4H2Y A;  2Q7G A;  4P71 A;  4X9C A;  2DQ0 A;  3IAL A;  2DKG A;  5C52 B;  3HXU A;  3RUX A;  4M75 D;  1KOG A;  4M7D F;  1H64 1;  5GAN g;  3HFN A;  4YDQ A;  4YRN A;  4NL2 A;  4J6Y A;  3LSS A;  2I4N A;  1WNL A;  2I2L A;  2JN0 A;  1G5I A;  4RMF A;  1N9S A;  2DEQ A;  4TQF A;  2I4M A; 
#chains in the Genus database with same CATH topology
 1KMM A;  3TEH A;  2J05 A;  3G1J A;  2ROT A;  2K3Y A;  2CSI A;  2ZNJ A;  2BE7 D;  4M78 D;  3I7F A;  8ATC B;  1RAI B;  2VC8 A;  2RQT A;  2E12 A;  2JM8 A;  4QW2 A;  4PKC C;  4C8Q G;  4C92 C;  5LJ5 j;  3PFS A;  1HTT A;  2DU5 A;  1PKS A;  3TUP A;  1M1K R;  3EGX B;  4C0D B;  1NPP A;  1Q82 C;  4J83 A;  2O9S A;  1WGS A;  2IVW A;  3CCU T;  1IB8 A;  4M77 G;  3UH0 A;  2EYW A;  2KT8 A;  2L8D A;  3PNW C;  1WA7 A;  2F1L A;  1ZBJ A;  1B8A A;  4CS4 A;  2DFU A;  2KI7 A;  5K1X A;  3WVD B;  3QKJ A;  2ZGW A;  4ORZ A;  5CKB A;  1VQL T;  1U1S A;  2AMC B;  3EG1 A;  1MV0 B;  4M7A F;  4M7A E;  4PL6 A;  3LWH A;  4Y92 A;  3HXV A;  4G84 A;  1JO8 A;  2ESW A;  5KE2 A;  3HL8 A;  2LT4 A;  3CPW A;  1EVK A;  2GCX A;  2JMC A;  5KYW B;  1VQ7 Q;  1E22 A;  4BI8 B;  2X3X D;  1AWX A;  4JS5 A;  2LRQ A;  1YJN Q;  2HQX A;  3CPF A;  3C12 A;  4CC4 B;  4P74 C;  5J3B A;  4UP9 A;  3L4G B;  3E19 A;  3S3M A;  5FU7 B;  1E24 A;  2PVO B;  4RTU A;  4P73 C;  3QZ9 B;  4M75 C;  4ZN3 A;  4LDY A;  3OW2 P;  5LJ5 h;  1H4T A;  2MI6 A;  3SEM A;  5CQY A;  3RGL A;  4M78 A;  3NTI A;  2HEQ A;  2O4X B;  3G71 Q;  3HTR A;  4ESR A;  1B70 B;  3E9F A;  3PT9 A;  3A8O B;  2AZS A;  2CT4 A;  1W2B P;  2LJ3 A;  2Y4Y A;  1FMV A;  2FHD A;  1UGV A;  4AFS C;  3CCQ A;  2CZ1 B;  4QQ6 A;  3OW2 A;  4XAX B;  5ELN A;  11AS A;  1AT1 B;  1QW1 A;  4PJO C;  1NPR A;  3A1P A;  3CCS Q;  4F7U F;  3VU3 C;  4C92 G;  2JM9 A;  1O9S A;  1KSW A;  2KBT A;  4LUD A;  3GIB A;  5F5W A;  3QDF A;  1SRY A;  4H2X B;  2ZZG A;  2H3E B;  1QP2 A;  1FMK A;  2QQR A;  1PC0 A;  5C0M A;  5FWB A;  2VGM A;  4M7D E;  2CJ9 A;  1TSF A;  2QTV A;  3RDV A;  4ZTF A;  5CK9 A;  2FZC B;  1QCN A;  2RNA A;  2DRM A;  4VUB A;  1E6G A;  2G3R A;  4PHC A;  2HNI A;  2LVM A;  3M54 A;  4BW9 A;  3C94 A;  2JMA A;  4P72 C;  1HSQ A;  2D8J A;  5IHK A;  4HT9 A;  1S72 A;  3X24 B;  5GAN 3;  4HVC A;  1K0S A;  4J9G A;  2FVU A;  1USY C;  1VQN A;  5KYU A;  5IAY A;  2WSF E;  1D0Y A;  3QO7 A;  3I35 A;  2ALY B;  3LW5 E;  3PCO A;  1AWW A;  1X01 A;  3LWI A;  5IXB A;  4YPF A;  3JCM d;  2KY9 A;  1RIQ A;  1VIF A;  3G7Z A;  2PVD B;  1KQ2 A;  2ZIM A;  3HY0 A;  4CH5 A;  2E5K A;  2ATC B;  2NUT B;  2NS6 A;  4HWO A;  1EFN A;  2FRY A;  4PLI A;  4BDY A;  3NEM A;  3HRT A;  1FXX A;  1WHJ A;  3HXX A;  4E7Z A;  5L23 A;  4M75 G;  2HMA A;  1JJC B;  2L89 A;  5A0D A;  1M27 C;  2X4X A;  4C0D C;  1Y71 A;  5HY6 A;  2E65 A;  2JT4 A;  1U1T A;  2EYY A;  1YNZ A;  4M4Z A;  4OGC A;  1PYS A;  5ECA A;  1OQK A;  1GCP A;  2OTJ A;  5GAM f;  3REX A;  1TS9 A;  2C0I A;  4ZN1 A;  1YJW T;  2XID A;  4F04 B;  4YRE A;  4PJO G;  4MML A;  2CDT A;  2PQW A;  1JEG A;  2DBM A;  3R6O A;  2OAU A;  3ERR A;  2VWF A;  1HC7 A;  4CH4 A;  4FSX A;  4KRT A;  4EMG A;  3PGG A;  4EX5 A;  4J9B A;  2RB6 A;  2RHQ B;  4AG2 C;  4Z88 A;  1X2G A;  1T3L A;  3A5Z B;  3MP1 A;  1BI1 A;  4E6R A;  2YUQ A;  1VIE A;  1QMC A;  1MMN A;  2G6F X;  5FU7 C;  3JCM J;  4CRI A;  5M9O A;  2PU9 B;  4YYE A;  1N9R A;  3EG9 A;  1UGS B;  2DXT A;  1D1B A;  1JJ2 A;  4TTV A;  1D0Z A;  1G8X A;  3M58 A;  4EMK A;  1B7Y A;  4TVW A;  1PRL C;  1G3S A;  3TCJ A;  1UHF A;  3QTC A;  2OAW A;  3P8T A;  2DLP A;  5I2M A;  2ZT8 A;  1OI1 A;  2VAS A;  1UJY A;  3CCQ T;  5GAM e;  3OD1 A;  3DSQ A;  1I0C A;  3H8Z A;  4HCZ A;  5FRN A;  1ATI A;  2I4O A;  1H4Q A;  1BBZ A;  3EG0 A;  4C8Q D;  1VQP A;  1NNH A;  4XQ3 A;  1RL2 A;  2ZNI A;  4RTZ A;  3BY7 A;  2ENM A;  2E5A A;  1KJW A;  1WXT A;  2X4J A;  4D8D A;  2DL3 A;  4M77 D;  1T0H A;  2YDL A;  4XU2 A;  2D0N A;  4O5V A;  2KRM A;  2Y90 A;  1KC8 R;  4K86 A;  2FPD A;  4YRM A;  1P92 A;  4R55 A;  1UE9 A;  2BTT A;  2C0T A;  1Y07 A;  3R07 A;  4LVK A;  2EFI A;  2R5M A;  1WJR A;  2JNG A;  4QQG A;  2XU8 A;  4QVC A;  3GOX A;  4BI4 A;  3RF1 A;  5IH2 A;  3QO8 A;  1H4V B;  1NJI U;  1YFT A;  1S72 T;  2D6F A;  1VQ5 A;  1K0X A;  4FM4 B;  1VQN T;  1R0B G;  2RK1 A;  5GAN 7;  1J3T A;  2EGC A;  2HSE B;  2LT1 A;  4HVW A;  1KG1 A;  4JRI A;  3THK A;  4KGX B;  3CCV Q;  3IKL A;  4H2U A;  2DQ3 A;  4CS3 A;  3VRZ A;  1WIE A;  3CCL A;  2ZZE A;  3QSU A;  4V2S A;  1YFS A;  2FO0 A;  5FRM A;  2LCC A;  4M7A B;  3VUB A;  1NJI C;  3DB4 A;  1YIJ A;  4RKU E;  1QKW A;  1LPL A;  1MMD A;  3CCM A;  1G2B A;  1MNE A;  2G4C A;  2FYK A;  1JBM A;  4B9W A;  1YFR A;  4C8Q A;  2DL4 A;  2V8K A;  2CP7 A;  2CP2 A;  2XDB A;  4H2S A;  3JCM b;  1RLQ C;  4FIB A;  4DOW A;  1SKU B;  2CUB A;  4HVV A;  1VQM Q;  4HCK A;  3BW1 A;  2I4L A;  4M77 A;  2F5T X;  1GL5 A;  3CPW S;  2OTJ T;  4Y91 A;  4LD9 K;  1BKB A;  3RL6 A;  3VKI A;  4D6W A;  1R0C B;  1WLE A;  3JCM P;  1UFF A;  4BE0 A;  1KD1 R;  3REB B;  4C92 D;  4QVZ A;  3CMA A;  1UHC A;  1W1F A;  3J80 E;  2B8A A;  1M5Q 1;  1RLP C;  1YP5 A;  2ARS A;  2ZPF B;  1K9A A;  4DPG A;  1NE8 A;  3HXY A;  1M9S A;  2QK0 A;  2RHS B;  1WXB A;  1QKX A;  4IIM A;  4OML A;  2ZIO A;  5CKH A;  1WZO A;  1VYT A;  2XMF A;  2Z0W A;  1UTI A;  3M59 A;  1GFD A;  1K9M U;  3SWN C;  3M4G A;  3OW2 S;  2KRO A;  2X9H A;  2X3W D;  1FWZ A;  4M78 F;  4YRF A;  2B86 A;  3FRN A;  2HD0 A;  2LX9 A;  3G4S Q;  1G3T A;  2D8H A;  3JCM f;  1YN8 A;  2JVV A;  3OSV A;  4JZ4 A;  4E7K A;  2K3B A;  3M9Q A;  5CIU A;  3OYY A;  4PJJ A;  2LCS A;  1SEM A;  1QVG P;  3CCR A;  3EFO B;  2HSP A;  1M4Z A;  1YBY A;  3IG2 A;  2P4R A;  5CKF A;  4X5O A;  1K9M C;  4JLI A;  1VA7 A;  2ABL A;  2K5I A;  4X9C A;  2DE0 X;  3IAL A;  5I2S A;  1TUD A;  2DKG A;  1BU1 A;  2GFA A;  5C52 B;  3A8H B;  4M75 D;  1KOG A;  4OB0 B;  5GAN g;  3HFN A;  2KEA A;  2XDD A;  3CC2 Q;  4J6Y A;  3CQT A;  1K8A R;  5KYY B;  4TQF A;  4RMF A;  2CUD A;  1RAE B;  3BDL A;  2J6K A;  4C92 A;  2DXU A;  2QDL A;  5GAN 5;  1VQ9 A;  2DJQ A;  2SRC A;  4A4H A;  4O6J A;  4PJM A;  3S3O A;  1J5W A;  4PNO A;  1AOJ A;  2QI2 A;  1VQO A;  3MP6 A;  2HKQ B;  4J9F A;  2JUF A;  5GAM h;  4LNS A;  4P3O A;  3KBG A;  4PJO D;  1OUL A;  2NYS A;  4EPC A;  2C7I A;  1M1K U;  4RTY A;  1BI0 A;  1VQ5 T;  4RTV A;  1WHG A;  3GLX A;  1I5L A;  1X75 C;  1W66 A;  3I55 Q;  4RTW A;  3DKM A;  5I22 A;  1ARK A;  4TVA A;  2FEI A;  4QQD A;  2YT6 A;  3CCL T;  3SB2 A;  4IUU A;  3HFZ A;  1M1K C;  3PZC A;  1NM7 A;  2L0A A;  2DAQ A;  1YIJ T;  1Q95 G;  3S3N A;  1OZ2 A;  3P8Y A;  1CKA A;  1NEB A;  4YRG A;  1WQW A;  3CCM T;  4P74 A;  4WF2 A;  5EC7 A;  1D3B A;  2VXF A;  2QQ9 A;  2LNV A;  3GNG A;  4RCC A;  4P73 A;  1ASZ A;  4M75 A;  2DBK A;  2QTX A;  2YUP A;  2VVK A;  4YRL A;  3LH0 A;  2ROL A;  1Y96 B;  2BZ8 A;  4JPB W;  3NEN A;  5KYN A;  3HRS A;  2X51 A;  3CD6 A;  4X34 A;  1X43 A;  2P0P A;  4KBM B;  2PVG B;  1PHT A;  3QYG B;  4YRK A;  3MPU B;  3TU4 K;  5FRO A;  3PTA A;  2OJ2 A;  3M0Q A;  5GAN 6;  3CMA T;  3RAC A;  5HK0 A;  1BCM A;  2GGR A;  2E5Q A;  2F2W A;  2CP0 A;  4PJO A;  2JTF A;  1Y0M A;  3CCU Q;  1X56 A;  2DIL A;  2KMT A;  1JJ2 S;  1ZBX A;  4XU0 A;  2RJC A;  1OX9 A;  1NLP C;  4XEM A;  3EG3 A;  4ZTZ B;  3IQL A;  2K5F A;  2QYZ A;  3JB9 G;  4MDW A;  2DER A;  3OYM A;  1X2H A;  5LJ3 f;  5GAN 2;  1GGM A;  3E9H A;  1VQL Q;  1AWJ A;  1X6B A;  1UDL A;  4BWA A;  4ANJ A;  2E41 A;  3UAT A;  1KQS P;  2KGT A;  4J9D A;  4YRS A;  3QWX X;  4M7D C;  5GAM g;  4FL6 A;  4BD3 A;  4P72 A;  2LCL A;  3MJX A;  2EVR A;  2DL8 A;  3EFR A;  3CCR T;  1YB3 A;  3I9Q A;  2EJ9 A;  4NOY A;  1YJN A;  1K73 R;  3L2W A;  4HXJ A;  4DOV A;  1USY A;  2V26 A;  2ZIN A;  1DJ7 B;  1LYL A;  1LNX A;  2GBQ A;  3FC3 A;  3R6N A;  1ZSG A;  1WX6 A;  2PTK A;  2EQJ A;  1HJD A;  1KQ1 A;  4HWS A;  3TEH B;  3G6E A;  2MWP A;  5D7U A;  3CC4 A;  4YRO A;  1C6V X;  3CBO A;  1UJ0 A;  2JTE A;  3HRI A;  2NUZ A;  1VQ9 T;  1VQ8 Q;  2O9V A;  3OS2 A;  2VUB A;  2YLC A;  2EPD A;  1M3A A;  2DXC A;  2CZ6 B;  5LJ3 e;  2KVQ G;  2FPE A;  1AWO A;  1VQO T;  2QQB A;  2EYZ A;  3MHX A;  4WI1 A;  2EKH A;  3M56 A;  1YJ9 A;  2QAZ A;  2ZZD A;  4LN2 A;  3GBQ A;  3H0F A;  3RBB B;  2AT1 B;  2LQW A;  3QNE A;  1OU9 A;  4C0Z A;  5C53 B;  1M1G A;  1PRM C;  2E3H A;  2DF6 A;  3OYE A;  3M55 A;  2CH4 W;  2QQS A;  5GAN f;  3A5Y A;  4HWP A;  4FT2 A;  4GBQ A;  4J5Y A;  4LDV A;  1X6G A;  5GAN 4;  2HL5 C;  4NS5 A;  3LYI A;  2A36 A;  2CRE A;  2RQR A;  3CXC P;  4YCU A;  1M1F A;  4C5H A;  4R0K A;  4C8Q F;  4C8Q E;  1QVF P;  4AMC A;  1JRI A;  1AHJ B;  2RO0 A;  3DB3 A;  4RG8 A;  2A28 A;  1ZSZ C;  1EIF A;  4YCV A;  1N5Z A;  3IKM B;  1V29 B;  4OMO A;  2XI9 A;  4H2V A;  3JCM h;  4M7D G;  2KRS A;  2LJ0 A;  4CI0 C;  4P75 A;  4M77 F;  3CD6 T;  3ICA A;  3MKD A;  1UGR B;  2QGF B;  2X35 A;  5KYX A;  2DJZ A;  1QVF A;  5GAO r;  1D1C A;  1VOM A;  4A53 A;  1XOV A;  4FYW B;  3KUF A;  5KE3 A;  1NYQ A;  1W2B A;  1KHI A;  3UT1 A;  4F7U E;  2DA9 A;  4OMM A;  1G3W A;  4JDS A;  1TUG B;  4CH3 A;  5GAO m;  3OS0 A;  3E1S A;  2J3L A;  5GAN e;  2EL9 A;  4JRK A;  3MP8 A;  3J81 E;  1Q86 C;  2C0O A;  1B7T A;  2MWO A;  3VQV A;  2E64 A;  12AS A;  1YWP A;  3UWN A;  3HXZ A;  1MUZ A;  4A4E A;  2FZK B;  3TSZ A;  1YJW Q;  4YRT A;  1JQQ A;  4LNP A;  2DM1 A;  1GBQ A;  1N8R R;  3CBP A;  2EJG A;  3JSC A;  1QWF A;  2DTH A;  2K5L A;  1YI2 T;  4H2T A;  4WTO B;  3JB9 J;  2VXE A;  5HKC A;  1KC8 U;  4YRP A;  2CJA A;  4CS2 A;  1I1J A;  1ZLM A;  5A2Q E;  3OY9 A;  4N0A C;  2ODR C;  4RDX A;  3L2R A;  5CAI A;  4P71 C;  1YJN T;  3E2U A;  5DY9 A;  4YCW A;  1SSH A;  2EJF A;  2RQW A;  4TVR A;  3RER A;  5FW9 A;  4KUL A;  1IHV A;  2CP3 A;  2RHY A;  1X55 A;  1LOJ A;  3MEW A;  3PCO B;  1KC8 C;  2ZPB B;  5LJ5 d;  4J7F A;  4KR2 A;  3G6E T;  5FU6 B;  1VQ6 A;  3CC4 T;  1SG5 A;  1OPK A;  2CKK A;  3OMC A;  4OMP A;  3P8B B;  4C92 F;  2XIC A;  4GY5 A;  1R8O B;  4A4K A;  4XU1 A;  3CCQ Q;  3QO3 A;  2FG0 A;  3QDR B;  2ZAE A;  1EVL A;  1GXI E;  1W70 A;  1TTH B;  4N4H A;  3JCM g;  2KAF A;  1ZUU A;  3QO5 A;  1E6H A;  1YJ9 T;  1QVP A;  4J6X A;  1OX8 A;  1QCF A;  4II1 A;  3OBY A;  3QJ6 A;  2BZX A;  3P8H A;  1NEG A;  1BBW A;  3GPL A;  1K1Z A;  1HYO A;  4HWT A;  1PYS B;  1MMG A;  2JJ9 A;  1WHL A;  1AD5 A;  1OYX A;  4KH0 B;  3HTZ A;  2ZCF B;  3UF4 A;  2CS7 A;  1MND A;  4YRR A;  2A3L A;  2DPP B;  2Q7E A;  3JB9 D;  4Q5W A;  2J6F A;  3UDC A;  1TU0 B;  1I07 A;  1KD1 U;  2ZPE B;  1SET A;  2IG0 A;  1T0J A;  5LJ3 h;  4YP0 A;  1S72 Q;  3OYH A;  4J7I A;  2LQK A;  4PFZ A;  4CC2 A;  1EQR A;  3KFU A;  2NUP A;  2EIF A;  4LDU A;  1YIT A;  2XG8 D;  1Q86 R;  2EAY A;  3H6Z A;  4P5N A;  4M75 F;  4M75 E;  1VQN Q;  2P0L A;  1OPL A;  4PFP A;  3SWN A;  1H92 A;  1M3B A;  1U3O A;  2V8I A;  3EGU A;  2DMO A;  4E7I A;  4FYX B;  4LVL A;  3M0U A;  2QA4 A;  1KD1 C;  3CCV A;  2DXB A;  4J8O A;  5KCH A;  3EG9 B;  3TVT A;  3NMZ C;  3X28 B;  4EMK B;  1B7Y B;  1O75 A;  1BI3 A;  1RI0 A;  3GNF B;  4G85 A;  5GMK m;  4CC3 A;  2A37 A;  1Y7X A;  2AKL A;  4DBH A;  1NJ5 A;  3CCE Q;  4PJL A;  4PJO F;  4HWR A;  3OBW A;  1B34 A;  2V1R A;  1K4U S;  2XTI A;  4AT1 B;  2VGN A;  2JTM A;  3QYH B;  2CP5 A;  4ZTU B;  2K6D A;  1YGB A;  4EDU A;  2XGT A;  2ZPH B;  2Q7G A;  5A0G A;  5CCA A;  2DYI A;  1VQM A;  2E70 A;  4BY6 B;  3CEY A;  1NYF A;  2OTJ Q;  3HXU A;  2HQH A;  4A4G A;  2E6N A;  3RUX A;  3VRY A;  4DA4 A;  3VV0 A;  1VQK A;  1H64 1;  2MK5 A;  3EGD A;  2LQN A;  2R57 A;  3HRU A;  1K8A U;  2I4N A;  3D7S B;  1WNL A;  2I2L A;  2JN0 A;  1G5I A;  1IRE B;  1RAF B;  2HQE A;  2JOY A;  1HD3 A;  3QXE B;  1UGQ B;  1M8V A;  2F5K A;  2RM4 A;  4B9X A;  2K2V A;  3BJU A;  2ZPG B;  1IO6 A;  1JB0 E;  3CBM A;  2KR3 A;  3X26 B;  1YHQ A;  1EIY B;  1QWE A;  1K8A C;  4C0G A;  5GAN h;  1UUE A;  2YLB A;  3ZBD A;  1OZ3 A;  4BAC A;  3FLG A;  3OYD A;  4KUI A;  4TWA A;  3QBY A;  4AH6 A;  4N4G A;  2KDS A;  5FU6 C;  2NLU A;  3EG2 A;  3CC7 A;  3EHR A;  1VQ6 T;  1X54 A;  4M7D D;  2EGA A;  4J15 A;  2ZXF A;  4IUT A;  4E51 A;  5LJ3 g;  3CME A;  5GJW B;  2KT1 A;  4UPA A;  2RMO A;  1UEC A;  2DVE A;  1QE0 A;  1WLP B;  3BE3 A;  3A8L B;  2A8E A;  1BK2 A;  4DBR A;  3UGT A;  3WVE B;  3QWY A;  4OF1 A;  1H3H A;  1Z7N A;  1XQH A;  4WJ3 M;  3FJ5 A;  4C8Q B;  3A8G B;  3O8V A;  2GTO A;  1BI2 A;  2IY5 A;  3BDU A;  2P0K A;  3OYB A;  1BCO A;  1GRI A;  2MOX A;  2QDY B;  4DQ2 A;  3CC2 A;  4OMN A;  4RTX A;  3E9G A;  4M77 B;  1MHN A;  4IUP A;  4K88 A;  1GCQ C;  2KQW A;  2M16 A;  4JLG A;  2ZT7 A;  4HT8 A;  3RMQ A;  1Q81 R;  2E6Z A;  2DZ9 A;  1KIK A;  2LNH B;  3MF1 A;  2BE9 B;  1I8F A;  3RKW A;  1Z9Q A;  5HCK A;  3SDZ A;  4F7U B;  1WQ7 A;  2BZY A;  2RHS A;  3AHU A;  1D1A A;  1G5H A;  1UB4 A;  2ECZ A;  5GAM j;  1L0W A;  1SER A;  5LL6 S;  1YIT T;  1QVF S;  1U8R A;  1QLY A;  4M78 E;  3L42 A;  3V7R A;  1H4S A;  3I56 Q;  3I55 A;  2EQM A;  2KRN A;  2QGG A;  2DD4 A;  2PZ1 A;  3JB9 I;  1SSF A;  2QAS A;  4PLL A;  3ZEH A;  2QA4 T;  1UGP B;  2DVJ A;  2LJ1 A;  2RJF A;  3CCV T;  1W2B S;  2Q5I A;  4L87 A;  2DRK A;  4XK8 E;  2H3J A;  4UC4 A;  4M7D A;  4BE1 A;  1PD1 A;  3ZL7 C;  2AKW A;  4PFO A;  5LJ5 f;  3F70 A;  3V8L A;  2DIQ A;  1YIJ Q;  3HXW A;  4HCB A;  4KR3 A;  2EBP A;  3VS7 A;  5EG2 A;  4LVI A;  3EFO A;  3X20 B;  5GAO n;  1VQP T;  1BBU A;  3CCM Q;  1HK9 A;  4XTW A;  4C5E A;  4E7J A;  1M90 R;  2QEX Q;  5D6Y A;  1V76 A;  1QVG A;  1KFZ A;  2IIM A;  1JU5 C;  4QT7 A;  4ZGE B;  1K73 U;  5GAO l;  4RUG A;  4OLF A;  4KQE A;  5D6W A;  4BY6 C;  4P3P A;  2LC4 A;  2AKK A;  3OQ5 A;  1VQK T;  2OTL A;  1I81 A;  5CVI A;  3M5A A;  4ZGD B;  4C92 B;  3A8M B;  1TH7 A;  2RF0 A;  2ART A;  4JUV A;  3CMA Q;  2FPF A;  1K73 C;  1ASY A;  3QZ5 B;  2RJD A;  3JCM e;  1RAG B;  2QHS A;  4RTT A;  4IIO A;  1AZE A;  1G3Y A;  1N6A A;  1QCO A;  2C06 A;  1YFN A;  2KXD A;  1VQ4 A;  2M0Y A;  1RUW A;  5CQX A;  5C6S A;  4DBQ A;  3V7S A;  4XTU A;  4XTX A;  1YHQ T;  2BIV A;  4K11 A;  1X69 A;  1BIB A;  3P8D A;  4M7A C;  2ZZF A;  2ARU A;  4FU6 A;  4KUD K;  2YWW A;  2DO3 A;  3CCJ A;  4TVA B;  1N27 A;  4Y28 E;  2CP6 A;  1TXQ A;  3EH2 A;  4OP0 A;  1NJ6 A;  4FSS A;  3CC7 T;  1EX4 A;  3CMQ A;  5I21 A;  1OOT A;  2D9T A;  3HFZ B;  7AT1 B;  3MEV A;  3CME T;  1IL2 A;  1PKT A;  1VUB A;  2QXF A;  3CCR Q;  2K4Y A;  2ODR D;  3ULR B;  1SRM A;  1TOV A;  4J6W A;  1ZSZ A;  1IXD A;  1NLO C;  4X9D A;  3Q1J A;  1R77 A;  3PMI A;  1D3B B;  4LVJ A;  1MMA A;  2CZ0 B;  3NHN A;  2KSS A;  4HA8 A;  3KXT A;  4M75 B;  5J26 A;  4A63 B;  4RQE A;  2AZV A;  1Y57 A;  2GFU A;  3M53 A;  2K79 A;  1BYM A;  3MCA B;  4PG3 A;  1D09 B;  1HXD A;  2MAM A;  2EQK A;  1XJW B;  2L5Q A;  1WI7 A;  3QG1 A;  1K76 A;  2CIM A;  2O31 A;  5A0L A;  1VQ9 Q;  4GLK A;  4EIK A;  1VQ8 A;  4F14 A;  4LD6 A;  1NJ1 A;  2LP5 A;  3M4Y A;  2Y4X A;  2EW3 A;  1JXM A;  1OEB A;  1VQO Q;  1M2V A;  1G83 A;  2ZT5 A;  2K57 A;  3JB9 H;  2RJE A;  1RAA B;  3JV3 A;  4PJO B;  1RAH B;  5IHN A;  4ATO A;  5GAM d;  3RR6 A;  3UA6 A;  3JRZ A;  1SHF A;  3U23 A;  1TUC A;  1C1A A;  3M0T A;  1E1O A;  4Z8A A;  3I55 T;  4JRQ A;  2GF7 A;  2EKO A;  4B6M A;  1Z9Z A;  4L5G A;  4C0F A;  1M2O A;  1YWO A;  1QF6 A;  4WCI A;  1VQ7 A;  3UPU A;  1IGU A;  3L2U A;  2V8J A;  2HZY A;  4YRI A;  2EYQ A;  1N8R U;  4NCX A;  1TWB A;  3QHS A;  3RNJ A;  4N0A A;  2L2P A;  3L2Z A;  3TEG A;  1KQS A;  4UP8 A;  3OS5 A;  5IXF A;  5HK3 A;  4M7A G;  2EQU A;  5GMK l;  2KE9 A;  3REA B;  2DZC A;  2OI3 A;  2CT3 A;  3LC0 A;  1UG1 A;  1Q7Y R;  2O88 A;  3G71 A;  2M1H A;  5CKD A;  2ZCE A;  1VYU A;  1MGQ A;  2DNU A;  4NL3 A;  3OMG A;  1YCS B;  2RPN A;  3A7U A;  4OMQ A;  1N8R C;  5FLX E;  3T9N A;  3INZ A;  2WSC E;  3PE0 A;  4AG1 C;  4QVD A;  5GMK i;  4JJN K;  2YRV A;  3A74 A;  3EGX A;  2OTL T;  4OGE A;  1V1C A;  4BDZ A;  5D6X A;  1E7O A;  2W0Z A;  3SFM A;  2P0Q A;  2RHU A;  3JB9 F;  2COZ A;  1FX7 A;  4KH1 B;  4ELZ C;  4DEY A;  2HBP A;  3CCS A;  3LGF A;  2GQV A;  9ATC B;  1IHW A;  4UP7 A;  5AYF A;  1VQ4 T;  1M3C A;  1XNI A;  2HDA A;  4FW2 A;  2ZR3 A;  2AMC A;  2LDM A;  1SES A;  5FWC A;  2ED1 A;  3CPW P;  2RHI A;  4D8K A;  1PM3 A;  2DD5 A;  2KK4 A;  2KXC A;  1CSK A;  2VYT A;  3ASK A;  5E3I A;  4JS4 A;  1YJW A;  2GQI A;  3OYF A;  5KYW A;  1AZG B;  4F7U G;  3CCJ T;  1NJ8 A;  1ZUY A;  1YI2 Q;  4E47 A;  4BI3 A;  1AVZ C;  3A7A A;  5I11 A;  2M9U A;  3L4G A;  2EQI A;  5CO7 A;  4HCC A;  3H0I A;  3JCM c;  4ZIB A;  2MYS A;  2ZR2 A;  1H3Z A;  2X4Y A;  2DEU A;  2XHC A;  2P84 A;  3C0C A;  3HY1 A;  2LMJ A;  2YRC A;  4M77 E;  3RIR A;  2O4X A;  3CXC A;  1SHG A;  1B70 A;  4DEX A;  4M78 B;  3HP9 A;  3OYI A;  1WU7 A;  1RAB B;  3LGL A;  3PIO A;  1Q86 U;  5J39 A;  4BUG A;  1IGQ A;  3G6E Q;  2F2V A;  3N5B B;  3CC4 Q;  5KYX B;  2XDP A;  3VUZ A;  1GFC A;  2J3M A;  2CGH A;  1VQ8 T;  3HKS A;  4LDX A;  4K87 A;  3DLM A;  3EHQ A;  2RD1 A;  3MEU A;  1YJ9 Q;  2HKN A;  4JJD A;  4H2X A;  5HGQ A;  2QQA A;  2RA2 A;  3JCM W;  2DL5 A;  3NEL A;  4H02 A;  3I5R A;  3OB9 A;  4H2Y A;  1M8M A;  1RAD B;  1M30 A;  2DQ0 A;  3NTK A;  5DM7 R;  1SPK A;  4JJB A;  4E2F B;  3PVQ A;  2L3S A;  1QVG S;  1VQ7 T;  4M7D F;  4YRN A;  4NL2 A;  1N9S A;  1Q82 R;  2XD0 A;  2ALY A;  4DBF A;  1NZ9 A;  3NPF A;  5KYU B;  1B76 A;  2YRD A;  5KH6 A;  4AFZ C;  3HFV A;  5LJ3 j;  1C0M A;  1WHH A;  1NYR A;  3G71 T;  2NUT A;  2QHT A;  2HBW A;  4IUV A;  3G1Z A;  5GAO p;  4EMH A;  3OA6 A;  4C92 E;  2FZG B;  4PK4 A;  1S1N A;  2VB6 A;  4IUQ A;  2HL3 A;  1D0X A;  1JJC A;  4OB3 B;  2PUK B;  4L59 A;  1FMW A;  4YRJ A;  3MET A;  4RMO A;  2EGE A;  1OU8 A;  2LZ6 B;  2M02 A;  2DL7 A;  1CKB A;  3CCS T;  4F16 A;  3CCE A;  5KNN A;  2DTO A;  2O2O A;  3KFV A;  5LJ5 g;  1C0A A;  1RI9 A;  3GF5 A;  3QUI A;  4XTV A;  5K1P A;  1PSF A;  2M51 A;  3VS1 A;  3VS6 A;  3BFM A;  2ED0 A;  4XU3 A;  3OYK A;  3HFO A;  1GCQ A;  2AIR B;  3VS0 A;  2RI2 A;  2YSQ A;  2E3I A;  4KGZ B;  2RHQ A;  1ABQ A;  3URG A;  2Q7H A;  4YRC A;  4LVM A;  4C5G A;  2DIG A;  3A5Z A;  4WJ4 A;  2F69 A;  3NFC A;  4A4F A;  3JCM X;  2MMP A;  4FCY A;  1Q81 U;  5IT9 E;  4MZT A;  1JJ2 P;  4Z02 A;  3VQY A;  3OS1 A;  3OYN A;  4PJN A;  4FYV B;  4MZP A;  2NUP B;  3PIP A;  3O5Z A;  3M4P A;  4EO4 A;  2PNI A;  4F17 A;  2JS2 A;  4CC7 A;  1NYG A;  1U5S A;  5KCO A;  4M78 C;  2YHT A;  3SWN B;  4QKU A;  5GAN j;  4M7A D;  2WAC A;  2VV5 A;  1H8K A;  3VS3 A;  2CZ7 B;  1Q81 C;  4P75 C;  2RQV A;  1WJQ A;  1I4K 1;  3M57 A;  1VQ6 Q;  3SHW A;  3NTH A;  2K7A A;  2CJB A;  4PJO E;  4OMF B;  2LQ8 A;  1XTD A;  3VYH B;  3LX7 A;  2DET A;  2L3R A;  3VQW A;  1G51 A;  2C8M A;  4XTZ A;  3TSW A;  4OB1 B;  4YRQ A;  2X4W A;  1WPY A;  3OYC A;  1B34 B;  1M90 U;  1ACM B;  1X2K A;  4HT4 A;  2MCN A;  5GMK e;  2FL7 A;  1WHM A;  2E4H A;  5CR2 A;  2P4T A;  1PCX A;  1VQZ A;  3MF2 A;  4BB7 A;  2DTI A;  2VKN A;  4X1V A;  1F1B B;  3S6W A;  2AHJ B;  2KYM A;  3VS4 A;  4JRP A;  1KQS S;  2YUN A;  1X2Q A;  5DLO A;  4E7H A;  1LJO A;  3A7R A;  3MEY A;  3EGD B;  3MQZ A;  4Z89 A;  1W6X A;  2GTJ A;  2QHU A;  2EWN A;  3DLL A;  1M90 C;  3UA7 A;  4YTL A;  1QQJ A;  5L8R E;  5ELO A;  2DK3 A;  8AT1 B;  3QII A;  2COW A;  3JCM V;  1ZHI A;  2LX7 A;  4ELY C;  4J9C A;  3ER0 A;  2CH4 A;  4MMK A;  1UEB A;  5LJ3 d;  1EIY A;  1YIT Q;  3TQ7 P;  3FIF A;  2E3C A;  3QJY A;  3I56 A;  4M7A A;  3G4S A;  1EZZ B;  4LE9 A;  1SRL A;  4AFQ C;  2QA4 Q;  1T3S A;  2L3P A;  3RES A;  1NG2 A;  2MF2 A;  1PG5 B;  3ME9 A;  2RHX A;  3VJP A;  1EOV A;  2CSQ A;  3HRK A;  3W3S A;  1Z7M A;  4P3N A;  3A98 A;  2IPO B;  3M4Q A;  2RN8 A;  1VQP Q;  3RKX A;  2DYB A;  3I5S A;  4M78 G;  3OYG A;  2WSE E;  2SEM A;  5C51 B;  4FYY B;  3CCE T;  2QEX A;  1WYD A;  2DDZ A;  2KYB A;  3NGP A;  4XTY A;  1ZA1 B;  1ADJ A;  1B3Q A;  3JAM E;  2F2X A;  2HAX A;  1MV3 A;  2RH2 A;  4FW1 A;  3C4S A;  3NET A;  2IY5 B;  1U06 A;  1AEY A;  2BUD A;  3RKY A;  2BKD N;  4KT0 E;  4IKF A;  1VQK Q;  3OYA A;  2D0Q B;  2E10 A;  3TRE A;  1SF9 A;  4KGV B;  3VBB A;  2YUO A;  3PMT A;  3TEE A;  1PWT A;  1ZUK A;  2MPX C;  3H41 A;  3CXC S;  1ADY A;  1LVK A;  1FYN A;  3V8J A;  1VQ5 Q;  2JW4 A;  4RG2 A;  4F7U A;  1KMN A;  5GAN 8;  3QPH A;  1IRX A;  4ZNX A;  4RCB A;  4LXC A;  4E7L A;  3P8V A;  2J06 A;  1YHQ Q;  2J6O A;  2DU7 A;  1TG0 A;  4CH6 A;  3CCL Q;  3LSQ A;  5GAN d;  5DLQ E;  4EMK C;  3EH1 A;  1RAC B;  2Q5H A;  1G5V A;  1KHC A;  5GAO q;  4O2D A;  4J9E A;  3CC7 Q;  4N4I A;  4M7D B;  2AKW B;  4MZM A;  5GMK j;  2HCK A;  3CME Q;  1N9W A;  2RI3 A;  2L3Q A;  1X27 A;  2EYX A;  3L2V A;  3VQX A;  3OYJ A;  3L2Q A;  1VQM T;  3VYG A;  5KYY A;  4Q6G A;  2D1X A;  2M0O A;  2XKO C;  4ME7 A;  5CKE A;  1E1T A;  2K2M A;  3E9I A;  1Q7Y U;  1IZ6 A;  2A08 A;  4LDW A;  2ZTG A;  1WHK A;  2E1H A;  2XK0 A;  3SD4 A;  2RHZ A;  3AT1 B;  1NJI R;  3M0R A;  2ZT6 A;  4Q15 A;  4HKE A;  3CCU A;  2QHV A;  2PME A;  3OYL A;  3JCM Q;  2V1Q A;  4RQF A;  2W10 A;  3PVL A;  5LJ5 e;  1NBE B;  3VS2 A;  1QP3 A;  3UGQ A;  3FJP A;  3V7C A;  2PMF A;  1PD0 A;  1Q7Y C;  3WQZ A;  2FRW A;  2P5I A;  1GBR A;  2A0F B;  2I0N A;  4J9I A;  3LLR A;  4A54 A;  1WDX A;  1ZX6 A;  4MDX A;  1VQL A;  5AT1 B;  1X6O A;  1PSE A;  4FT4 A;  3A31 A;  4GLM A;  3M0S A;  3I56 T;  3G4S T;  5GMK h;  3HSB A;  2MIO A;  3V8K A;  1WFW A;  3FEO A;  2R5A A;  3VS5 A;  3UFG A;  4JZ3 A;  3MEA A;  3RMS A;  4C5I A;  3H0H A;  1KK7 A;  3WXM B;  1BB9 A;  3EFS A;  1I5O B;  4J9H A;  2PUO B;  2R58 A;  1B07 A;  4HVU A;  3J7A F;  1ZA2 B;  1ABO A;  4C8Q C;  4TQD A;  1Y96 A;  2AK5 A;  2A7Y A;  4OB2 B;  4XEO A;  2H8H A;  1OV3 A;  2DX1 A;  4AFU C;  4ZGJ B;  2QEX T;  2KNB B;  4LUE A;  4L6V 5;  2LTO A;  1ZSZ B;  3CC2 T;  3REU A;  3FDR A;  4M77 C;  2K3X A;  4R56 A;  1BIA A;  2FB7 A;  1WYX A;  2COY A;  1EFW A;  1PNJ A;  3HHT B;  2RK2 A;  2JS0 A;  1A0N B;  2OTL Q;  1YCY A;  2RI5 A;  1NJ2 A;  1VYV A;  2OX7 A;  2RQU A;  1JXO A;  5GJV B;  3FB9 A;  3MO8 A;  3C95 A;  3L1A A;  5IHI A;  1K9M R;  3HPW A;  1WXU A;  1M2V B;  3EAE A;  3LH5 A;  4JJC A;  1FYF A;  1VQ4 Q;  4IUR A;  4H2W A;  2ZPI B;  4TVY A;  3A32 A;  2YXY A;  4E7S A;  2NWM A;  3H9N A;  1ZQ1 A;  2J7I A;  2K9G A;  5IN1 A;  2JZ2 A;  2QG9 B;  1W4S A;  1WJS A;  3ZFJ A;  3CCJ Q;  2JXB A;  4OVA A;  3GP8 A;  1LCK A;  4P71 A;  6AT1 B;  1YI2 A;  4ZTJ A;  3OSS C;  3M0P A;  4YDQ A;  3X25 B;  2CYZ B;  4BE2 A;  3LSS A;  2O01 E;  2DEQ A;  1Q82 U;  2GNC A;  3CD6 Q;  2I4M A; 
#chains in the Genus database with same CATH homology
 1KMM A;  3TEH A;  2K3Y A;  2ZNJ A;  4M78 D;  3I7F A;  2VC8 A;  2E12 A;  4QW2 A;  4PKC C;  4C8Q G;  4C92 C;  5LJ5 j;  3PFS A;  1HTT A;  2DU5 A;  3TUP A;  4C0D B;  1NPP A;  1Q82 C;  4J83 A;  1WGS A;  2IVW A;  3CCU T;  4M77 G;  3UH0 A;  2L8D A;  3PNW C;  1B8A A;  4CS4 A;  5K1X A;  3WVD B;  3QKJ A;  2ZGW A;  5CKB A;  1VQL T;  1U1S A;  2AMC B;  4M7A F;  4M7A E;  4PL6 A;  3LWH A;  3HXV A;  4G84 A;  5KE2 A;  3HL8 A;  2LT4 A;  3CPW A;  1EVK A;  2GCX A;  1E22 A;  4BI8 B;  4JS5 A;  2LRQ A;  2HQX A;  3CPF A;  3C12 A;  4P74 C;  5J3B A;  4UP9 A;  3L4G B;  3E19 A;  3S3M A;  5FU7 B;  1E24 A;  2PVO B;  4P73 C;  3QZ9 B;  4M75 C;  4ZN3 A;  4LDY A;  5LJ5 h;  1H4T A;  2MI6 A;  5CQY A;  3RGL A;  4M78 A;  3NTI A;  2O4X B;  1B70 B;  3E9F A;  3PT9 A;  3A8O B;  2Y4Y A;  2FHD A;  3CCQ A;  2CZ1 B;  4QQ6 A;  3OW2 A;  4XAX B;  5ELN A;  11AS A;  1QW1 A;  4PJO C;  1NPR A;  4F7U F;  3VU3 C;  4C92 G;  1O9S A;  3GIB A;  5F5W A;  1SRY A;  4H2X B;  2ZZG A;  1QP2 A;  2QQR A;  5C0M A;  2VGM A;  4M7D E;  2CJ9 A;  4ZTF A;  5CK9 A;  4VUB A;  2G3R A;  4PHC A;  2HNI A;  2LVM A;  3M54 A;  4BW9 A;  3C94 A;  4P72 C;  4HT9 A;  1S72 A;  3X24 B;  5GAN 3;  4HVC A;  2FVU A;  1USY C;  1VQN A;  5IAY A;  2WSF E;  3QO7 A;  2ALY B;  3LW5 E;  3PCO A;  1X01 A;  3LWI A;  4YPF A;  3JCM d;  2KY9 A;  1RIQ A;  1VIF A;  3G7Z A;  2PVD B;  1KQ2 A;  2ZIM A;  3HY0 A;  4CH5 A;  2NS6 A;  4HWO A;  4PLI A;  4BDY A;  3NEM A;  3HRT A;  1FXX A;  3HXX A;  4M75 G;  1JJC B;  2L89 A;  5A0D A;  2X4X A;  4C0D C;  1Y71 A;  5HY6 A;  2E65 A;  1U1T A;  4OGC A;  1PYS A;  2OTJ A;  5GAM f;  3REX A;  4ZN1 A;  1YJW T;  2XID A;  4YRE A;  4PJO G;  4MML A;  2PQW A;  3R6O A;  2OAU A;  3ERR A;  1HC7 A;  4CH4 A;  4FSX A;  4EMG A;  3PGG A;  4EX5 A;  2RB6 A;  2RHQ B;  1X2G A;  3A5Z B;  3MP1 A;  1BI1 A;  5FU7 C;  1VIE A;  3JCM J;  4CRI A;  5M9O A;  2PU9 B;  4YYE A;  1N9R A;  1UGS B;  2DXT A;  4TTV A;  1JJ2 A;  3M58 A;  4EMK A;  1B7Y A;  4TVW A;  1G3S A;  3TCJ A;  3QTC A;  3P8T A;  5I2M A;  2ZT8 A;  1OI1 A;  3CCQ T;  5GAM e;  3OD1 A;  3DSQ A;  3H8Z A;  4HCZ A;  5FRN A;  1ATI A;  2I4O A;  1H4Q A;  4C8Q D;  1VQP A;  1NNH A;  4XQ3 A;  1RL2 A;  2ZNI A;  3BY7 A;  2E5A A;  2X4J A;  4M77 D;  4XU2 A;  4O5V A;  2Y90 A;  4K86 A;  4YRM A;  1P92 A;  4R55 A;  1Y07 A;  3R07 A;  4LVK A;  2EFI A;  2R5M A;  1WJR A;  2JNG A;  4QQG A;  2XU8 A;  4QVC A;  3GOX A;  4BI4 A;  3RF1 A;  3QO8 A;  1H4V B;  1NJI U;  1YFT A;  1S72 T;  2D6F A;  1VQ5 A;  4FM4 B;  1VQN T;  2RK1 A;  5GAN 7;  2LT1 A;  1KG1 A;  4JRI A;  3IKL A;  4H2U A;  2DQ3 A;  4CS3 A;  3CCL A;  2ZZE A;  3QSU A;  4V2S A;  1YFS A;  5FRM A;  2LCC A;  4M7A B;  3VUB A;  1NJI C;  3DB4 A;  1YIJ A;  4RKU E;  3CCM A;  2G4C A;  2FYK A;  1JBM A;  4B9W A;  1YFR A;  4C8Q A;  2V8K A;  2XDB A;  4H2S A;  3JCM b;  4FIB A;  4DOW A;  3BW1 A;  2I4L A;  4M77 A;  2F5T X;  3CPW S;  2OTJ T;  4Y91 A;  4LD9 K;  1BKB A;  3RL6 A;  3VKI A;  4D6W A;  1WLE A;  3JCM P;  4BE0 A;  4C92 D;  4QVZ A;  3CMA A;  3J80 E;  2B8A A;  1M5Q 1;  2ARS A;  2ZPF B;  4DPG A;  1NE8 A;  3HXY A;  1M9S A;  2RHS B;  2ZIO A;  5CKH A;  3M59 A;  1K9M U;  3SWN C;  3M4G A;  3OW2 S;  1FWZ A;  4M78 F;  4YRF A;  3FRN A;  2HD0 A;  2LX9 A;  1G3T A;  3JCM f;  2JVV A;  3OSV A;  4E7K A;  3M9Q A;  5CIU A;  3OYY A;  3CCR A;  1M4Z A;  1YBY A;  3IG2 A;  5CKF A;  4X5O A;  1K9M C;  4JLI A;  2K5I A;  4X9C A;  3IAL A;  5I2S A;  2DKG A;  2GFA A;  5C52 B;  3A8H B;  4M75 D;  1KOG A;  4OB0 B;  5GAN g;  3HFN A;  2XDD A;  4J6Y A;  4TQF A;  4RMF A;  3BDL A;  4C92 A;  2DXU A;  5GAN 5;  1VQ9 A;  4A4H A;  4O6J A;  3S3O A;  1J5W A;  4PNO A;  2QI2 A;  1VQO A;  3MP6 A;  2JUF A;  5GAM h;  4LNS A;  4P3O A;  3KBG A;  4PJO D;  2C7I A;  4EPC A;  1M1K U;  1BI0 A;  1VQ5 T;  3GLX A;  1I5L A;  1X75 C;  1W66 A;  3DKM A;  4TVA A;  4QQD A;  3CCL T;  3SB2 A;  4IUU A;  3HFZ A;  1M1K C;  3PZC A;  1YIJ T;  2DAQ A;  3S3N A;  1OZ2 A;  3P8Y A;  4YRG A;  1WQW A;  3CCM T;  4P74 A;  4WF2 A;  1D3B A;  2VXF A;  2QQ9 A;  2LNV A;  3GNG A;  4RCC A;  4P73 A;  1ASZ A;  4M75 A;  2QTX A;  4YRL A;  3LH0 A;  1Y96 B;  3NEN A;  3CD6 A;  3HRS A;  4X34 A;  2P0P A;  4KBM B;  2PVG B;  3QYG B;  4YRK A;  3TU4 K;  5FRO A;  3PTA A;  5GAN 6;  3CMA T;  3RAC A;  5HK0 A;  2E5Q A;  4PJO A;  2JTF A;  1X56 A;  1JJ2 S;  2KMT A;  1ZBX A;  4XU0 A;  2RJC A;  4XEM A;  4ZTZ B;  2K5F A;  3JB9 G;  4MDW A;  3OYM A;  1X2H A;  5LJ3 f;  5GAN 2;  1GGM A;  3E9H A;  4BWA A;  2E41 A;  4YRS A;  4M7D C;  5GAM g;  4FL6 A;  4BD3 A;  4P72 A;  2LCL A;  3CCR T;  3EFR A;  1YB3 A;  2EJ9 A;  4NOY A;  1YJN A;  3L2W A;  4DOV A;  1USY A;  2ZIN A;  1DJ7 B;  1LYL A;  1LNX A;  3FC3 A;  2EQJ A;  1KQ1 A;  4HWS A;  3TEH B;  3G6E A;  2MWP A;  3CC4 A;  4YRO A;  3CBO A;  3HRI A;  1VQ9 T;  3OS2 A;  2VUB A;  2YLC A;  2DXC A;  2CZ6 B;  5LJ3 e;  2KVQ G;  1VQO T;  2QQB A;  3MHX A;  4WI1 A;  3M56 A;  1YJ9 A;  2ZZD A;  3QNE A;  4C0Z A;  5C53 B;  1M1G A;  3OYE A;  3M55 A;  2QQS A;  5GAN f;  3A5Y A;  4HWP A;  4FT2 A;  4LDV A;  4J5Y A;  5GAN 4;  4NS5 A;  3LYI A;  4YCU A;  1M1F A;  4C5H A;  4C8Q F;  4C8Q E;  1JRI A;  1AHJ B;  2RO0 A;  3DB3 A;  4RG8 A;  1EIF A;  4YCV A;  3IKM B;  1V29 B;  2XI9 A;  4H2V A;  3JCM h;  4M7D G;  4CI0 C;  4P75 A;  4M77 F;  3CD6 T;  3ICA A;  1UGR B;  2X35 A;  2DJZ A;  1QVF A;  5GAO r;  4A53 A;  1XOV A;  3KUF A;  5KE3 A;  1NYQ A;  1W2B A;  1KHI A;  3UT1 A;  4F7U E;  1G3W A;  4JDS A;  4CH3 A;  5GAO m;  3OS0 A;  3E1S A;  2J3L A;  5GAN e;  2EL9 A;  4JRK A;  3MP8 A;  3J81 E;  1Q86 C;  2MWO A;  3VQV A;  2E64 A;  12AS A;  3UWN A;  3HXZ A;  4A4E A;  4YRT A;  3CBP A;  2EJG A;  3JSC A;  2DTH A;  2K5L A;  1YI2 T;  4H2T A;  3JB9 J;  2VXE A;  5HKC A;  1KC8 U;  4YRP A;  2CJA A;  4CS2 A;  3OY9 A;  5A2Q E;  2ODR C;  4RDX A;  4N0A C;  3L2R A;  5CAI A;  4P71 C;  1YJN T;  5DY9 A;  4YCW A;  2EJF A;  4TVR A;  3RER A;  4KUL A;  2RHY A;  1X55 A;  1LOJ A;  3MEW A;  3PCO B;  1KC8 C;  2ZPB B;  5LJ5 d;  4J7F A;  4KR2 A;  3G6E T;  5FU6 B;  1VQ6 A;  3CC4 T;  2CKK A;  3OMC A;  3P8B B;  4C92 F;  2XIC A;  4GY5 A;  1R8O B;  4A4K A;  4XU1 A;  3QO3 A;  3QDR B;  1EVL A;  1GXI E;  4N4H A;  3JCM g;  2KAF A;  3QO5 A;  1YJ9 T;  1QVP A;  4J6X A;  4II1 A;  3OBY A;  3QJ6 A;  3P8H A;  1BBW A;  3GPL A;  4HWT A;  1PYS B;  3HTZ A;  1OYX A;  2ZCF B;  2CS7 A;  4YRR A;  2A3L A;  2DPP B;  2Q7E A;  3JB9 D;  4Q5W A;  3UDC A;  1KD1 U;  2ZPE B;  1SET A;  2IG0 A;  5LJ3 h;  4YP0 A;  3OYH A;  4J7I A;  2LQK A;  1EQR A;  3KFU A;  2EIF A;  4LDU A;  1YIT A;  2XG8 D;  2EAY A;  3H6Z A;  4P5N A;  4M75 F;  4M75 E;  2P0L A;  3SWN A;  2V8I A;  4E7I A;  4LVL A;  2QA4 A;  1KD1 C;  3CCV A;  2DXB A;  4J8O A;  5KCH A;  3X28 B;  4EMK B;  1B7Y B;  1O75 A;  1BI3 A;  1RI0 A;  3GNF B;  4G85 A;  5GMK m;  1Y7X A;  1NJ5 A;  4PJO F;  4HWR A;  3OBW A;  1B34 A;  2XTI A;  2VGN A;  2JTM A;  3QYH B;  4ZTU B;  1YGB A;  4EDU A;  2XGT A;  2ZPH B;  2Q7G A;  5A0G A;  5CCA A;  1VQM A;  2E70 A;  4BY6 B;  3CEY A;  3HXU A;  4A4G A;  2E6N A;  3RUX A;  4DA4 A;  3VV0 A;  1VQK A;  1H64 1;  2R57 A;  3HRU A;  1K8A U;  2I4N A;  1WNL A;  2I2L A;  2JN0 A;  1G5I A;  1IRE B;  2HQE A;  2JOY A;  3QXE B;  1UGQ B;  1M8V A;  2F5K A;  2RM4 A;  4B9X A;  2K2V A;  3BJU A;  2ZPG B;  1JB0 E;  3CBM A;  3X26 B;  1YHQ A;  1EIY B;  1K8A C;  4C0G A;  5GAN h;  2YLB A;  3ZBD A;  1OZ3 A;  4BAC A;  3FLG A;  3OYD A;  4KUI A;  4TWA A;  3QBY A;  4AH6 A;  4N4G A;  2KDS A;  5FU6 C;  2NLU A;  3CC7 A;  1VQ6 T;  1X54 A;  4M7D D;  4J15 A;  2ZXF A;  4IUT A;  4E51 A;  5LJ3 g;  3CME A;  4UPA A;  2DVE A;  1QE0 A;  3A8L B;  2A8E A;  3UGT A;  3WVE B;  1Z7N A;  4OF1 A;  4WJ3 M;  1XQH A;  4C8Q B;  3A8G B;  3O8V A;  1BI2 A;  2IY5 A;  3BDU A;  2P0K A;  3OYB A;  2QDY B;  4DQ2 A;  3CC2 A;  3E9G A;  4M77 B;  1MHN A;  4IUP A;  4K88 A;  2KQW A;  2M16 A;  4JLG A;  2ZT7 A;  4HT8 A;  3RMQ A;  2E6Z A;  2DZ9 A;  3MF1 A;  1I8F A;  3RKW A;  3SDZ A;  4F7U B;  1WQ7 A;  2RHS A;  3AHU A;  1G5H A;  1UB4 A;  5GAM j;  1L0W A;  1SER A;  5LL6 S;  1YIT T;  1QVF S;  1U8R A;  4M78 E;  3L42 A;  3V7R A;  1H4S A;  3I55 A;  2EQM A;  2DD4 A;  3JB9 I;  1SSF A;  3ZEH A;  4PLL A;  1W2B S;  2QA4 T;  1UGP B;  2RJF A;  3CCV T;  2Q5I A;  4L87 A;  4XK8 E;  2H3J A;  4UC4 A;  4M7D A;  4BE1 A;  2AKW A;  5LJ5 f;  3F70 A;  3V8L A;  2DIQ A;  3HXW A;  4HCB A;  4KR3 A;  4LVI A;  5EG2 A;  3X20 B;  5GAO n;  1VQP T;  1BBU A;  1HK9 A;  4XTW A;  4C5E A;  4E7J A;  5D6Y A;  1QVG A;  4ZGE B;  1K73 U;  5GAO l;  4OLF A;  4KQE A;  5D6W A;  4BY6 C;  4P3P A;  2LC4 A;  3OQ5 A;  1VQK T;  2OTL A;  1I81 A;  5CVI A;  3M5A A;  4ZGD B;  4C92 B;  3A8M B;  1TH7 A;  2ART A;  4JUV A;  1K73 C;  1ASY A;  3QZ5 B;  2RJD A;  3JCM e;  2QHS A;  1G3Y A;  1N6A A;  2C06 A;  1VQ4 A;  5CQX A;  5C6S A;  3V7S A;  4XTU A;  4XTX A;  1YHQ T;  2BIV A;  1BIB A;  3P8D A;  4M7A C;  2ZZF A;  2ARU A;  4FU6 A;  4KUD K;  2DO3 A;  3CCJ A;  4TVA B;  1N27 A;  4Y28 E;  4OP0 A;  1NJ6 A;  3CC7 T;  3CMQ A;  5I21 A;  2D9T A;  3HFZ B;  3MEV A;  3CME T;  1IL2 A;  1VUB A;  2QXF A;  2K4Y A;  2ODR D;  4J6W A;  4X9D A;  3Q1J A;  3PMI A;  1D3B B;  4LVJ A;  2CZ0 B;  3KXT A;  2KSS A;  4HA8 A;  4M75 B;  5J26 A;  4RQE A;  2GFU A;  3M53 A;  1BYM A;  3MCA B;  4PG3 A;  1HXD A;  2MAM A;  2EQK A;  2L5Q A;  3QG1 A;  2CIM A;  5A0L A;  4GLK A;  1VQ8 A;  4LD6 A;  1NJ1 A;  3M4Y A;  2Y4X A;  2ZT5 A;  2K57 A;  3JB9 H;  2RJE A;  4PJO B;  4ATO A;  5GAM d;  3JRZ A;  1E1O A;  3I55 T;  4JRQ A;  2GF7 A;  2EKO A;  4L5G A;  4C0F A;  1QF6 A;  1VQ7 A;  3UPU A;  3L2U A;  2V8J A;  4YRI A;  2EYQ A;  1N8R U;  4NCX A;  3QHS A;  4N0A A;  3TEG A;  3L2Z A;  1KQS A;  4UP8 A;  3OS5 A;  5HK3 A;  4M7A G;  2EQU A;  5GMK l;  2DZC A;  3LC0 A;  3G71 A;  2M1H A;  5CKD A;  2ZCE A;  1MGQ A;  4NL3 A;  3OMG A;  3A7U A;  1N8R C;  5FLX E;  3T9N A;  3INZ A;  2WSC E;  4QVD A;  5GMK i;  4JJN K;  2YRV A;  3A74 A;  2OTL T;  4OGE A;  4BDZ A;  3JB9 F;  5D6X A;  3SFM A;  2P0Q A;  2RHU A;  1FX7 A;  4ELZ C;  2HBP A;  3CCS A;  3LGF A;  2GQV A;  4UP7 A;  5AYF A;  1VQ4 T;  1XNI A;  2ZR3 A;  2AMC A;  2LDM A;  1SES A;  2RHI A;  2DD5 A;  2KK4 A;  2VYT A;  3ASK A;  5E3I A;  4JS4 A;  1YJW A;  3OYF A;  4F7U G;  3CCJ T;  1NJ8 A;  4E47 A;  4BI3 A;  3A7A A;  2M9U A;  3L4G A;  5CO7 A;  4HCC A;  3JCM c;  4ZIB A;  2ZR2 A;  1H3Z A;  2X4Y A;  2XHC A;  3HY1 A;  4M77 E;  3RIR A;  2O4X A;  3CXC A;  1B70 A;  4M78 B;  3HP9 A;  3OYI A;  1WU7 A;  3LGL A;  3PIO A;  1Q86 U;  5J39 A;  4BUG A;  3N5B B;  2XDP A;  3VUZ A;  2J3M A;  2CGH A;  1VQ8 T;  3HKS A;  4LDX A;  4K87 A;  3DLM A;  2RD1 A;  3MEU A;  4H2X A;  5HGQ A;  2QQA A;  2RA2 A;  3JCM W;  3NEL A;  4H02 A;  3OB9 A;  4H2Y A;  2DQ0 A;  3NTK A;  5DM7 R;  1QVG S;  1VQ7 T;  4M7D F;  4YRN A;  4NL2 A;  1N9S A;  2XD0 A;  2ALY A;  1NZ9 A;  1B76 A;  5KH6 A;  3HFV A;  5LJ3 j;  1NYR A;  3G71 T;  2QHT A;  4IUV A;  3G1Z A;  5GAO p;  4EMH A;  3OA6 A;  4C92 E;  4IUQ A;  1JJC A;  4OB3 B;  2PUK B;  4L59 A;  4YRJ A;  3MET A;  4RMO A;  3CCS T;  3CCE A;  5KNN A;  2DTO A;  5LJ5 g;  1C0A A;  3GF5 A;  3QUI A;  4XTV A;  5K1P A;  1PSF A;  3BFM A;  4XU3 A;  3OYK A;  3HFO A;  2RI2 A;  2RHQ A;  3URG A;  2Q7H A;  4YRC A;  4LVM A;  4C5G A;  2DIG A;  3A5Z A;  4WJ4 A;  2F69 A;  3NFC A;  4A4F A;  3JCM X;  2MMP A;  1Q81 U;  5IT9 E;  4MZT A;  4Z02 A;  3VQY A;  3OS1 A;  3OYN A;  4EO4 A;  4MZP A;  3PIP A;  3M4P A;  5KCO A;  4M78 C;  2YHT A;  3SWN B;  5GAN j;  4M7A D;  2WAC A;  2VV5 A;  2CZ7 B;  1Q81 C;  4P75 C;  1WJQ A;  1I4K 1;  3M57 A;  3NTH A;  2CJB A;  4PJO E;  4OMF B;  2LQ8 A;  1XTD A;  3VYH B;  3LX7 A;  2L3R A;  3VQW A;  1G51 A;  2C8M A;  4XTZ A;  4OB1 B;  4YRQ A;  2X4W A;  1WPY A;  3OYC A;  1B34 B;  1M90 U;  4HT4 A;  5GMK e;  2FL7 A;  5CR2 A;  2P4T A;  3MF2 A;  1VQZ A;  4BB7 A;  2DTI A;  3S6W A;  2AHJ B;  4JRP A;  1KQS S;  5DLO A;  4E7H A;  1LJO A;  3A7R A;  3MEY A;  3MQZ A;  2QHU A;  2EWN A;  3DLL A;  1M90 C;  4YTL A;  5L8R E;  5ELO A;  2DK3 A;  3QII A;  3JCM V;  1ZHI A;  4ELY C;  3ER0 A;  4MMK A;  5LJ3 d;  1UEB A;  1EIY A;  3FIF A;  2E3C A;  3QJY A;  3I56 A;  4M7A A;  3G4S A;  3RES A;  2MF2 A;  3ME9 A;  2RHX A;  3VJP A;  1EOV A;  3HRK A;  3W3S A;  1Z7M A;  4P3N A;  3M4Q A;  3RKX A;  4M78 G;  3OYG A;  2WSE E;  5C51 B;  3CCE T;  2QEX A;  1WYD A;  2DDZ A;  4XTY A;  1ADJ A;  3JAM E;  2HAX A;  2RH2 A;  3C4S A;  3NET A;  2IY5 B;  2BUD A;  3RKY A;  2BKD N;  4KT0 E;  4IKF A;  3OYA A;  2D0Q B;  2E10 A;  3TRE A;  3VBB A;  3PMT A;  1ADY A;  3TEE A;  3CXC S;  3V8J A;  4RG2 A;  4F7U A;  1KMN A;  5GAN 8;  3QPH A;  4RCB A;  4E7L A;  3P8V A;  2DU7 A;  4CH6 A;  3LSQ A;  5GAN d;  5DLQ E;  4EMK C;  2Q5H A;  1G5V A;  1KHC A;  5GAO q;  4O2D A;  4N4I A;  4M7D B;  2AKW B;  4MZM A;  5GMK j;  1N9W A;  2RI3 A;  3VQX A;  3L2V A;  3OYJ A;  3L2Q A;  1VQM T;  3VYG A;  4Q6G A;  2M0O A;  2XKO C;  4ME7 A;  5CKE A;  1E1T A;  3E9I A;  1Q7Y U;  1IZ6 A;  4LDW A;  2ZTG A;  2E1H A;  2XK0 A;  3SD4 A;  2RHZ A;  2ZT6 A;  4Q15 A;  4HKE A;  3CCU A;  2QHV A;  2PME A;  3OYL A;  3JCM Q;  4RQF A;  5LJ5 e;  1QP3 A;  3UGQ A;  2PMF A;  3FJP A;  3V7C A;  1Q7Y C;  3WQZ A;  2P5I A;  3LLR A;  4A54 A;  4MDX A;  1VQL A;  1X6O A;  1PSE A;  4FT4 A;  3A31 A;  3I56 T;  3G4S T;  5GMK h;  3HSB A;  3V8K A;  3FEO A;  2R5A A;  3UFG A;  3MEA A;  3RMS A;  4C5I A;  3WXM B;  3EFS A;  2PUO B;  2R58 A;  3J7A F;  4C8Q C;  4TQD A;  1Y96 A;  2A7Y A;  4OB2 B;  4XEO A;  4ZGJ B;  2QEX T;  4L6V 5;  2LTO A;  3CC2 T;  3REU A;  3FDR A;  4M77 C;  2K3X A;  4R56 A;  1BIA A;  2FB7 A;  1EFW A;  3HHT B;  2RK2 A;  1YCY A;  2RI5 A;  1NJ2 A;  3FB9 A;  3MO8 A;  3C95 A;  3L1A A;  3HPW A;  3EAE A;  1FYF A;  4IUR A;  4H2W A;  2ZPI B;  4TVY A;  3A32 A;  1ZQ1 A;  5IN1 A;  2JZ2 A;  1W4S A;  1WJS A;  3ZFJ A;  4OVA A;  3GP8 A;  4P71 A;  1YI2 A;  4ZTJ A;  3OSS C;  4YDQ A;  3X25 B;  2CYZ B;  4BE2 A;  3LSS A;  2O01 E;  2DEQ A;  1Q82 U;  2I4M A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...