1WQ7A

Crystal structure of biotin-(acetyl-coa-carboxylase) ligase from pyrococcus horikoshii ot3
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
235
structure length
229
Chain Sequence
MLGLKTSIIGRRVIYFQEITSTNEFAKTSYLEEGTVIVADKQTMGHGESPEGGLWLSIVLSPKVPQKDLPKIVFLGAVGVVETLKEFSIDGRIKWPNDVLVNYKKIAGVLVEGKGDKIVLGIGLNVNNKVPNGATSMKLELGSEVPLLSVFRSLITNLDRLYLNFLKNPMDILNLVRDNMILGVRVKILGDGSFEGIAEDIDDFGRLIIRLDSGEVKKVIYGDVSLRFL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords biotin--[acetyl-CoA-carboxylase] ligase
publication title Crystal Structures of Biotin Protein Ligase from Pyrococcus horikoshii OT3 and its Complexes: Structural Basis of Biotin Activation
pubmed doi rcsb
source organism Pyrococcus horikoshii
molecule tags Ligase
total genus 76
structure length 229
sequence length 235
chains with identical sequence B
ec nomenclature ec 6.3.4.15: Biotin--[biotin carboxyl-carrier protein] ligase.
pdb deposition date 2004-09-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02237 BPL_C Biotin protein ligase C terminal domain
A PF03099 BPL_LplA_LipB Biotin/lipoate A/B protein ligase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 1wq7A02
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 1wq7A01
2DXTA 3HXYA 4YRSA 3BW1A 4M77C 3SWNC 5GAOq 1KQ1A 2AKWA 5GAN7 2ARTA 4TVWA 2E41A 5GAN8 4M75A 3NEMA 4PJOA 3HFZA 4YRLA 2ZINA 3GIBA 3JCMb 2DDZA 1SRYA 3OD1A 4G85A 3REXA 5GMKm 4M78B 3JB9F 2E65A 3ERRA 4YCVA 4P72C 4RCBA 2AMCA 3RGLA 2CGHA 4WJ4A 1EQRA 3PCOB 2QHUA 4M75D 3A31A 4PJOD 1YFRA 3P8VA 1B76A 1X56A 5C53B 4DQ2A 2JN0A 3JCMh 4HWSA 2FB7A 1JJCA 4H2TA 3SB2A 3LSQA 3IKLA 4XEOA 1EIYA 5LJ5e 3QO8A 1LOJA 3V8LA 1B8AA 3QTCA 3INZA 4YROA 3BY7A 1N9WA 4M7DB 4NL2A 1ADYA 4F7UB 3QSUA 4C8QA 3VQVA 4N0AC 4XQ3A 2ZIOA 2E64A 3L4GB 5GMKj 3RL6A 4J6XA 2ZIMA 2FYKA 3REUA 4ZIBA 5GAN6 5GANg 4P73C 1WQWA 3A5ZA 4M77F 3L2ZA 5LJ5f 4TTVA 4MMLA 4EMKA 1KMMA 4J15A 3JCMV 5C52B 5LJ3h 4C8QD 3JB9J 1FYFA 1X55A 2EL9A 3HRIA 3JCMe 4DPGA 4YRPA 5K1PA 1I5LA 2E5AA 4HT8A 2I4OA 3A5YA 2DTOA 4WJ3M 1Z7NA 2C8MA 2AKWB 2I4LA 4A54A 3R07A 1IL2A 4M7AG 1WU7A 4ZTUB 4M75B 4RDXA 2I2LA 3RIRA 4PJOB 4H2UA 1LJOA 4HVCA 4C92A 4YRRA 2DTHA 4EMGA 1G51A 1B7YA 5GAOr 2Q5HA 3MF1A 1HXDA 2VXEA 4YRFA 4XTUA 1ASZA 2AMCB 4CH4A 1BBWA 3VQXA 3HXXA 5GMKi 1H4QA 4C92D 2ODRC 1WPYA 5LJ3e 4K87A 4OLFA 2G4CA 1WLEA 1I8FA 1ATIA 3A7UA 4P3PA 4WF2A 4WI1A 12ASA 5KNNA 1M5Q1 1EIYB 4M7AC 4V2SA 1B34B 2XTIA 2DJZA 4NL3A 4XU2A 1G5HA 4RMFA 1JBMA 4P71C 4H2WA 5GAOm 5HGQA 3JCMX 4XTXA 3HY1A 4A53A 4YRGA 4C8QB 1E24A 3E9IA 1JRIA 3RERA 5C51B 3JCMd 1RIQA 2CIMA 3CMQA 1Y96A 3IALA 4EX5A 5GAN4 3HXUA 2YLCA 1WQ7A 5GAMg 4M78G 3HSBA 4J5YA 4UP9A 2ZNIA 2EJGA 4EMKB 4M77E 5GMKl 2ALYA 4CS3A 2I4NA 4TWAA 4XU3A 4YP0A 1NJ2A 2YHTA 1ADJA 3UH0A 4TQFA 4P3NA 1EVKA 1PYSB 3FJPA 3UGQA 3EFSA 3JB9D 2DZ9A 3MEYA 4YDQA 4RQEA 1X01A 4KR3A 3A7RA 5GAMh 5LJ3d 3PZCA 4C92B 3QO7A 4M7DG 3JCMQ 1B7YB 4P74C 3BJUA 4UP8A 1G5IA 4F7UG 3QNEA 1B34A 5K1XA 4M78C 4RCCA 4Y91A 2CJBA 4M7AF 5LJ3j 3I7FA 3TEHA 4J6YA 3EFRA 4PHCA 3QO5A 2ZT7A 4XU0A 1USYA 4YPFA 4YRIA 4Q6GA 4YRQA 4M78E 3NENA 3V7SA 3HXWA 3SWNA 4JRKA 4M77A 2RHSA 2C7IA 3VQWA 3RUXA 3HXZA 1X54A 4HWOA 1WYDA 4P75A 2P5IA 2RB6A 4PNOA 3QO3A 1VQZA 5E3IA 2VC8A 4X5OA 1YFTA 4RQFA 2E10A 1KQ2A 4P72A 4TVAA 4M77D 3HTZA 4M7DC 1H4TA 1KMNA 4YRTA 4XTYA 3QHSA 1PYSA 4M75G 1Y96B 4PJOG 4NOYA 1M8VA 2CJAA 2ZTGA 4F7UE 1W66A 4H2XA 2Q7EA 3VU3C 3A74A 1NJ1A 5GANh 4K88A 3RACA 4YYEA 2DZCA 1EOVA 2ALYB 3HFOA 4KQEA 4BWAA 2EJ9A 3A7AA 3AHUA 4HWRA 3JCMf 3E9HA 1NJ8A 4YRJA 2PMFA 4M78F 3KFUA 4N0AA 3M4PA 1NJ6A 4P73A 2ZR3A 3VQYA 2IY5A 4XTZA 2ZZFA 3HFVA 4HWTA 3RKWA 4M75C 2ARUA 1EFWA 4PJOC 5I21A 4CH3A 3JB9I 2ZCEA 3LSSA 4H2VA 3JCMW 2RM4A 3PGGA 2ZT5A 5GAOl 1QE0A 3HXVA 1YB3A 4C8QG 2XGTA 1WNLA 3HRKA 2HNIA 4PJOE 5LJ5g 2DU5A 3TEHB 1LYLA 4M7AE 1YCYA 2EJFA 1NYRA 3IKMB 4X9DA 4M7DF 2P0LA 4YRCA 3SWNB 4M77B 5GANe 2RHSB 4KR2A 3V8JA 4F7UF 1MGQA 5LJ3f 3FB9A 1X2GA 4MMKA 5GAMd 1SETA 2QHSA 2DEQA 4TVYA 2E3CA 2ZT8A 2Q7GA 2VXFA 3P8TA 5GAN2 3A32A 1E1TA 5GAMj 2ZZEA 3JCMJ 1E1OA 4XTVA 3MF2A 4TVAB 3RF1A 2QHVA 11ASA 1KOGA 3UFGA 2ZNJA 5GAN5 4G84A 1NJ5A 4XU1A 4C8QC 1J5WA 3JCMg 1SESA 1I81A 4CH5A 2I4MA 3WQZA 1H4SA 4UP7A 2CJ9A 4C92G 4ZTZB 2Y90A 4H2XB 2EWNA 4C8QE 2ZZGA 4P75C 5CAIA 1YGBA 1SERA 2RHQA 4BW9A 1X2HA 3RKYA 2YLBA 3IG2A 1QF6A 4EMKC 4M7AA 4X9CA 4M75F 5GAOn 4H2SA 4PJOF 4P71A 4YREA 4H02A 3NETA 2ODRD 1YFSA 2DXUA 4JRIA 1D3BA 4OP0A 2J3LA 4O2DA 1EVLA 4UPAA 2ZXFA 4M7AD 3TUPA 2DKGA 4JUVA 2IY5B 5GANd 1B70B 1BIAA 2RA2A 3HFNA 1ASYA 4HT9A 2ZGWA 5LJ3g 2DU7A 4C92C 1BBUA 1E22A 4CS2A 2E1HA 4CS4A 5GANj 3HY0A 3W3SA 3TEGA 3JCMc 3JB9H 1HTTA 5ELNA 4C92E 1GGMA 3BDUA 2ARSA 4JLIA 4YCUA 3JB9G 1C0AA 5GAMe 1H641 4M7DE 2DQ0A 4C8QF 3G1ZA 1U1TA 3VBBA 3M4GA 1I4K1 2J3MA 2EAYA 4P74A 5ELOA 4PG3A 3FIFA 1Z7MA 4M78A 4QVCA 5DY9A 4NCXA 4L87A 1HC7A 3PCOA 5GMKh 5GAMf 2Q5IA 3ICAA 1LNXA 3NELA 3DSQA 2DQ3A 3BFMA 1NYQA 3L1AA 4K86A 4XEMA 4E51A 4M78D 3P8YA 4AH6A 1N9RA 3HFZB 1B70A 4EMHA 1H4VB 2RD1A 2RHQB 1TH7A 5GAOp 4CH6A 4YRNA 1N9SA 4M7AB 2DVEA 2Q7HA 2ZT6A 4YRKA 4YCWA 5LJ5d 2ZR2A 4M75E 4P3OA 4C92F 4Q15A 4M7DA 4M77G 3M4QA 5F5WA 3V7RA 3JCMP 1BIBA 4F7UA 4LNSA 2QHTA 3RESA 1D3BB 4EO4A 5LJ5j 1U1SA 1L0WA 3V7CA 4J6WA 5GAN3 3L4GA 4YRMA 1JJCB 2DTIA 3RKXA 1HK9A 3UGTA 4QVDA 4M7DD 2K57A 2QTXA 1NNHA 4HWPA 5GMKe 2PMEA 3LC0A 4XTWA 5LJ5h 4H2YA 3QUIA 5GANf 3V8KA 1USYC 4TQDA 4HA8A
chains in the Genus database with same CATH superfamily
1CKBA 2QASA 2DPPB 4PFPA 2FRYA 1KQ1A 5GAN7 2ARTA 2E41A 2CP0A 1AZGB 1TOVA 3GOXA 3CCLT 1VQ7T 2ED1A 4YRLA 3R6OA 2ZINA 5CR2A 2DDZA 3L2VA 2JVVA 3REXA 5GMKm 2ESWA 4M78B 3JB9F 3ULRB 2E65A 3QPHA 2JXBA 2YXYA 4L6V5 2BIVA 2AMCA 1PSEA 4WJ4A 3M56A 3PCOB 2GTOA 2PTKA 1B76A 1X56A 3FC3A 1I0CA 3CCLQ 1VQ7Q 5D6XA 1PC0A 1JJCA 2M16A 2EQIA 3C0CA 3M9QA 1Y57A 4MDWA 1VQ4Q 1WFWA 4F14A 3A8GB 3QO8A 1NEBA 3L42A 4M4ZA 4J9FA 3INZA 4YROA 3BY7A 2DIGA 4M7DB 4J7IA 1ZX6A 1W2BS 4XQ3A 3FEOA 4DBQA 2RI3A 1TUGB 1TWBA 3REUA 1UUEA 4D8KA 1N8RU 4P73C 3OYAA 3L2ZA 3GNGA 1FYNA 2CKKA 3OB9A 5LJ5f 2JJ9A 4TTVA 4EMKA 1RADB 4J15A 1D09B 2OJ2A 5C52B 2CP5A 5DLOA 2CSIA 4Z02A 2ZZDA 1U5SA 1WGSA 4YRPA 2GF7A 5K1PA 3OYMA 1PKTA 1MNDA 1TUCA 3NMZC 1YJWA 1Z7NA 2C8MA 4R56A 4M7AG 4ZTUB 3VS4A 4M75B 1JB0E 2LJ0A 4PFOA 1KIKA 1MHNA 2MMPA 4C92A 1K8AC 1G51A 5EG2A 2MF2A 1M3AA 1C0MA 2LQKA 2OTJT 2VXEA 1GBQA 2RHYA 3QJ6A 1PRLC 3HKSA 1ZSZC 1QVFA 1QKWA 2RPNA 1ARKA 2KXDA 1H4QA 4RTUA 3KFVA 1Q7YU 5LJ3e 1WLEA 3PT9A 1ATIA 2VUBA 1VQ9A 4WF2A 4OF1A 4WI1A 2XKOC 1CSKA 12ASA 4DBFA 5FWCA 1B34B 4XU2A 3PTAA 4RMFA 2QQSA 3IQLA 3JCMX 2O9VA 1JU5C 1W70A 4XTXA 3HY1A 4C8QB 1E24A 3JCMd 1VQ6T 2ED0A 3CMQA 3JSCA 1KJWA 1QVFP 3HTRA 3QYHB 4M78G 4UP9A 2ZNIA 2BTTA 1UE9A 4OB1B 1O9SA 2VYTA 1NLPC 2J6OA 4J9EA 3CCRT 2CREA 1WHKA 2QXFA 2X4YA 2GFAA 1VQ6Q 2JMCA 3FJPA 3OYDA 3GF5A 1KD1U 1T0HA 3C95A 2DZ9A 3MEYA 2KY9A 1MMDA 4RQEA 2RHZA 2X4WA 3VUZA 4KR3A 5CK9A 3UA7A 2EBPA 3REAB 3DKMA 4BI8B 4M7DG 3CCRQ 4UP8A 1G5IA 4FT2A 2KYBA 2DFUA 4B9XA 4E7KA 4J6YA 3EFRA 3CCST 4PHCA 2ZT7A 1USYA 1V76A 2LJ1A 3NENA 3V7SA 1JEGA 1SPKA 1Y7XA 2FVUA 2C7IA 5IXBA 1YHQT 3OBWA 2RK1A 4VUBA 2P5IA 4HWOA 3PIPA 2IPOB 1Y0MA 2RB6A 3QO3A 1VQZA 1WXUA 1E6HA 5E3IA 2IVWA 2VC8A 3M4YA 3ME9A 4HXJA 3MEWA 1ZSGA 4P72A 4M77D 5D6WA 2NUZA 3QHSA 1PYSA 3EG1A 3QDRB 2QTVA 4M75G 2AZVA 1JXOA 1M8VA 1VQLT 2CJAA 2ZPHB 2HBWA 4H2XA 4X34A 3PE0A 1N8RC 5GANh 5J26A 4K88A 1PWTA 2XDBA 4YYEA 2HKNA 1YI2A 2SRCA 1EOVA 3I56A 1K1ZA 2ALYB 2QGGA 1YJ9Q 4RKUE 2OTLT 2AIRB 1O75A 3JCMf 5IHKA 1EFNA 3NTKA 1K9MU 1K8AR 4YRJA 2RI2A 2PMFA 2AZSA 1G3YA 3X26B 5D6YA 4ZGJB 1VQLQ 1NJ6A 4EDUA 1WIEA 1EIFA 2KT1A 1EZZB 2D8JA 5A0GA 3VQYA 2IY5A 3PVLA 2D6FA 2BZYA 2EQUA 4JZ4A 2B8AA 3RKWA 6AT1B 2ARUA 4PJOC 5EC7A 3JB9I 2DERA 2QEXA 4E7IA 4F17A 2OTLQ 1VQOQ 3LSSA 4KUIA 3JCMW 3PGGA 4C8QG 1WNLA 5LJ5g 2CP6A 3G6ET 1SKUB 3TEHB 3QZ5B 4Z89A 3T9NA 1GXIE 3IKMB 4X9DA 2RHSB 3V8JA 4F7UF 1OZ3A 2NUPA 3M0TA 4J9CA 4MMKA 2K3XA 3A98A 2QHSA 4TVYA 2Z0WA 1Q7YC 1SRMA 2ZT8A 1D0ZA 3RMQA 2Q7GA 2VXFA 1AZEA 1E1TA 4A4FA 1NM7A 3MF2A 4FYXB 4TVAB 2QHVA 3CPWS 4RTYA 2RHUA 3TREA 1JJ2P 1J5WA 1SESA 4CH5A 1G2BA 2YUOA 1KC8U 3CPFA 2K6DA 2CYZB 4ZTZB 2Y90A 1F1BB 2EWNA 2VGMA 4P75C 5CAIA 3ZBDA 3QWXX 1QVFS 1H3ZA 1YGBA 4BW9A 1SERA 3RKYA 5A2QE 1BYMA 3IG2A 4LVLA 3G7ZA 4M7AA 2X51A 4PJOF 1WJRA 2QA4A 2HL5C 4YREA 2L2PA 1W1FA 4NS5A 4AFUC 2HD0A 3ZL7C 4N4HA 2JTFA 1YJNT 4JRIA 4OP0A 3KBGA 4MZPA 2F2WA 4AFSC 1EVLA 1W6XA 1KD1C 2H3JA 3RMSA 3CC2Q 3CCET 1BIAA 2B86A 1WHHA 2EYYA 5FLXE 2LNVA 3Q1JA 4KGZB 3QZ9B 2V8IA 1BBUA 2HDAA 1WHLA 3G4SA 2OX7A 2RQUA 4E7ZA 5DLQE 3OSVA 4MDXA 3CMET 1RL2A 1GGMA 1NYFA 2NWMA 4E2FB 3BDUA 2DL3A 3VS6A 4CC7A 3LGFA 2P0KA 1UEBA 4PK4A 3JB9G 3TSWA 4WCIA 5GAMe 1LPLA 1H641 2EKOA 1UG1A 5IXFA 1RABB 1K4US 4A63B 3I35A 3CCQT 3S3OA 3EG0A 2FRWA 5I2SA 2EW3A 4P74A 1LVKA 2ZPIB 2RQRA 1Z7MA 5FRMA 4M78A 2DXCA 1N8RR 2ENMA 1RAHB 1ZSZB 2VV5A 2YT6A 3PCOA 3G1JA 2Q5IA 1K76A 4J9BA 1ZUYA 3CMAQ 1VQ8A 3CCQQ 2KE9A 4RTXA 2YSQA 1PNJA 1WX6A 4A4KA 2DL5A 2LQWA 3P8YA 4AH6A 1N9RA 1HJDA 3VS7A 1YNZA 1UECA 3C94A 4KGVB 1IZ6A 2ZR2A 3WXMB 4M7DA 5F5WA 1QCFA 4LNSA 3JV3A 3A8HB 3RESA 1K9MC 4IUTA 1ABOA 2QGFB 3V7CA 4KH1B 4AFZC 1BCMA 3VV0A 5D7UA 1GCPA 4DEXA 1UB4A 3UGTA 4BI4A 2FZKB 3M58A 2D8HA 3MEAA 2DRKA 3LC0A 1Q7YR 1N27A 4FU6A 3OYIA 5L23A 1NJIR 2RO0A 3CC7T 1M2VB 1G3WA 1UJ0A 2BKDN 3NHNA 3HXYA 3BW1A 3SWNC 3OS5A 1QLYA 5M9OA 2BE7D 1FXXA 1QKXA 3EG2A 4TVWA 5GAN8 3OYCA 2OAWA 1X69A 4M75A 5FWBA 1G8XA 1SRYA 2P4RA 4G85A 2JOYA 1M30A 1VYUA 1UDLA 1GBRA 2DAQA 2LVMA 3ERRA 2Y4YA 4YCVA 4JRQA 3RNJA 1VQKQ 3RGLA 3CCJT 2OI3A 2FG0A 4JDSA 3L2UA 1OU8A 3P8VA 2EIFA 2EQJA 2BZ8A 1KC8C 4JJNK 1QW1A 2X9HA 2DETA 4LVIA 2PVOB 2LT1A 3FLGA 2NUTA 1KD1R 4XEOA 1RLQC 1VQ5A 3EH1A 4B6MA 3V8LA 2V1QA 1B8AA 1UGRB 1RUWA 3C12A 3FJ5A 4OMMA 1N9WA 4WTOB 3ASKA 1OPKA 4F7UB 3G71Q 2HEQA 4C8QA 4D6WA 4KBMB 4N0AC 3CCMQ 1U8RA 1BI2A 2WSFE 1XJWB 2E64A 5GMKj 2K9GA 4J6XA 1Q82U 1YCSB 3CD6T 5GANg 1WQWA 1GCQC 1VIFA 3UF4A 1S1NA 4OMFB 1SHFA 3HRUA 1OX9A 3TSZA 3JCMe 5FRNA 4DPGA 1I5LA 3EAEA 4HT8A 2J7IA 2DTOA 1MMAA 3OMCA 3C4SA 3CD6Q 1BCOA 4WJ3M 1G5VA 2AKWB 2I4LA 2PUOB 2LX9A 1WU7A 1ZBJA 4RDXA 4PJOB 3LH5A 1TU0B 4YRRA 2DTHA 4EMGA 3HHTB 5GAOr 2WSEE 2D0NA 1X75C 5CO7A 1TS9A 4XTUA 3CC4T 1DJ7B 1PD0A 2M0OA 3VQXA 2XIDA 1QCNA 2H8HA 4C92D 3CBPA 1YIJQ 2XICA 2ODRC 2O01E 4XAXB 1K9MR 2ZPEB 1VQPT 2R58A 1UGQB 1EIYB 3VS1A 3EHQA 2XTIA 1G5HA 2P0PA 4H2WA 3X24B 5HGQA 3QYGB 4PJLA 5GJVB 3VYGA 1D1CA 1M1GA 3CCVT 1AWWA 1JRIA 2MYSA 1D1AA 3MP8A 2RJDA 3HXUA 1VQPQ 2OAUA 3A5ZB 3TVTA 1KK7A 2FO0A 3H8ZA 3L2QA 2MOXA 4OMNA 2ALYA 2I4NA 1FX7A 1VQ4T 1ADJA 1WYXA 4TVRA 3CCVQ 3E2UA 3OYYA 1IB8A 1WA7A 3VRYA 3EFSA 3EGXB 3UWNA 4YDQA 4QT7A 1WHGA 1XTDA 2QDYB 1X01A 2JS2A 2OTJA 3A7RA 3MO8A 5GAMh 3I55Q 3PZCA 3QO7A 5IN1A 3BJUA 4F7UG 1NE8A 1KC8R 2L3PA 1Y71A 3E9FA 5CKFA 3I7FA 1X2QA 2M51A 3TEHA 2ZAEA 3TQ7P 3QO5A 4YRIA 5AT1B 2RHSA 4CC3A 1EX4A 1QMCA 4ORZA 3VS0A 2RHXA 2QQBA 1M90R 1D1BA 1M1KU 1ZLMA 2M02A 4AT1B 3CBOA 2CS7A 2L5QA 3M5AA 4QQGA 1QVPA 5IH2A 1M1FA 4Y92A 2E10A 5CQXA 1K0XA 4TVAA 3HTZA 4GY5A 2L8DA 4E7SA 1YWOA 4YRTA 4XTYA 1UGSB 5FU7C 1Q86U 4EPCA 4PJOG 2YWWA 3L2WA 1W66A 2Q7EA 2DEUA 3CPWA 3CCRA 3M54A 1NJ1A 1SEMA 3RACA 5HY6A 2EQMA 2VASA 5CVIA 4KQEA 3A7AA 5IT9E 3X25B 4ELYC 2HAXA 3E9HA 3H0IA 2MI6A 2DL7A 1UHCA 3P8DA 1UGPB 1B3QA 2FEIA 4BDZA 3M0UA 2YRCA 2FL7A 4JZ3A 3REBB 4P73A 2V26A 1GRIA 4HWTA 2COYA 1ZQ1A 3JRZA 3HRTA 1OULA 2YUPA 5I21A 1IXDA 4LN2A 4CH3A 2NYSA 4BE2A 3CCSA 2RM4A 2ZT5A 5GAOl 1QE0A 5AYFA 2P4TA 1LYLA 3CPWP 4ZGEB 2QG9B 4L5GA 3N5BB 3E9GA 2MAMA 1YHQA 4YRCA 3SWNB 3OYNA 2HL3A 2JW4A 2AKKA 2MCNA 1SHGA 2DEQA 2CDTA 4HT4A 2KEAA 2JT4A 4FT4A 5GAN2 1QP2A 2ZZEA 1BK2A 5CQYA 5KH6A 2LQNA 3RF1A 2ZNJA 2VVKA 4OMPA 1ZSZA 1WXBA 4X1VA 2KRSA 1I81A 3TEEA 2FZGB 2RQVA 3M0RA 2YUNA 2NS6A 2ZZGA 2GTJA 1X43A 1QF6A 4X9CA 4KUDK 4UC4A 2ZPGB 1QQJA 4H02A 1GFCA 4C5GA 4J9IA 4A4GA 1MUZA 2M9UA 2J3LA 2L0AA 2ZXFA 2DJQA 4M7AD 2EGCA 4OMQA 4JUVA 3A1PA 1T3SA 5GANd 1YJWQ 1VOMA 2ZGWA 2HSPA 3OSSC 5I11A 3G6EA 2DU7A 2F5TX 4BB7A 5GANj 3SDZA 3TEGA 1NPPA 1HTTA 1KQSA 2CZ7B 3FRNA 4FYVB 1VQNA 3DB3A 1YJ9T 4C92E 1QVGA 3M53A 1M3BA 3P8BB 2ARSA 2BUDA 4JLIA 1M2VA 4YCUA 1RI0A 1QP3A 1JO8A 1C0AA 2BZXA 2K5FA 2C0TA 3VRZA 4R55A 3EGDB 4PJJA 3U23A 4LDWA 1VYVA 1Y07A 2J3MA 2YRVA 1M1KC 4JJBA 5ELOA 2QQAA 1X6GA 1VQ9Q 3M0SA 4IUVA 4QVCA 5DY9A 2LCSA 2XDPA 1VQOT 1T0JA 2AHJB 2R5MA 4QVZA 4HVUA 4IUQA 3OYJA 1LNXA 3H0FA 3GNFB 4QQ6A 1KQSP 1Q86C 3BFMA 2K4YA 1NYQA 4XEMA 2KNBB 4M78D 1B70A 4HVVA 2RHQB 2DVEA 2Q7HA 5KYWB 4C5EA 4YCWA 1YJNA 4C0FA 4JS5A 1M27C 2BE9B 3I5RA 3V7RA 4F7UA 3JCMP 1TSFA 4FSXA 1D3BB 1LCKA 1TG0A 3CCEA 4EO4A 1S72T 5A0LA 1JXMA 1U1SA 2COZA 1L0WA 2DD4A 2ROTA 2DVJA 5GAN3 1JJCB 3META 1V1CA 1HD3A 4M7DD 1K73U 2P0QA 3CMEA 5IHIA 5GMKe 4LDXA 1VA7A 1SRLA 2EYWA 2QYZA 2DYIA 4PLLA 5KYYB 2VKNA 3PNWC 2A08A 2HSEB 1S72Q 5GANf 3V8KA 3VS2A 3CCQA 2DXTA 5GJWB 1RAAB 4YRSA 3TCJA 1Q81U 4M77C 1KHIA 5C0MA 2AKWA 3EG9B 3NEMA 2KSSA 4PJOA 3HFZA 3CC2T 3JCMb 1KHCA 5C6SA 2A8EA 3OD1A 1OYXA 4IKFA 4LVMA 3LWHA 2X3WD 1WHMA 1I5OB 3S3MA 1YI2T 3I56T 1YBYA 4RCBA 2EYZA 1EQRA 1TUDA 2GGRA 4M75D 2J6KA 1YFRA 5C53B 4DQ2A 2JN0A 1R8OB 4HWSA 2FB7A 3OY9A 4H2TA 2RF0A 3OA6A 7AT1B 4LUDA 4FCYA 3OYEA 1EIYA 3IKLA 1ABQA 3S6WA 5LJ5e 1LOJA 1YI2Q 3I56Q 4FYYB 2O88A 1XNIA 1ADYA 2DX1A 3QSUA 5KYNA 5FU7B 3WVDB 2JM9A 2O4XB 4PKCC 1FMWA 2KMTA 3RL6A 2ROLA 2FYKA 2XK0A 2D1XA 4ZIBA 5GAN6 2ZPFB 2X3XD 3CMAT 4D8DA 3A5ZA 2LCLA 4M77F 3OS0A 1FWZA 4MMLA 2EGAA 3MCAB 3JCMV 5LJ3h 4C8QD 2FPDA 2QEXQ 1FYFA 3CC7A 1X55A 2E12A 1C6VX 2F2VA 5J3BA 1M1KR 2LZ6B 1BB9A 2E5AA 2I4OA 3A5YA 3EGXA 3GPLA 2JZ2A 4LDYA 4KT0E 3R07A 4A54A 1IL2A 2O2OA 1IREB 2I2LA 3RIRA 1H92A 4HVCA 2F1LA 1Q86R 1OV3A 1WXTA 2Q5HA 3MF1A 3CCJA 2AKLA 3OYHA 1ASZA 2LJ3A 2KRNA 3MJXA 3X28B 4CH4A 2QA4T 2A7YA 1IHWA 1OEBA 1AD5A 3HXXA 2HQXA 3CCUA 1KQSS 1SF9A 2DA9A 1WI7A 3TU4K 1WPYA 4CC4B 4K87A 3MP1A 1QVGS 2G4CA 1I8FA 5DM7R 4P3PA 3A7UA 3F70A 3UATA 2J06A 5HK3A 1AT1B 1ZHIA 4J9HA 2DJZA 4HVWA 1VQMA 4V2SA 4P71C 5GAOm 3J81E 2QA4Q 4LE9A 4L59A 3G4ST 1JQQA 4A53A 4YRGA 2G6FX 5C51B 1VQKT 2EGEA 4RTWA 3IALA 5CKHA 4EX5A 5GAN4 2CZ0B 4YTLA 2LP5A 4A4HA 4RG2A 3EGUA 2DF6A 3HSBA 4J5YA 2EJGA 4FL6A 4M77E 2EKHA 4CS3A 4TWAA 3MP6A 4XU3A 1K73C 2GBQA 2YHTA 4YP0A 1PG5B 2HBPA 3MHXA 2X4JA 3LLRA 2RI5A 3DLLA 2HCKA 3G4SQ 1BI3A 2LNHB 3OYBA 2KK4A 4TQFA 2EVRA 4P3NA 1PYSB 4BACA 3UGQA 4J83A 2K2VA 1PKSA 3JB9D 5CIUA 3G71T 1WJQA 3CCMT 5CKBA 1QCOA 1Q81C 1YITT 3VUBA 3CC4A 5HK0A 3VKIA 3GP8A 1B7YB 1SSFA 1OPLA 1B34A 3RR6A 3OS2A 2ATCB 5K1XA 2CJBA 1R77A 1WJSA 1RAGB 4XU0A 3QJYA 1WZOA 4YRQA 4M78E 2ECZA 1MMNA 3SWNA 1VUBA 4JRKA 1VQPA 3OMGA 5HCKA 1NEGA 1YITQ 3VQWA 1VQ8Q 4BD3A 3HRSA 1I1JA 1WYDA 3KUFA 4FW2A 2V8KA 4PNOA 1R0CB 3ER0A 1YWPA 4X5OA 4RQFA 4RTVA 1A0NB 1KQ2A 2DIQA 3BDLA 1KMNA 3M59A 3EFOB 4A4EA 5KE3A 3M55A 1UHFA 4Y28E 1Y96B 3CCLA 1VQ7A 2E70A 2MWPA 5IAYA 2ZTGA 5L8RE 3NTHA 1YIJT 1VQ4A 3P8HA 3CEYA 2V8JA 1UTIA 3EHRA 1IGUA 4C0GA 4BWAA 2LQ8A 2KAFA 3QBYA 1AOJA 2VWFA 9ATCB 1U06A 2XU8A 5HKCA 3OBYA 1YN8A 3KFUA 4N0AA 4DBRA 3J80E 4BY6C 2DL8A 4F16A 2K5IA 1B7TA 2ZR3A 4ME7A 1GCQA 2ZZFA 1WDXA 2AK5A 5I22A 2DO3A 2E3IA 1EFWA 2CH4W 2JMAA 5KE2A 1VIEA 1NPRA 3HXVA 1YB3A 3HRKA 2HNIA 1NBEB 3HL8A 4F04B 4CI0C 1Q95G 4M77B 5GANe 1BKBA 1X2GA 3EGDA 2E5KA 3NFCA 4AG1C 5GAMd 2JTEA 2LTOA 4HCBA 2E3CA 2KYMA 3P8TA 4IIOA 3A32A 5GAMj 3I55T 1E1OA 4XTVA 1KSWA 1VQ5Q 2NLUA 1MV0B 4MZTA 1ZUUA 1J3TA 1NJ5A 2A28A 1K73R 2M0YA 3WQZA 3OYFA 1H4SA 2I4MA 3UDCA 5ECAA 2RQTA 4C8QE 4C5HA 4KGXB 2QQRA 4B9WA 2RHQA 4EIKA 2K5LA 1OOTA 4EMKC 3OW2A 2RJCA 3PMIA 5KYWA 1Q81R 4QKUA 1E6GA 1YFSA 2QAZA 4DOVA 1D3BA 4UPAA 5KYXB 3VJPA 2DKGA 3HFNA 2K3YA 2DD5A 4HT9A 3SHWA 4PFZA 5LJ3g 1X6BA 1T3LA 1FMKA 4C92C 1H8KA 3KXTA 4CS2A 4PLIA 3NGPA 2A0FB 3QKJA 4E47A 5KYYA 5ELNA 2X35A 1VQ6A 2X4XA 1M8MA 4FW1A 4DBHA 3OW2P 5KYUB 2PZ1A 2XDDA 2H3EB 3CXCS 1RAFB 1V29B 4LVKA 4J8OA 2RQWA 3EG9A 1M2OA 1ACMB 1MV3A 1U1TA 1Q82C 3M4GA 5I2MA 1I4K1 2C0OA 2A37A 4N4IA 4FYWB 4PG3A 1PSFA 4RUGA 3M57A 4Z88A 2WACA 2PVDB 4NCXA 2RJFA 3LYIA 5GAMf 1M9SA 3I5SA 1MMGA 3HPWA 2DBKA 5A0DA 4K86A 4E51A 3QDFA 2DMOA 2Y4XA 1H4VB 5GAOp 2FHDA 4CH6A 4J9DA 1PD1A 2KGTA 2COWA 3A8MB 2E6ZA 4LXCA 4YRKA 3EG3A 4GLMA 2KBTA 4P5NA 4P3OA 2PVGB 4C92F 4Q15A 4K11A 4AFQC 1U3OA 4M77G 4Z8AA 1BIBA 8AT1B 3MKDA 2QQ9A 2O4XA 2ZCFB 4HCKA 2L3QA 3GBQA 2HQHA 4YRMA 2GQIA 1HSQA 3RKXA 3H6ZA 1NJIU 2GCXA 3QG1A 4JS4A 2NUTB 2OTJQ 2K57A 2QTXA 1YJ9A 1NNHA 1IO6A 4E6RA 3O8VA 2A36A 2JUFA 3SEMA 4XTWA 4LNPA 3NTIA 4H2YA 1VQLA 1USYC 4TQDA 1D0XA 2R5AA 4HA8A 2CT4A 1OQKA 4J7FA 4GBQA 5GAOq 2EYQA 1ZUKA 2QK0A 4LVJA 1MNEA 4CRIA 4OB3B 1YJWT 3GIBA 2OTLA 2KROA 1VQOA 4OVAA 4FM4B 3URGA 4RTZA 3OYLA 2KVQG 3HP9A 4P72C 2CGHA 2F5KA 2XHCA 2QHUA 3A31A 2LT4A 2PQWA 2EYXA 4PJOD 3X20B 2SEMA 3JCMh 2KXCA 3I9QA 3MQZA 3LW5E 3VS3A 4QW2A 4KRTA 2HMAA 3A8OB 5KCHA 5FU6C 2CP3A 3SB2A 3LSQA 1AWXA 2LCCA 1I07A 3QTCA 1VQ9T 1S72A 4NL2A 5CKDA 4HKEA 1GFDA 1QWFA 5FROA 3QXEB 3VQVA 2D0QB 4II1A 1RACB 2ZIOA 3L4GB 4OMLA 4JRPA 2ZIMA 2EPDA 2JM8A 4JLGA 5J39A 3MPUB 1KMMA 2RNAA 1B07A 2RHIA 1PCXA 1IHVA 3JB9J 2EL9A 3CCSQ 1Q82R 1D0YA 4DA4A 3HRIA 5CKEA 4BY6B 3OW2S 1FMVA 1ZA2B 4N4GA 2FPEA 1YHQQ 3CC2A 2I0NA 1GL5A 1QVGP 2XD0A 4H2UA 5KCOA 1LJOA 2K79A 2YRDA 1X6OA 1B7YA 4AMCA 1HXDA 4YRFA 4HCCA 4LUEA 1AWJA 2DNUA 3OS1A 2AMCB 3PIOA 4C0DC 3FDRA 1BBWA 2RH2A 2CUBA 3OQ5A 4J9GA 3PMTA 5GMKi 3S3NA 1UFFA 3UPUA 4OLFA 2WSCE 1JJ2A 2F2XA 4KH0B 5KNNA 1M5Q1 4JJCA 3E19A 1K0SA 4M7AC 4ELZC 4NL3A 1JBMA 3M0QA 3O5ZA 1M4ZA 1SG5A 1Z9QA 4LDUA 3EFOA 3E9IA 3RERA 1VQNT 1IRXA 3CMAA 1RIQA 2CIMA 1Y96A 2QI2A 4ZN3A 4OGEA 2PU9B 4PJMA 3H0HA 1NYGA 2YLCA 1WQ7A 5GAMg 3QWYA 1NJIC 3ZEHA 4EMKB 1W4SA 1OU9A 5GMKl 2M1HA 3G6EQ 2CUDA 1NJ2A 3UH0A 4ATOA 2DILA 3PFSA 4DEYA 1VQNQ 1EVKA 2EQKA 4IUPA 4E7LA 1CKAA 4BDYA 4PJNA 4IUUA 2R57A 1QWEA 2L3RA 4O5VA 5LJ3d 4C92B 3JCMQ 4P74C 1RI9A 4RTTA 1AEYA 2QDLA 3QNEA 4RMOA 1VYTA 4M78C 4RCCA 4Y91A 1M90U 2ABLA 4M7AF 5LJ3j 2QEXT 1M3CA 2G3RA 5IHNA 1H3HA 4YPFA 3VS5A 4Q6GA 2DLPA 3HXWA 1OI1A 4M77A 3RUXA 3HXZA 1X54A 4OB0B 2MPXC 4P75A 2HZYA 2J6FA 3WVEB 2F69A 2D9TA 1G3TA 1NLOC 2LC4A 1X2KA 1YFTA 3GLXA 1VQKA 1YJNQ 2J05A 2VGNA 2RJEA 4BE1A 4OB2B 1BI0A 3MEUA 4M7DC 1H4TA 3NPFA 2XI9A 3CCEQ 3SD4A 4NOYA 2DK3A 4ZTFA 4F7UE 4LD9K 2KRMA 2MWOA 3LH0A 3M0PA 3VU3C 3A74A 3BE3A 3A8LB 3D7SB 2FZCB 3DLMA 2P84A 2DZCA 2EFIA 3HFOA 3CMEQ 2EJ9A 3AHUA 3THKA 4GLKA 1AVZC 4HWRA 3DB4A 2YDLA 2RMOA 3G71A 1NJ8A 4M78F 3CCMA 2KR3A 3J7AF 3M4PA 4C0ZA 2K2MA 4ZN1A 2CT3A 2DBMA 1YITA 2JNGA 2GFUA 5KYXA 1HYOA 1KFZA 2LRQA 4C5IA 4BE0A 4XTZA 3HFVA 2C0IA 4BUGA 4M75C 4LDVA 1G83A 4ESRA 2C06A 8ATCB 2ZCEA 4H2VA 1ZA1B 2XGTA 4PJOE 1R0BG 2DU5A 4IIMA 4CC2A 1SSHA 3L2RA 4IURA 1WHJA 2GQVA 2XMFA 4M7AE 1YCYA 2EJFA 4E7JA 2A3LA 2RK2A 5KYUA 1NYRA 1TXQA 1IGQA 3CD6A 4M7DF 1BI1A 4JPBW 2P0LA 3OYKA 2MK5A 4KR2A 3SFMA 2L3SA 1MGQA 1NG2A 5LJ3f 1P92A 3FB9A 1SETA 1UGVA 2VB6A 3VYHB 2FPFA 2CSQA 2JS0A 3CBMA 2K7AA 4FIBA 1W2BA 4R0KA 3JCMJ 3JAME 2CP7A 1XOVA 4OGCA 3CXCA 1KOGA 11ASA 3UFGA 5GAN5 4G84A 1E7OA 4XU1A 4C8QC 3JCMg 2W0ZA 3QIIA 1YIJA 1KG1A 4ANJA 2GNCA 4UP7A 1G3SA 2RN8A 3PVQA 4C92G 1PHTA 2CJ9A 4H2XB 4PL6A 1RLPC 1OX8A 1RAEB 4ZGDB 2O31A 5FU6B 2LDMA 1VQ8T 1X2HA 2YLBA 2DRMA 1RAIB 3R6NA 4O6JA 4M75F 5GAOn 4H2SA 2KT8A 4P71A 2PNIA 1YP5A 2DYBA 3CC7Q 1XQHA 1OZ2A 3NETA 3E1SA 4RG8A 2ODRD 2DXUA 1JJ2S 1W2BP 3AT1B 2K3BA 4O2DA 4KULA 3CXCP 3TUPA 1AHJB 2IY5B 1ASYA 1B70B 2RA2A 2IG0A 3CCUT 2L89A 4AG2C 2E4HA 1E22A 4CS4A 1C1AA 2E1HA 3HY0A 3W3SA 3JCMc 4DOWA 2XG8D 2O9SA 3CCJQ 3JB9H 3CCVA 4E7HA 1VQMT 5LL6S 1M90C 2KDSA 4QQDA 2DXBA 4FSSA 2YUQA 4OMOA 1N5ZA 2JTMA 3RDVA 3H41A 3UT1A 3CQTA 3LWIA 1YFNA 2NUPB 1BBZA 2LX7A 3CCUQ 4M7DE 2DQ0A 4C8QF 2CH4A 2IIMA 2CZ1B 1WLPB 4ZTJA 3G1ZA 1X27A 3EH2A 3I55A 1K8AU 3VBBA 5CCAA 2EAYA 2CZ6B 1ZBXA 3FIFA 1AWOA 4ZNXA 1VQMQ 1NZ9A 4C0DB 4L87A 2KQWA 2V1RA 1HC7A 1TTHB 5GMKh 4JJDA 3ICAA 3UA6A 2AT1B 3NELA 3DSQA 1PRMC 2DQ3A 2KI7A 1BU1A 3H9NA 2HKQB 2ZPBB 3L1AA 1PM3A 3HFZB 4EMHA 2DL4A 2RD1A 1TH7A 3MEVA 4BI3A 4YRNA 1N9SA 4M7AB 3OYGA 4XK8E 2ZT6A 2W10A 2CP2A 1N6AA 4LD6A 5LJ5d 4M75E 3RBBB 2HQEA 3LX7A 3M4QA 1Z9ZA 4HCZA 1VQ5T 5FW9A 2QHTA 5LJ5j 2LMJA 4J6WA 3L4GA 2E5QA 2DTIA 2MIOA 2DM1A 3ZFJA 1HK9A 4QVDA 1UJYA 4HWPA 3CC4Q 2DE0X 2E6NA 4Q5WA 4MZMA 2PMEA 1K9AA 2PUKB 5LJ5h 3LGLA 3QUIA 2E3HA
chains in the Genus database with same CATH topology
2DPPB 1KQ1A 5GAN7 2ARTA 2E41A 3CCLT 3GOXA 1VQ7T 4YRLA 3R6OA 2ZINA 5CR2A 2DDZA 3L2VA 2JVVA 3REXA 5GMKm 4M78B 3JB9F 2E65A 3QPHA 4L6V5 2BIVA 2AMCA 1PSEA 4WJ4A 3M56A 3PCOB 1B76A 1X56A 3FC3A 5D6XA 1JJCA 2M16A 3M9QA 4MDWA 3A8GB 3QO8A 3L42A 3INZA 4YROA 3BY7A 2DIGA 4M7DB 4J7IA 1W2BS 4XQ3A 3FEOA 2RI3A 3REUA 1N8RU 4P73C 3OYAA 3L2ZA 3GNGA 2CKKA 3OB9A 5LJ5f 4TTVA 4EMKA 4J15A 5C52B 5DLOA 4Z02A 2ZZDA 1WGSA 4YRPA 2GF7A 5K1PA 3OYMA 1YJWA 1Z7NA 2C8MA 4R56A 4M7AG 4ZTUB 4M75B 1JB0E 1MHNA 2MMPA 4C92A 1K8AC 1G51A 5EG2A 2MF2A 2LQKA 2OTJT 2VXEA 2RHYA 3QJ6A 3HKSA 1QVFA 1H4QA 1Q7YU 5LJ3e 1WLEA 3PT9A 1ATIA 2VUBA 1VQ9A 4WF2A 4OF1A 4WI1A 2XKOC 12ASA 1B34B 4XU2A 3PTAA 4RMFA 2QQSA 3JCMX 4XTXA 3HY1A 4C8QB 1E24A 3JCMd 1VQ6T 3CMQA 3JSCA 3QYHB 4M78G 4UP9A 2ZNIA 4OB1B 1O9SA 2VYTA 3CCRT 2QXFA 2X4YA 2GFAA 3FJPA 3OYDA 3GF5A 1KD1U 3C95A 2DZ9A 3MEYA 2KY9A 4RQEA 2RHZA 2X4WA 3VUZA 4KR3A 5CK9A 3DKMA 4BI8B 4M7DG 4UP8A 1G5IA 4FT2A 4B9XA 4E7KA 4J6YA 3EFRA 3CCST 4PHCA 2ZT7A 1USYA 3NENA 3V7SA 1Y7XA 2FVUA 2C7IA 1YHQT 3OBWA 2RK1A 4VUBA 2P5IA 4HWOA 3PIPA 2RB6A 3QO3A 1VQZA 5E3IA 2IVWA 2VC8A 3M4YA 3ME9A 3MEWA 4P72A 4M77D 5D6WA 3QHSA 1PYSA 3QDRB 4M75G 1M8VA 1VQLT 2CJAA 2ZPHB 4H2XA 4X34A 1N8RC 5GANh 5J26A 4K88A 2XDBA 4YYEA 1YI2A 1EOVA 2ALYB 3I56A 4RKUE 2OTLT 1O75A 3JCMf 3NTKA 1K9MU 4YRJA 2RI2A 2PMFA 1G3YA 3X26B 5D6YA 4ZGJB 1NJ6A 4EDUA 1EIFA 5A0GA 3VQYA 2IY5A 2D6FA 2EQUA 2B8AA 3RKWA 2ARUA 4PJOC 3JB9I 2QEXA 4E7IA 3LSSA 4KUIA 3JCMW 3PGGA 4C8QG 1WNLA 5LJ5g 3G6ET 3TEHB 3QZ5B 1GXIE 3T9NA 3IKMB 4X9DA 2RHSB 3V8JA 4F7UF 1OZ3A 4MMKA 2K3XA 2QHSA 4TVYA 1Q7YC 2ZT8A 3RMQA 2Q7GA 2VXFA 1E1TA 4A4FA 3MF2A 4TVAB 2QHVA 3CPWS 2RHUA 3TREA 1J5WA 1SESA 4CH5A 1KC8U 3CPFA 2CYZB 4ZTZB 2Y90A 2EWNA 2VGMA 4P75C 5CAIA 3ZBDA 1H3ZA 1QVFS 1YGBA 4BW9A 1SERA 3RKYA 5A2QE 1BYMA 3IG2A 4LVLA 3G7ZA 4M7AA 4PJOF 1WJRA 2QA4A 4YREA 4NS5A 2HD0A 4N4HA 2JTFA 1YJNT 4JRIA 4OP0A 3KBGA 4MZPA 1EVLA 1KD1C 2H3JA 3RMSA 3CCET 1BIAA 5FLXE 2LNVA 3Q1JA 3QZ9B 2V8IA 1BBUA 3G4SA 5DLQE 4MDXA 3OSVA 3CMET 1RL2A 1GGMA 3BDUA 3LGFA 2P0KA 1UEBA 3JB9G 5GAMe 1H641 2EKOA 3S3OA 3CCQT 5I2SA 4P74A 2ZPIB 1Z7MA 5FRMA 4M78A 2DXCA 2VV5A 3PCOA 2Q5IA 1VQ8A 4A4KA 3P8YA 4AH6A 1N9RA 3C94A 1IZ6A 2ZR2A 3WXMB 4M7DA 5F5WA 4LNSA 3A8HB 3RESA 1K9MC 4IUTA 3V7CA 3VV0A 1UB4A 3UGTA 4BI4A 3M58A 3MEAA 3LC0A 1N27A 4FU6A 3OYIA 2RO0A 3CC7T 1G3WA 2BKDN 3HXYA 3BW1A 3SWNC 3OS5A 5M9OA 1FXXA 4TVWA 5GAN8 3OYCA 4M75A 1SRYA 4G85A 2JOYA 2DAQA 2LVMA 3ERRA 2Y4YA 4YCVA 4JRQA 3RGLA 3CCJT 4JDSA 3L2UA 3P8VA 2EIFA 2EQJA 1KC8C 4JJNK 1QW1A 4LVIA 2PVOB 2LT1A 3FLGA 4XEOA 1VQ5A 3V8LA 1B8AA 1UGRB 3C12A 1N9WA 3ASKA 4F7UB 4C8QA 4D6WA 4KBMB 4N0AC 1U8RA 1BI2A 2WSFE 2E64A 5GMKj 1Q82U 4J6XA 3CD6T 5GANg 1WQWA 1VIFA 4OMFB 3HRUA 3JCMe 5FRNA 4DPGA 1I5LA 3EAEA 4HT8A 2DTOA 3OMCA 3C4SA 4WJ3M 1G5VA 2AKWB 2I4LA 2PUOB 2LX9A 1WU7A 4RDXA 4PJOB 4YRRA 2DTHA 4EMGA 3HHTB 5GAOr 2WSEE 1X75C 5CO7A 4XTUA 3CC4T 1DJ7B 2M0OA 3VQXA 2XIDA 4C92D 3CBPA 2XICA 2ODRC 2O01E 4XAXB 2ZPEB 1VQPT 2R58A 1UGQB 1EIYB 2XTIA 1G5HA 2P0PA 4H2WA 3X24B 5HGQA 3QYGB 3VYGA 1M1GA 3CCVT 1JRIA 3MP8A 2RJDA 3HXUA 2OAUA 3A5ZB 3L2QA 3H8ZA 2ALYA 2I4NA 1FX7A 1VQ4T 1ADJA 4TVRA 3OYYA 3EFSA 3UWNA 4YDQA 1XTDA 2QDYB 1X01A 2OTJA 3A7RA 3MO8A 5GAMh 3PZCA 3QO7A 5IN1A 3BJUA 4F7UG 1NE8A 1Y71A 3E9FA 5CKFA 3I7FA 3TEHA 3QO5A 4YRIA 2RHSA 2RHXA 2QQBA 1M1KU 3CBOA 2CS7A 2L5QA 3M5AA 4QQGA 1QVPA 1M1FA 2E10A 5CQXA 4TVAA 3HTZA 4GY5A 2L8DA 4YRTA 4XTYA 1UGSB 5FU7C 1Q86U 4EPCA 4PJOG 3L2WA 1W66A 2Q7EA 3CPWA 3CCRA 3M54A 1NJ1A 3RACA 5HY6A 2EQMA 5CVIA 4KQEA 3A7AA 5IT9E 3X25B 4ELYC 2HAXA 3E9HA 2MI6A 3P8DA 1UGPB 4BDZA 2FL7A 4P73A 4HWTA 1ZQ1A 3JRZA 3HRTA 5I21A 4CH3A 4BE2A 3CCSA 2RM4A 2ZT5A 5GAOl 1QE0A 5AYFA 2P4TA 1LYLA 4ZGEB 4L5GA 3N5BB 3E9GA 2MAMA 1YHQA 4YRCA 3SWNB 3OYNA 2DEQA 4HT4A 4FT4A 5GAN2 1QP2A 2ZZEA 5CQYA 5KH6A 3RF1A 2ZNJA 1I81A 3TEEA 2NS6A 2ZZGA 1QF6A 4X9CA 4KUDK 4UC4A 2ZPGB 4H02A 4C5GA 4A4GA 2M9UA 2J3LA 2ZXFA 4M7AD 4JUVA 5GANd 2ZGWA 3OSSC 3G6EA 2DU7A 2F5TX 4BB7A 5GANj 3SDZA 3TEGA 1NPPA 1HTTA 1KQSA 2CZ7B 3FRNA 1VQNA 3DB3A 1YJ9T 4C92E 1QVGA 3M53A 3P8BB 2ARSA 2BUDA 4JLIA 4YCUA 1RI0A 1QP3A 1C0AA 2K5FA 4R55A 4LDWA 1Y07A 2J3MA 2YRVA 1M1KC 5ELOA 2QQAA 4IUVA 4QVCA 5DY9A 2XDPA 1VQOT 2AHJB 2R5MA 4QVZA 4IUQA 3OYJA 1LNXA 3GNFB 4QQ6A 1Q86C 3BFMA 2K4YA 1NYQA 4XEMA 4M78D 1B70A 2RHQB 2DVEA 2Q7HA 4C5EA 4YCWA 1YJNA 4C0FA 4JS5A 3V7RA 3JCMP 4F7UA 4FSXA 1D3BB 3CCEA 4EO4A 1S72T 5A0LA 1U1SA 1L0WA 2DD4A 5GAN3 1JJCB 3META 4M7DD 1K73U 2P0QA 3CMEA 5GMKe 4LDXA 4PLLA 3PNWC 5GANf 3V8KA 3CCQA 2DXTA 4YRSA 3TCJA 1Q81U 4M77C 1KHIA 5C0MA 2AKWA 3NEMA 2KSSA 4PJOA 3HFZA 3CC2T 3JCMb 1KHCA 5C6SA 2A8EA 3OD1A 1OYXA 4IKFA 4LVMA 3LWHA 3S3MA 1YI2T 3I56T 1YBYA 4RCBA 1EQRA 4M75D 1YFRA 5C53B 4DQ2A 2JN0A 1R8OB 4HWSA 2FB7A 3OY9A 4H2TA 3OA6A 3OYEA 1EIYA 3IKLA 3S6WA 5LJ5e 1LOJA 1XNIA 1ADYA 3QSUA 5FU7B 3WVDB 2O4XB 4PKCC 2KMTA 3RL6A 2FYKA 2XK0A 4ZIBA 5GAN6 2ZPFB 3CMAT 3A5ZA 2LCLA 4M77F 3OS0A 1FWZA 4MMLA 3MCAB 3JCMV 5LJ3h 4C8QD 1FYFA 3CC7A 1X55A 2E12A 5J3BA 2E5AA 2I4OA 3A5YA 3GPLA 2JZ2A 4LDYA 4KT0E 3R07A 4A54A 1IL2A 1IREB 2I2LA 3RIRA 4HVCA 2Q5HA 3MF1A 3CCJA 3OYHA 1ASZA 3X28B 4CH4A 2QA4T 2A7YA 3HXXA 2HQXA 3CCUA 1KQSS 3TU4K 1WPYA 4K87A 3MP1A 1QVGS 2G4CA 1I8FA 5DM7R 4P3PA 3A7UA 3F70A 5HK3A 1ZHIA 4V2SA 1VQMA 2DJZA 4P71C 5GAOm 3J81E 4L59A 3G4ST 4A53A 4YRGA 5C51B 1VQKT 3IALA 5CKHA 4EX5A 5GAN4 2CZ0B 4YTLA 4A4HA 4RG2A 3HSBA 4J5YA 2EJGA 4FL6A 4M77E 4CS3A 4TWAA 3MP6A 4XU3A 1K73C 4YP0A 2YHTA 2X4JA 2HBPA 3MHXA 3DLLA 3LLRA 2RI5A 4TQFA 1BI3A 3OYBA 2KK4A 4P3NA 1PYSB 4BACA 3UGQA 4J83A 2K2VA 3JB9D 5CIUA 3G71T 1WJQA 3CCMT 5CKBA 1Q81C 1YITT 3VUBA 3CC4A 5HK0A 3VKIA 3GP8A 1B7YB 1SSFA 1B34A 3OS2A 5K1XA 2CJBA 1WJSA 4XU0A 3QJYA 4YRQA 4M78E 3SWNA 1VUBA 4JRKA 1VQPA 3OMGA 3VQWA 4BD3A 3HRSA 1WYDA 3KUFA 2V8KA 4PNOA 3ER0A 4X5OA 4RQFA 1KQ2A 2DIQA 3BDLA 1KMNA 3M59A 5KE3A 4A4EA 3M55A 4Y28E 1Y96B 3CCLA 1VQ7A 2E70A 2MWPA 5IAYA 2ZTGA 5L8RE 3NTHA 1YIJT 1VQ4A 3P8HA 3CEYA 2V8JA 4C0GA 4BWAA 2LQ8A 2KAFA 3QBYA 2XU8A 5HKCA 3OBYA 3KFUA 4N0AA 3J80E 4BY6C 2K5IA 2ZR3A 4ME7A 2ZZFA 2DO3A 1EFWA 5KE2A 1VIEA 1NPRA 3HXVA 1YB3A 3HRKA 2HNIA 3HL8A 4CI0C 4M77B 5GANe 1BKBA 1X2GA 5GAMd 3NFCA 2LTOA 4HCBA 2E3CA 3P8TA 3A32A 5GAMj 3I55T 1E1OA 4XTVA 2NLUA 4MZTA 1NJ5A 3WQZA 3OYFA 1H4SA 2I4MA 3UDCA 4C8QE 4C5HA 2QQRA 4B9WA 2RHQA 2K5LA 3OW2A 4EMKC 2RJCA 3PMIA 1YFSA 4DOVA 1D3BA 4UPAA 3VJPA 2DKGA 2K3YA 3HFNA 2DD5A 4HT9A 5LJ3g 4CS2A 4C92C 3KXTA 4PLIA 3QKJA 4E47A 5ELNA 2X35A 1VQ6A 2X4XA 2XDDA 3CXCS 1V29B 4LVKA 4J8OA 1U1TA 1Q82C 3M4GA 5I2MA 1I4K1 4N4IA 4PG3A 1PSFA 3M57A 2WACA 2PVDB 4NCXA 2RJFA 3LYIA 5GAMf 1M9SA 3HPWA 5A0DA 4K86A 4E51A 2Y4XA 1H4VB 5GAOp 2FHDA 4CH6A 3A8MB 2E6ZA 4YRKA 4P5NA 4P3OA 2PVGB 4C92F 4Q15A 4M77G 1BIBA 2QQ9A 2O4XA 2ZCFB 4YRMA 3RKXA 3H6ZA 1NJIU 2GCXA 3QG1A 4JS4A 2K57A 2QTXA 1YJ9A 1NNHA 3O8VA 2JUFA 4XTWA 3NTIA 4H2YA 1VQLA 1USYC 4TQDA 4HA8A 2R5AA 4J7FA 5GAOq 2EYQA 4LVJA 4CRIA 4OB3B 1YJWT 3GIBA 2OTLA 1VQOA 4OVAA 4FM4B 3URGA 3OYLA 2KVQG 3HP9A 4P72C 2CGHA 2F5KA 2XHCA 2QHUA 3A31A 2LT4A 2PQWA 4PJOD 3X20B 3JCMh 3MQZA 3LW5E 4QW2A 3A8OB 5KCHA 5FU6C 3SB2A 3LSQA 2LCCA 3QTCA 1VQ9T 1S72A 4NL2A 5CKDA 4HKEA 5FROA 3QXEB 3VQVA 2D0QB 4II1A 2ZIOA 3L4GB 4JRPA 2ZIMA 4JLGA 5J39A 1KMMA 2RHIA 3JB9J 2EL9A 4DA4A 3HRIA 5CKEA 4BY6B 3OW2S 4N4GA 3CC2A 2XD0A 4H2UA 5KCOA 1LJOA 1X6OA 1B7YA 1HXDA 4YRFA 4HCCA 3OS1A 2AMCB 3PIOA 4C0DC 3FDRA 1BBWA 2RH2A 3OQ5A 5GMKi 3PMTA 3S3NA 3UPUA 4OLFA 2WSCE 1JJ2A 5KNNA 1M5Q1 3E19A 4M7AC 4ELZC 4NL3A 1JBMA 1M4ZA 4LDUA 3E9IA 3RERA 1VQNT 3CMAA 1RIQA 2CIMA 1Y96A 2QI2A 4ZN3A 4OGEA 2PU9B 2YLCA 1WQ7A 5GAMg 1NJIC 3ZEHA 4EMKB 1W4SA 5GMKl 2M1HA 1NJ2A 3UH0A 4ATOA 3PFSA 1EVKA 2EQKA 4IUPA 4E7LA 4BDYA 4IUUA 2R57A 2L3RA 4O5VA 5LJ3d 4C92B 3JCMQ 4P74C 3QNEA 4RMOA 4M78C 4RCCA 4Y91A 1M90U 4M7AF 5LJ3j 2QEXT 2G3RA 4YPFA 4Q6GA 3HXWA 1OI1A 4M77A 3RUXA 3HXZA 1X54A 4OB0B 4P75A 3WVEB 2F69A 2D9TA 1G3TA 2LC4A 1YFTA 3GLXA 1VQKA 2VGNA 2RJEA 4BE1A 4OB2B 1BI0A 3MEUA 4M7DC 1H4TA 2XI9A 3SD4A 4NOYA 2DK3A 4ZTFA 4F7UE 4LD9K 2MWOA 3LH0A 3VU3C 3A74A 3A8LB 3DLMA 2DZCA 2EFIA 3HFOA 2EJ9A 3AHUA 4GLKA 4HWRA 3DB4A 3G71A 1NJ8A 4M78F 3CCMA 3J7AF 3M4PA 4C0ZA 4ZN1A 1YITA 2JNGA 2GFUA 2LRQA 4C5IA 4BE0A 4XTZA 3HFVA 4BUGA 4M75C 4LDVA 2C06A 2ZCEA 4H2VA 2XGTA 4PJOE 2DU5A 3L2RA 4IURA 2GQVA 4M7AE 1YCYA 2EJFA 4E7JA 2A3LA 2RK2A 1NYRA 3CD6A 4M7DF 1BI1A 2P0LA 3OYKA 4KR2A 3SFMA 1MGQA 5LJ3f 1P92A 3FB9A 1SETA 3VYHB 3CBMA 4FIBA 1W2BA 3JCMJ 3JAME 1XOVA 4OGCA 3CXCA 1KOGA 11ASA 3UFGA 5GAN5 4G84A 4XU1A 4C8QC 3JCMg 3QIIA 1YIJA 1KG1A 4UP7A 1G3SA 4C92G 2CJ9A 4H2XB 4PL6A 4ZGDB 5FU6B 2LDMA 1VQ8T 1X2HA 2YLBA 4O6JA 4M75F 5GAOn 4H2SA 4P71A 1XQHA 1OZ2A 3NETA 3E1SA 4RG8A 2ODRD 2DXUA 1JJ2S 4O2DA 4KULA 3TUPA 1AHJB 2IY5B 1ASYA 1B70B 2RA2A 2IG0A 3CCUT 2L89A 1E22A 4CS4A 2E1HA 3HY0A 3W3SA 3JCMc 4DOWA 2XG8D 3JB9H 3CCVA 4E7HA 1VQMT 5LL6S 1M90C 2KDSA 4QQDA 2DXBA 2JTMA 3UT1A 3LWIA 4M7DE 2DQ0A 4C8QF 4ZTJA 2CZ1B 3G1ZA 3I55A 3VBBA 1K8AU 5CCAA 2EAYA 2CZ6B 1ZBXA 3FIFA 1NZ9A 4C0DB 4L87A 2KQWA 1HC7A 5GMKh 3ICAA 3NELA 3DSQA 2DQ3A 2ZPBB 3L1AA 3HFZB 4EMHA 2RD1A 4BI3A 1TH7A 3MEVA 4YRNA 1N9SA 4M7AB 3OYGA 4XK8E 2ZT6A 1N6AA 4LD6A 5LJ5d 4M75E 2HQEA 3LX7A 3M4QA 4HCZA 1VQ5T 2QHTA 5LJ5j 4J6WA 3L4GA 2E5QA 2DTIA 3ZFJA 1HK9A 4QVDA 4HWPA 2E6NA 4Q5WA 4MZMA 2PMEA 2PUKB 5LJ5h 3LGLA 3QUIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DXT A;  3HXY A;  4YRS A;  3BW1 A;  4M77 C;  3SWN C;  5GAO q;  1KQ1 A;  2AKW A;  5GAN 7;  2ART A;  4TVW A;  2E41 A;  5GAN 8;  4M75 A;  3NEM A;  4PJO A;  3HFZ A;  4YRL A;  2ZIN A;  3GIB A;  3JCM b;  2DDZ A;  1SRY A;  3OD1 A;  4G85 A;  3REX A;  5GMK m;  4M78 B;  3JB9 F;  2E65 A;  3ERR A;  4YCV A;  4P72 C;  4RCB A;  2AMC A;  3RGL A;  2CGH A;  4WJ4 A;  1EQR A;  3PCO B;  2QHU A;  4M75 D;  3A31 A;  4PJO D;  1YFR A;  3P8V A;  1B76 A;  1X56 A;  5C53 B;  4DQ2 A;  2JN0 A;  3JCM h;  4HWS A;  2FB7 A;  1JJC A;  4H2T A;  3SB2 A;  3LSQ A;  3IKL A;  4XEO A;  1EIY A;  5LJ5 e;  3QO8 A;  1LOJ A;  3V8L A;  1B8A A;  3QTC A;  3INZ A;  4YRO A;  3BY7 A;  1N9W A;  4M7D B;  4NL2 A;  1ADY A;  4F7U B;  3QSU A;  4C8Q A;  3VQV A;  4N0A C;  4XQ3 A;  2ZIO A;  2E64 A;  3L4G B;  5GMK j;  3RL6 A;  4J6X A;  2ZIM A;  2FYK A;  3REU A;  4ZIB A;  5GAN 6;  5GAN g;  4P73 C;  1WQW A;  3A5Z A;  4M77 F;  3L2Z A;  5LJ5 f;  4TTV A;  4MML A;  4EMK A;  1KMM A;  4J15 A;  3JCM V;  5C52 B;  5LJ3 h;  4C8Q D;  3JB9 J;  1FYF A;  1X55 A;  2EL9 A;  3HRI A;  3JCM e;  4DPG A;  4YRP A;  5K1P A;  1I5L A;  2E5A A;  4HT8 A;  2I4O A;  3A5Y A;  2DTO A;  4WJ3 M;  1Z7N A;  2C8M A;  2AKW B;  2I4L A;  4A54 A;  3R07 A;  1IL2 A;  4M7A G;  1WU7 A;  4ZTU B;  4M75 B;  4RDX A;  2I2L A;  3RIR A;  4PJO B;  4H2U A;  1LJO A;  4HVC A;  4C92 A;  4YRR A;  2DTH A;  4EMG A;  1G51 A;  1B7Y A;  5GAO r;  2Q5H A;  3MF1 A;  1HXD A;  2VXE A;  4YRF A;  4XTU A;  1ASZ A;  2AMC B;  4CH4 A;  1BBW A;  3VQX A;  3HXX A;  5GMK i;  1H4Q A;  4C92 D;  2ODR C;  1WPY A;  5LJ3 e;  4K87 A;  4OLF A;  2G4C A;  1WLE A;  1I8F A;  1ATI A;  3A7U A;  4P3P A;  4WF2 A;  4WI1 A;  12AS A;  5KNN A;  1M5Q 1;  1EIY B;  4M7A C;  4V2S A;  1B34 B;  2XTI A;  2DJZ A;  4NL3 A;  4XU2 A;  1G5H A;  4RMF A;  1JBM A;  4P71 C;  4H2W A;  5GAO m;  5HGQ A;  3JCM X;  4XTX A;  3HY1 A;  4A53 A;  4YRG A;  4C8Q B;  1E24 A;  3E9I A;  1JRI A;  3RER A;  5C51 B;  3JCM d;  1RIQ A;  2CIM A;  3CMQ A;  1Y96 A;  3IAL A;  4EX5 A;  5GAN 4;  3HXU A;  2YLC A;  1WQ7 A;  5GAM g;  4M78 G;  3HSB A;  4J5Y A;  4UP9 A;  2ZNI A;  2EJG A;  4EMK B;  4M77 E;  5GMK l;  2ALY A;  4CS3 A;  2I4N A;  4TWA A;  4XU3 A;  4YP0 A;  1NJ2 A;  2YHT A;  1ADJ A;  3UH0 A;  4TQF A;  4P3N A;  1EVK A;  1PYS B;  3FJP A;  3UGQ A;  3EFS A;  3JB9 D;  2DZ9 A;  3MEY A;  4YDQ A;  4RQE A;  1X01 A;  4KR3 A;  3A7R A;  5GAM h;  5LJ3 d;  3PZC A;  4C92 B;  3QO7 A;  4M7D G;  3JCM Q;  1B7Y B;  4P74 C;  3BJU A;  4UP8 A;  1G5I A;  4F7U G;  3QNE A;  1B34 A;  5K1X A;  4M78 C;  4RCC A;  4Y91 A;  2CJB A;  4M7A F;  5LJ3 j;  3I7F A;  3TEH A;  4J6Y A;  3EFR A;  4PHC A;  3QO5 A;  2ZT7 A;  4XU0 A;  1USY A;  4YPF A;  4YRI A;  4Q6G A;  4YRQ A;  4M78 E;  3NEN A;  3V7S A;  3HXW A;  3SWN A;  4JRK A;  4M77 A;  2RHS A;  2C7I A;  3VQW A;  3RUX A;  3HXZ A;  1X54 A;  4HWO A;  1WYD A;  4P75 A;  2P5I A;  2RB6 A;  4PNO A;  3QO3 A;  1VQZ A;  5E3I A;  2VC8 A;  4X5O A;  1YFT A;  4RQF A;  2E10 A;  1KQ2 A;  4P72 A;  4TVA A;  4M77 D;  3HTZ A;  4M7D C;  1H4T A;  1KMN A;  4YRT A;  4XTY A;  3QHS A;  1PYS A;  4M75 G;  1Y96 B;  4PJO G;  4NOY A;  1M8V A;  2CJA A;  2ZTG A;  4F7U E;  1W66 A;  4H2X A;  2Q7E A;  3VU3 C;  3A74 A;  1NJ1 A;  5GAN h;  4K88 A;  3RAC A;  4YYE A;  2DZC A;  1EOV A;  2ALY B;  3HFO A;  4KQE A;  4BWA A;  2EJ9 A;  3A7A A;  3AHU A;  4HWR A;  3JCM f;  3E9H A;  1NJ8 A;  4YRJ A;  2PMF A;  4M78 F;  3KFU A;  4N0A A;  3M4P A;  1NJ6 A;  4P73 A;  2ZR3 A;  3VQY A;  2IY5 A;  4XTZ A;  2ZZF A;  3HFV A;  4HWT A;  3RKW A;  4M75 C;  2ARU A;  1EFW A;  4PJO C;  5I21 A;  4CH3 A;  3JB9 I;  2ZCE A;  3LSS A;  4H2V A;  3JCM W;  2RM4 A;  3PGG A;  2ZT5 A;  5GAO l;  1QE0 A;  3HXV A;  1YB3 A;  4C8Q G;  2XGT A;  1WNL A;  3HRK A;  2HNI A;  4PJO E;  5LJ5 g;  2DU5 A;  3TEH B;  1LYL A;  4M7A E;  1YCY A;  2EJF A;  1NYR A;  3IKM B;  4X9D A;  4M7D F;  2P0L A;  4YRC A;  3SWN B;  4M77 B;  5GAN e;  2RHS B;  4KR2 A;  3V8J A;  4F7U F;  1MGQ A;  5LJ3 f;  3FB9 A;  1X2G A;  4MMK A;  5GAM d;  1SET A;  2QHS A;  2DEQ A;  4TVY A;  2E3C A;  2ZT8 A;  2Q7G A;  2VXF A;  3P8T A;  5GAN 2;  3A32 A;  1E1T A;  5GAM j;  2ZZE A;  3JCM J;  1E1O A;  4XTV A;  3MF2 A;  4TVA B;  3RF1 A;  2QHV A;  11AS A;  1KOG A;  3UFG A;  2ZNJ A;  5GAN 5;  4G84 A;  1NJ5 A;  4XU1 A;  4C8Q C;  1J5W A;  3JCM g;  1SES A;  1I81 A;  4CH5 A;  2I4M A;  3WQZ A;  1H4S A;  4UP7 A;  2CJ9 A;  4C92 G;  4ZTZ B;  2Y90 A;  4H2X B;  2EWN A;  4C8Q E;  2ZZG A;  4P75 C;  5CAI A;  1YGB A;  1SER A;  2RHQ A;  4BW9 A;  1X2H A;  3RKY A;  2YLB A;  3IG2 A;  1QF6 A;  4EMK C;  4M7A A;  4X9C A;  4M75 F;  5GAO n;  4H2S A;  4PJO F;  4P71 A;  4YRE A;  4H02 A;  3NET A;  2ODR D;  1YFS A;  2DXU A;  4JRI A;  1D3B A;  4OP0 A;  2J3L A;  4O2D A;  1EVL A;  4UPA A;  2ZXF A;  4M7A D;  3TUP A;  2DKG A;  4JUV A;  2IY5 B;  5GAN d;  1B70 B;  1BIA A;  2RA2 A;  3HFN A;  1ASY A;  4HT9 A;  2ZGW A;  5LJ3 g;  2DU7 A;  4C92 C;  1BBU A;  1E22 A;  4CS2 A;  2E1H A;  4CS4 A;  5GAN j;  3HY0 A;  3W3S A;  3TEG A;  3JCM c;  3JB9 H;  1HTT A;  5ELN A;  4C92 E;  1GGM A;  3BDU A;  2ARS A;  4JLI A;  4YCU A;  3JB9 G;  1C0A A;  5GAM e;  1H64 1;  4M7D E;  2DQ0 A;  4C8Q F;  3G1Z A;  1U1T A;  3VBB A;  3M4G A;  1I4K 1;  2J3M A;  2EAY A;  4P74 A;  5ELO A;  4PG3 A;  3FIF A;  1Z7M A;  4M78 A;  4QVC A;  5DY9 A;  4NCX A;  4L87 A;  1HC7 A;  3PCO A;  5GMK h;  5GAM f;  2Q5I A;  3ICA A;  1LNX A;  3NEL A;  3DSQ A;  2DQ3 A;  3BFM A;  1NYQ A;  3L1A A;  4K86 A;  4XEM A;  4E51 A;  4M78 D;  3P8Y A;  4AH6 A;  1N9R A;  3HFZ B;  1B70 A;  4EMH A;  1H4V B;  2RD1 A;  2RHQ B;  1TH7 A;  5GAO p;  4CH6 A;  4YRN A;  1N9S A;  4M7A B;  2DVE A;  2Q7H A;  2ZT6 A;  4YRK A;  4YCW A;  5LJ5 d;  2ZR2 A;  4M75 E;  4P3O A;  4C92 F;  4Q15 A;  4M7D A;  4M77 G;  3M4Q A;  5F5W A;  3V7R A;  3JCM P;  1BIB A;  4F7U A;  4LNS A;  2QHT A;  3RES A;  1D3B B;  4EO4 A;  5LJ5 j;  1U1S A;  1L0W A;  3V7C A;  4J6W A;  5GAN 3;  3L4G A;  4YRM A;  1JJC B;  2DTI A;  3RKX A;  1HK9 A;  3UGT A;  4QVD A;  4M7D D;  2K57 A;  2QTX A;  1NNH A;  4HWP A;  5GMK e;  2PME A;  3LC0 A;  4XTW A;  5LJ5 h;  4H2Y A;  3QUI A;  5GAN f;  3V8K A;  1USY C;  4TQD A;  4HA8 A; 
#chains in the Genus database with same CATH topology
 1CKB A;  2QAS A;  2DPP B;  4PFP A;  2FRY A;  1KQ1 A;  5GAN 7;  2ART A;  2E41 A;  2CP0 A;  1AZG B;  1TOV A;  3GOX A;  3CCL T;  1VQ7 T;  2ED1 A;  4YRL A;  3R6O A;  2ZIN A;  5CR2 A;  2DDZ A;  3L2V A;  2JVV A;  3REX A;  5GMK m;  2ESW A;  4M78 B;  3JB9 F;  3ULR B;  2E65 A;  3QPH A;  2JXB A;  2YXY A;  4L6V 5;  2BIV A;  2AMC A;  1PSE A;  4WJ4 A;  3M56 A;  3PCO B;  2GTO A;  2PTK A;  1B76 A;  1X56 A;  3FC3 A;  1I0C A;  3CCL Q;  1VQ7 Q;  5D6X A;  1PC0 A;  1JJC A;  2M16 A;  2EQI A;  3C0C A;  3M9Q A;  1Y57 A;  4MDW A;  1VQ4 Q;  1WFW A;  4F14 A;  3A8G B;  3QO8 A;  1NEB A;  3L42 A;  4M4Z A;  4J9F A;  3INZ A;  4YRO A;  3BY7 A;  2DIG A;  4M7D B;  4J7I A;  1ZX6 A;  1W2B S;  4XQ3 A;  3FEO A;  4DBQ A;  2RI3 A;  1TUG B;  1TWB A;  3REU A;  1UUE A;  4D8K A;  1N8R U;  4P73 C;  3OYA A;  3L2Z A;  3GNG A;  1FYN A;  2CKK A;  3OB9 A;  5LJ5 f;  2JJ9 A;  4TTV A;  4EMK A;  1RAD B;  4J15 A;  1D09 B;  2OJ2 A;  5C52 B;  2CP5 A;  5DLO A;  2CSI A;  4Z02 A;  2ZZD A;  1U5S A;  1WGS A;  4YRP A;  2GF7 A;  5K1P A;  3OYM A;  1PKT A;  1MND A;  1TUC A;  3NMZ C;  1YJW A;  1Z7N A;  2C8M A;  4R56 A;  4M7A G;  4ZTU B;  3VS4 A;  4M75 B;  1JB0 E;  2LJ0 A;  4PFO A;  1KIK A;  1MHN A;  2MMP A;  4C92 A;  1K8A C;  1G51 A;  5EG2 A;  2MF2 A;  1M3A A;  1C0M A;  2LQK A;  2OTJ T;  2VXE A;  1GBQ A;  2RHY A;  3QJ6 A;  1PRL C;  3HKS A;  1ZSZ C;  1QVF A;  1QKW A;  2RPN A;  1ARK A;  2KXD A;  1H4Q A;  4RTU A;  3KFV A;  1Q7Y U;  5LJ3 e;  1WLE A;  3PT9 A;  1ATI A;  2VUB A;  1VQ9 A;  4WF2 A;  4OF1 A;  4WI1 A;  2XKO C;  1CSK A;  12AS A;  4DBF A;  5FWC A;  1B34 B;  4XU2 A;  3PTA A;  4RMF A;  2QQS A;  3IQL A;  3JCM X;  2O9V A;  1JU5 C;  1W70 A;  4XTX A;  3HY1 A;  4C8Q B;  1E24 A;  3JCM d;  1VQ6 T;  2ED0 A;  3CMQ A;  3JSC A;  1KJW A;  1QVF P;  3HTR A;  3QYH B;  4M78 G;  4UP9 A;  2ZNI A;  2BTT A;  1UE9 A;  4OB1 B;  1O9S A;  2VYT A;  1NLP C;  2J6O A;  4J9E A;  3CCR T;  2CRE A;  1WHK A;  2QXF A;  2X4Y A;  2GFA A;  1VQ6 Q;  2JMC A;  3FJP A;  3OYD A;  3GF5 A;  1KD1 U;  1T0H A;  3C95 A;  2DZ9 A;  3MEY A;  2KY9 A;  1MMD A;  4RQE A;  2RHZ A;  2X4W A;  3VUZ A;  4KR3 A;  5CK9 A;  3UA7 A;  2EBP A;  3REA B;  3DKM A;  4BI8 B;  4M7D G;  3CCR Q;  4UP8 A;  1G5I A;  4FT2 A;  2KYB A;  2DFU A;  4B9X A;  4E7K A;  4J6Y A;  3EFR A;  3CCS T;  4PHC A;  2ZT7 A;  1USY A;  1V76 A;  2LJ1 A;  3NEN A;  3V7S A;  1JEG A;  1SPK A;  1Y7X A;  2FVU A;  2C7I A;  5IXB A;  1YHQ T;  3OBW A;  2RK1 A;  4VUB A;  2P5I A;  4HWO A;  3PIP A;  2IPO B;  1Y0M A;  2RB6 A;  3QO3 A;  1VQZ A;  1WXU A;  1E6H A;  5E3I A;  2IVW A;  2VC8 A;  3M4Y A;  3ME9 A;  4HXJ A;  3MEW A;  1ZSG A;  4P72 A;  4M77 D;  5D6W A;  2NUZ A;  3QHS A;  1PYS A;  3EG1 A;  3QDR B;  2QTV A;  4M75 G;  2AZV A;  1JXO A;  1M8V A;  1VQL T;  2CJA A;  2ZPH B;  2HBW A;  4H2X A;  4X34 A;  3PE0 A;  1N8R C;  5GAN h;  5J26 A;  4K88 A;  1PWT A;  2XDB A;  4YYE A;  2HKN A;  1YI2 A;  2SRC A;  1EOV A;  3I56 A;  1K1Z A;  2ALY B;  2QGG A;  1YJ9 Q;  4RKU E;  2OTL T;  2AIR B;  1O75 A;  3JCM f;  5IHK A;  1EFN A;  3NTK A;  1K9M U;  1K8A R;  4YRJ A;  2RI2 A;  2PMF A;  2AZS A;  1G3Y A;  3X26 B;  5D6Y A;  4ZGJ B;  1VQL Q;  1NJ6 A;  4EDU A;  1WIE A;  1EIF A;  2KT1 A;  1EZZ B;  2D8J A;  5A0G A;  3VQY A;  2IY5 A;  3PVL A;  2D6F A;  2BZY A;  2EQU A;  4JZ4 A;  2B8A A;  3RKW A;  6AT1 B;  2ARU A;  4PJO C;  5EC7 A;  3JB9 I;  2DER A;  2QEX A;  4E7I A;  4F17 A;  2OTL Q;  1VQO Q;  3LSS A;  4KUI A;  3JCM W;  3PGG A;  4C8Q G;  1WNL A;  5LJ5 g;  2CP6 A;  3G6E T;  1SKU B;  3TEH B;  3QZ5 B;  4Z89 A;  3T9N A;  1GXI E;  3IKM B;  4X9D A;  2RHS B;  3V8J A;  4F7U F;  1OZ3 A;  2NUP A;  3M0T A;  4J9C A;  4MMK A;  2K3X A;  3A98 A;  2QHS A;  4TVY A;  2Z0W A;  1Q7Y C;  1SRM A;  2ZT8 A;  1D0Z A;  3RMQ A;  2Q7G A;  2VXF A;  1AZE A;  1E1T A;  4A4F A;  1NM7 A;  3MF2 A;  4FYX B;  4TVA B;  2QHV A;  3CPW S;  4RTY A;  2RHU A;  3TRE A;  1JJ2 P;  1J5W A;  1SES A;  4CH5 A;  1G2B A;  2YUO A;  1KC8 U;  3CPF A;  2K6D A;  2CYZ B;  4ZTZ B;  2Y90 A;  1F1B B;  2EWN A;  2VGM A;  4P75 C;  5CAI A;  3ZBD A;  3QWX X;  1QVF S;  1H3Z A;  1YGB A;  4BW9 A;  1SER A;  3RKY A;  5A2Q E;  1BYM A;  3IG2 A;  4LVL A;  3G7Z A;  4M7A A;  2X51 A;  4PJO F;  1WJR A;  2QA4 A;  2HL5 C;  4YRE A;  2L2P A;  1W1F A;  4NS5 A;  4AFU C;  2HD0 A;  3ZL7 C;  4N4H A;  2JTF A;  1YJN T;  4JRI A;  4OP0 A;  3KBG A;  4MZP A;  2F2W A;  4AFS C;  1EVL A;  1W6X A;  1KD1 C;  2H3J A;  3RMS A;  3CC2 Q;  3CCE T;  1BIA A;  2B86 A;  1WHH A;  2EYY A;  5FLX E;  2LNV A;  3Q1J A;  4KGZ B;  3QZ9 B;  2V8I A;  1BBU A;  2HDA A;  1WHL A;  3G4S A;  2OX7 A;  2RQU A;  4E7Z A;  5DLQ E;  3OSV A;  4MDX A;  3CME T;  1RL2 A;  1GGM A;  1NYF A;  2NWM A;  4E2F B;  3BDU A;  2DL3 A;  3VS6 A;  4CC7 A;  3LGF A;  2P0K A;  1UEB A;  4PK4 A;  3JB9 G;  3TSW A;  4WCI A;  5GAM e;  1LPL A;  1H64 1;  2EKO A;  1UG1 A;  5IXF A;  1RAB B;  1K4U S;  4A63 B;  3I35 A;  3CCQ T;  3S3O A;  3EG0 A;  2FRW A;  5I2S A;  2EW3 A;  4P74 A;  1LVK A;  2ZPI B;  2RQR A;  1Z7M A;  5FRM A;  4M78 A;  2DXC A;  1N8R R;  2ENM A;  1RAH B;  1ZSZ B;  2VV5 A;  2YT6 A;  3PCO A;  3G1J A;  2Q5I A;  1K76 A;  4J9B A;  1ZUY A;  3CMA Q;  1VQ8 A;  3CCQ Q;  2KE9 A;  4RTX A;  2YSQ A;  1PNJ A;  1WX6 A;  4A4K A;  2DL5 A;  2LQW A;  3P8Y A;  4AH6 A;  1N9R A;  1HJD A;  3VS7 A;  1YNZ A;  1UEC A;  3C94 A;  4KGV B;  1IZ6 A;  2ZR2 A;  3WXM B;  4M7D A;  5F5W A;  1QCF A;  4LNS A;  3JV3 A;  3A8H B;  3RES A;  1K9M C;  4IUT A;  1ABO A;  2QGF B;  3V7C A;  4KH1 B;  4AFZ C;  1BCM A;  3VV0 A;  5D7U A;  1GCP A;  4DEX A;  1UB4 A;  3UGT A;  4BI4 A;  2FZK B;  3M58 A;  2D8H A;  3MEA A;  2DRK A;  3LC0 A;  1Q7Y R;  1N27 A;  4FU6 A;  3OYI A;  5L23 A;  1NJI R;  2RO0 A;  3CC7 T;  1M2V B;  1G3W A;  1UJ0 A;  2BKD N;  3NHN A;  3HXY A;  3BW1 A;  3SWN C;  3OS5 A;  1QLY A;  5M9O A;  2BE7 D;  1FXX A;  1QKX A;  3EG2 A;  4TVW A;  5GAN 8;  3OYC A;  2OAW A;  1X69 A;  4M75 A;  5FWB A;  1G8X A;  1SRY A;  2P4R A;  4G85 A;  2JOY A;  1M30 A;  1VYU A;  1UDL A;  1GBR A;  2DAQ A;  2LVM A;  3ERR A;  2Y4Y A;  4YCV A;  4JRQ A;  3RNJ A;  1VQK Q;  3RGL A;  3CCJ T;  2OI3 A;  2FG0 A;  4JDS A;  3L2U A;  1OU8 A;  3P8V A;  2EIF A;  2EQJ A;  2BZ8 A;  1KC8 C;  4JJN K;  1QW1 A;  2X9H A;  2DET A;  4LVI A;  2PVO B;  2LT1 A;  3FLG A;  2NUT A;  1KD1 R;  4XEO A;  1RLQ C;  1VQ5 A;  3EH1 A;  4B6M A;  3V8L A;  2V1Q A;  1B8A A;  1UGR B;  1RUW A;  3C12 A;  3FJ5 A;  4OMM A;  1N9W A;  4WTO B;  3ASK A;  1OPK A;  4F7U B;  3G71 Q;  2HEQ A;  4C8Q A;  4D6W A;  4KBM B;  4N0A C;  3CCM Q;  1U8R A;  1BI2 A;  2WSF E;  1XJW B;  2E64 A;  5GMK j;  2K9G A;  4J6X A;  1Q82 U;  1YCS B;  3CD6 T;  5GAN g;  1WQW A;  1GCQ C;  1VIF A;  3UF4 A;  1S1N A;  4OMF B;  1SHF A;  3HRU A;  1OX9 A;  3TSZ A;  3JCM e;  5FRN A;  4DPG A;  1I5L A;  3EAE A;  4HT8 A;  2J7I A;  2DTO A;  1MMA A;  3OMC A;  3C4S A;  3CD6 Q;  1BCO A;  4WJ3 M;  1G5V A;  2AKW B;  2I4L A;  2PUO B;  2LX9 A;  1WU7 A;  1ZBJ A;  4RDX A;  4PJO B;  3LH5 A;  1TU0 B;  4YRR A;  2DTH A;  4EMG A;  3HHT B;  5GAO r;  2WSE E;  2D0N A;  1X75 C;  5CO7 A;  1TS9 A;  4XTU A;  3CC4 T;  1DJ7 B;  1PD0 A;  2M0O A;  3VQX A;  2XID A;  1QCN A;  2H8H A;  4C92 D;  3CBP A;  1YIJ Q;  2XIC A;  2ODR C;  2O01 E;  4XAX B;  1K9M R;  2ZPE B;  1VQP T;  2R58 A;  1UGQ B;  1EIY B;  3VS1 A;  3EHQ A;  2XTI A;  1G5H A;  2P0P A;  4H2W A;  3X24 B;  5HGQ A;  3QYG B;  4PJL A;  5GJV B;  3VYG A;  1D1C A;  1M1G A;  3CCV T;  1AWW A;  1JRI A;  2MYS A;  1D1A A;  3MP8 A;  2RJD A;  3HXU A;  1VQP Q;  2OAU A;  3A5Z B;  3TVT A;  1KK7 A;  2FO0 A;  3H8Z A;  3L2Q A;  2MOX A;  4OMN A;  2ALY A;  2I4N A;  1FX7 A;  1VQ4 T;  1ADJ A;  1WYX A;  4TVR A;  3CCV Q;  3E2U A;  3OYY A;  1IB8 A;  1WA7 A;  3VRY A;  3EFS A;  3EGX B;  3UWN A;  4YDQ A;  4QT7 A;  1WHG A;  1XTD A;  2QDY B;  1X01 A;  2JS2 A;  2OTJ A;  3A7R A;  3MO8 A;  5GAM h;  3I55 Q;  3PZC A;  3QO7 A;  5IN1 A;  3BJU A;  4F7U G;  1NE8 A;  1KC8 R;  2L3P A;  1Y71 A;  3E9F A;  5CKF A;  3I7F A;  1X2Q A;  2M51 A;  3TEH A;  2ZAE A;  3TQ7 P;  3QO5 A;  4YRI A;  5AT1 B;  2RHS A;  4CC3 A;  1EX4 A;  1QMC A;  4ORZ A;  3VS0 A;  2RHX A;  2QQB A;  1M90 R;  1D1B A;  1M1K U;  1ZLM A;  2M02 A;  4AT1 B;  3CBO A;  2CS7 A;  2L5Q A;  3M5A A;  4QQG A;  1QVP A;  5IH2 A;  1M1F A;  4Y92 A;  2E10 A;  5CQX A;  1K0X A;  4TVA A;  3HTZ A;  4GY5 A;  2L8D A;  4E7S A;  1YWO A;  4YRT A;  4XTY A;  1UGS B;  5FU7 C;  1Q86 U;  4EPC A;  4PJO G;  2YWW A;  3L2W A;  1W66 A;  2Q7E A;  2DEU A;  3CPW A;  3CCR A;  3M54 A;  1NJ1 A;  1SEM A;  3RAC A;  5HY6 A;  2EQM A;  2VAS A;  5CVI A;  4KQE A;  3A7A A;  5IT9 E;  3X25 B;  4ELY C;  2HAX A;  3E9H A;  3H0I A;  2MI6 A;  2DL7 A;  1UHC A;  3P8D A;  1UGP B;  1B3Q A;  2FEI A;  4BDZ A;  3M0U A;  2YRC A;  2FL7 A;  4JZ3 A;  3REB B;  4P73 A;  2V26 A;  1GRI A;  4HWT A;  2COY A;  1ZQ1 A;  3JRZ A;  3HRT A;  1OUL A;  2YUP A;  5I21 A;  1IXD A;  4LN2 A;  4CH3 A;  2NYS A;  4BE2 A;  3CCS A;  2RM4 A;  2ZT5 A;  5GAO l;  1QE0 A;  5AYF A;  2P4T A;  1LYL A;  3CPW P;  4ZGE B;  2QG9 B;  4L5G A;  3N5B B;  3E9G A;  2MAM A;  1YHQ A;  4YRC A;  3SWN B;  3OYN A;  2HL3 A;  2JW4 A;  2AKK A;  2MCN A;  1SHG A;  2DEQ A;  2CDT A;  4HT4 A;  2KEA A;  2JT4 A;  4FT4 A;  5GAN 2;  1QP2 A;  2ZZE A;  1BK2 A;  5CQY A;  5KH6 A;  2LQN A;  3RF1 A;  2ZNJ A;  2VVK A;  4OMP A;  1ZSZ A;  1WXB A;  4X1V A;  2KRS A;  1I81 A;  3TEE A;  2FZG B;  2RQV A;  3M0R A;  2YUN A;  2NS6 A;  2ZZG A;  2GTJ A;  1X43 A;  1QF6 A;  4X9C A;  4KUD K;  4UC4 A;  2ZPG B;  1QQJ A;  4H02 A;  1GFC A;  4C5G A;  4J9I A;  4A4G A;  1MUZ A;  2M9U A;  2J3L A;  2L0A A;  2ZXF A;  2DJQ A;  4M7A D;  2EGC A;  4OMQ A;  4JUV A;  3A1P A;  1T3S A;  5GAN d;  1YJW Q;  1VOM A;  2ZGW A;  2HSP A;  3OSS C;  5I11 A;  3G6E A;  2DU7 A;  2F5T X;  4BB7 A;  5GAN j;  3SDZ A;  3TEG A;  1NPP A;  1HTT A;  1KQS A;  2CZ7 B;  3FRN A;  4FYV B;  1VQN A;  3DB3 A;  1YJ9 T;  4C92 E;  1QVG A;  3M53 A;  1M3B A;  3P8B B;  2ARS A;  2BUD A;  4JLI A;  1M2V A;  4YCU A;  1RI0 A;  1QP3 A;  1JO8 A;  1C0A A;  2BZX A;  2K5F A;  2C0T A;  3VRZ A;  4R55 A;  3EGD B;  4PJJ A;  3U23 A;  4LDW A;  1VYV A;  1Y07 A;  2J3M A;  2YRV A;  1M1K C;  4JJB A;  5ELO A;  2QQA A;  1X6G A;  1VQ9 Q;  3M0S A;  4IUV A;  4QVC A;  5DY9 A;  2LCS A;  2XDP A;  1VQO T;  1T0J A;  2AHJ B;  2R5M A;  4QVZ A;  4HVU A;  4IUQ A;  3OYJ A;  1LNX A;  3H0F A;  3GNF B;  4QQ6 A;  1KQS P;  1Q86 C;  3BFM A;  2K4Y A;  1NYQ A;  4XEM A;  2KNB B;  4M78 D;  1B70 A;  4HVV A;  2RHQ B;  2DVE A;  2Q7H A;  5KYW B;  4C5E A;  4YCW A;  1YJN A;  4C0F A;  4JS5 A;  1M27 C;  2BE9 B;  3I5R A;  3V7R A;  4F7U A;  3JCM P;  1TSF A;  4FSX A;  1D3B B;  1LCK A;  1TG0 A;  3CCE A;  4EO4 A;  1S72 T;  5A0L A;  1JXM A;  1U1S A;  2COZ A;  1L0W A;  2DD4 A;  2ROT A;  2DVJ A;  5GAN 3;  1JJC B;  3MET A;  1V1C A;  1HD3 A;  4M7D D;  1K73 U;  2P0Q A;  3CME A;  5IHI A;  5GMK e;  4LDX A;  1VA7 A;  1SRL A;  2EYW A;  2QYZ A;  2DYI A;  4PLL A;  5KYY B;  2VKN A;  3PNW C;  2A08 A;  2HSE B;  1S72 Q;  5GAN f;  3V8K A;  3VS2 A;  3CCQ A;  2DXT A;  5GJW B;  1RAA B;  4YRS A;  3TCJ A;  1Q81 U;  4M77 C;  1KHI A;  5C0M A;  2AKW A;  3EG9 B;  3NEM A;  2KSS A;  4PJO A;  3HFZ A;  3CC2 T;  3JCM b;  1KHC A;  5C6S A;  2A8E A;  3OD1 A;  1OYX A;  4IKF A;  4LVM A;  3LWH A;  2X3W D;  1WHM A;  1I5O B;  3S3M A;  1YI2 T;  3I56 T;  1YBY A;  4RCB A;  2EYZ A;  1EQR A;  1TUD A;  2GGR A;  4M75 D;  2J6K A;  1YFR A;  5C53 B;  4DQ2 A;  2JN0 A;  1R8O B;  4HWS A;  2FB7 A;  3OY9 A;  4H2T A;  2RF0 A;  3OA6 A;  7AT1 B;  4LUD A;  4FCY A;  3OYE A;  1EIY A;  3IKL A;  1ABQ A;  3S6W A;  5LJ5 e;  1LOJ A;  1YI2 Q;  3I56 Q;  4FYY B;  2O88 A;  1XNI A;  1ADY A;  2DX1 A;  3QSU A;  5KYN A;  5FU7 B;  3WVD B;  2JM9 A;  2O4X B;  4PKC C;  1FMW A;  2KMT A;  3RL6 A;  2ROL A;  2FYK A;  2XK0 A;  2D1X A;  4ZIB A;  5GAN 6;  2ZPF B;  2X3X D;  3CMA T;  4D8D A;  3A5Z A;  2LCL A;  4M77 F;  3OS0 A;  1FWZ A;  4MML A;  2EGA A;  3MCA B;  3JCM V;  5LJ3 h;  4C8Q D;  2FPD A;  2QEX Q;  1FYF A;  3CC7 A;  1X55 A;  2E12 A;  1C6V X;  2F2V A;  5J3B A;  1M1K R;  2LZ6 B;  1BB9 A;  2E5A A;  2I4O A;  3A5Y A;  3EGX A;  3GPL A;  2JZ2 A;  4LDY A;  4KT0 E;  3R07 A;  4A54 A;  1IL2 A;  2O2O A;  1IRE B;  2I2L A;  3RIR A;  1H92 A;  4HVC A;  2F1L A;  1Q86 R;  1OV3 A;  1WXT A;  2Q5H A;  3MF1 A;  3CCJ A;  2AKL A;  3OYH A;  1ASZ A;  2LJ3 A;  2KRN A;  3MJX A;  3X28 B;  4CH4 A;  2QA4 T;  2A7Y A;  1IHW A;  1OEB A;  1AD5 A;  3HXX A;  2HQX A;  3CCU A;  1KQS S;  1SF9 A;  2DA9 A;  1WI7 A;  3TU4 K;  1WPY A;  4CC4 B;  4K87 A;  3MP1 A;  1QVG S;  2G4C A;  1I8F A;  5DM7 R;  4P3P A;  3A7U A;  3F70 A;  3UAT A;  2J06 A;  5HK3 A;  1AT1 B;  1ZHI A;  4J9H A;  2DJZ A;  4HVW A;  1VQM A;  4V2S A;  4P71 C;  5GAO m;  3J81 E;  2QA4 Q;  4LE9 A;  4L59 A;  3G4S T;  1JQQ A;  4A53 A;  4YRG A;  2G6F X;  5C51 B;  1VQK T;  2EGE A;  4RTW A;  3IAL A;  5CKH A;  4EX5 A;  5GAN 4;  2CZ0 B;  4YTL A;  2LP5 A;  4A4H A;  4RG2 A;  3EGU A;  2DF6 A;  3HSB A;  4J5Y A;  2EJG A;  4FL6 A;  4M77 E;  2EKH A;  4CS3 A;  4TWA A;  3MP6 A;  4XU3 A;  1K73 C;  2GBQ A;  2YHT A;  4YP0 A;  1PG5 B;  2HBP A;  3MHX A;  2X4J A;  3LLR A;  2RI5 A;  3DLL A;  2HCK A;  3G4S Q;  1BI3 A;  2LNH B;  3OYB A;  2KK4 A;  4TQF A;  2EVR A;  4P3N A;  1PYS B;  4BAC A;  3UGQ A;  4J83 A;  2K2V A;  1PKS A;  3JB9 D;  5CIU A;  3G71 T;  1WJQ A;  3CCM T;  5CKB A;  1QCO A;  1Q81 C;  1YIT T;  3VUB A;  3CC4 A;  5HK0 A;  3VKI A;  3GP8 A;  1B7Y B;  1SSF A;  1OPL A;  1B34 A;  3RR6 A;  3OS2 A;  2ATC B;  5K1X A;  2CJB A;  1R77 A;  1WJS A;  1RAG B;  4XU0 A;  3QJY A;  1WZO A;  4YRQ A;  4M78 E;  2ECZ A;  1MMN A;  3SWN A;  1VUB A;  4JRK A;  1VQP A;  3OMG A;  5HCK A;  1NEG A;  1YIT Q;  3VQW A;  1VQ8 Q;  4BD3 A;  3HRS A;  1I1J A;  1WYD A;  3KUF A;  4FW2 A;  2V8K A;  4PNO A;  1R0C B;  3ER0 A;  1YWP A;  4X5O A;  4RQF A;  4RTV A;  1A0N B;  1KQ2 A;  2DIQ A;  3BDL A;  1KMN A;  3M59 A;  3EFO B;  4A4E A;  5KE3 A;  3M55 A;  1UHF A;  4Y28 E;  1Y96 B;  3CCL A;  1VQ7 A;  2E70 A;  2MWP A;  5IAY A;  2ZTG A;  5L8R E;  3NTH A;  1YIJ T;  1VQ4 A;  3P8H A;  3CEY A;  2V8J A;  1UTI A;  3EHR A;  1IGU A;  4C0G A;  4BWA A;  2LQ8 A;  2KAF A;  3QBY A;  1AOJ A;  2VWF A;  9ATC B;  1U06 A;  2XU8 A;  5HKC A;  3OBY A;  1YN8 A;  3KFU A;  4N0A A;  4DBR A;  3J80 E;  4BY6 C;  2DL8 A;  4F16 A;  2K5I A;  1B7T A;  2ZR3 A;  4ME7 A;  1GCQ A;  2ZZF A;  1WDX A;  2AK5 A;  5I22 A;  2DO3 A;  2E3I A;  1EFW A;  2CH4 W;  2JMA A;  5KE2 A;  1VIE A;  1NPR A;  3HXV A;  1YB3 A;  3HRK A;  2HNI A;  1NBE B;  3HL8 A;  4F04 B;  4CI0 C;  1Q95 G;  4M77 B;  5GAN e;  1BKB A;  1X2G A;  3EGD A;  2E5K A;  3NFC A;  4AG1 C;  5GAM d;  2JTE A;  2LTO A;  4HCB A;  2E3C A;  2KYM A;  3P8T A;  4IIO A;  3A32 A;  5GAM j;  3I55 T;  1E1O A;  4XTV A;  1KSW A;  1VQ5 Q;  2NLU A;  1MV0 B;  4MZT A;  1ZUU A;  1J3T A;  1NJ5 A;  2A28 A;  1K73 R;  2M0Y A;  3WQZ A;  3OYF A;  1H4S A;  2I4M A;  3UDC A;  5ECA A;  2RQT A;  4C8Q E;  4C5H A;  4KGX B;  2QQR A;  4B9W A;  2RHQ A;  4EIK A;  2K5L A;  1OOT A;  4EMK C;  3OW2 A;  2RJC A;  3PMI A;  5KYW A;  1Q81 R;  4QKU A;  1E6G A;  1YFS A;  2QAZ A;  4DOV A;  1D3B A;  4UPA A;  5KYX B;  3VJP A;  2DKG A;  3HFN A;  2K3Y A;  2DD5 A;  4HT9 A;  3SHW A;  4PFZ A;  5LJ3 g;  1X6B A;  1T3L A;  1FMK A;  4C92 C;  1H8K A;  3KXT A;  4CS2 A;  4PLI A;  3NGP A;  2A0F B;  3QKJ A;  4E47 A;  5KYY A;  5ELN A;  2X35 A;  1VQ6 A;  2X4X A;  1M8M A;  4FW1 A;  4DBH A;  3OW2 P;  5KYU B;  2PZ1 A;  2XDD A;  2H3E B;  3CXC S;  1RAF B;  1V29 B;  4LVK A;  4J8O A;  2RQW A;  3EG9 A;  1M2O A;  1ACM B;  1MV3 A;  1U1T A;  1Q82 C;  3M4G A;  5I2M A;  1I4K 1;  2C0O A;  2A37 A;  4N4I A;  4FYW B;  4PG3 A;  1PSF A;  4RUG A;  3M57 A;  4Z88 A;  2WAC A;  2PVD B;  4NCX A;  2RJF A;  3LYI A;  5GAM f;  1M9S A;  3I5S A;  1MMG A;  3HPW A;  2DBK A;  5A0D A;  4K86 A;  4E51 A;  3QDF A;  2DMO A;  2Y4X A;  1H4V B;  5GAO p;  2FHD A;  4CH6 A;  4J9D A;  1PD1 A;  2KGT A;  2COW A;  3A8M B;  2E6Z A;  4LXC A;  4YRK A;  3EG3 A;  4GLM A;  2KBT A;  4P5N A;  4P3O A;  2PVG B;  4C92 F;  4Q15 A;  4K11 A;  4AFQ C;  1U3O A;  4M77 G;  4Z8A A;  1BIB A;  8AT1 B;  3MKD A;  2QQ9 A;  2O4X A;  2ZCF B;  4HCK A;  2L3Q A;  3GBQ A;  2HQH A;  4YRM A;  2GQI A;  1HSQ A;  3RKX A;  3H6Z A;  1NJI U;  2GCX A;  3QG1 A;  4JS4 A;  2NUT B;  2OTJ Q;  2K57 A;  2QTX A;  1YJ9 A;  1NNH A;  1IO6 A;  4E6R A;  3O8V A;  2A36 A;  2JUF A;  3SEM A;  4XTW A;  4LNP A;  3NTI A;  4H2Y A;  1VQL A;  1USY C;  4TQD A;  1D0X A;  2R5A A;  4HA8 A;  2CT4 A;  1OQK A;  4J7F A;  4GBQ A;  5GAO q;  2EYQ A;  1ZUK A;  2QK0 A;  4LVJ A;  1MNE A;  4CRI A;  4OB3 B;  1YJW T;  3GIB A;  2OTL A;  2KRO A;  1VQO A;  4OVA A;  4FM4 B;  3URG A;  4RTZ A;  3OYL A;  2KVQ G;  3HP9 A;  4P72 C;  2CGH A;  2F5K A;  2XHC A;  2QHU A;  3A31 A;  2LT4 A;  2PQW A;  2EYX A;  4PJO D;  3X20 B;  2SEM A;  3JCM h;  2KXC A;  3I9Q A;  3MQZ A;  3LW5 E;  3VS3 A;  4QW2 A;  4KRT A;  2HMA A;  3A8O B;  5KCH A;  5FU6 C;  2CP3 A;  3SB2 A;  3LSQ A;  1AWX A;  2LCC A;  1I07 A;  3QTC A;  1VQ9 T;  1S72 A;  4NL2 A;  5CKD A;  4HKE A;  1GFD A;  1QWF A;  5FRO A;  3QXE B;  3VQV A;  2D0Q B;  4II1 A;  1RAC B;  2ZIO A;  3L4G B;  4OML A;  4JRP A;  2ZIM A;  2EPD A;  2JM8 A;  4JLG A;  5J39 A;  3MPU B;  1KMM A;  2RNA A;  1B07 A;  2RHI A;  1PCX A;  1IHV A;  3JB9 J;  2EL9 A;  3CCS Q;  1Q82 R;  1D0Y A;  4DA4 A;  3HRI A;  5CKE A;  4BY6 B;  3OW2 S;  1FMV A;  1ZA2 B;  4N4G A;  2FPE A;  1YHQ Q;  3CC2 A;  2I0N A;  1GL5 A;  1QVG P;  2XD0 A;  4H2U A;  5KCO A;  1LJO A;  2K79 A;  2YRD A;  1X6O A;  1B7Y A;  4AMC A;  1HXD A;  4YRF A;  4HCC A;  4LUE A;  1AWJ A;  2DNU A;  3OS1 A;  2AMC B;  3PIO A;  4C0D C;  3FDR A;  1BBW A;  2RH2 A;  2CUB A;  3OQ5 A;  4J9G A;  3PMT A;  5GMK i;  3S3N A;  1UFF A;  3UPU A;  4OLF A;  2WSC E;  1JJ2 A;  2F2X A;  4KH0 B;  5KNN A;  1M5Q 1;  4JJC A;  3E19 A;  1K0S A;  4M7A C;  4ELZ C;  4NL3 A;  1JBM A;  3M0Q A;  3O5Z A;  1M4Z A;  1SG5 A;  1Z9Q A;  4LDU A;  3EFO A;  3E9I A;  3RER A;  1VQN T;  1IRX A;  3CMA A;  1RIQ A;  2CIM A;  1Y96 A;  2QI2 A;  4ZN3 A;  4OGE A;  2PU9 B;  4PJM A;  3H0H A;  1NYG A;  2YLC A;  1WQ7 A;  5GAM g;  3QWY A;  1NJI C;  3ZEH A;  4EMK B;  1W4S A;  1OU9 A;  5GMK l;  2M1H A;  3G6E Q;  2CUD A;  1NJ2 A;  3UH0 A;  4ATO A;  2DIL A;  3PFS A;  4DEY A;  1VQN Q;  1EVK A;  2EQK A;  4IUP A;  4E7L A;  1CKA A;  4BDY A;  4PJN A;  4IUU A;  2R57 A;  1QWE A;  2L3R A;  4O5V A;  5LJ3 d;  4C92 B;  3JCM Q;  4P74 C;  1RI9 A;  4RTT A;  1AEY A;  2QDL A;  3QNE A;  4RMO A;  1VYT A;  4M78 C;  4RCC A;  4Y91 A;  1M90 U;  2ABL A;  4M7A F;  5LJ3 j;  2QEX T;  1M3C A;  2G3R A;  5IHN A;  1H3H A;  4YPF A;  3VS5 A;  4Q6G A;  2DLP A;  3HXW A;  1OI1 A;  4M77 A;  3RUX A;  3HXZ A;  1X54 A;  4OB0 B;  2MPX C;  4P75 A;  2HZY A;  2J6F A;  3WVE B;  2F69 A;  2D9T A;  1G3T A;  1NLO C;  2LC4 A;  1X2K A;  1YFT A;  3GLX A;  1VQK A;  1YJN Q;  2J05 A;  2VGN A;  2RJE A;  4BE1 A;  4OB2 B;  1BI0 A;  3MEU A;  4M7D C;  1H4T A;  3NPF A;  2XI9 A;  3CCE Q;  3SD4 A;  4NOY A;  2DK3 A;  4ZTF A;  4F7U E;  4LD9 K;  2KRM A;  2MWO A;  3LH0 A;  3M0P A;  3VU3 C;  3A74 A;  3BE3 A;  3A8L B;  3D7S B;  2FZC B;  3DLM A;  2P84 A;  2DZC A;  2EFI A;  3HFO A;  3CME Q;  2EJ9 A;  3AHU A;  3THK A;  4GLK A;  1AVZ C;  4HWR A;  3DB4 A;  2YDL A;  2RMO A;  3G71 A;  1NJ8 A;  4M78 F;  3CCM A;  2KR3 A;  3J7A F;  3M4P A;  4C0Z A;  2K2M A;  4ZN1 A;  2CT3 A;  2DBM A;  1YIT A;  2JNG A;  2GFU A;  5KYX A;  1HYO A;  1KFZ A;  2LRQ A;  4C5I A;  4BE0 A;  4XTZ A;  3HFV A;  2C0I A;  4BUG A;  4M75 C;  4LDV A;  1G83 A;  4ESR A;  2C06 A;  8ATC B;  2ZCE A;  4H2V A;  1ZA1 B;  2XGT A;  4PJO E;  1R0B G;  2DU5 A;  4IIM A;  4CC2 A;  1SSH A;  3L2R A;  4IUR A;  1WHJ A;  2GQV A;  2XMF A;  4M7A E;  1YCY A;  2EJF A;  4E7J A;  2A3L A;  2RK2 A;  5KYU A;  1NYR A;  1TXQ A;  1IGQ A;  3CD6 A;  4M7D F;  1BI1 A;  4JPB W;  2P0L A;  3OYK A;  2MK5 A;  4KR2 A;  3SFM A;  2L3S A;  1MGQ A;  1NG2 A;  5LJ3 f;  1P92 A;  3FB9 A;  1SET A;  1UGV A;  2VB6 A;  3VYH B;  2FPF A;  2CSQ A;  2JS0 A;  3CBM A;  2K7A A;  4FIB A;  1W2B A;  4R0K A;  3JCM J;  3JAM E;  2CP7 A;  1XOV A;  4OGC A;  3CXC A;  1KOG A;  11AS A;  3UFG A;  5GAN 5;  4G84 A;  1E7O A;  4XU1 A;  4C8Q C;  3JCM g;  2W0Z A;  3QII A;  1YIJ A;  1KG1 A;  4ANJ A;  2GNC A;  4UP7 A;  1G3S A;  2RN8 A;  3PVQ A;  4C92 G;  1PHT A;  2CJ9 A;  4H2X B;  4PL6 A;  1RLP C;  1OX8 A;  1RAE B;  4ZGD B;  2O31 A;  5FU6 B;  2LDM A;  1VQ8 T;  1X2H A;  2YLB A;  2DRM A;  1RAI B;  3R6N A;  4O6J A;  4M75 F;  5GAO n;  4H2S A;  2KT8 A;  4P71 A;  2PNI A;  1YP5 A;  2DYB A;  3CC7 Q;  1XQH A;  1OZ2 A;  3NET A;  3E1S A;  4RG8 A;  2ODR D;  2DXU A;  1JJ2 S;  1W2B P;  3AT1 B;  2K3B A;  4O2D A;  4KUL A;  3CXC P;  3TUP A;  1AHJ B;  2IY5 B;  1ASY A;  1B70 B;  2RA2 A;  2IG0 A;  3CCU T;  2L89 A;  4AG2 C;  2E4H A;  1E22 A;  4CS4 A;  1C1A A;  2E1H A;  3HY0 A;  3W3S A;  3JCM c;  4DOW A;  2XG8 D;  2O9S A;  3CCJ Q;  3JB9 H;  3CCV A;  4E7H A;  1VQM T;  5LL6 S;  1M90 C;  2KDS A;  4QQD A;  2DXB A;  4FSS A;  2YUQ A;  4OMO A;  1N5Z A;  2JTM A;  3RDV A;  3H41 A;  3UT1 A;  3CQT A;  3LWI A;  1YFN A;  2NUP B;  1BBZ A;  2LX7 A;  3CCU Q;  4M7D E;  2DQ0 A;  4C8Q F;  2CH4 A;  2IIM A;  2CZ1 B;  1WLP B;  4ZTJ A;  3G1Z A;  1X27 A;  3EH2 A;  3I55 A;  1K8A U;  3VBB A;  5CCA A;  2EAY A;  2CZ6 B;  1ZBX A;  3FIF A;  1AWO A;  4ZNX A;  1VQM Q;  1NZ9 A;  4C0D B;  4L87 A;  2KQW A;  2V1R A;  1HC7 A;  1TTH B;  5GMK h;  4JJD A;  3ICA A;  3UA6 A;  2AT1 B;  3NEL A;  3DSQ A;  1PRM C;  2DQ3 A;  2KI7 A;  1BU1 A;  3H9N A;  2HKQ B;  2ZPB B;  3L1A A;  1PM3 A;  3HFZ B;  4EMH A;  2DL4 A;  2RD1 A;  1TH7 A;  3MEV A;  4BI3 A;  4YRN A;  1N9S A;  4M7A B;  3OYG A;  4XK8 E;  2ZT6 A;  2W10 A;  2CP2 A;  1N6A A;  4LD6 A;  5LJ5 d;  4M75 E;  3RBB B;  2HQE A;  3LX7 A;  3M4Q A;  1Z9Z A;  4HCZ A;  1VQ5 T;  5FW9 A;  2QHT A;  5LJ5 j;  2LMJ A;  4J6W A;  3L4G A;  2E5Q A;  2DTI A;  2MIO A;  2DM1 A;  3ZFJ A;  1HK9 A;  4QVD A;  1UJY A;  4HWP A;  3CC4 Q;  2DE0 X;  2E6N A;  4Q5W A;  4MZM A;  2PME A;  1K9A A;  2PUK B;  5LJ5 h;  3LGL A;  3QUI A;  2E3H A; 
#chains in the Genus database with same CATH homology
 2DPP B;  1KQ1 A;  5GAN 7;  2ART A;  2E41 A;  3CCL T;  3GOX A;  1VQ7 T;  4YRL A;  3R6O A;  2ZIN A;  5CR2 A;  2DDZ A;  3L2V A;  2JVV A;  3REX A;  5GMK m;  4M78 B;  3JB9 F;  2E65 A;  3QPH A;  4L6V 5;  2BIV A;  2AMC A;  1PSE A;  4WJ4 A;  3M56 A;  3PCO B;  1B76 A;  1X56 A;  3FC3 A;  5D6X A;  1JJC A;  2M16 A;  3M9Q A;  4MDW A;  3A8G B;  3QO8 A;  3L42 A;  3INZ A;  4YRO A;  3BY7 A;  2DIG A;  4M7D B;  4J7I A;  1W2B S;  4XQ3 A;  3FEO A;  2RI3 A;  3REU A;  1N8R U;  4P73 C;  3OYA A;  3L2Z A;  3GNG A;  2CKK A;  3OB9 A;  5LJ5 f;  4TTV A;  4EMK A;  4J15 A;  5C52 B;  5DLO A;  4Z02 A;  2ZZD A;  1WGS A;  4YRP A;  2GF7 A;  5K1P A;  3OYM A;  1YJW A;  1Z7N A;  2C8M A;  4R56 A;  4M7A G;  4ZTU B;  4M75 B;  1JB0 E;  1MHN A;  2MMP A;  4C92 A;  1K8A C;  1G51 A;  5EG2 A;  2MF2 A;  2LQK A;  2OTJ T;  2VXE A;  2RHY A;  3QJ6 A;  3HKS A;  1QVF A;  1H4Q A;  1Q7Y U;  5LJ3 e;  1WLE A;  3PT9 A;  1ATI A;  2VUB A;  1VQ9 A;  4WF2 A;  4OF1 A;  4WI1 A;  2XKO C;  12AS A;  1B34 B;  4XU2 A;  3PTA A;  4RMF A;  2QQS A;  3JCM X;  4XTX A;  3HY1 A;  4C8Q B;  1E24 A;  3JCM d;  1VQ6 T;  3CMQ A;  3JSC A;  3QYH B;  4M78 G;  4UP9 A;  2ZNI A;  4OB1 B;  1O9S A;  2VYT A;  3CCR T;  2QXF A;  2X4Y A;  2GFA A;  3FJP A;  3OYD A;  3GF5 A;  1KD1 U;  3C95 A;  2DZ9 A;  3MEY A;  2KY9 A;  4RQE A;  2RHZ A;  2X4W A;  3VUZ A;  4KR3 A;  5CK9 A;  3DKM A;  4BI8 B;  4M7D G;  4UP8 A;  1G5I A;  4FT2 A;  4B9X A;  4E7K A;  4J6Y A;  3EFR A;  3CCS T;  4PHC A;  2ZT7 A;  1USY A;  3NEN A;  3V7S A;  1Y7X A;  2FVU A;  2C7I A;  1YHQ T;  3OBW A;  2RK1 A;  4VUB A;  2P5I A;  4HWO A;  3PIP A;  2RB6 A;  3QO3 A;  1VQZ A;  5E3I A;  2IVW A;  2VC8 A;  3M4Y A;  3ME9 A;  3MEW A;  4P72 A;  4M77 D;  5D6W A;  3QHS A;  1PYS A;  3QDR B;  4M75 G;  1M8V A;  1VQL T;  2CJA A;  2ZPH B;  4H2X A;  4X34 A;  1N8R C;  5GAN h;  5J26 A;  4K88 A;  2XDB A;  4YYE A;  1YI2 A;  1EOV A;  2ALY B;  3I56 A;  4RKU E;  2OTL T;  1O75 A;  3JCM f;  3NTK A;  1K9M U;  4YRJ A;  2RI2 A;  2PMF A;  1G3Y A;  3X26 B;  5D6Y A;  4ZGJ B;  1NJ6 A;  4EDU A;  1EIF A;  5A0G A;  3VQY A;  2IY5 A;  2D6F A;  2EQU A;  2B8A A;  3RKW A;  2ARU A;  4PJO C;  3JB9 I;  2QEX A;  4E7I A;  3LSS A;  4KUI A;  3JCM W;  3PGG A;  4C8Q G;  1WNL A;  5LJ5 g;  3G6E T;  3TEH B;  3QZ5 B;  1GXI E;  3T9N A;  3IKM B;  4X9D A;  2RHS B;  3V8J A;  4F7U F;  1OZ3 A;  4MMK A;  2K3X A;  2QHS A;  4TVY A;  1Q7Y C;  2ZT8 A;  3RMQ A;  2Q7G A;  2VXF A;  1E1T A;  4A4F A;  3MF2 A;  4TVA B;  2QHV A;  3CPW S;  2RHU A;  3TRE A;  1J5W A;  1SES A;  4CH5 A;  1KC8 U;  3CPF A;  2CYZ B;  4ZTZ B;  2Y90 A;  2EWN A;  2VGM A;  4P75 C;  5CAI A;  3ZBD A;  1H3Z A;  1QVF S;  1YGB A;  4BW9 A;  1SER A;  3RKY A;  5A2Q E;  1BYM A;  3IG2 A;  4LVL A;  3G7Z A;  4M7A A;  4PJO F;  1WJR A;  2QA4 A;  4YRE A;  4NS5 A;  2HD0 A;  4N4H A;  2JTF A;  1YJN T;  4JRI A;  4OP0 A;  3KBG A;  4MZP A;  1EVL A;  1KD1 C;  2H3J A;  3RMS A;  3CCE T;  1BIA A;  5FLX E;  2LNV A;  3Q1J A;  3QZ9 B;  2V8I A;  1BBU A;  3G4S A;  5DLQ E;  4MDX A;  3OSV A;  3CME T;  1RL2 A;  1GGM A;  3BDU A;  3LGF A;  2P0K A;  1UEB A;  3JB9 G;  5GAM e;  1H64 1;  2EKO A;  3S3O A;  3CCQ T;  5I2S A;  4P74 A;  2ZPI B;  1Z7M A;  5FRM A;  4M78 A;  2DXC A;  2VV5 A;  3PCO A;  2Q5I A;  1VQ8 A;  4A4K A;  3P8Y A;  4AH6 A;  1N9R A;  3C94 A;  1IZ6 A;  2ZR2 A;  3WXM B;  4M7D A;  5F5W A;  4LNS A;  3A8H B;  3RES A;  1K9M C;  4IUT A;  3V7C A;  3VV0 A;  1UB4 A;  3UGT A;  4BI4 A;  3M58 A;  3MEA A;  3LC0 A;  1N27 A;  4FU6 A;  3OYI A;  2RO0 A;  3CC7 T;  1G3W A;  2BKD N;  3HXY A;  3BW1 A;  3SWN C;  3OS5 A;  5M9O A;  1FXX A;  4TVW A;  5GAN 8;  3OYC A;  4M75 A;  1SRY A;  4G85 A;  2JOY A;  2DAQ A;  2LVM A;  3ERR A;  2Y4Y A;  4YCV A;  4JRQ A;  3RGL A;  3CCJ T;  4JDS A;  3L2U A;  3P8V A;  2EIF A;  2EQJ A;  1KC8 C;  4JJN K;  1QW1 A;  4LVI A;  2PVO B;  2LT1 A;  3FLG A;  4XEO A;  1VQ5 A;  3V8L A;  1B8A A;  1UGR B;  3C12 A;  1N9W A;  3ASK A;  4F7U B;  4C8Q A;  4D6W A;  4KBM B;  4N0A C;  1U8R A;  1BI2 A;  2WSF E;  2E64 A;  5GMK j;  1Q82 U;  4J6X A;  3CD6 T;  5GAN g;  1WQW A;  1VIF A;  4OMF B;  3HRU A;  3JCM e;  5FRN A;  4DPG A;  1I5L A;  3EAE A;  4HT8 A;  2DTO A;  3OMC A;  3C4S A;  4WJ3 M;  1G5V A;  2AKW B;  2I4L A;  2PUO B;  2LX9 A;  1WU7 A;  4RDX A;  4PJO B;  4YRR A;  2DTH A;  4EMG A;  3HHT B;  5GAO r;  2WSE E;  1X75 C;  5CO7 A;  4XTU A;  3CC4 T;  1DJ7 B;  2M0O A;  3VQX A;  2XID A;  4C92 D;  3CBP A;  2XIC A;  2ODR C;  2O01 E;  4XAX B;  2ZPE B;  1VQP T;  2R58 A;  1UGQ B;  1EIY B;  2XTI A;  1G5H A;  2P0P A;  4H2W A;  3X24 B;  5HGQ A;  3QYG B;  3VYG A;  1M1G A;  3CCV T;  1JRI A;  3MP8 A;  2RJD A;  3HXU A;  2OAU A;  3A5Z B;  3L2Q A;  3H8Z A;  2ALY A;  2I4N A;  1FX7 A;  1VQ4 T;  1ADJ A;  4TVR A;  3OYY A;  3EFS A;  3UWN A;  4YDQ A;  1XTD A;  2QDY B;  1X01 A;  2OTJ A;  3A7R A;  3MO8 A;  5GAM h;  3PZC A;  3QO7 A;  5IN1 A;  3BJU A;  4F7U G;  1NE8 A;  1Y71 A;  3E9F A;  5CKF A;  3I7F A;  3TEH A;  3QO5 A;  4YRI A;  2RHS A;  2RHX A;  2QQB A;  1M1K U;  3CBO A;  2CS7 A;  2L5Q A;  3M5A A;  4QQG A;  1QVP A;  1M1F A;  2E10 A;  5CQX A;  4TVA A;  3HTZ A;  4GY5 A;  2L8D A;  4YRT A;  4XTY A;  1UGS B;  5FU7 C;  1Q86 U;  4EPC A;  4PJO G;  3L2W A;  1W66 A;  2Q7E A;  3CPW A;  3CCR A;  3M54 A;  1NJ1 A;  3RAC A;  5HY6 A;  2EQM A;  5CVI A;  4KQE A;  3A7A A;  5IT9 E;  3X25 B;  4ELY C;  2HAX A;  3E9H A;  2MI6 A;  3P8D A;  1UGP B;  4BDZ A;  2FL7 A;  4P73 A;  4HWT A;  1ZQ1 A;  3JRZ A;  3HRT A;  5I21 A;  4CH3 A;  4BE2 A;  3CCS A;  2RM4 A;  2ZT5 A;  5GAO l;  1QE0 A;  5AYF A;  2P4T A;  1LYL A;  4ZGE B;  4L5G A;  3N5B B;  3E9G A;  2MAM A;  1YHQ A;  4YRC A;  3SWN B;  3OYN A;  2DEQ A;  4HT4 A;  4FT4 A;  5GAN 2;  1QP2 A;  2ZZE A;  5CQY A;  5KH6 A;  3RF1 A;  2ZNJ A;  1I81 A;  3TEE A;  2NS6 A;  2ZZG A;  1QF6 A;  4X9C A;  4KUD K;  4UC4 A;  2ZPG B;  4H02 A;  4C5G A;  4A4G A;  2M9U A;  2J3L A;  2ZXF A;  4M7A D;  4JUV A;  5GAN d;  2ZGW A;  3OSS C;  3G6E A;  2DU7 A;  2F5T X;  4BB7 A;  5GAN j;  3SDZ A;  3TEG A;  1NPP A;  1HTT A;  1KQS A;  2CZ7 B;  3FRN A;  1VQN A;  3DB3 A;  1YJ9 T;  4C92 E;  1QVG A;  3M53 A;  3P8B B;  2ARS A;  2BUD A;  4JLI A;  4YCU A;  1RI0 A;  1QP3 A;  1C0A A;  2K5F A;  4R55 A;  4LDW A;  1Y07 A;  2J3M A;  2YRV A;  1M1K C;  5ELO A;  2QQA A;  4IUV A;  4QVC A;  5DY9 A;  2XDP A;  1VQO T;  2AHJ B;  2R5M A;  4QVZ A;  4IUQ A;  3OYJ A;  1LNX A;  3GNF B;  4QQ6 A;  1Q86 C;  3BFM A;  2K4Y A;  1NYQ A;  4XEM A;  4M78 D;  1B70 A;  2RHQ B;  2DVE A;  2Q7H A;  4C5E A;  4YCW A;  1YJN A;  4C0F A;  4JS5 A;  3V7R A;  3JCM P;  4F7U A;  4FSX A;  1D3B B;  3CCE A;  4EO4 A;  1S72 T;  5A0L A;  1U1S A;  1L0W A;  2DD4 A;  5GAN 3;  1JJC B;  3MET A;  4M7D D;  1K73 U;  2P0Q A;  3CME A;  5GMK e;  4LDX A;  4PLL A;  3PNW C;  5GAN f;  3V8K A;  3CCQ A;  2DXT A;  4YRS A;  3TCJ A;  1Q81 U;  4M77 C;  1KHI A;  5C0M A;  2AKW A;  3NEM A;  2KSS A;  4PJO A;  3HFZ A;  3CC2 T;  3JCM b;  1KHC A;  5C6S A;  2A8E A;  3OD1 A;  1OYX A;  4IKF A;  4LVM A;  3LWH A;  3S3M A;  1YI2 T;  3I56 T;  1YBY A;  4RCB A;  1EQR A;  4M75 D;  1YFR A;  5C53 B;  4DQ2 A;  2JN0 A;  1R8O B;  4HWS A;  2FB7 A;  3OY9 A;  4H2T A;  3OA6 A;  3OYE A;  1EIY A;  3IKL A;  3S6W A;  5LJ5 e;  1LOJ A;  1XNI A;  1ADY A;  3QSU A;  5FU7 B;  3WVD B;  2O4X B;  4PKC C;  2KMT A;  3RL6 A;  2FYK A;  2XK0 A;  4ZIB A;  5GAN 6;  2ZPF B;  3CMA T;  3A5Z A;  2LCL A;  4M77 F;  3OS0 A;  1FWZ A;  4MML A;  3MCA B;  3JCM V;  5LJ3 h;  4C8Q D;  1FYF A;  3CC7 A;  1X55 A;  2E12 A;  5J3B A;  2E5A A;  2I4O A;  3A5Y A;  3GPL A;  2JZ2 A;  4LDY A;  4KT0 E;  3R07 A;  4A54 A;  1IL2 A;  1IRE B;  2I2L A;  3RIR A;  4HVC A;  2Q5H A;  3MF1 A;  3CCJ A;  3OYH A;  1ASZ A;  3X28 B;  4CH4 A;  2QA4 T;  2A7Y A;  3HXX A;  2HQX A;  3CCU A;  1KQS S;  3TU4 K;  1WPY A;  4K87 A;  3MP1 A;  1QVG S;  2G4C A;  1I8F A;  5DM7 R;  4P3P A;  3A7U A;  3F70 A;  5HK3 A;  1ZHI A;  4V2S A;  1VQM A;  2DJZ A;  4P71 C;  5GAO m;  3J81 E;  4L59 A;  3G4S T;  4A53 A;  4YRG A;  5C51 B;  1VQK T;  3IAL A;  5CKH A;  4EX5 A;  5GAN 4;  2CZ0 B;  4YTL A;  4A4H A;  4RG2 A;  3HSB A;  4J5Y A;  2EJG A;  4FL6 A;  4M77 E;  4CS3 A;  4TWA A;  3MP6 A;  4XU3 A;  1K73 C;  4YP0 A;  2YHT A;  2X4J A;  2HBP A;  3MHX A;  3DLL A;  3LLR A;  2RI5 A;  4TQF A;  1BI3 A;  3OYB A;  2KK4 A;  4P3N A;  1PYS B;  4BAC A;  3UGQ A;  4J83 A;  2K2V A;  3JB9 D;  5CIU A;  3G71 T;  1WJQ A;  3CCM T;  5CKB A;  1Q81 C;  1YIT T;  3VUB A;  3CC4 A;  5HK0 A;  3VKI A;  3GP8 A;  1B7Y B;  1SSF A;  1B34 A;  3OS2 A;  5K1X A;  2CJB A;  1WJS A;  4XU0 A;  3QJY A;  4YRQ A;  4M78 E;  3SWN A;  1VUB A;  4JRK A;  1VQP A;  3OMG A;  3VQW A;  4BD3 A;  3HRS A;  1WYD A;  3KUF A;  2V8K A;  4PNO A;  3ER0 A;  4X5O A;  4RQF A;  1KQ2 A;  2DIQ A;  3BDL A;  1KMN A;  3M59 A;  5KE3 A;  4A4E A;  3M55 A;  4Y28 E;  1Y96 B;  3CCL A;  1VQ7 A;  2E70 A;  2MWP A;  5IAY A;  2ZTG A;  5L8R E;  3NTH A;  1YIJ T;  1VQ4 A;  3P8H A;  3CEY A;  2V8J A;  4C0G A;  4BWA A;  2LQ8 A;  2KAF A;  3QBY A;  2XU8 A;  5HKC A;  3OBY A;  3KFU A;  4N0A A;  3J80 E;  4BY6 C;  2K5I A;  2ZR3 A;  4ME7 A;  2ZZF A;  2DO3 A;  1EFW A;  5KE2 A;  1VIE A;  1NPR A;  3HXV A;  1YB3 A;  3HRK A;  2HNI A;  3HL8 A;  4CI0 C;  4M77 B;  5GAN e;  1BKB A;  1X2G A;  5GAM d;  3NFC A;  2LTO A;  4HCB A;  2E3C A;  3P8T A;  3A32 A;  5GAM j;  3I55 T;  1E1O A;  4XTV A;  2NLU A;  4MZT A;  1NJ5 A;  3WQZ A;  3OYF A;  1H4S A;  2I4M A;  3UDC A;  4C8Q E;  4C5H A;  2QQR A;  4B9W A;  2RHQ A;  2K5L A;  3OW2 A;  4EMK C;  2RJC A;  3PMI A;  1YFS A;  4DOV A;  1D3B A;  4UPA A;  3VJP A;  2DKG A;  2K3Y A;  3HFN A;  2DD5 A;  4HT9 A;  5LJ3 g;  4CS2 A;  4C92 C;  3KXT A;  4PLI A;  3QKJ A;  4E47 A;  5ELN A;  2X35 A;  1VQ6 A;  2X4X A;  2XDD A;  3CXC S;  1V29 B;  4LVK A;  4J8O A;  1U1T A;  1Q82 C;  3M4G A;  5I2M A;  1I4K 1;  4N4I A;  4PG3 A;  1PSF A;  3M57 A;  2WAC A;  2PVD B;  4NCX A;  2RJF A;  3LYI A;  5GAM f;  1M9S A;  3HPW A;  5A0D A;  4K86 A;  4E51 A;  2Y4X A;  1H4V B;  5GAO p;  2FHD A;  4CH6 A;  3A8M B;  2E6Z A;  4YRK A;  4P5N A;  4P3O A;  2PVG B;  4C92 F;  4Q15 A;  4M77 G;  1BIB A;  2QQ9 A;  2O4X A;  2ZCF B;  4YRM A;  3RKX A;  3H6Z A;  1NJI U;  2GCX A;  3QG1 A;  4JS4 A;  2K57 A;  2QTX A;  1YJ9 A;  1NNH A;  3O8V A;  2JUF A;  4XTW A;  3NTI A;  4H2Y A;  1VQL A;  1USY C;  4TQD A;  4HA8 A;  2R5A A;  4J7F A;  5GAO q;  2EYQ A;  4LVJ A;  4CRI A;  4OB3 B;  1YJW T;  3GIB A;  2OTL A;  1VQO A;  4OVA A;  4FM4 B;  3URG A;  3OYL A;  2KVQ G;  3HP9 A;  4P72 C;  2CGH A;  2F5K A;  2XHC A;  2QHU A;  3A31 A;  2LT4 A;  2PQW A;  4PJO D;  3X20 B;  3JCM h;  3MQZ A;  3LW5 E;  4QW2 A;  3A8O B;  5KCH A;  5FU6 C;  3SB2 A;  3LSQ A;  2LCC A;  3QTC A;  1VQ9 T;  1S72 A;  4NL2 A;  5CKD A;  4HKE A;  5FRO A;  3QXE B;  3VQV A;  2D0Q B;  4II1 A;  2ZIO A;  3L4G B;  4JRP A;  2ZIM A;  4JLG A;  5J39 A;  1KMM A;  2RHI A;  3JB9 J;  2EL9 A;  4DA4 A;  3HRI A;  5CKE A;  4BY6 B;  3OW2 S;  4N4G A;  3CC2 A;  2XD0 A;  4H2U A;  5KCO A;  1LJO A;  1X6O A;  1B7Y A;  1HXD A;  4YRF A;  4HCC A;  3OS1 A;  2AMC B;  3PIO A;  4C0D C;  3FDR A;  1BBW A;  2RH2 A;  3OQ5 A;  5GMK i;  3PMT A;  3S3N A;  3UPU A;  4OLF A;  2WSC E;  1JJ2 A;  5KNN A;  1M5Q 1;  3E19 A;  4M7A C;  4ELZ C;  4NL3 A;  1JBM A;  1M4Z A;  4LDU A;  3E9I A;  3RER A;  1VQN T;  3CMA A;  1RIQ A;  2CIM A;  1Y96 A;  2QI2 A;  4ZN3 A;  4OGE A;  2PU9 B;  2YLC A;  1WQ7 A;  5GAM g;  1NJI C;  3ZEH A;  4EMK B;  1W4S A;  5GMK l;  2M1H A;  1NJ2 A;  3UH0 A;  4ATO A;  3PFS A;  1EVK A;  2EQK A;  4IUP A;  4E7L A;  4BDY A;  4IUU A;  2R57 A;  2L3R A;  4O5V A;  5LJ3 d;  4C92 B;  3JCM Q;  4P74 C;  3QNE A;  4RMO A;  4M78 C;  4RCC A;  4Y91 A;  1M90 U;  4M7A F;  5LJ3 j;  2QEX T;  2G3R A;  4YPF A;  4Q6G A;  3HXW A;  1OI1 A;  4M77 A;  3RUX A;  3HXZ A;  1X54 A;  4OB0 B;  4P75 A;  3WVE B;  2F69 A;  2D9T A;  1G3T A;  2LC4 A;  1YFT A;  3GLX A;  1VQK A;  2VGN A;  2RJE A;  4BE1 A;  4OB2 B;  1BI0 A;  3MEU A;  4M7D C;  1H4T A;  2XI9 A;  3SD4 A;  4NOY A;  2DK3 A;  4ZTF A;  4F7U E;  4LD9 K;  2MWO A;  3LH0 A;  3VU3 C;  3A74 A;  3A8L B;  3DLM A;  2DZC A;  2EFI A;  3HFO A;  2EJ9 A;  3AHU A;  4GLK A;  4HWR A;  3DB4 A;  3G71 A;  1NJ8 A;  4M78 F;  3CCM A;  3J7A F;  3M4P A;  4C0Z A;  4ZN1 A;  1YIT A;  2JNG A;  2GFU A;  2LRQ A;  4C5I A;  4BE0 A;  4XTZ A;  3HFV A;  4BUG A;  4M75 C;  4LDV A;  2C06 A;  2ZCE A;  4H2V A;  2XGT A;  4PJO E;  2DU5 A;  3L2R A;  4IUR A;  2GQV A;  4M7A E;  1YCY A;  2EJF A;  4E7J A;  2A3L A;  2RK2 A;  1NYR A;  3CD6 A;  4M7D F;  1BI1 A;  2P0L A;  3OYK A;  4KR2 A;  3SFM A;  1MGQ A;  5LJ3 f;  1P92 A;  3FB9 A;  1SET A;  3VYH B;  3CBM A;  4FIB A;  1W2B A;  3JCM J;  3JAM E;  1XOV A;  4OGC A;  3CXC A;  1KOG A;  11AS A;  3UFG A;  5GAN 5;  4G84 A;  4XU1 A;  4C8Q C;  3JCM g;  3QII A;  1YIJ A;  1KG1 A;  4UP7 A;  1G3S A;  4C92 G;  2CJ9 A;  4H2X B;  4PL6 A;  4ZGD B;  5FU6 B;  2LDM A;  1VQ8 T;  1X2H A;  2YLB A;  4O6J A;  4M75 F;  5GAO n;  4H2S A;  4P71 A;  1XQH A;  1OZ2 A;  3NET A;  3E1S A;  4RG8 A;  2ODR D;  2DXU A;  1JJ2 S;  4O2D A;  4KUL A;  3TUP A;  1AHJ B;  2IY5 B;  1ASY A;  1B70 B;  2RA2 A;  2IG0 A;  3CCU T;  2L89 A;  1E22 A;  4CS4 A;  2E1H A;  3HY0 A;  3W3S A;  3JCM c;  4DOW A;  2XG8 D;  3JB9 H;  3CCV A;  4E7H A;  1VQM T;  5LL6 S;  1M90 C;  2KDS A;  4QQD A;  2DXB A;  2JTM A;  3UT1 A;  3LWI A;  4M7D E;  2DQ0 A;  4C8Q F;  4ZTJ A;  2CZ1 B;  3G1Z A;  3I55 A;  3VBB A;  1K8A U;  5CCA A;  2EAY A;  2CZ6 B;  1ZBX A;  3FIF A;  1NZ9 A;  4C0D B;  4L87 A;  2KQW A;  1HC7 A;  5GMK h;  3ICA A;  3NEL A;  3DSQ A;  2DQ3 A;  2ZPB B;  3L1A A;  3HFZ B;  4EMH A;  2RD1 A;  4BI3 A;  1TH7 A;  3MEV A;  4YRN A;  1N9S A;  4M7A B;  3OYG A;  4XK8 E;  2ZT6 A;  1N6A A;  4LD6 A;  5LJ5 d;  4M75 E;  2HQE A;  3LX7 A;  3M4Q A;  4HCZ A;  1VQ5 T;  2QHT A;  5LJ5 j;  4J6W A;  3L4G A;  2E5Q A;  2DTI A;  3ZFJ A;  1HK9 A;  4QVD A;  4HWP A;  2E6N A;  4Q5W A;  4MZM A;  2PME A;  2PUK B;  5LJ5 h;  3LGL A;  3QUI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...