1WQ7A

Crystal structure of biotin-(acetyl-coa-carboxylase) ligase from pyrococcus horikoshii ot3
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
235
structure length
229
Chain Sequence
b'MLGLKTSIIGRRVIYFQEITSTNEFAKTSYLEEGTVIVADKQTMGHGESPEGGLWLSIVLSPKVPQKDLPKIVFLGAVGVVETLKEFSIDGRIKWPNDVLVNYKKIAGVLVEGKGDKIVLGIGLNVNNKVPNGATSMKLELGSEVPLLSVFRSLITNLDRLYLNFLKNPMDILNLVRDNMILGVRVKILGDGSFEGIAEDIDDFGRLIIRLDSGEVKKVIYGDVSLRFL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords biotin--[acetyl-CoA-carboxylase] ligase
publication title Crystal Structures of Biotin Protein Ligase from Pyrococcus horikoshii OT3 and its Complexes: Structural Basis of Biotin Activation
pubmed doi rcsb
source organism Pyrococcus horikoshii
molecule tags Ligase
total genus 76
structure length 229
sequence length 235
chains with identical sequence B
ec nomenclature ec 6.3.4.15: Biotin--[biotin carboxyl-carrier protein] ligase.
pdb deposition date 2004-09-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02237 BPL_C Biotin protein ligase C terminal domain
A PF03099 BPL_LplA_LipB Biotin/lipoate A/B protein ligase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 1wq7A02
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 1wq7A01
4BW9A 3QTCA 2DXTA 3R07A 5GAMf 2AMCA 2DXUA 1B34B 1E1OA 4P74C 4Q6GA 3QHSA 4X9CA 2DEQA 3JCMb 3REXA 2JN0A 2EL9A 4C8QA 1ADJA 1H4VB 1H4TA 12ASA 2DQ0A 1G51A 4PJOG 5LJ5j 1SRYA 5LJ5f 4PJOE 3UGTA 5GAN6 4PJOB 3JCMc 4M7AF 5GMKh 1IL2A 4NL2A 2ZR3A 1MGQA 3JCMP 4PJOC 4NCXA 1H4SA 3JCMd 2ODRC 3KFUA 3FJPA 2ZT5A 1Y96B 1B76A 2DU7A 1N9RA 2DZ9A 4XTUA 1H641 3A74A 3L4GB 3NETA 1EVKA 2ARUA 3NELA 4NOYA 2I4NA 5GMKl 3LSQA 4TVWA 1QE0A 4YREA 4YP0A 1YCYA 2RA2A 4YRTA 2ARTA 2ZZFA 4M78B 3PCOB 2RM4A 1B7YB 2RB6A 3P8YA 1HXDA 1YB3A 4QVDA 4V2SA 4YRPA 3TEHB 3A7UA 3BJUA 4P74A 1LNXA 4O2DA 4M7DA 4P73C 4M75G 5GAN7 5LJ5d 3BFMA 4YRSA 4PHCA 2K57A 3BW1A 4M75E 1KMMA 2E65A 3ERRA 3VBBA 4HVCA 4M75B 4J5YA 1USYC 4HWSA 4M77D 4XEOA 4XEMA 4M75C 1I5LA 4MMKA 4QVCA 3HFZB 2DZCA 4K87A 4P3NA 4H2WA 1GGMA 4UPAA 3EFSA 4H2VA 4P75A 5I21A 2AMCB 1NYQA 2YLBA 5GANf 3V7RA 3L2ZA 4XU2A 1WLEA 4M77F 3HXWA 4YCVA 5GAOm 4C8QG 2ZINA 3HXYA 4C92A 4C8QE 2ZZGA 4C8QB 1I4K1 2ZIOA 2CJBA 2PMFA 4C8QC 3LC0A 4L87A 4KR3A 4HA8A 2EWNA 4RMFA 4M78A 4X5OA 1B7YA 4UP9A 3V7SA 4E51A 3ICAA 3WQZA 2CJAA 3JCMQ 4HT9A 3E9IA 4XU3A 4H2UA 3IG2A 3V8JA 3JB9F 2DTHA 1JRIA 5CAIA 4HWOA 4WJ3M 4YPFA 3OD1A 2Q7EA 2J3MA 1YGBA 3IKLA 5GANd 5K1PA 4J6XA 4JUVA 4M7DG 4HWPA 5LJ3d 4CS4A 4M7DE 1X55A 3VQWA 3RKWA 4M7DB 2I4LA 3HY0A 3A7AA 5HGQA 3GIBA 4M7DC 4M7AD 5GMKj 4WJ4A 5GAMj 5C51B 3JCMh 4CH3A 1YFTA 1SETA 1VQZA 2E1HA 2ZT7A 4P71A 1H4QA 3HRIA 3RESA 4XTWA 4YRMA 2Y90A 1G5HA 2ZTGA 3E9HA 1NYRA 1LJOA 3V8LA 2QHTA 4C92G 5LJ3e 5GAOr 4P75C 4WF2A 2ZR2A 4C92E 3BY7A 1JJCA 1NJ6A 3AHUA 1WNLA 3JCMg 4C92B 2J3LA 1SESA 2QTXA 4TWAA 2P5IA 3HXVA 4CH5A 4C92C 1B8AA 5K1XA 2G4CA 4PG3A 3SWNA 4H2SA 3VQVA 3FB9A 1NJ1A 4ZTUB 4M78G 2VXFA 4M78E 3M4PA 1I8FA 4CS3A 5C53B 3HXXA 4HT8A 5GAMd 1J5WA 3HXUA 1ATIA 3M4QA 4M78C 3JCMe 3QUIA 5GAOp 4YRJA 2HNIA 4RQFA 1LYLA 4XTXA 3UH0A 1NJ2A 1BBWA 2ZT6A 3UGQA 1NJ8A 4YRIA 3W3SA 4JRKA 5GMKi 2EJFA 3A5ZA 2YLCA 3QO5A 1D3BA 4H2XA 1E1TA 1E24A 5GAMe 5GAOl 4PJOD 2VC8A 4EMKA 4A53A 3P8TA 4F7UE 4JLIA 4EX5A 4F7UB 1KMNA 2EJ9A 3A7RA 1B70A 4YDQA 1KOGA 2CGHA 5ELOA 4PJOF 3RUXA 5LJ5e 2PMEA 1KQ1A 3A32A 1NNHA 4M77A 1BIAA 2Q7HA 2RHQA 4RCCA 1TH7A 2C7IA 4ZIBA 4RCBA 4P71C 2DKGA 1JBMA 4XU0A 2XGTA 3EFRA 4YRRA 3RL6A 3JB9D 4YRLA 4XTYA 3REUA 1JJCB 3HXZA 4M7AB 4EMGA 1N9WA 3MF2A 4TQFA 3DSQA 1EQRA 1WPYA 1WYDA 5GANh 2DTIA 3SWNB 4M78F 2RD1A 5LJ3h 3SWNC 2IY5A 3HFVA 3RERA 5C52B 1WQ7A 4HWRA 3INZA 1EIYA 3BDUA 5GAOq 2C8MA 4YRFA 5GANg 1N9SA 4N0AA 2Q5IA 1U1TA 4YRGA 2EAYA 4M75F 4F7UA 3HFNA 5LJ3g 3HRKA 4J15A 1I81A 4X9DA 4K88A 1ADYA 3LSSA 2ZZEA 1QF6A 3RIRA 3RKYA 3JCMV 4YRNA 2ZGWA 4YRKA 3HFOA 2ZCEA 4C8QD 1ASZA 1D3BB 4YCUA 4H2XB 3JCMW 5F5WA 2E5AA 5GANe 2Q7GA 1Z7NA 4EMKB 4A54A 2I2LA 2QHUA 3IALA 2E3CA 1BIBA 1PYSA 4C8QF 1B70B 1HTTA 2XTIA 4EMKC 3NEMA 4ZTZB 3PGGA 4YROA 2ZNIA 3RKXA 1U1SA 4M7AA 1WQWA 5GAN4 1HK9A 4TTVA 4OP0A 4M77G 3V7CA 3HY1A 2Q5HA 11ASA 4EMHA 3JCMX 5GAMh 4CS2A 4M77E 4Q15A 4M77B 3QO3A 2P0LA 4TVAA 1EVLA 1X54A 2RHQB 4XTVA 1BBUA 2ZXFA 1X2HA 4HWTA 4M77C 4H2TA 5GAN8 3CMQA 3VU3C 3FIFA 5GAOn 3RACA 2E41A 4YRCA 5LJ5h 4LNSA 1X2GA 1YFRA 3TUPA 4BWAA 2AKWB 2QHSA 5GAMg 2CIMA 2DQ3A 5KNNA 3HTZA 2DTOA 4JRIA 1HC7A 1M8VA 4P72C 4M7DD 3QO8A 3RF1A 5ELNA 3RGLA 2DDZA 4TQDA 3SB2A 3JB9G 2IY5B 3JB9H 3JB9J 5LJ5g 1RIQA 4AH6A 1Z7MA 2RHSA 1EIYB 2ALYB 1M5Q1 5GMKm 3JCMJ 4G85A 1KQ2A 3QNEA 5GAN3 2YHTA 4M7DF 4F7UG 5GAN2 2ZNJA 2ALYA 3NENA 3A5YA 2ODRD 4DQ2A 2QHVA 4N0AC 4H02A 1B34A 2DJZA 5GMKe 4DPGA 4XTZA 2DVEA 4C92D 3UFGA 4EO4A 4UP7A 2DU5A 3L1AA 3IKMB 5GAN5 3HSBA 2ZT8A 3I7FA 4TVYA 4KR2A 3V8KA 4PJOA 4RQEA 3VQYA 4NL3A 4C92F 1PYSB 5GANj 4M7AG 4M78D 1WU7A 4M7AE 2E64A 5LJ3j 1X56A 3PZCA 1Y96A 2AKWA 2ARSA 4K86A 2VXEA 5LJ3f 3QO7A 3MEYA 4P72A 2I4OA 4M7AC 5DY9A 3L4GA 4TVAB 1W66A 4P3PA 4J6YA 2EJGA 4YYEA 2FB7A 1SERA 4P3OA 3MF1A 4M75D 3VQXA 1X01A 3PCOA 4G84A 4YCWA 4OLFA 4UP8A 1LOJA 4CH6A 2I4MA 1EOVA 1NJ5A 3M4GA 2E10A 1G5IA 3P8VA 4PNOA 1C0AA 3TEHA 1FYFA 3JCMf 2ZIMA 4P73A 4CH4A 4H2YA 4J6WA 1L0WA 4KQEA 1E22A 2CJ9A 1EFWA 1USYA 4MMLA 3QSUA 4M75A 2RHSB 3A31A 1YFSA 4YRQA 4WI1A 4F7UF 4XU1A 3G1ZA 3TEGA 1ASYA 3HFZA 4XQ3A 5E3IA 4RDXA 2FYKA 4Y91A 3JB9I
chains in the Genus database with same CATH superfamily
1LCKA 2J6FA 3FC3A 1YI2Q 2H8HA 3HRTA 3QZ9B 1QCNA 3OQ5A 2ECZA 1B34B 1VQ9Q 1BI0A 2CH4W 1E1OA 1G8XA 2DEQA 4X9CA 3OYFA 1RAGB 4E7KA 3MP1A 4C8QA 2BZ8A 2J06A 1AD5A 2R5MA 2E3HA 3VKIA 5GAN6 5GMKh 1IL2A 2ZR3A 3JCMP 4C0FA 1H4SA 3JCMd 4IUPA 3E2UA 3JSCA 1B76A 2RI2A 1BI2A 4WTOB 4DA4A 1ZLMA 1NYFA 3ME9A 4LVMA 3BE3A 4NOYA 1QE0A 4YREA 4YP0A 3QKJA 4YRTA 1GBRA 2OI3A 3R6NA 2DIQA 1ZA1B 3PCOB 1MMDA 2QEXT 1JJ2S 1OOTA 2COYA 3G1JA 1B7YB 1F1BB 1YB3A 1CKAA 4QVDA 5FROA 1JU5C 3CMEQ 4YRPA 2XK0A 1UECA 2QYZA 2LQWA 4M7DA 3EG3A 4P73C 4M75G 4L5GA 5LJ5d 3E1SA 3IQLA 1KMMA 3BW1A 2E65A 2VV5A 3VBBA 4M75B 5IT9E 2JM8A 3J80E 4PFZA 1USYC 4HWSA 2AK5A 1K76A 4RTZA 1X27A 4MMKA 4CC2A 2LC4A 4X1VA 1V76A 2FRYA 1LPLA 3PVQA 2AMCB 3NFCA 1RLPC 3A98A 3OW2P 3HHTB 3L2ZA 4XU2A 3V7RA 4M77F 3L42A 4YCVA 2ZINA 4R56A 4Z89A 1UHCA 4BUGA 2QASA 5KYNA 1ZSGA 2CJBA 3HL8A 3NMZC 4X34A 1BYMA 1K4US 3LC0A 2HKNA 4F14A 4L87A 4FSSA 1G3YA 3I56T 4IUQA 4E7JA 1B3QA 4RMFA 2DAQA 2C06A 2RK1A 4FT2A 3CCVA 1WI7A 2MCNA 1UEBA 5CVIA 3PIPA 3CC4Q 3JCMQ 1IXDA 3RMSA 4FYWB 2VGMA 3IG2A 2YT6A 4RTUA 5KE2A 4IUTA 2LX7A 5CAIA 1YITT 4PJMA 4HWOA 2RJFA 4BE0A 3E19A 3OD1A 4J9FA 2WACA 1YGBA 2COWA 1QVGS 1QP2A 1VIEA 3QPHA 4HVVA 2QTVA 3LX7A 4JUVA 1QWEA 2KRNA 2DE0X 3RMQA 5LJ3d 3META 1X55A 2DM1A 3RKWA 3M0SA 3A7AA 4E47A 4MZMA 4E7ZA 1VQKA 1SETA 3CCUQ 3QYGB 2E1HA 4LDUA 3HRIA 3RESA 2EBPA 3VS6A 2M16A 1WA7A 2Y90A 1UJYA 2ZTGA 4LD9K 2QQAA 3V8LA 4E7IA 5KE3A 1MV3A 4P75C 1D0XA 1JJCA 1WNLA 2D8HA 3QIIA 2FZKB 3JCMg 2EGEA 3AHUA 2F1LA 2KYBA 2QTXA 1SESA 4OMFB 3HXVA 4C92C 1NLPC 2G4CA 4PG3A 2GTJA 2X35A 2D9TA 3VQVA 1XQHA 4M78G 1VQ8T 1X6GA 2VXFA 1X75C 1UG1A 2DXCA 3M4PA 3JAME 5C53B 2HD0A 3CCLA 1C1AA 1J5WA 3HXUA 1ATIA 3M4QA 2QA4Q 3JCMe 4E6RA 2Y4XA 2K3YA 1I1JA 2DA9A 4PK4A 2DF6A 3QXEB 4OF1A 2JMCA 1NJ2A 3UH0A 1BBWA 2DBMA 3U23A 2ZT6A 1D1BA 1E6GA 3A5ZA 3CCEQ 2ENMA 5LL6S 4FYXB 1ZBJA 2DRMA 1E24A 3MO8A 1J3TA 4QW2A 2J7IA 5GAMe 1G5VA 1RAEB 2EVRA 3G7ZA 2VC8A 2HSEB 3EFOA 5CQYA 2BKDN 3WVDB 1VQPT 1XNIA 1QVFP 1VQNQ 1RI9A 1B70A 2QI2A 4JS5A 2JMAA 2CGHA 5ELOA 4N4GA 3EGUA 2KY9A 3SDZA 5LJ5e 4BD3A 1KQ1A 3CXCP 1HJDA 4ME7A 4CC7A 2Q7HA 2JZ2A 3L2RA 1YIJT 1Y7XA 4RCCA 1TH7A 2HL5C 4ZIBA 4MDXA 2DKGA 4KGZB 3M58A 1Q7YC 1RLQC 2JVVA 4M7AB 4EMGA 4HCKA 1S1NA 1EQRA 1WYDA 5GANh 2D0NA 3I35A 2CP7A 3MCAB 3A8GB 2EKHA 3NTKA 3SWNC 1H8KA 1V29B 4OMPA 1E6HA 2F5TX 1VQOQ 4HWRA 2DL3A 2C8MA 4YRFA 1SPKA 2MAMA 1M2OA 1Q82U 2LTOA 2KNBB 3NTHA 3G6EA 2FL7A 4N4IA 4N0AA 4J7FA 4YRGA 2EAYA 4M75F 4F7UA 5LJ3g 3HRKA 3TVTA 4X9DA 1GBQA 2KQWA 2YUPA 4K88A 2ZCFB 1ADYA 4GLKA 4YRNA 5J26A 4AFZC 1M9SA 2KT1A 3CPWP 3G4ST 2G3RA 2F2WA 1R8OB 1AHJB 1N8RR 5EG2A 2E5AA 2Q7GA 1Z7NA 1YI2A 4JLGA 3IALA 2E3CA 1MHNA 1T3LA 1VQ9A 3GF5A 5KYXB 2ZNIA 5KYYA 3M0PA 5GAN4 4OP0A 1YHQT 4FSXA 4QT7A 4EMHA 3JCMX 4M77E 3C95A 3MKDA 3ZEHA 1YWPA 4TVAA 1EVLA 4XTVA 1X2HA 4EPCA 2V1RA 4H2TA 3CMQA 2KGTA 3VU3C 1D0ZA 2PVOB 1UE9A 2XG8D 3M0TA 5FU6B 3OBWA 2E41A 1AEYA 2YRCA 2RJEA 3SD4A 4BWAA 1NJIC 1OX8A 2FPDA 2AKWB 2QHSA 4OB1B 3CCMT 2CSIA 2CT4A 1VOMA 3OYJA 1YJWQ 4P72C 1ARKA 2LMJA 3QO8A 5ELNA 1QKXA 3JB9G 2IY5B 2LJ0A 3JB9H 3I56Q 5L23A 3FJ5A 1EIYB 3OY9A 1M5Q1 5GMKm 2CP2A 3CMEA 4G85A 3MP8A 4LNPA 3WVEB 4N4HA 3NENA 2MWPA 7AT1B 2KROA 2QHVA 2J6OA 3QWYA 2R58A 5GMKe 4DPGA 1BK2A 2ZPIB 1QP3A 4C0DC 1W2BS 4UP7A 1ZUUA 1V1CA 2AKKA 2DLPA 4J9BA 5GAN5 1Q81C 2YSQA 1K9MC 3M56A 4KR2A 4C5IA 2A8EA 1TTHB 2VKNA 3GOXA 2DYIA 2Z0WA 1PYSB 3CMAT 1OQKA 3LLRA 3SHWA 1VQ4T 3THKA 2E64A 3A8MB 1Y96A 2XDDA 2RHIA 1KQSS 4P72A 1EFNA 2I4OA 4M7AC 1SF9A 3JRZA 5DY9A 5IAYA 3L4GA 1W66A 2RK2A 1PWTA 3X26B 2LQNA 1T0JA 2PUOB 3H0FA 5A0GA 2VUBA 3MF1A 2CZ0B 2A7YA 4G84A 4YCWA 1KC8C 1PSFA 5J39A 3CC4A 2I4MA 1JJ2A 1G5IA 3P8VA 1P92A 3TEHA 2EGCA 2BZYA 3JCMf 2VASA 2ZIMA 2EQMA 2JUFA 4BDZA 1TG0A 4KQEA 1GCQA 1EFWA 2E70A 4MMLA 3QSUA 4FYVB 5C6SA 2EQIA 3LWHA 1ZSZC 1YFSA 4YRQA 4XU1A 3TEGA 1ASYA 2D8JA 2K3BA 1RAHB 4J8OA 4RDXA 2FYKA 2E5KA 4BW9A 1VIFA 5GAMf 1X6OA 1K1ZA 3X28B 3QHSA 2ZPBB 2JTFA 1NJIU 2OJ2A 2OX7A 3CCUA 3MEUA 1M2VB 2EL9A 1K8AC 1H4TA 2JTMA 1VYUA 5LJ5f 1JO8A 2ED1A 2PTKA 3M55A 5FWBA 1K73C 3QDRB 4M7AF 3J7AF 4PJOC 2CDTA 2KEAA 3VRZA 4Y28E 2QGFB 4KRTA 3KFUA 3EH2A 3PTAA 2DL7A 2DU7A 2AZSA 2DZ9A 3OW2A 1ZQ1A 2P84A 2VYTA 2LJ1A 2LCLA 3UATA 1EVKA 1WHJA 2I4NA 2IIMA 1OZ2A 4FIBA 2FEIA 4GBQA 1MUZA 4PJJA 4PFOA 1VQ5T 2QA4A 2RO0A 2X3XD 3UT1A 4V2SA 4AFQC 2JS0A 4HVUA 2ROLA 4CI0C 2C0OA 4QQGA 2M1HA 1ZA2B 4LXCA 3GNFB 4HXJA 2NUTA 2CSQA 2IG0A 3TQ7P 1UGVA 3OYGA 4PHCA 4M75E 3CCEA 3ERRA 5IH2A 4HVCA 1KD1R 4RTYA 4J5YA 1ACMB 4M77D 4XEOA 1MNDA 4HCCA 1IRXA 1PG5B 4HCZA 2HQHA 4JJBA 1NG2A 3QYHB 4QQ6A 4H2WA 1I5OB 1R0CB 4LVLA 2V8IA 1B07A 1VQNA 3DKMA 1HYOA 2KXDA 1NYQA 1I07A 4A4KA 2OTJT 1KHCA 1C6VX 3I5SA 3SFMA 3PMIA 2ZZGA 2OTLT 1RI0A 1I4K1 2ZIOA 2JTEA 2RNAA 1OPLA 3I55Q 2PMFA 4C8QC 3CCST 1TUGB 2EYZA 3G4SQ 4KR3A 2A28A 2MWOA 3EH1A 2GCXA 1PKTA 3EG2A 1OYXA 1EX4A 3EGDB 4OGCA 4ELYC 5I22A 2CJAA 1M3AA 5DM7R 2XIDA 3PT9A 3E9IA 3GP8A 3G71T 3V8JA 3JB9F 2DTHA 1JRIA 1M1KU 4IKFA 2HMAA 4JJDA 1VQOA 4WJ3M 4YPFA 2J3MA 1UGPB 1FXXA 3PMTA 1VQ6Q 3L2VA 5K1PA 2AZVA 5IXBA 3M57A 3CD6Q 4J6XA 1K73U 1TSFA 2HQEA 5KYUA 4HWPA 2AHJB 3HY0A 2LZ6B 1SSHA 2FHDA 3OYKA 3UDCA 4CC4B 3GIBA 3A1PA 4LDVA 4M7DC 4WJ4A 2GQIA 2QDLA 1YFTA 1KJWA 2ZT7A 3MEVA 4AG1C 5HK3A 3GBQA 3VUZA 1LJOA 1VA7A 1JJ2P 1OULA 1FYNA 2MF2A 4C92G 5GAOr 2ZR2A 1E7OA 3LYIA 3BY7A 1VQLT 4C92B 1UHFA 3OYCA 1QVFA 1T3SA 2MK5A 3ASKA 1IHVA 4PFPA 1TUDA 3CXCA 2DL4A 4ZTUB 4M78E 4Q5WA 2KRMA 2P0QA 2O9SA 5GAMd 3QDFA 1VQ4Q 2EYXA 2KYMA 1YJWA 4RQFA 1LYLA 3EGXA 4L59A 4AG2C 4DEYA 2B8AA 2XICA 3DLMA 1NJ8A 4LD6A 2P4TA 4ANJA 1YJ9T 3I56A 4KT0E 1C0MA 5GMKi 2EJFA 2QAZA 1AWOA 2GF7A 3QO5A 2LJ3A 3HKSA 3CC2T 1D3BA 4H2XA 2O88A 1CKBA 2LNVA 2W0ZA 2E12A 4II1A 2XMFA 2EW3A 5GAOl 3C94A 5J3BA 4EMKA 4A53A 1OX9A 3EG9A 4JLIA 3OYEA 3P8TA 4EX5A 4F7UB 2NUZA 2L3QA 3CCRQ 4ZTJA 4YDQA 2GNCA 2K2MA 2DD4A 1M3BA 5CKEA 2QDYB 3RUXA 3OYNA 2E3IA 2LDMA 1UFFA 3UWNA 1YNZA 4M77A 4NS5A 3EHRA 2COZA 2YWWA 3CPWA 2VGNA 4D8KA 4DBFA 1JBMA 5D6XA 1O9SA 4XU0A 3EFRA 3RL6A 2JNGA 4XTYA 1QVGP 1AWJA 3HXZA 3MF2A 4TQFA 3M5AA 3DSQA 1WPYA 1M4ZA 1AWXA 2E5QA 1NEGA 1WHLA 3SWNB 2LVMA 5AT1B 1D1CA 2SEMA 3DB4A 3EG0A 1WQ7A 3INZA 3BDUA 2EQJA 4D8DA 3OS2A 2HQXA 2CUDA 5HKCA 1TUCA 2R5AA 5KYWA 1N9SA 5FRNA 3HFNA 2DIGA 1U5SA 4J15A 1I81A 2CREA 1OI1A 2KT8A 4XK8E 2A0FB 2P0PA 2ZZEA 2ZGWA 4TVRA 2KE9A 2RHUA 1ASZA 4Y92A 4RTVA 4EDUA 3JCMW 1Q82C 2KI7A 3MEWA 3A8LB 2QHUA 3M4YA 4J9HA 3CCVT 5GJVB 1VUBA 5CQXA 1GCPA 3RKXA 4P5NA 1Q95G 1U1SA 1WQWA 3UF4A 1S72T 3VS4A 4LDXA 1EZZB 2X4WA 3HY1A 2Q5HA 4CS2A 4IUUA 4Q15A 4BI8B 2CZ7B 1ZUKA 2P0LA 3VYGA 3P8HA 4BY6C 2RHQB 1BBUA 2NUPA 2VB6A 3FIFA 2RQWA 4ZN1A 1ABQA 4A4EA 1KG1A 2MMPA 3C4SA 4LNSA 1YFRA 3TUPA 2AT1B 2B86A 3C0CA 4R0KA 5GAMg 2LT4A 3HTZA 2K6DA 4JRIA 5FLXE 2RQRA 1ZUYA 2O4XB 4JZ4A 2MI6A 4JZ3A 1OZ3A 1TU0B 5LJ5g 1VQMQ 4AH6A 1Z7MA 1WXUA 1SHFA 2EGAA 3RBBB 2DETA 2MIOA 2L3RA 3RR6A 2L0AA 4KUDK 1NEBA 4XAXB 2ODRD 1X2QA 1WHGA 4C0DB 4N0AC 4H02A 1B34A 5FU7C 1MMNA 4JRPA 1ZBXA 3G71Q 1RABB 2RMOA 1FMWA 3VS7A 2DU5A 1PM3A 1OPKA 3L1AA 1K9AA 3CQTA 3HSBA 1SHGA 3IKMB 3H41A 4TVYA 3REAB 1N27A 1G83A 3V8KA 4RQEA 2LX9A 4C92F 3PIOA 2KK4A 4M7AG 2BIVA 4M78D 1WU7A 5LJ3j 1X56A 3PZCA 1UGSB 4K86A 2VXEA 4WCIA 3SEMA 3I55A 2DERA 3QBYA 3OS0A 3CBMA 3G4SA 2V1QA 1WYXA 1KK7A 1UJ0A 4YYEA 2K9GA 1SERA 4P3OA 1QVPA 3VQXA 3QWXX 1X01A 3PCOA 2NWMA 4UP8A 1T0HA 4CH6A 1TWBA 3M4GA 2CT3A 3HRSA 1G2BA 4PNOA 1VQLQ 5CKBA 4CH4A 2HKQB 3LGFA 4A4HA 2LP5A 4J6WA 4HT4A 5M9OA 1E22A 1ZSZB 1U8RA 2DMOA 3I5RA 2RN8A 4M75A 2RHSB 3OYAA 3CC7T 1VQ6A 4F7UF 3G1ZA 3CD6A 2QEXQ 5E3IA 2ALYB 4Y91A 3JB9I 2HEQA 2ZPHB 3QTCA 2DXTA 1PNJA 2AMCA 1U06A 2DXUA 2NUTB 4P74C 4Q6GA 1JXOA 3JCMb 4GY5A 3TEEA 2YDLA 3CCJT 2JN0A 1YJ9Q 2FO0A 4B9WA 2RI3A 3REBB 1H4VB 2DQ0A 1G51A 4PJOG 3CC2Q 1D1AA 4PJOB 1N5ZA 1WZOA 2CP0A 3JCMc 4IUVA 4CC3A 1AZGB 1MGQA 3M59A 1PKSA 4JRQA 2RF0A 4CRIA 2ODRC 2CYZB 1YFNA 3FJPA 1N8RU 2ZT5A 1WJQA 2JOYA 4XTUA 3G6ET 2YUOA 1H641 3VS1A 3L2QA 2YUQA 4AMCA 3NETA 4RMOA 3VJPA 4AFUC 4IIMA 3NELA 3RNJA 3LSQA 4A4FA 1W2BP 2RA2A 2ARTA 2ZZFA 1Q7YR 1VQ4A 2LCSA 4FL6A 2A08A 2AKLA 3OMCA 1YI2T 2VVKA 2F2VA 1X6BA 3P8DA 3BJUA 4P74A 1VQ9T 2DO3A 2J6KA 3C12A 1KIKA 4O2DA 2P0KA 5GAN7 4YRSA 3BFMA 2K57A 2ED0A 1AZEA 1YITQ 1GCQC 2D6FA 4XEMA 4KULA 1I5LA 3HFZB 3EG1A 1UUEA 4KH1B 4P3NA 3ZL7C 1GGMA 2JS2A 4UPAA 1BCMA 5KYUB 1KFZA 3X20B 4H2VA 2O9VA 3CCRA 3T9NA 4JS4A 1WLEA 3OBYA 3HXWA 4C8QG 2BE9B 1RADB 3DB3A 4C8QB 3NTIA 2KRSA 2WSFE 1OEBA 3TU4K 1D09B 5I2MA 4HA8A 2P4RA 2VWFA 3KUFA 2EKOA 4M78A 4X5OA 4QKUA 2JXBA 4E51A 3WQZA 3EHQA 1M90R 2DVJA 3MPUB 1IGUA 2QQ9A 1S72Q 4BDYA 4XU3A 4ORZA 4GLMA 3H0IA 4PL6A 4RTWA 4RTXA 5A2QE 1A0NB 5KCOA 1M30A 3GNGA 1KD1C 2FG0A 2ZPFB 3I9QA 1VQ8Q 4OVAA 3IKLA 2XU8A 3Q1JA 5GANd 1H3HA 4PLIA 2LCCA 3CCQT 2EQKA 4ZGDB 4M7DG 3F70A 5KH6A 4CS4A 3EGXB 4F17A 2DEUA 3VQWA 4PJNA 3TREA 4ESRA 1SEMA 4M7DB 2I4LA 4ZTFA 1M1KC 5HGQA 3ER0A 3VYHB 5CCAA 1M8MA 2J05A 4PJLA 1PSEA 2PU9B 5C51B 3JCMh 3OMGA 1VQ7T 3FRNA 4P71A 4YRMA 1WHKA 2LQ8A 2L8DA 2IPOB 1G5HA 2KVQG 1NYRA 2K5IA 2QHTA 4WF2A 3CC4T 4C92E 1VQPQ 4RKUE 2J3LA 1IREB 3H8ZA 2P5IA 4CH5A 2DL5A 5K1XA 4H2SA 1HD3A 1K9MR 2F2XA 1Q81R 3TCJA 1YIJQ 1NBEB 1WHHA 1I8FA 4K11A 4CS3A 3HXXA 3TSWA 2DX1A 2OAWA 2WSCE 1M27C 4HVWA 4BI4A 5HK0A 1QVGA 1G3TA 3QUIA 3RDVA 3LWIA 2DBKA 4J9CA 3UGQA 2JT4A 4YRIA 3GLXA 1X2KA 1NE8A 4J9DA 2KMTA 3CCUT 2NYSA 1VQMA 2O31A 1N6AA 5IHNA 4QVZA 1E1TA 4OMNA 4ATOA 1KC8R 2CKKA 4HKEA 4F7UE 2V8JA 1KMNA 2DJQA 3A7RA 3G71A 2K7AA 3CBPA 1SRLA 5KYXA 1KOGA 5CK9A 5DLQE 1K0XA 4PJOF 2E4HA 1GL5A 1Q86R 2QK0A 1NM7A 3CC7Q 4RCBA 3H0HA 1KD1U 4YRLA 2RHZA 3REUA 1ZX6A 1JJCB 5HCKA 3KFVA 2EQUA 2YXYA 4ZGJB 5CIUA 1N9WA 1YJNT 2XD0A 2QQRA 3CCJQ 1YHQQ 2DTIA 2ZZDA 5L8RE 1K8AR 4FCYA 2RD1A 2K5LA 1M1GA 5LJ3h 2FZGB 3CCET 2IY5A 3RERA 3VS5A 1AVZC 4B6MA 2FRWA 1EIYA 3CEYA 1GXIE 2OAUA 1QWFA 1VQLA 5GANg 4VUBA 2JW4A 1O75A 1U1TA 3CCMQ 1AWWA 1JQQA 5FWCA 4JJNK 1PHTA 2K2VA 2ZPGB 2PQWA 3LSSA 2MOXA 1QF6A 4ZGEB 3JCMV 3OSVA 4OB3B 3A5ZB 4YRKA 1TS9A 3HTRA 2ZCEA 4JJCA 4YCUA 2QEXA 1RL2A 5HY6A 5F5WA 2IVWA 3OYIA 5GANe 4LVIA 3KXTA 3EFOB 3VS0A 1VYTA 1BIBA 1PYSA 4C8QF 2MYSA 1B70B 1HTTA 4Z02A 4EMKC 3PGGA 2EYQA 2W10A 1W4SA 2DNUA 3QJ6A 2FPEA 1YJ9A 1HK9A 3V7CA 3MHXA 4BY6B 11ASA 1FMKA 5CKHA 3UA6A 5CKFA 2E6NA 3QO3A 3CC2A 1X54A 3O8VA 2DPPB 4HWTA 3OB9A 4M77C 1YN8A 5GAN8 2GFAA 1Y0MA 1VQOT 3OYDA 4IURA 1Y57A 4RG2A 3D7SB 3RACA 2O2OA 3WXMB 2C0TA 3QZ5B 2X4JA 3CMAQ 1WHMA 2RQVA 4J7IA 2EIFA 3CPFA 2CIMA 4LUDA 5KNNA 4EIKA 5CKDA 2DTOA 1HC7A 3OSSC 3VS2A 3FLGA 1M8VA 3CBOA 3NGPA 2QG9B 2DDZA 4TQDA 1FMVA 3JB9J 1B7TA 5A0LA 3X25B 1KQ2A 3QNEA 5A0DA 2A3LA 4M7DF 1UTIA 2X4XA 1VYVA 4F7UG 5GAN2 5FU7B 1OU9A 3A5YA 2HL3A 3URGA 4DQ2A 4C0GA 4FW1A 1JXMA 1W1FA 2RJCA 2DJZA 1KHIA 1X43A 2GFUA 4XTZA 4C92D 3UFGA 1YITA 4DEXA 1M2VA 4JDSA 3M53A 3UA7A 2ZT8A 1AOJA 3H9NA 1XOVA 1TXQA 4NL3A 5IHIA 3CCQQ 3OA6A 2PNIA 4M7AE 4LN2A 8ATCB 5KYYB 3FEOA 2EYYA 2ARSA 2LT1A 1YJWT 1GRIA 1WXBA 4OB0B 4TVAB 4RUGA 1PD0A 1VQ7Q 4J83A 4J6YA 4P3PA 3JV3A 2CZ6B 2F69A 4M75D 2CUBA 2NLUA 1WXTA 3OW2S 4YTLA 1EOVA 2DFUA 4DBQA 1NJ5A 2CP6A 1PRLC 1S72A 1C0AA 2GTOA 4P73A 2M51A 2QGGA 2R57A 1L0WA 2CP5A 4C5GA 4D6WA 1VQ8A 1USYA 4J9IA 1SSFA 3A31A 3QJYA 2E6ZA 5C0MA 1W2BA 1MMGA 4M4ZA 1QCFA 1YCSB 1VQ5Q 4XQ3A 3MP6A 4HCBA 5GAMj 2JJ9A 1IHWA 3R07A 4OMLA 1JB0E 1RACB 1IB8A 2HCKA 1XTDA 1TOVA 4BE2A 3REXA 1MNEA 4FT4A 4AFSC 1ADJA 1NPPA 12ASA 4LDWA 5LJ5j 1SRYA 4PKCC 2F5KA 2X4YA 1KQSA 4PJOE 3UGTA 2HBWA 4RG8A 4NL2A 1PD1A 3TSZA 4NCXA 2DILA 1VQPA 2RQUA 2OTJQ 1Y96B 9ATCB 3EGDA 1N9RA 4UC4A 3UPUA 2K79A 1M1FA 3A74A 2HSPA 5FRMA 3L4GB 2XHCA 2OTLQ 2ARUA 3M9QA 4Z8AA 3ZBDA 5GMKl 1YIJA 4TVWA 1NLOC 2ESWA 1YCYA 3CCSQ 1VQKT 3M0UA 2KDSA 4M78B 2GBQA 6AT1B 3M54A 3S3MA 2RM4A 3P8YA 1N8RC 3LW5E 1HXDA 1YWOA 3P8BB 2BZXA 3TEHB 3A7UA 1WX6A 1Y71A 2V8KA 4FM4B 2RI5A 1LNXA 3PVLA 1RUWA 1YJNQ 4LUEA 3FDRA 4BI3A 2ZPEB 1DJ7B 4M75C 4QVCA 2DZCA 5FW9A 4K87A 3NHNA 1IZ6A 2BTTA 3EFSA 4P75A 2H3JA 4E2FB 5I21A 1KSWA 1PRMC 1H92A 2YLBA 5D6WA 5GANf 3CCLT 1MV0B 3R6OA 2K5FA 5GAOm 4OMQA 3HXYA 4C92A 4C8QE 1WDXA 4ZNXA 3CC7A 1D0YA 4FU6A 3GPLA 2D0QB 1Q82R 2EWNA 2MPXC 1K0SA 2I0NA 2KR3A 4A4GA 1GFCA 1QVFS 1B7YA 3V7SA 4UP9A 3ICAA 1IGQA 2KAFA 3O5ZA 4OMMA 3CCJA 1YHQA 4HT9A 3CXCS 4H2UA 3E9GA 2EFIA 2CH4A 2Y4YA 1W70A 4KGXB 4PLLA 1QMCA 2FZCB 2Q7EA 2G6FX 2SRCA 4C5EA 2ATCB 3E9FA 3CCMA 1BB9A 1NZ9A 4M7DE 2DD5A 2QQBA 4F04B 2EPDA 2ABLA 2CS7A 4M7AD 3N5BB 3L2WA 5GMKj 4LDYA 3H6ZA 1GFDA 4E7LA 3I55T 4CH3A 3OS1A 2CZ1B 1VQZA 1NYGA 4C5HA 4BACA 5ECAA 1H4QA 4XTWA 2ZAEA 3E9HA 4KGVB 1G3SA 2HZYA 2HBPA 1WGSA 1UGQB 5LJ3e 1M90C 1NJ6A 3NPFA 1UB4A 4ZN3A 3J81E 4TWAA 2YRDA 3KBGA 4DBRA 2RJDA 3CPWS 1B8AA 4ELZC 3SWNA 3FB9A 2PUKB 2FPFA 1NJ1A 1SG5A 4A63B 4FYYB 1BBZA 2O01E 1VQ6T 3CMAA 2BUDA 1AT1B 4HT8A 3CD6T 1WIEA 1HSQA 4M78C 5GJWB 1FX7A 3S3NA 4YRJA 5GAOp 2HNIA 4XTXA 2C0IA 5I2SA 1QLYA 3HP9A 2HAXA 1PC0A 3W3SA 1W6XA 4FW2A 2M9UA 2X3WD 4B9XA 4JRKA 1KQSP 2YLCA 3HRUA 4BB7A 2L3PA 2HDAA 1RAIB 2KSSA 5IHKA 1JEGA 5D7UA 4PJOD 3S3OA 2M0YA 4J9EA 4OGEA 4AT1B 4LVKA 2EJ9A 1Q7YU 2KBTA 4QQDA 2DK3A 1X69A 2PMEA 2D1XA 3A32A 1NNHA 1RAFB 2L5QA 1BIAA 1YBYA 2RHQA 1IO6A 1PCXA 3ULRB 2C7IA 2H3EB 5D6YA 4P71C 3CCQA 2XGTA 4YRRA 3JB9D 3BDLA 3CMET 1EIFA 2LQKA 4LVJA 4IIOA 2GGRA 3CCVQ 3L2UA 3VUBA 2DRKA 1LVKA 4E7HA 4R55A 2ROTA 5AYFA 1VQ7A 4M78F 3VRYA 3A8HB 4O6JA 2O4XA 1QW1A 3HFVA 5C52B 1WJSA 3OS5A 4KBMB 1U3OA 3HPWA 1BI1A 1WLPB 5GAOq 2A36A 2FVUA 1G3WA 1NJIR 2RPNA 2AIRB 2Q5IA 3CCRT 1ZHIA 1CSKA 1OV3A 1BI3A 4F16A 1M90U 3EAEA 3RIRA 3RKYA 2DL8A 3OYHA 1Q86C 4MZPA 3HFOA 4C8QD 1D3BB 4RTTA 1VQKQ 4H2XB 1R77A 1BKBA 2RHYA 1VQ5A 1SKUB 1WJRA 1Y07A 4EMKB 3EG9B 4A54A 2I2LA 2K3XA 2XTIA 5KCHA 4J9GA 3NEMA 4ZTZB 4YROA 5IN1A 4MZTA 2RQTA 1BU1A 2A37A 4M7AA 4TTVA 3LH5A 4M77G 4DOWA 3S6WA 5GAMh 1ABOA 4M77B 3PFSA 2NS6A 4OB2B 3OYBA 3A8OB 2ZXFA 5IXFA 4KH0B 1Z9QA 3MQZA 5GAOn 4JPBW 1RAAB 4YRCA 1MMAA 5LJ5h 2OTJA 3VV0A 1X2GA 5CR2A 5FU6C 4LE9A 3CCLQ 2DQ3A 2QQSA 4DOVA 3DLLA 2OTLA 2LNHB 2LRQA 2PVGB 1QCOA 4M7DD 3CCSA 3RF1A 3RGLA 3X24B 4MDWA 2DXBA 3SB2A 5DLOA 1YP5A 1ZSZA 2KXCA 2M0OA 2XDBA 1RIQA 2WSEE 1QKWA 2YUNA 2RHSA 3VS3A 3JCMJ 1M3CA 1Q81U 5GAN3 1K9MU 2YHTA 3AT1B 5I11A 5KYWB 3OYMA 1QQJA 4OMOA 2ZNJA 3M0QA 5EC7A 2ALYA 1YJNA 2X51A 2CP3A 4O5VA 1FWZA 2DVEA 2JM9A 4EO4A 2L2PA 4KUIA 1R0BG 3OYLA 4L6V5 1BCOA 4C0ZA 3I7FA 1Z9ZA 3LH0A 1XJWB 4PJOA 3VQYA 5GANj 2X9HA 2YRVA 2QA4T 2V26A 3MJXA 1KC8U 1M1KR 1UGRB 4DBHA 2AKWA 5LJ3f 3QO7A 3MEAA 3MEYA 3QG1A 3ZFJA 2PVDB 1NPRA 2RHXA 2NUPB 3M0RA 3OYYA 2DYBA 2EJGA 2EYWA 4Z88A 1VQMT 2FB7A 1K73R 2XKOC 1Q86U 2L3SA 2M02A 2K4YA 1I0CA 4OLFA 2RH2A 1LOJA 2E10A 3PE0A 3PNWC 2QXFA 1VQNT 1FYFA 3G6EQ 2L89A 1UDLA 4H2YA 2XDPA 5CO7A 1WFWA 4E7SA 8AT1B 2CJ9A 2BE7D 1SRMA 3LGLA 1K8AU 2XI9A 4WI1A 2PZ1A 1OU8A 2GQVA 3HFZA 1H3ZA 2RB6A 4BE1A
chains in the Genus database with same CATH topology
3FC3A 3HRTA 3QZ9B 3OQ5A 1B34B 1BI0A 1E1OA 4X9CA 2DEQA 3OYFA 4E7KA 3MP1A 4C8QA 2R5MA 3VKIA 5GAN6 5GMKh 1IL2A 2ZR3A 3JCMP 4C0FA 1H4SA 3JCMd 4IUPA 3JSCA 1B76A 2RI2A 1BI2A 4DA4A 4LVMA 3ME9A 4NOYA 1QE0A 4YREA 4YP0A 3QKJA 4YRTA 2DIQA 3PCOB 2QEXT 1JJ2S 1B7YB 1YB3A 4QVDA 5FROA 4YRPA 2XK0A 4M7DA 4P73C 4M75G 4L5GA 5LJ5d 3E1SA 1KMMA 3BW1A 2E65A 2VV5A 3VBBA 4M75B 5IT9E 3J80E 1USYC 4HWSA 4MMKA 2LC4A 2AMCB 3NFCA 3HHTB 3L2ZA 4XU2A 3V7RA 4M77F 3L42A 4YCVA 2ZINA 4R56A 4BUGA 2CJBA 3HL8A 4X34A 1BYMA 3LC0A 4L87A 1G3YA 3I56T 4IUQA 4E7JA 4RMFA 2DAQA 2C06A 2RK1A 4FT2A 3CCVA 1UEBA 5CVIA 3PIPA 3JCMQ 3RMSA 2VGMA 3IG2A 5KE2A 4IUTA 5CAIA 1YITT 4HWOA 2RJFA 4BE0A 3E19A 3OD1A 2WACA 1YGBA 1QVGS 1QP2A 1VIEA 3QPHA 4JUVA 3LX7A 3RMQA 5LJ3d 3META 1X55A 3RKWA 3A7AA 4E47A 4MZMA 1VQKA 1SETA 3QYGB 2E1HA 4LDUA 3HRIA 3RESA 2M16A 2Y90A 2ZTGA 4LD9K 2QQAA 3V8LA 4E7IA 5KE3A 4P75C 1JJCA 1WNLA 3QIIA 3JCMg 3AHUA 1SESA 2QTXA 4OMFB 3HXVA 4C92C 2G4CA 4PG3A 2X35A 2D9TA 3VQVA 1XQHA 4M78G 1VQ8T 2VXFA 1X75C 2DXCA 3M4PA 3JAME 5C53B 2HD0A 3CCLA 1J5WA 3HXUA 1ATIA 3M4QA 3JCMe 2Y4XA 2K3YA 3QXEB 4OF1A 3UH0A 1NJ2A 1BBWA 2ZT6A 3A5ZA 5LL6S 1E24A 3MO8A 1G5VA 4QW2A 5GAMe 3G7ZA 2VC8A 5CQYA 2BKDN 3WVDB 1VQPT 1XNIA 1B70A 2QI2A 4JS5A 2CGHA 5ELOA 4N4GA 2KY9A 3SDZA 5LJ5e 4BD3A 1KQ1A 4ME7A 2Q7HA 2JZ2A 3L2RA 1YIJT 1Y7XA 4RCCA 1TH7A 4ZIBA 4MDXA 2DKGA 3M58A 1Q7YC 2JVVA 4M7AB 4EMGA 1EQRA 1WYDA 5GANh 3MCAB 3A8GB 3NTKA 3SWNC 1V29B 2F5TX 4HWRA 2C8MA 4YRFA 2MAMA 1Q82U 2LTOA 3NTHA 3G6EA 2FL7A 4N4IA 4N0AA 4J7FA 4YRGA 2EAYA 4M75F 4F7UA 5LJ3g 3HRKA 4X9DA 2KQWA 4K88A 2ZCFB 1ADYA 4GLKA 4YRNA 5J26A 1M9SA 3G4ST 2G3RA 1R8OB 1AHJB 5EG2A 2E5AA 2Q7GA 1Z7NA 1YI2A 4JLGA 3IALA 2E3CA 1MHNA 1VQ9A 3GF5A 2ZNIA 5GAN4 4OP0A 1YHQT 4FSXA 4EMHA 3JCMX 4M77E 3C95A 3ZEHA 4TVAA 1EVLA 4XTVA 1X2HA 4EPCA 4H2TA 3CMQA 3VU3C 2PVOB 2XG8D 5FU6B 3OBWA 2E41A 2RJEA 3SD4A 4BWAA 1NJIC 2AKWB 2QHSA 4OB1B 3CCMT 3OYJA 4P72C 3QO8A 5ELNA 3JB9G 2IY5B 3JB9H 1EIYB 3OY9A 1M5Q1 5GMKm 3CMEA 4G85A 3MP8A 3WVEB 4N4HA 3NENA 2MWPA 2QHVA 2R58A 5GMKe 4DPGA 2ZPIB 1QP3A 4C0DC 1W2BS 4UP7A 5GAN5 1Q81C 1K9MC 3M56A 4KR2A 4C5IA 2A8EA 3GOXA 1PYSB 3CMAT 3LLRA 1VQ4T 2E64A 3A8MB 1Y96A 2XDDA 2RHIA 1KQSS 4P72A 2I4OA 4M7AC 3JRZA 5DY9A 5IAYA 3L4GA 1W66A 2RK2A 3X26B 2PUOB 5A0GA 2VUBA 3MF1A 2CZ0B 2A7YA 4G84A 4YCWA 1KC8C 1PSFA 5J39A 3CC4A 2I4MA 1JJ2A 1G5IA 3P8VA 1P92A 3TEHA 3JCMf 2ZIMA 2EQMA 2JUFA 4BDZA 4KQEA 1EFWA 2E70A 4MMLA 3QSUA 5C6SA 3LWHA 1YFSA 4YRQA 4XU1A 3TEGA 1ASYA 4J8OA 4RDXA 2FYKA 4BW9A 1VIFA 5GAMf 1X6OA 3X28B 3QHSA 2ZPBB 2JTFA 1NJIU 3CCUA 3MEUA 2EL9A 1K8AC 1H4TA 2JTMA 5LJ5f 3M55A 1K73C 3QDRB 4M7AF 3J7AF 4PJOC 4Y28E 3KFUA 3PTAA 2DU7A 2DZ9A 3OW2A 1ZQ1A 2VYTA 2LCLA 1EVKA 2I4NA 1OZ2A 4FIBA 1VQ5T 2QA4A 2RO0A 3UT1A 4V2SA 4CI0C 4QQGA 2M1HA 3GNFB 2IG0A 3OYGA 4PHCA 4M75E 3CCEA 3ERRA 4HVCA 4J5YA 4M77D 4XEOA 4HCCA 4HCZA 4H2WA 3QYHB 4QQ6A 4LVLA 2V8IA 1VQNA 3DKMA 1NYQA 4A4KA 2OTJT 1KHCA 3SFMA 3PMIA 2ZZGA 2OTLT 1RI0A 1I4K1 2ZIOA 2PMFA 4C8QC 3CCST 4KR3A 2MWOA 2GCXA 1OYXA 4OGCA 4ELYC 2CJAA 5DM7R 2XIDA 3PT9A 3E9IA 3GP8A 3G71T 3V8JA 3JB9F 2DTHA 1JRIA 1M1KU 4IKFA 1VQOA 4WJ3M 4YPFA 2J3MA 1UGPB 1FXXA 3PMTA 3L2VA 5K1PA 3M57A 4J6XA 1K73U 2HQEA 4HWPA 2AHJB 3HY0A 2FHDA 3OYKA 3UDCA 3GIBA 4LDVA 4M7DC 4WJ4A 1YFTA 2ZT7A 3MEVA 5HK3A 3VUZA 1LJOA 2MF2A 4C92G 5GAOr 2ZR2A 3LYIA 3BY7A 1VQLT 4C92B 3OYCA 1QVFA 3ASKA 3CXCA 4ZTUB 4M78E 4Q5WA 2P0QA 5GAMd 1YJWA 4RQFA 1LYLA 4L59A 2B8AA 2XICA 3DLMA 1NJ8A 4LD6A 2P4TA 1YJ9T 3I56A 4KT0E 5GMKi 2EJFA 2GF7A 3QO5A 3HKSA 3CC2T 1D3BA 4H2XA 2LNVA 2E12A 4II1A 5GAOl 3C94A 5J3BA 4EMKA 4A53A 3P8TA 3OYEA 4JLIA 4EX5A 4F7UB 4ZTJA 4YDQA 2DD4A 5CKEA 2QDYB 3RUXA 3OYNA 2LDMA 3UWNA 4M77A 4NS5A 3CPWA 2VGNA 1JBMA 5D6XA 1O9SA 4XU0A 3EFRA 3RL6A 2JNGA 4XTYA 3HXZA 3MF2A 4TQFA 3M5AA 3DSQA 1WPYA 1M4ZA 2E5QA 3SWNB 2LVMA 3DB4A 1WQ7A 3INZA 3BDUA 2EQJA 3OS2A 2HQXA 5HKCA 2R5AA 1N9SA 5FRNA 3HFNA 2DIGA 4J15A 1I81A 1OI1A 4XK8E 2P0PA 2ZZEA 2ZGWA 4TVRA 1ASZA 2RHUA 4EDUA 3JCMW 1Q82C 3MEWA 3A8LB 2QHUA 3M4YA 3CCVT 1VUBA 5CQXA 3RKXA 4P5NA 1U1SA 1WQWA 1S72T 4LDXA 2X4WA 3HY1A 2Q5HA 4CS2A 4IUUA 4Q15A 4BI8B 2P0LA 2CZ7B 3VYGA 3P8HA 4BY6C 2RHQB 1BBUA 3FIFA 4ZN1A 4A4EA 1KG1A 2MMPA 3C4SA 4LNSA 1YFRA 3TUPA 5GAMg 2LT4A 3HTZA 4JRIA 5FLXE 2O4XB 2MI6A 1OZ3A 5LJ5g 4AH6A 1Z7MA 2L3RA 4KUDK 4XAXB 2ODRD 4C0DB 4N0AC 4H02A 1B34A 5FU7C 4JRPA 1ZBXA 2DU5A 3L1AA 3IKMB 3HSBA 4TVYA 1N27A 3V8KA 4RQEA 2LX9A 4C92F 3PIOA 2KK4A 4M7AG 2BIVA 4M78D 1WU7A 5LJ3j 1X56A 3PZCA 1UGSB 4K86A 2VXEA 3I55A 3QBYA 3OS0A 3CBMA 3G4SA 4YYEA 1SERA 4P3OA 1QVPA 3VQXA 1X01A 3PCOA 4UP8A 4CH6A 3M4GA 3HRSA 4PNOA 5CKBA 4CH4A 3LGFA 4A4HA 4J6WA 4HT4A 5M9OA 1E22A 1U8RA 4M75A 2RHSB 3OYAA 3CC7T 1VQ6A 4F7UF 3G1ZA 3CD6A 5E3IA 2ALYB 4Y91A 3JB9I 2ZPHB 3QTCA 2DXTA 2AMCA 2DXUA 4P74C 4Q6GA 3JCMb 4GY5A 3TEEA 3CCJT 2JN0A 4B9WA 2RI3A 1H4VB 2DQ0A 1G51A 4PJOG 4PJOB 3JCMc 4IUVA 1MGQA 3M59A 4JRQA 4CRIA 2ODRC 2CYZB 3FJPA 1N8RU 2ZT5A 1WJQA 2JOYA 4XTUA 3G6ET 1H641 3L2QA 3NETA 4RMOA 3VJPA 3NELA 3LSQA 4A4FA 2RA2A 2ARTA 2ZZFA 1VQ4A 4FL6A 3OMCA 1YI2T 3P8DA 3BJUA 4P74A 1VQ9T 2DO3A 3C12A 4O2DA 2P0KA 5GAN7 4YRSA 3BFMA 2K57A 2D6FA 4XEMA 4KULA 1I5LA 3HFZB 4P3NA 1GGMA 4UPAA 4H2VA 3X20B 3CCRA 3T9NA 4JS4A 1WLEA 3OBYA 3HXWA 4C8QG 3DB3A 4C8QB 3NTIA 2WSFE 3TU4K 5I2MA 4HA8A 3KUFA 2EKOA 4M78A 4X5OA 4E51A 3WQZA 2QQ9A 4BDYA 4XU3A 4PL6A 5A2QE 5KCOA 3GNGA 1KD1C 2ZPFB 4OVAA 3IKLA 2XU8A 3Q1JA 5GANd 4PLIA 2LCCA 3CCQT 2EQKA 4ZGDB 4M7DG 3F70A 5KH6A 4CS4A 3VQWA 3TREA 4M7DB 2I4LA 4ZTFA 1M1KC 5HGQA 3ER0A 3VYHB 5CCAA 1PSEA 2PU9B 5C51B 3JCMh 3OMGA 1VQ7T 3FRNA 4P71A 4YRMA 2LQ8A 2L8DA 1G5HA 2KVQG 1NYRA 2K5IA 2QHTA 4WF2A 3CC4T 4C92E 4RKUE 2J3LA 1IREB 3H8ZA 2P5IA 4CH5A 5K1XA 4H2SA 3TCJA 1I8FA 4CS3A 3HXXA 2WSCE 4BI4A 5HK0A 1QVGA 1G3TA 3QUIA 3LWIA 3UGQA 4YRIA 3GLXA 1NE8A 2KMTA 3CCUT 1VQMA 1N6AA 4QVZA 1E1TA 4ATOA 2CKKA 4HKEA 4F7UE 2V8JA 1KMNA 3A7RA 3G71A 3CBPA 1KOGA 5CK9A 5DLQE 4PJOF 4RCBA 1KD1U 4YRLA 2RHZA 3REUA 1JJCB 2EQUA 4ZGJB 5CIUA 1N9WA 1YJNT 2XD0A 2QQRA 2DTIA 2ZZDA 5L8RE 2RD1A 2K5LA 1M1GA 5LJ3h 3CCET 2IY5A 3RERA 1EIYA 3CEYA 1GXIE 2OAUA 1VQLA 5GANg 4VUBA 1O75A 1U1TA 4JJNK 2K2VA 2ZPGB 2PQWA 3LSSA 1QF6A 4ZGEB 3JCMV 3OSVA 4OB3B 3A5ZB 4YRKA 2ZCEA 4YCUA 2QEXA 1RL2A 5HY6A 5F5WA 2IVWA 3OYIA 5GANe 4LVIA 3KXTA 1BIBA 1PYSA 4C8QF 1B70B 1HTTA 4Z02A 4EMKC 3PGGA 2EYQA 1W4SA 3QJ6A 1YJ9A 1HK9A 3V7CA 3MHXA 4BY6B 11ASA 5CKHA 5CKFA 2E6NA 3QO3A 3CC2A 1X54A 3O8VA 2DPPB 4HWTA 3OB9A 4M77C 5GAN8 2GFAA 1VQOT 3OYDA 4IURA 3RACA 4RG2A 3WXMB 3QZ5B 2X4JA 4J7IA 2EIFA 3CPFA 2CIMA 5KNNA 5CKDA 2DTOA 1HC7A 3OSSC 3FLGA 1M8VA 3CBOA 2DDZA 4TQDA 3JB9J 5A0LA 3X25B 1KQ2A 3QNEA 5A0DA 2A3LA 4M7DF 2X4XA 4F7UG 5GAN2 5FU7B 3A5YA 3URGA 4DQ2A 4C0GA 2RJCA 2DJZA 1KHIA 2GFUA 4XTZA 4C92D 3UFGA 1YITA 4JDSA 3M53A 2ZT8A 1XOVA 4NL3A 3OA6A 4M7AE 3FEOA 2ARSA 2LT1A 1YJWT 4OB0B 4TVAB 4J83A 4J6YA 4P3PA 2CZ6B 2F69A 4M75D 2NLUA 3OW2S 4YTLA 1EOVA 1NJ5A 1S72A 1C0AA 4P73A 2R57A 1L0WA 4C5GA 4D6WA 1VQ8A 1USYA 1SSFA 3A31A 3QJYA 2E6ZA 5C0MA 1W2BA 4XQ3A 3MP6A 4HCBA 5GAMj 3R07A 1JB0E 1XTDA 4BE2A 3REXA 4FT4A 1ADJA 1NPPA 12ASA 4LDWA 5LJ5j 1SRYA 4PKCC 2F5KA 2X4YA 1KQSA 4PJOE 3UGTA 4RG8A 4NL2A 4NCXA 1VQPA 1Y96B 1N9RA 4UC4A 3UPUA 1M1FA 3A74A 5FRMA 3L4GB 2XHCA 2ARUA 3M9QA 3ZBDA 5GMKl 1YIJA 4TVWA 1YCYA 1VQKT 2KDSA 4M78B 3M54A 3S3MA 2RM4A 3P8YA 1N8RC 3LW5E 1HXDA 3P8BB 3TEHB 3A7UA 1Y71A 2V8KA 4FM4B 2RI5A 1LNXA 3FDRA 4BI3A 2ZPEB 1DJ7B 4M75C 4QVCA 2DZCA 4K87A 1IZ6A 3EFSA 4P75A 2H3JA 5I21A 2YLBA 5D6WA 5GANf 3CCLT 3R6OA 2K5FA 5GAOm 3HXYA 4C92A 4C8QE 3CC7A 4FU6A 3GPLA 2D0QB 2EWNA 4A4GA 1QVFS 1B7YA 3V7SA 4UP9A 3ICAA 2KAFA 3CCJA 1YHQA 4HT9A 3CXCS 4H2UA 3E9GA 2EFIA 2Y4YA 4PLLA 2Q7EA 4C5EA 3E9FA 3CCMA 1NZ9A 4M7DE 2DD5A 2QQBA 2CS7A 4M7AD 3N5BB 3L2WA 5GMKj 4LDYA 3H6ZA 4E7LA 3I55T 4CH3A 3OS1A 2CZ1B 1VQZA 4C5HA 4BACA 1H4QA 4XTWA 3E9HA 1G3SA 2HBPA 1WGSA 1UGQB 5LJ3e 1M90C 1NJ6A 1UB4A 4ZN3A 3J81E 4TWAA 3KBGA 2RJDA 3CPWS 1B8AA 4ELZC 3SWNA 3FB9A 2PUKB 1NJ1A 2O01E 1VQ6T 3CMAA 2BUDA 4HT8A 3CD6T 4M78C 1FX7A 3S3NA 4YRJA 5GAOp 2HNIA 4XTXA 5I2SA 3HP9A 2HAXA 3W3SA 2M9UA 4B9XA 4JRKA 2YLCA 3HRUA 4BB7A 2KSSA 4PJOD 3S3OA 4OGEA 4LVKA 2EJ9A 1Q7YU 4QQDA 2DK3A 2PMEA 3A32A 1NNHA 2L5QA 1BIAA 1YBYA 2RHQA 2C7IA 5D6YA 4P71C 3CCQA 2XGTA 4YRRA 3JB9D 3BDLA 3CMET 1EIFA 2LQKA 4LVJA 3L2UA 3VUBA 4E7HA 4R55A 5AYFA 1VQ7A 4M78F 3A8HB 4O6JA 2O4XA 1QW1A 3HFVA 5C52B 1WJSA 3OS5A 4KBMB 3HPWA 1BI1A 5GAOq 2FVUA 1G3WA 2Q5IA 3CCRT 1ZHIA 1BI3A 1M90U 3EAEA 3RIRA 3RKYA 3OYHA 1Q86C 4MZPA 3HFOA 4C8QD 1D3BB 4H2XB 1BKBA 2RHYA 1VQ5A 1WJRA 1Y07A 4EMKB 4A54A 2I2LA 2K3XA 2XTIA 5KCHA 3NEMA 4ZTZB 4YROA 5IN1A 4MZTA 4M7AA 4TTVA 4M77G 4DOWA 3S6WA 5GAMh 4M77B 3PFSA 2NS6A 2ZXFA 4OB2B 3A8OB 3OYBA 3MQZA 5GAOn 4YRCA 5LJ5h 2OTJA 3VV0A 1X2GA 5CR2A 5FU6C 2DQ3A 2QQSA 4DOVA 3DLLA 2OTLA 2LRQA 2PVGB 4M7DD 3CCSA 3RF1A 3RGLA 3X24B 4MDWA 2DXBA 3SB2A 5DLOA 2M0OA 2XDBA 1RIQA 2WSEE 2RHSA 3JCMJ 1K9MU 1Q81U 5GAN3 2YHTA 3OYMA 2ZNJA 2ALYA 1YJNA 4O5VA 1FWZA 2DVEA 4EO4A 4KUIA 3OYLA 4L6V5 4C0ZA 3I7FA 3LH0A 4PJOA 3VQYA 5GANj 2YRVA 2QA4T 1KC8U 1UGRB 2AKWA 5LJ3f 3QO7A 3MEAA 3MEYA 3QG1A 3ZFJA 2PVDB 1NPRA 2RHXA 3OYYA 2EJGA 1VQMT 2FB7A 2XKOC 1Q86U 2K4YA 4OLFA 2RH2A 1LOJA 2E10A 3PNWC 2QXFA 1VQNT 1FYFA 2L89A 4H2YA 2XDPA 5CO7A 2CJ9A 3LGLA 1K8AU 2XI9A 4WI1A 2GQVA 3HFZA 1H3ZA 2RB6A 4BE1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4BW9 A;  3QTC A;  2DXT A;  3R07 A;  5GAM f;  2AMC A;  2DXU A;  1B34 B;  1E1O A;  4P74 C;  4Q6G A;  3QHS A;  4X9C A;  2DEQ A;  3JCM b;  3REX A;  2JN0 A;  2EL9 A;  4C8Q A;  1ADJ A;  1H4V B;  1H4T A;  12AS A;  2DQ0 A;  1G51 A;  4PJO G;  5LJ5 j;  1SRY A;  5LJ5 f;  4PJO E;  3UGT A;  5GAN 6;  4PJO B;  3JCM c;  4M7A F;  5GMK h;  1IL2 A;  4NL2 A;  2ZR3 A;  1MGQ A;  3JCM P;  4PJO C;  4NCX A;  1H4S A;  3JCM d;  2ODR C;  3KFU A;  3FJP A;  2ZT5 A;  1Y96 B;  1B76 A;  2DU7 A;  1N9R A;  2DZ9 A;  4XTU A;  1H64 1;  3A74 A;  3L4G B;  3NET A;  1EVK A;  2ARU A;  3NEL A;  4NOY A;  2I4N A;  5GMK l;  3LSQ A;  4TVW A;  1QE0 A;  4YRE A;  4YP0 A;  1YCY A;  2RA2 A;  4YRT A;  2ART A;  2ZZF A;  4M78 B;  3PCO B;  2RM4 A;  1B7Y B;  2RB6 A;  3P8Y A;  1HXD A;  1YB3 A;  4QVD A;  4V2S A;  4YRP A;  3TEH B;  3A7U A;  3BJU A;  4P74 A;  1LNX A;  4O2D A;  4M7D A;  4P73 C;  4M75 G;  5GAN 7;  5LJ5 d;  3BFM A;  4YRS A;  4PHC A;  2K57 A;  3BW1 A;  4M75 E;  1KMM A;  2E65 A;  3ERR A;  3VBB A;  4HVC A;  4M75 B;  4J5Y A;  1USY C;  4HWS A;  4M77 D;  4XEO A;  4XEM A;  4M75 C;  1I5L A;  4MMK A;  4QVC A;  3HFZ B;  2DZC A;  4K87 A;  4P3N A;  4H2W A;  1GGM A;  4UPA A;  3EFS A;  4H2V A;  4P75 A;  5I21 A;  2AMC B;  1NYQ A;  2YLB A;  5GAN f;  3V7R A;  3L2Z A;  4XU2 A;  1WLE A;  4M77 F;  3HXW A;  4YCV A;  5GAO m;  4C8Q G;  2ZIN A;  3HXY A;  4C92 A;  4C8Q E;  2ZZG A;  4C8Q B;  1I4K 1;  2ZIO A;  2CJB A;  2PMF A;  4C8Q C;  3LC0 A;  4L87 A;  4KR3 A;  4HA8 A;  2EWN A;  4RMF A;  4M78 A;  4X5O A;  1B7Y A;  4UP9 A;  3V7S A;  4E51 A;  3ICA A;  3WQZ A;  2CJA A;  3JCM Q;  4HT9 A;  3E9I A;  4XU3 A;  4H2U A;  3IG2 A;  3V8J A;  3JB9 F;  2DTH A;  1JRI A;  5CAI A;  4HWO A;  4WJ3 M;  4YPF A;  3OD1 A;  2Q7E A;  2J3M A;  1YGB A;  3IKL A;  5GAN d;  5K1P A;  4J6X A;  4JUV A;  4M7D G;  4HWP A;  5LJ3 d;  4CS4 A;  4M7D E;  1X55 A;  3VQW A;  3RKW A;  4M7D B;  2I4L A;  3HY0 A;  3A7A A;  5HGQ A;  3GIB A;  4M7D C;  4M7A D;  5GMK j;  4WJ4 A;  5GAM j;  5C51 B;  3JCM h;  4CH3 A;  1YFT A;  1SET A;  1VQZ A;  2E1H A;  2ZT7 A;  4P71 A;  1H4Q A;  3HRI A;  3RES A;  4XTW A;  4YRM A;  2Y90 A;  1G5H A;  2ZTG A;  3E9H A;  1NYR A;  1LJO A;  3V8L A;  2QHT A;  4C92 G;  5LJ3 e;  5GAO r;  4P75 C;  4WF2 A;  2ZR2 A;  4C92 E;  3BY7 A;  1JJC A;  1NJ6 A;  3AHU A;  1WNL A;  3JCM g;  4C92 B;  2J3L A;  1SES A;  2QTX A;  4TWA A;  2P5I A;  3HXV A;  4CH5 A;  4C92 C;  1B8A A;  5K1X A;  2G4C A;  4PG3 A;  3SWN A;  4H2S A;  3VQV A;  3FB9 A;  1NJ1 A;  4ZTU B;  4M78 G;  2VXF A;  4M78 E;  3M4P A;  1I8F A;  4CS3 A;  5C53 B;  3HXX A;  4HT8 A;  5GAM d;  1J5W A;  3HXU A;  1ATI A;  3M4Q A;  4M78 C;  3JCM e;  3QUI A;  5GAO p;  4YRJ A;  2HNI A;  4RQF A;  1LYL A;  4XTX A;  3UH0 A;  1NJ2 A;  1BBW A;  2ZT6 A;  3UGQ A;  1NJ8 A;  4YRI A;  3W3S A;  4JRK A;  5GMK i;  2EJF A;  3A5Z A;  2YLC A;  3QO5 A;  1D3B A;  4H2X A;  1E1T A;  1E24 A;  5GAM e;  5GAO l;  4PJO D;  2VC8 A;  4EMK A;  4A53 A;  3P8T A;  4F7U E;  4JLI A;  4EX5 A;  4F7U B;  1KMN A;  2EJ9 A;  3A7R A;  1B70 A;  4YDQ A;  1KOG A;  2CGH A;  5ELO A;  4PJO F;  3RUX A;  5LJ5 e;  2PME A;  1KQ1 A;  3A32 A;  1NNH A;  4M77 A;  1BIA A;  2Q7H A;  2RHQ A;  4RCC A;  1TH7 A;  2C7I A;  4ZIB A;  4RCB A;  4P71 C;  2DKG A;  1JBM A;  4XU0 A;  2XGT A;  3EFR A;  4YRR A;  3RL6 A;  3JB9 D;  4YRL A;  4XTY A;  3REU A;  1JJC B;  3HXZ A;  4M7A B;  4EMG A;  1N9W A;  3MF2 A;  4TQF A;  3DSQ A;  1EQR A;  1WPY A;  1WYD A;  5GAN h;  2DTI A;  3SWN B;  4M78 F;  2RD1 A;  5LJ3 h;  3SWN C;  2IY5 A;  3HFV A;  3RER A;  5C52 B;  1WQ7 A;  4HWR A;  3INZ A;  1EIY A;  3BDU A;  5GAO q;  2C8M A;  4YRF A;  5GAN g;  1N9S A;  4N0A A;  2Q5I A;  1U1T A;  4YRG A;  2EAY A;  4M75 F;  4F7U A;  3HFN A;  5LJ3 g;  3HRK A;  4J15 A;  1I81 A;  4X9D A;  4K88 A;  1ADY A;  3LSS A;  2ZZE A;  1QF6 A;  3RIR A;  3RKY A;  3JCM V;  4YRN A;  2ZGW A;  4YRK A;  3HFO A;  2ZCE A;  4C8Q D;  1ASZ A;  1D3B B;  4YCU A;  4H2X B;  3JCM W;  5F5W A;  2E5A A;  5GAN e;  2Q7G A;  1Z7N A;  4EMK B;  4A54 A;  2I2L A;  2QHU A;  3IAL A;  2E3C A;  1BIB A;  1PYS A;  4C8Q F;  1B70 B;  1HTT A;  2XTI A;  4EMK C;  3NEM A;  4ZTZ B;  3PGG A;  4YRO A;  2ZNI A;  3RKX A;  1U1S A;  4M7A A;  1WQW A;  5GAN 4;  1HK9 A;  4TTV A;  4OP0 A;  4M77 G;  3V7C A;  3HY1 A;  2Q5H A;  11AS A;  4EMH A;  3JCM X;  5GAM h;  4CS2 A;  4M77 E;  4Q15 A;  4M77 B;  3QO3 A;  2P0L A;  4TVA A;  1EVL A;  1X54 A;  2RHQ B;  4XTV A;  1BBU A;  2ZXF A;  1X2H A;  4HWT A;  4M77 C;  4H2T A;  5GAN 8;  3CMQ A;  3VU3 C;  3FIF A;  5GAO n;  3RAC A;  2E41 A;  4YRC A;  5LJ5 h;  4LNS A;  1X2G A;  1YFR A;  3TUP A;  4BWA A;  2AKW B;  2QHS A;  5GAM g;  2CIM A;  2DQ3 A;  5KNN A;  3HTZ A;  2DTO A;  4JRI A;  1HC7 A;  1M8V A;  4P72 C;  4M7D D;  3QO8 A;  3RF1 A;  5ELN A;  3RGL A;  2DDZ A;  4TQD A;  3SB2 A;  3JB9 G;  2IY5 B;  3JB9 H;  3JB9 J;  5LJ5 g;  1RIQ A;  4AH6 A;  1Z7M A;  2RHS A;  1EIY B;  2ALY B;  1M5Q 1;  5GMK m;  3JCM J;  4G85 A;  1KQ2 A;  3QNE A;  5GAN 3;  2YHT A;  4M7D F;  4F7U G;  5GAN 2;  2ZNJ A;  2ALY A;  3NEN A;  3A5Y A;  2ODR D;  4DQ2 A;  2QHV A;  4N0A C;  4H02 A;  1B34 A;  2DJZ A;  5GMK e;  4DPG A;  4XTZ A;  2DVE A;  4C92 D;  3UFG A;  4EO4 A;  4UP7 A;  2DU5 A;  3L1A A;  3IKM B;  5GAN 5;  3HSB A;  2ZT8 A;  3I7F A;  4TVY A;  4KR2 A;  3V8K A;  4PJO A;  4RQE A;  3VQY A;  4NL3 A;  4C92 F;  1PYS B;  5GAN j;  4M7A G;  4M78 D;  1WU7 A;  4M7A E;  2E64 A;  5LJ3 j;  1X56 A;  3PZC A;  1Y96 A;  2AKW A;  2ARS A;  4K86 A;  2VXE A;  5LJ3 f;  3QO7 A;  3MEY A;  4P72 A;  2I4O A;  4M7A C;  5DY9 A;  3L4G A;  4TVA B;  1W66 A;  4P3P A;  4J6Y A;  2EJG A;  4YYE A;  2FB7 A;  1SER A;  4P3O A;  3MF1 A;  4M75 D;  3VQX A;  1X01 A;  3PCO A;  4G84 A;  4YCW A;  4OLF A;  4UP8 A;  1LOJ A;  4CH6 A;  2I4M A;  1EOV A;  1NJ5 A;  3M4G A;  2E10 A;  1G5I A;  3P8V A;  4PNO A;  1C0A A;  3TEH A;  1FYF A;  3JCM f;  2ZIM A;  4P73 A;  4CH4 A;  4H2Y A;  4J6W A;  1L0W A;  4KQE A;  1E22 A;  2CJ9 A;  1EFW A;  1USY A;  4MML A;  3QSU A;  4M75 A;  2RHS B;  3A31 A;  1YFS A;  4YRQ A;  4WI1 A;  4F7U F;  4XU1 A;  3G1Z A;  3TEG A;  1ASY A;  3HFZ A;  4XQ3 A;  5E3I A;  4RDX A;  2FYK A;  4Y91 A;  3JB9 I; 
#chains in the Genus database with same CATH topology
 1LCK A;  2J6F A;  3FC3 A;  1YI2 Q;  2H8H A;  3HRT A;  3QZ9 B;  1QCN A;  3OQ5 A;  2ECZ A;  1B34 B;  1VQ9 Q;  1BI0 A;  2CH4 W;  1E1O A;  1G8X A;  2DEQ A;  4X9C A;  3OYF A;  1RAG B;  4E7K A;  3MP1 A;  4C8Q A;  2BZ8 A;  2J06 A;  1AD5 A;  2R5M A;  2E3H A;  3VKI A;  5GAN 6;  5GMK h;  1IL2 A;  2ZR3 A;  3JCM P;  4C0F A;  1H4S A;  3JCM d;  4IUP A;  3E2U A;  3JSC A;  1B76 A;  2RI2 A;  1BI2 A;  4WTO B;  4DA4 A;  1ZLM A;  1NYF A;  3ME9 A;  4LVM A;  3BE3 A;  4NOY A;  1QE0 A;  4YRE A;  4YP0 A;  3QKJ A;  4YRT A;  1GBR A;  2OI3 A;  3R6N A;  2DIQ A;  1ZA1 B;  3PCO B;  1MMD A;  2QEX T;  1JJ2 S;  1OOT A;  2COY A;  3G1J A;  1B7Y B;  1F1B B;  1YB3 A;  1CKA A;  4QVD A;  5FRO A;  1JU5 C;  3CME Q;  4YRP A;  2XK0 A;  1UEC A;  2QYZ A;  2LQW A;  4M7D A;  3EG3 A;  4P73 C;  4M75 G;  4L5G A;  5LJ5 d;  3E1S A;  3IQL A;  1KMM A;  3BW1 A;  2E65 A;  2VV5 A;  3VBB A;  4M75 B;  5IT9 E;  2JM8 A;  3J80 E;  4PFZ A;  1USY C;  4HWS A;  2AK5 A;  1K76 A;  4RTZ A;  1X27 A;  4MMK A;  4CC2 A;  2LC4 A;  4X1V A;  1V76 A;  2FRY A;  1LPL A;  3PVQ A;  2AMC B;  3NFC A;  1RLP C;  3A98 A;  3OW2 P;  3HHT B;  3L2Z A;  4XU2 A;  3V7R A;  4M77 F;  3L42 A;  4YCV A;  2ZIN A;  4R56 A;  4Z89 A;  1UHC A;  4BUG A;  2QAS A;  5KYN A;  1ZSG A;  2CJB A;  3HL8 A;  3NMZ C;  4X34 A;  1BYM A;  1K4U S;  3LC0 A;  2HKN A;  4F14 A;  4L87 A;  4FSS A;  1G3Y A;  3I56 T;  4IUQ A;  4E7J A;  1B3Q A;  4RMF A;  2DAQ A;  2C06 A;  2RK1 A;  4FT2 A;  3CCV A;  1WI7 A;  2MCN A;  1UEB A;  5CVI A;  3PIP A;  3CC4 Q;  3JCM Q;  1IXD A;  3RMS A;  4FYW B;  2VGM A;  3IG2 A;  2YT6 A;  4RTU A;  5KE2 A;  4IUT A;  2LX7 A;  5CAI A;  1YIT T;  4PJM A;  4HWO A;  2RJF A;  4BE0 A;  3E19 A;  3OD1 A;  4J9F A;  2WAC A;  1YGB A;  2COW A;  1QVG S;  1QP2 A;  1VIE A;  3QPH A;  4HVV A;  2QTV A;  3LX7 A;  4JUV A;  1QWE A;  2KRN A;  2DE0 X;  3RMQ A;  5LJ3 d;  3MET A;  1X55 A;  2DM1 A;  3RKW A;  3M0S A;  3A7A A;  4E47 A;  4MZM A;  4E7Z A;  1VQK A;  1SET A;  3CCU Q;  3QYG B;  2E1H A;  4LDU A;  3HRI A;  3RES A;  2EBP A;  3VS6 A;  2M16 A;  1WA7 A;  2Y90 A;  1UJY A;  2ZTG A;  4LD9 K;  2QQA A;  3V8L A;  4E7I A;  5KE3 A;  1MV3 A;  4P75 C;  1D0X A;  1JJC A;  1WNL A;  2D8H A;  3QII A;  2FZK B;  3JCM g;  2EGE A;  3AHU A;  2F1L A;  2KYB A;  2QTX A;  1SES A;  4OMF B;  3HXV A;  4C92 C;  1NLP C;  2G4C A;  4PG3 A;  2GTJ A;  2X35 A;  2D9T A;  3VQV A;  1XQH A;  4M78 G;  1VQ8 T;  1X6G A;  2VXF A;  1X75 C;  1UG1 A;  2DXC A;  3M4P A;  3JAM E;  5C53 B;  2HD0 A;  3CCL A;  1C1A A;  1J5W A;  3HXU A;  1ATI A;  3M4Q A;  2QA4 Q;  3JCM e;  4E6R A;  2Y4X A;  2K3Y A;  1I1J A;  2DA9 A;  4PK4 A;  2DF6 A;  3QXE B;  4OF1 A;  2JMC A;  1NJ2 A;  3UH0 A;  1BBW A;  2DBM A;  3U23 A;  2ZT6 A;  1D1B A;  1E6G A;  3A5Z A;  3CCE Q;  2ENM A;  5LL6 S;  4FYX B;  1ZBJ A;  2DRM A;  1E24 A;  3MO8 A;  1J3T A;  4QW2 A;  2J7I A;  5GAM e;  1G5V A;  1RAE B;  2EVR A;  3G7Z A;  2VC8 A;  2HSE B;  3EFO A;  5CQY A;  2BKD N;  3WVD B;  1VQP T;  1XNI A;  1QVF P;  1VQN Q;  1RI9 A;  1B70 A;  2QI2 A;  4JS5 A;  2JMA A;  2CGH A;  5ELO A;  4N4G A;  3EGU A;  2KY9 A;  3SDZ A;  5LJ5 e;  4BD3 A;  1KQ1 A;  3CXC P;  1HJD A;  4ME7 A;  4CC7 A;  2Q7H A;  2JZ2 A;  3L2R A;  1YIJ T;  1Y7X A;  4RCC A;  1TH7 A;  2HL5 C;  4ZIB A;  4MDX A;  2DKG A;  4KGZ B;  3M58 A;  1Q7Y C;  1RLQ C;  2JVV A;  4M7A B;  4EMG A;  4HCK A;  1S1N A;  1EQR A;  1WYD A;  5GAN h;  2D0N A;  3I35 A;  2CP7 A;  3MCA B;  3A8G B;  2EKH A;  3NTK A;  3SWN C;  1H8K A;  1V29 B;  4OMP A;  1E6H A;  2F5T X;  1VQO Q;  4HWR A;  2DL3 A;  2C8M A;  4YRF A;  1SPK A;  2MAM A;  1M2O A;  1Q82 U;  2LTO A;  2KNB B;  3NTH A;  3G6E A;  2FL7 A;  4N4I A;  4N0A A;  4J7F A;  4YRG A;  2EAY A;  4M75 F;  4F7U A;  5LJ3 g;  3HRK A;  3TVT A;  4X9D A;  1GBQ A;  2KQW A;  2YUP A;  4K88 A;  2ZCF B;  1ADY A;  4GLK A;  4YRN A;  5J26 A;  4AFZ C;  1M9S A;  2KT1 A;  3CPW P;  3G4S T;  2G3R A;  2F2W A;  1R8O B;  1AHJ B;  1N8R R;  5EG2 A;  2E5A A;  2Q7G A;  1Z7N A;  1YI2 A;  4JLG A;  3IAL A;  2E3C A;  1MHN A;  1T3L A;  1VQ9 A;  3GF5 A;  5KYX B;  2ZNI A;  5KYY A;  3M0P A;  5GAN 4;  4OP0 A;  1YHQ T;  4FSX A;  4QT7 A;  4EMH A;  3JCM X;  4M77 E;  3C95 A;  3MKD A;  3ZEH A;  1YWP A;  4TVA A;  1EVL A;  4XTV A;  1X2H A;  4EPC A;  2V1R A;  4H2T A;  3CMQ A;  2KGT A;  3VU3 C;  1D0Z A;  2PVO B;  1UE9 A;  2XG8 D;  3M0T A;  5FU6 B;  3OBW A;  2E41 A;  1AEY A;  2YRC A;  2RJE A;  3SD4 A;  4BWA A;  1NJI C;  1OX8 A;  2FPD A;  2AKW B;  2QHS A;  4OB1 B;  3CCM T;  2CSI A;  2CT4 A;  1VOM A;  3OYJ A;  1YJW Q;  4P72 C;  1ARK A;  2LMJ A;  3QO8 A;  5ELN A;  1QKX A;  3JB9 G;  2IY5 B;  2LJ0 A;  3JB9 H;  3I56 Q;  5L23 A;  3FJ5 A;  1EIY B;  3OY9 A;  1M5Q 1;  5GMK m;  2CP2 A;  3CME A;  4G85 A;  3MP8 A;  4LNP A;  3WVE B;  4N4H A;  3NEN A;  2MWP A;  7AT1 B;  2KRO A;  2QHV A;  2J6O A;  3QWY A;  2R58 A;  5GMK e;  4DPG A;  1BK2 A;  2ZPI B;  1QP3 A;  4C0D C;  1W2B S;  4UP7 A;  1ZUU A;  1V1C A;  2AKK A;  2DLP A;  4J9B A;  5GAN 5;  1Q81 C;  2YSQ A;  1K9M C;  3M56 A;  4KR2 A;  4C5I A;  2A8E A;  1TTH B;  2VKN A;  3GOX A;  2DYI A;  2Z0W A;  1PYS B;  3CMA T;  1OQK A;  3LLR A;  3SHW A;  1VQ4 T;  3THK A;  2E64 A;  3A8M B;  1Y96 A;  2XDD A;  2RHI A;  1KQS S;  4P72 A;  1EFN A;  2I4O A;  4M7A C;  1SF9 A;  3JRZ A;  5DY9 A;  5IAY A;  3L4G A;  1W66 A;  2RK2 A;  1PWT A;  3X26 B;  2LQN A;  1T0J A;  2PUO B;  3H0F A;  5A0G A;  2VUB A;  3MF1 A;  2CZ0 B;  2A7Y A;  4G84 A;  4YCW A;  1KC8 C;  1PSF A;  5J39 A;  3CC4 A;  2I4M A;  1JJ2 A;  1G5I A;  3P8V A;  1P92 A;  3TEH A;  2EGC A;  2BZY A;  3JCM f;  2VAS A;  2ZIM A;  2EQM A;  2JUF A;  4BDZ A;  1TG0 A;  4KQE A;  1GCQ A;  1EFW A;  2E70 A;  4MML A;  3QSU A;  4FYV B;  5C6S A;  2EQI A;  3LWH A;  1ZSZ C;  1YFS A;  4YRQ A;  4XU1 A;  3TEG A;  1ASY A;  2D8J A;  2K3B A;  1RAH B;  4J8O A;  4RDX A;  2FYK A;  2E5K A;  4BW9 A;  1VIF A;  5GAM f;  1X6O A;  1K1Z A;  3X28 B;  3QHS A;  2ZPB B;  2JTF A;  1NJI U;  2OJ2 A;  2OX7 A;  3CCU A;  3MEU A;  1M2V B;  2EL9 A;  1K8A C;  1H4T A;  2JTM A;  1VYU A;  5LJ5 f;  1JO8 A;  2ED1 A;  2PTK A;  3M55 A;  5FWB A;  1K73 C;  3QDR B;  4M7A F;  3J7A F;  4PJO C;  2CDT A;  2KEA A;  3VRZ A;  4Y28 E;  2QGF B;  4KRT A;  3KFU A;  3EH2 A;  3PTA A;  2DL7 A;  2DU7 A;  2AZS A;  2DZ9 A;  3OW2 A;  1ZQ1 A;  2P84 A;  2VYT A;  2LJ1 A;  2LCL A;  3UAT A;  1EVK A;  1WHJ A;  2I4N A;  2IIM A;  1OZ2 A;  4FIB A;  2FEI A;  4GBQ A;  1MUZ A;  4PJJ A;  4PFO A;  1VQ5 T;  2QA4 A;  2RO0 A;  2X3X D;  3UT1 A;  4V2S A;  4AFQ C;  2JS0 A;  4HVU A;  2ROL A;  4CI0 C;  2C0O A;  4QQG A;  2M1H A;  1ZA2 B;  4LXC A;  3GNF B;  4HXJ A;  2NUT A;  2CSQ A;  2IG0 A;  3TQ7 P;  1UGV A;  3OYG A;  4PHC A;  4M75 E;  3CCE A;  3ERR A;  5IH2 A;  4HVC A;  1KD1 R;  4RTY A;  4J5Y A;  1ACM B;  4M77 D;  4XEO A;  1MND A;  4HCC A;  1IRX A;  1PG5 B;  4HCZ A;  2HQH A;  4JJB A;  1NG2 A;  3QYH B;  4QQ6 A;  4H2W A;  1I5O B;  1R0C B;  4LVL A;  2V8I A;  1B07 A;  1VQN A;  3DKM A;  1HYO A;  2KXD A;  1NYQ A;  1I07 A;  4A4K A;  2OTJ T;  1KHC A;  1C6V X;  3I5S A;  3SFM A;  3PMI A;  2ZZG A;  2OTL T;  1RI0 A;  1I4K 1;  2ZIO A;  2JTE A;  2RNA A;  1OPL A;  3I55 Q;  2PMF A;  4C8Q C;  3CCS T;  1TUG B;  2EYZ A;  3G4S Q;  4KR3 A;  2A28 A;  2MWO A;  3EH1 A;  2GCX A;  1PKT A;  3EG2 A;  1OYX A;  1EX4 A;  3EGD B;  4OGC A;  4ELY C;  5I22 A;  2CJA A;  1M3A A;  5DM7 R;  2XID A;  3PT9 A;  3E9I A;  3GP8 A;  3G71 T;  3V8J A;  3JB9 F;  2DTH A;  1JRI A;  1M1K U;  4IKF A;  2HMA A;  4JJD A;  1VQO A;  4WJ3 M;  4YPF A;  2J3M A;  1UGP B;  1FXX A;  3PMT A;  1VQ6 Q;  3L2V A;  5K1P A;  2AZV A;  5IXB A;  3M57 A;  3CD6 Q;  4J6X A;  1K73 U;  1TSF A;  2HQE A;  5KYU A;  4HWP A;  2AHJ B;  3HY0 A;  2LZ6 B;  1SSH A;  2FHD A;  3OYK A;  3UDC A;  4CC4 B;  3GIB A;  3A1P A;  4LDV A;  4M7D C;  4WJ4 A;  2GQI A;  2QDL A;  1YFT A;  1KJW A;  2ZT7 A;  3MEV A;  4AG1 C;  5HK3 A;  3GBQ A;  3VUZ A;  1LJO A;  1VA7 A;  1JJ2 P;  1OUL A;  1FYN A;  2MF2 A;  4C92 G;  5GAO r;  2ZR2 A;  1E7O A;  3LYI A;  3BY7 A;  1VQL T;  4C92 B;  1UHF A;  3OYC A;  1QVF A;  1T3S A;  2MK5 A;  3ASK A;  1IHV A;  4PFP A;  1TUD A;  3CXC A;  2DL4 A;  4ZTU B;  4M78 E;  4Q5W A;  2KRM A;  2P0Q A;  2O9S A;  5GAM d;  3QDF A;  1VQ4 Q;  2EYX A;  2KYM A;  1YJW A;  4RQF A;  1LYL A;  3EGX A;  4L59 A;  4AG2 C;  4DEY A;  2B8A A;  2XIC A;  3DLM A;  1NJ8 A;  4LD6 A;  2P4T A;  4ANJ A;  1YJ9 T;  3I56 A;  4KT0 E;  1C0M A;  5GMK i;  2EJF A;  2QAZ A;  1AWO A;  2GF7 A;  3QO5 A;  2LJ3 A;  3HKS A;  3CC2 T;  1D3B A;  4H2X A;  2O88 A;  1CKB A;  2LNV A;  2W0Z A;  2E12 A;  4II1 A;  2XMF A;  2EW3 A;  5GAO l;  3C94 A;  5J3B A;  4EMK A;  4A53 A;  1OX9 A;  3EG9 A;  4JLI A;  3OYE A;  3P8T A;  4EX5 A;  4F7U B;  2NUZ A;  2L3Q A;  3CCR Q;  4ZTJ A;  4YDQ A;  2GNC A;  2K2M A;  2DD4 A;  1M3B A;  5CKE A;  2QDY B;  3RUX A;  3OYN A;  2E3I A;  2LDM A;  1UFF A;  3UWN A;  1YNZ A;  4M77 A;  4NS5 A;  3EHR A;  2COZ A;  2YWW A;  3CPW A;  2VGN A;  4D8K A;  4DBF A;  1JBM A;  5D6X A;  1O9S A;  4XU0 A;  3EFR A;  3RL6 A;  2JNG A;  4XTY A;  1QVG P;  1AWJ A;  3HXZ A;  3MF2 A;  4TQF A;  3M5A A;  3DSQ A;  1WPY A;  1M4Z A;  1AWX A;  2E5Q A;  1NEG A;  1WHL A;  3SWN B;  2LVM A;  5AT1 B;  1D1C A;  2SEM A;  3DB4 A;  3EG0 A;  1WQ7 A;  3INZ A;  3BDU A;  2EQJ A;  4D8D A;  3OS2 A;  2HQX A;  2CUD A;  5HKC A;  1TUC A;  2R5A A;  5KYW A;  1N9S A;  5FRN A;  3HFN A;  2DIG A;  1U5S A;  4J15 A;  1I81 A;  2CRE A;  1OI1 A;  2KT8 A;  4XK8 E;  2A0F B;  2P0P A;  2ZZE A;  2ZGW A;  4TVR A;  2KE9 A;  2RHU A;  1ASZ A;  4Y92 A;  4RTV A;  4EDU A;  3JCM W;  1Q82 C;  2KI7 A;  3MEW A;  3A8L B;  2QHU A;  3M4Y A;  4J9H A;  3CCV T;  5GJV B;  1VUB A;  5CQX A;  1GCP A;  3RKX A;  4P5N A;  1Q95 G;  1U1S A;  1WQW A;  3UF4 A;  1S72 T;  3VS4 A;  4LDX A;  1EZZ B;  2X4W A;  3HY1 A;  2Q5H A;  4CS2 A;  4IUU A;  4Q15 A;  4BI8 B;  2CZ7 B;  1ZUK A;  2P0L A;  3VYG A;  3P8H A;  4BY6 C;  2RHQ B;  1BBU A;  2NUP A;  2VB6 A;  3FIF A;  2RQW A;  4ZN1 A;  1ABQ A;  4A4E A;  1KG1 A;  2MMP A;  3C4S A;  4LNS A;  1YFR A;  3TUP A;  2AT1 B;  2B86 A;  3C0C A;  4R0K A;  5GAM g;  2LT4 A;  3HTZ A;  2K6D A;  4JRI A;  5FLX E;  2RQR A;  1ZUY A;  2O4X B;  4JZ4 A;  2MI6 A;  4JZ3 A;  1OZ3 A;  1TU0 B;  5LJ5 g;  1VQM Q;  4AH6 A;  1Z7M A;  1WXU A;  1SHF A;  2EGA A;  3RBB B;  2DET A;  2MIO A;  2L3R A;  3RR6 A;  2L0A A;  4KUD K;  1NEB A;  4XAX B;  2ODR D;  1X2Q A;  1WHG A;  4C0D B;  4N0A C;  4H02 A;  1B34 A;  5FU7 C;  1MMN A;  4JRP A;  1ZBX A;  3G71 Q;  1RAB B;  2RMO A;  1FMW A;  3VS7 A;  2DU5 A;  1PM3 A;  1OPK A;  3L1A A;  1K9A A;  3CQT A;  3HSB A;  1SHG A;  3IKM B;  3H41 A;  4TVY A;  3REA B;  1N27 A;  1G83 A;  3V8K A;  4RQE A;  2LX9 A;  4C92 F;  3PIO A;  2KK4 A;  4M7A G;  2BIV A;  4M78 D;  1WU7 A;  5LJ3 j;  1X56 A;  3PZC A;  1UGS B;  4K86 A;  2VXE A;  4WCI A;  3SEM A;  3I55 A;  2DER A;  3QBY A;  3OS0 A;  3CBM A;  3G4S A;  2V1Q A;  1WYX A;  1KK7 A;  1UJ0 A;  4YYE A;  2K9G A;  1SER A;  4P3O A;  1QVP A;  3VQX A;  3QWX X;  1X01 A;  3PCO A;  2NWM A;  4UP8 A;  1T0H A;  4CH6 A;  1TWB A;  3M4G A;  2CT3 A;  3HRS A;  1G2B A;  4PNO A;  1VQL Q;  5CKB A;  4CH4 A;  2HKQ B;  3LGF A;  4A4H A;  2LP5 A;  4J6W A;  4HT4 A;  5M9O A;  1E22 A;  1ZSZ B;  1U8R A;  2DMO A;  3I5R A;  2RN8 A;  4M75 A;  2RHS B;  3OYA A;  3CC7 T;  1VQ6 A;  4F7U F;  3G1Z A;  3CD6 A;  2QEX Q;  5E3I A;  2ALY B;  4Y91 A;  3JB9 I;  2HEQ A;  2ZPH B;  3QTC A;  2DXT A;  1PNJ A;  2AMC A;  1U06 A;  2DXU A;  2NUT B;  4P74 C;  4Q6G A;  1JXO A;  3JCM b;  4GY5 A;  3TEE A;  2YDL A;  3CCJ T;  2JN0 A;  1YJ9 Q;  2FO0 A;  4B9W A;  2RI3 A;  3REB B;  1H4V B;  2DQ0 A;  1G51 A;  4PJO G;  3CC2 Q;  1D1A A;  4PJO B;  1N5Z A;  1WZO A;  2CP0 A;  3JCM c;  4IUV A;  4CC3 A;  1AZG B;  1MGQ A;  3M59 A;  1PKS A;  4JRQ A;  2RF0 A;  4CRI A;  2ODR C;  2CYZ B;  1YFN A;  3FJP A;  1N8R U;  2ZT5 A;  1WJQ A;  2JOY A;  4XTU A;  3G6E T;  2YUO A;  1H64 1;  3VS1 A;  3L2Q A;  2YUQ A;  4AMC A;  3NET A;  4RMO A;  3VJP A;  4AFU C;  4IIM A;  3NEL A;  3RNJ A;  3LSQ A;  4A4F A;  1W2B P;  2RA2 A;  2ART A;  2ZZF A;  1Q7Y R;  1VQ4 A;  2LCS A;  4FL6 A;  2A08 A;  2AKL A;  3OMC A;  1YI2 T;  2VVK A;  2F2V A;  1X6B A;  3P8D A;  3BJU A;  4P74 A;  1VQ9 T;  2DO3 A;  2J6K A;  3C12 A;  1KIK A;  4O2D A;  2P0K A;  5GAN 7;  4YRS A;  3BFM A;  2K57 A;  2ED0 A;  1AZE A;  1YIT Q;  1GCQ C;  2D6F A;  4XEM A;  4KUL A;  1I5L A;  3HFZ B;  3EG1 A;  1UUE A;  4KH1 B;  4P3N A;  3ZL7 C;  1GGM A;  2JS2 A;  4UPA A;  1BCM A;  5KYU B;  1KFZ A;  3X20 B;  4H2V A;  2O9V A;  3CCR A;  3T9N A;  4JS4 A;  1WLE A;  3OBY A;  3HXW A;  4C8Q G;  2BE9 B;  1RAD B;  3DB3 A;  4C8Q B;  3NTI A;  2KRS A;  2WSF E;  1OEB A;  3TU4 K;  1D09 B;  5I2M A;  4HA8 A;  2P4R A;  2VWF A;  3KUF A;  2EKO A;  4M78 A;  4X5O A;  4QKU A;  2JXB A;  4E51 A;  3WQZ A;  3EHQ A;  1M90 R;  2DVJ A;  3MPU B;  1IGU A;  2QQ9 A;  1S72 Q;  4BDY A;  4XU3 A;  4ORZ A;  4GLM A;  3H0I A;  4PL6 A;  4RTW A;  4RTX A;  5A2Q E;  1A0N B;  5KCO A;  1M30 A;  3GNG A;  1KD1 C;  2FG0 A;  2ZPF B;  3I9Q A;  1VQ8 Q;  4OVA A;  3IKL A;  2XU8 A;  3Q1J A;  5GAN d;  1H3H A;  4PLI A;  2LCC A;  3CCQ T;  2EQK A;  4ZGD B;  4M7D G;  3F70 A;  5KH6 A;  4CS4 A;  3EGX B;  4F17 A;  2DEU A;  3VQW A;  4PJN A;  3TRE A;  4ESR A;  1SEM A;  4M7D B;  2I4L A;  4ZTF A;  1M1K C;  5HGQ A;  3ER0 A;  3VYH B;  5CCA A;  1M8M A;  2J05 A;  4PJL A;  1PSE A;  2PU9 B;  5C51 B;  3JCM h;  3OMG A;  1VQ7 T;  3FRN A;  4P71 A;  4YRM A;  1WHK A;  2LQ8 A;  2L8D A;  2IPO B;  1G5H A;  2KVQ G;  1NYR A;  2K5I A;  2QHT A;  4WF2 A;  3CC4 T;  4C92 E;  1VQP Q;  4RKU E;  2J3L A;  1IRE B;  3H8Z A;  2P5I A;  4CH5 A;  2DL5 A;  5K1X A;  4H2S A;  1HD3 A;  1K9M R;  2F2X A;  1Q81 R;  3TCJ A;  1YIJ Q;  1NBE B;  1WHH A;  1I8F A;  4K11 A;  4CS3 A;  3HXX A;  3TSW A;  2DX1 A;  2OAW A;  2WSC E;  1M27 C;  4HVW A;  4BI4 A;  5HK0 A;  1QVG A;  1G3T A;  3QUI A;  3RDV A;  3LWI A;  2DBK A;  4J9C A;  3UGQ A;  2JT4 A;  4YRI A;  3GLX A;  1X2K A;  1NE8 A;  4J9D A;  2KMT A;  3CCU T;  2NYS A;  1VQM A;  2O31 A;  1N6A A;  5IHN A;  4QVZ A;  1E1T A;  4OMN A;  4ATO A;  1KC8 R;  2CKK A;  4HKE A;  4F7U E;  2V8J A;  1KMN A;  2DJQ A;  3A7R A;  3G71 A;  2K7A A;  3CBP A;  1SRL A;  5KYX A;  1KOG A;  5CK9 A;  5DLQ E;  1K0X A;  4PJO F;  2E4H A;  1GL5 A;  1Q86 R;  2QK0 A;  1NM7 A;  3CC7 Q;  4RCB A;  3H0H A;  1KD1 U;  4YRL A;  2RHZ A;  3REU A;  1ZX6 A;  1JJC B;  5HCK A;  3KFV A;  2EQU A;  2YXY A;  4ZGJ B;  5CIU A;  1N9W A;  1YJN T;  2XD0 A;  2QQR A;  3CCJ Q;  1YHQ Q;  2DTI A;  2ZZD A;  5L8R E;  1K8A R;  4FCY A;  2RD1 A;  2K5L A;  1M1G A;  5LJ3 h;  2FZG B;  3CCE T;  2IY5 A;  3RER A;  3VS5 A;  1AVZ C;  4B6M A;  2FRW A;  1EIY A;  3CEY A;  1GXI E;  2OAU A;  1QWF A;  1VQL A;  5GAN g;  4VUB A;  2JW4 A;  1O75 A;  1U1T A;  3CCM Q;  1AWW A;  1JQQ A;  5FWC A;  4JJN K;  1PHT A;  2K2V A;  2ZPG B;  2PQW A;  3LSS A;  2MOX A;  1QF6 A;  4ZGE B;  3JCM V;  3OSV A;  4OB3 B;  3A5Z B;  4YRK A;  1TS9 A;  3HTR A;  2ZCE A;  4JJC A;  4YCU A;  2QEX A;  1RL2 A;  5HY6 A;  5F5W A;  2IVW A;  3OYI A;  5GAN e;  4LVI A;  3KXT A;  3EFO B;  3VS0 A;  1VYT A;  1BIB A;  1PYS A;  4C8Q F;  2MYS A;  1B70 B;  1HTT A;  4Z02 A;  4EMK C;  3PGG A;  2EYQ A;  2W10 A;  1W4S A;  2DNU A;  3QJ6 A;  2FPE A;  1YJ9 A;  1HK9 A;  3V7C A;  3MHX A;  4BY6 B;  11AS A;  1FMK A;  5CKH A;  3UA6 A;  5CKF A;  2E6N A;  3QO3 A;  3CC2 A;  1X54 A;  3O8V A;  2DPP B;  4HWT A;  3OB9 A;  4M77 C;  1YN8 A;  5GAN 8;  2GFA A;  1Y0M A;  1VQO T;  3OYD A;  4IUR A;  1Y57 A;  4RG2 A;  3D7S B;  3RAC A;  2O2O A;  3WXM B;  2C0T A;  3QZ5 B;  2X4J A;  3CMA Q;  1WHM A;  2RQV A;  4J7I A;  2EIF A;  3CPF A;  2CIM A;  4LUD A;  5KNN A;  4EIK A;  5CKD A;  2DTO A;  1HC7 A;  3OSS C;  3VS2 A;  3FLG A;  1M8V A;  3CBO A;  3NGP A;  2QG9 B;  2DDZ A;  4TQD A;  1FMV A;  3JB9 J;  1B7T A;  5A0L A;  3X25 B;  1KQ2 A;  3QNE A;  5A0D A;  2A3L A;  4M7D F;  1UTI A;  2X4X A;  1VYV A;  4F7U G;  5GAN 2;  5FU7 B;  1OU9 A;  3A5Y A;  2HL3 A;  3URG A;  4DQ2 A;  4C0G A;  4FW1 A;  1JXM A;  1W1F A;  2RJC A;  2DJZ A;  1KHI A;  1X43 A;  2GFU A;  4XTZ A;  4C92 D;  3UFG A;  1YIT A;  4DEX A;  1M2V A;  4JDS A;  3M53 A;  3UA7 A;  2ZT8 A;  1AOJ A;  3H9N A;  1XOV A;  1TXQ A;  4NL3 A;  5IHI A;  3CCQ Q;  3OA6 A;  2PNI A;  4M7A E;  4LN2 A;  8ATC B;  5KYY B;  3FEO A;  2EYY A;  2ARS A;  2LT1 A;  1YJW T;  1GRI A;  1WXB A;  4OB0 B;  4TVA B;  4RUG A;  1PD0 A;  1VQ7 Q;  4J83 A;  4J6Y A;  4P3P A;  3JV3 A;  2CZ6 B;  2F69 A;  4M75 D;  2CUB A;  2NLU A;  1WXT A;  3OW2 S;  4YTL A;  1EOV A;  2DFU A;  4DBQ A;  1NJ5 A;  2CP6 A;  1PRL C;  1S72 A;  1C0A A;  2GTO A;  4P73 A;  2M51 A;  2QGG A;  2R57 A;  1L0W A;  2CP5 A;  4C5G A;  4D6W A;  1VQ8 A;  1USY A;  4J9I A;  1SSF A;  3A31 A;  3QJY A;  2E6Z A;  5C0M A;  1W2B A;  1MMG A;  4M4Z A;  1QCF A;  1YCS B;  1VQ5 Q;  4XQ3 A;  3MP6 A;  4HCB A;  5GAM j;  2JJ9 A;  1IHW A;  3R07 A;  4OML A;  1JB0 E;  1RAC B;  1IB8 A;  2HCK A;  1XTD A;  1TOV A;  4BE2 A;  3REX A;  1MNE A;  4FT4 A;  4AFS C;  1ADJ A;  1NPP A;  12AS A;  4LDW A;  5LJ5 j;  1SRY A;  4PKC C;  2F5K A;  2X4Y A;  1KQS A;  4PJO E;  3UGT A;  2HBW A;  4RG8 A;  4NL2 A;  1PD1 A;  3TSZ A;  4NCX A;  2DIL A;  1VQP A;  2RQU A;  2OTJ Q;  1Y96 B;  9ATC B;  3EGD A;  1N9R A;  4UC4 A;  3UPU A;  2K79 A;  1M1F A;  3A74 A;  2HSP A;  5FRM A;  3L4G B;  2XHC A;  2OTL Q;  2ARU A;  3M9Q A;  4Z8A A;  3ZBD A;  5GMK l;  1YIJ A;  4TVW A;  1NLO C;  2ESW A;  1YCY A;  3CCS Q;  1VQK T;  3M0U A;  2KDS A;  4M78 B;  2GBQ A;  6AT1 B;  3M54 A;  3S3M A;  2RM4 A;  3P8Y A;  1N8R C;  3LW5 E;  1HXD A;  1YWO A;  3P8B B;  2BZX A;  3TEH B;  3A7U A;  1WX6 A;  1Y71 A;  2V8K A;  4FM4 B;  2RI5 A;  1LNX A;  3PVL A;  1RUW A;  1YJN Q;  4LUE A;  3FDR A;  4BI3 A;  2ZPE B;  1DJ7 B;  4M75 C;  4QVC A;  2DZC A;  5FW9 A;  4K87 A;  3NHN A;  1IZ6 A;  2BTT A;  3EFS A;  4P75 A;  2H3J A;  4E2F B;  5I21 A;  1KSW A;  1PRM C;  1H92 A;  2YLB A;  5D6W A;  5GAN f;  3CCL T;  1MV0 B;  3R6O A;  2K5F A;  5GAO m;  4OMQ A;  3HXY A;  4C92 A;  4C8Q E;  1WDX A;  4ZNX A;  3CC7 A;  1D0Y A;  4FU6 A;  3GPL A;  2D0Q B;  1Q82 R;  2EWN A;  2MPX C;  1K0S A;  2I0N A;  2KR3 A;  4A4G A;  1GFC A;  1QVF S;  1B7Y A;  3V7S A;  4UP9 A;  3ICA A;  1IGQ A;  2KAF A;  3O5Z A;  4OMM A;  3CCJ A;  1YHQ A;  4HT9 A;  3CXC S;  4H2U A;  3E9G A;  2EFI A;  2CH4 A;  2Y4Y A;  1W70 A;  4KGX B;  4PLL A;  1QMC A;  2FZC B;  2Q7E A;  2G6F X;  2SRC A;  4C5E A;  2ATC B;  3E9F A;  3CCM A;  1BB9 A;  1NZ9 A;  4M7D E;  2DD5 A;  2QQB A;  4F04 B;  2EPD A;  2ABL A;  2CS7 A;  4M7A D;  3N5B B;  3L2W A;  5GMK j;  4LDY A;  3H6Z A;  1GFD A;  4E7L A;  3I55 T;  4CH3 A;  3OS1 A;  2CZ1 B;  1VQZ A;  1NYG A;  4C5H A;  4BAC A;  5ECA A;  1H4Q A;  4XTW A;  2ZAE A;  3E9H A;  4KGV B;  1G3S A;  2HZY A;  2HBP A;  1WGS A;  1UGQ B;  5LJ3 e;  1M90 C;  1NJ6 A;  3NPF A;  1UB4 A;  4ZN3 A;  3J81 E;  4TWA A;  2YRD A;  3KBG A;  4DBR A;  2RJD A;  3CPW S;  1B8A A;  4ELZ C;  3SWN A;  3FB9 A;  2PUK B;  2FPF A;  1NJ1 A;  1SG5 A;  4A63 B;  4FYY B;  1BBZ A;  2O01 E;  1VQ6 T;  3CMA A;  2BUD A;  1AT1 B;  4HT8 A;  3CD6 T;  1WIE A;  1HSQ A;  4M78 C;  5GJW B;  1FX7 A;  3S3N A;  4YRJ A;  5GAO p;  2HNI A;  4XTX A;  2C0I A;  5I2S A;  1QLY A;  3HP9 A;  2HAX A;  1PC0 A;  3W3S A;  1W6X A;  4FW2 A;  2M9U A;  2X3W D;  4B9X A;  4JRK A;  1KQS P;  2YLC A;  3HRU A;  4BB7 A;  2L3P A;  2HDA A;  1RAI B;  2KSS A;  5IHK A;  1JEG A;  5D7U A;  4PJO D;  3S3O A;  2M0Y A;  4J9E A;  4OGE A;  4AT1 B;  4LVK A;  2EJ9 A;  1Q7Y U;  2KBT A;  4QQD A;  2DK3 A;  1X69 A;  2PME A;  2D1X A;  3A32 A;  1NNH A;  1RAF B;  2L5Q A;  1BIA A;  1YBY A;  2RHQ A;  1IO6 A;  1PCX A;  3ULR B;  2C7I A;  2H3E B;  5D6Y A;  4P71 C;  3CCQ A;  2XGT A;  4YRR A;  3JB9 D;  3BDL A;  3CME T;  1EIF A;  2LQK A;  4LVJ A;  4IIO A;  2GGR A;  3CCV Q;  3L2U A;  3VUB A;  2DRK A;  1LVK A;  4E7H A;  4R55 A;  2ROT A;  5AYF A;  1VQ7 A;  4M78 F;  3VRY A;  3A8H B;  4O6J A;  2O4X A;  1QW1 A;  3HFV A;  5C52 B;  1WJS A;  3OS5 A;  4KBM B;  1U3O A;  3HPW A;  1BI1 A;  1WLP B;  5GAO q;  2A36 A;  2FVU A;  1G3W A;  1NJI R;  2RPN A;  2AIR B;  2Q5I A;  3CCR T;  1ZHI A;  1CSK A;  1OV3 A;  1BI3 A;  4F16 A;  1M90 U;  3EAE A;  3RIR A;  3RKY A;  2DL8 A;  3OYH A;  1Q86 C;  4MZP A;  3HFO A;  4C8Q D;  1D3B B;  4RTT A;  1VQK Q;  4H2X B;  1R77 A;  1BKB A;  2RHY A;  1VQ5 A;  1SKU B;  1WJR A;  1Y07 A;  4EMK B;  3EG9 B;  4A54 A;  2I2L A;  2K3X A;  2XTI A;  5KCH A;  4J9G A;  3NEM A;  4ZTZ B;  4YRO A;  5IN1 A;  4MZT A;  2RQT A;  1BU1 A;  2A37 A;  4M7A A;  4TTV A;  3LH5 A;  4M77 G;  4DOW A;  3S6W A;  5GAM h;  1ABO A;  4M77 B;  3PFS A;  2NS6 A;  4OB2 B;  3OYB A;  3A8O B;  2ZXF A;  5IXF A;  4KH0 B;  1Z9Q A;  3MQZ A;  5GAO n;  4JPB W;  1RAA B;  4YRC A;  1MMA A;  5LJ5 h;  2OTJ A;  3VV0 A;  1X2G A;  5CR2 A;  5FU6 C;  4LE9 A;  3CCL Q;  2DQ3 A;  2QQS A;  4DOV A;  3DLL A;  2OTL A;  2LNH B;  2LRQ A;  2PVG B;  1QCO A;  4M7D D;  3CCS A;  3RF1 A;  3RGL A;  3X24 B;  4MDW A;  2DXB A;  3SB2 A;  5DLO A;  1YP5 A;  1ZSZ A;  2KXC A;  2M0O A;  2XDB A;  1RIQ A;  2WSE E;  1QKW A;  2YUN A;  2RHS A;  3VS3 A;  3JCM J;  1M3C A;  1Q81 U;  5GAN 3;  1K9M U;  2YHT A;  3AT1 B;  5I11 A;  5KYW B;  3OYM A;  1QQJ A;  4OMO A;  2ZNJ A;  3M0Q A;  5EC7 A;  2ALY A;  1YJN A;  2X51 A;  2CP3 A;  4O5V A;  1FWZ A;  2DVE A;  2JM9 A;  4EO4 A;  2L2P A;  4KUI A;  1R0B G;  3OYL A;  4L6V 5;  1BCO A;  4C0Z A;  3I7F A;  1Z9Z A;  3LH0 A;  1XJW B;  4PJO A;  3VQY A;  5GAN j;  2X9H A;  2YRV A;  2QA4 T;  2V26 A;  3MJX A;  1KC8 U;  1M1K R;  1UGR B;  4DBH A;  2AKW A;  5LJ3 f;  3QO7 A;  3MEA A;  3MEY A;  3QG1 A;  3ZFJ A;  2PVD B;  1NPR A;  2RHX A;  2NUP B;  3M0R A;  3OYY A;  2DYB A;  2EJG A;  2EYW A;  4Z88 A;  1VQM T;  2FB7 A;  1K73 R;  2XKO C;  1Q86 U;  2L3S A;  2M02 A;  2K4Y A;  1I0C A;  4OLF A;  2RH2 A;  1LOJ A;  2E10 A;  3PE0 A;  3PNW C;  2QXF A;  1VQN T;  1FYF A;  3G6E Q;  2L89 A;  1UDL A;  4H2Y A;  2XDP A;  5CO7 A;  1WFW A;  4E7S A;  8AT1 B;  2CJ9 A;  2BE7 D;  1SRM A;  3LGL A;  1K8A U;  2XI9 A;  4WI1 A;  2PZ1 A;  1OU8 A;  2GQV A;  3HFZ A;  1H3Z A;  2RB6 A;  4BE1 A; 
#chains in the Genus database with same CATH homology
 3FC3 A;  3HRT A;  3QZ9 B;  3OQ5 A;  1B34 B;  1BI0 A;  1E1O A;  4X9C A;  2DEQ A;  3OYF A;  4E7K A;  3MP1 A;  4C8Q A;  2R5M A;  3VKI A;  5GAN 6;  5GMK h;  1IL2 A;  2ZR3 A;  3JCM P;  4C0F A;  1H4S A;  3JCM d;  4IUP A;  3JSC A;  1B76 A;  2RI2 A;  1BI2 A;  4DA4 A;  4LVM A;  3ME9 A;  4NOY A;  1QE0 A;  4YRE A;  4YP0 A;  3QKJ A;  4YRT A;  2DIQ A;  3PCO B;  2QEX T;  1JJ2 S;  1B7Y B;  1YB3 A;  4QVD A;  5FRO A;  4YRP A;  2XK0 A;  4M7D A;  4P73 C;  4M75 G;  4L5G A;  5LJ5 d;  3E1S A;  1KMM A;  3BW1 A;  2E65 A;  2VV5 A;  3VBB A;  4M75 B;  5IT9 E;  3J80 E;  1USY C;  4HWS A;  4MMK A;  2LC4 A;  2AMC B;  3NFC A;  3HHT B;  3L2Z A;  4XU2 A;  3V7R A;  4M77 F;  3L42 A;  4YCV A;  2ZIN A;  4R56 A;  4BUG A;  2CJB A;  3HL8 A;  4X34 A;  1BYM A;  3LC0 A;  4L87 A;  1G3Y A;  3I56 T;  4IUQ A;  4E7J A;  4RMF A;  2DAQ A;  2C06 A;  2RK1 A;  4FT2 A;  3CCV A;  1UEB A;  5CVI A;  3PIP A;  3JCM Q;  3RMS A;  2VGM A;  3IG2 A;  5KE2 A;  4IUT A;  5CAI A;  1YIT T;  4HWO A;  2RJF A;  4BE0 A;  3E19 A;  3OD1 A;  2WAC A;  1YGB A;  1QVG S;  1QP2 A;  1VIE A;  3QPH A;  4JUV A;  3LX7 A;  3RMQ A;  5LJ3 d;  3MET A;  1X55 A;  3RKW A;  3A7A A;  4E47 A;  4MZM A;  1VQK A;  1SET A;  3QYG B;  2E1H A;  4LDU A;  3HRI A;  3RES A;  2M16 A;  2Y90 A;  2ZTG A;  4LD9 K;  2QQA A;  3V8L A;  4E7I A;  5KE3 A;  4P75 C;  1JJC A;  1WNL A;  3QII A;  3JCM g;  3AHU A;  1SES A;  2QTX A;  4OMF B;  3HXV A;  4C92 C;  2G4C A;  4PG3 A;  2X35 A;  2D9T A;  3VQV A;  1XQH A;  4M78 G;  1VQ8 T;  2VXF A;  1X75 C;  2DXC A;  3M4P A;  3JAM E;  5C53 B;  2HD0 A;  3CCL A;  1J5W A;  3HXU A;  1ATI A;  3M4Q A;  3JCM e;  2Y4X A;  2K3Y A;  3QXE B;  4OF1 A;  3UH0 A;  1NJ2 A;  1BBW A;  2ZT6 A;  3A5Z A;  5LL6 S;  1E24 A;  3MO8 A;  1G5V A;  4QW2 A;  5GAM e;  3G7Z A;  2VC8 A;  5CQY A;  2BKD N;  3WVD B;  1VQP T;  1XNI A;  1B70 A;  2QI2 A;  4JS5 A;  2CGH A;  5ELO A;  4N4G A;  2KY9 A;  3SDZ A;  5LJ5 e;  4BD3 A;  1KQ1 A;  4ME7 A;  2Q7H A;  2JZ2 A;  3L2R A;  1YIJ T;  1Y7X A;  4RCC A;  1TH7 A;  4ZIB A;  4MDX A;  2DKG A;  3M58 A;  1Q7Y C;  2JVV A;  4M7A B;  4EMG A;  1EQR A;  1WYD A;  5GAN h;  3MCA B;  3A8G B;  3NTK A;  3SWN C;  1V29 B;  2F5T X;  4HWR A;  2C8M A;  4YRF A;  2MAM A;  1Q82 U;  2LTO A;  3NTH A;  3G6E A;  2FL7 A;  4N4I A;  4N0A A;  4J7F A;  4YRG A;  2EAY A;  4M75 F;  4F7U A;  5LJ3 g;  3HRK A;  4X9D A;  2KQW A;  4K88 A;  2ZCF B;  1ADY A;  4GLK A;  4YRN A;  5J26 A;  1M9S A;  3G4S T;  2G3R A;  1R8O B;  1AHJ B;  5EG2 A;  2E5A A;  2Q7G A;  1Z7N A;  1YI2 A;  4JLG A;  3IAL A;  2E3C A;  1MHN A;  1VQ9 A;  3GF5 A;  2ZNI A;  5GAN 4;  4OP0 A;  1YHQ T;  4FSX A;  4EMH A;  3JCM X;  4M77 E;  3C95 A;  3ZEH A;  4TVA A;  1EVL A;  4XTV A;  1X2H A;  4EPC A;  4H2T A;  3CMQ A;  3VU3 C;  2PVO B;  2XG8 D;  5FU6 B;  3OBW A;  2E41 A;  2RJE A;  3SD4 A;  4BWA A;  1NJI C;  2AKW B;  2QHS A;  4OB1 B;  3CCM T;  3OYJ A;  4P72 C;  3QO8 A;  5ELN A;  3JB9 G;  2IY5 B;  3JB9 H;  1EIY B;  3OY9 A;  1M5Q 1;  5GMK m;  3CME A;  4G85 A;  3MP8 A;  3WVE B;  4N4H A;  3NEN A;  2MWP A;  2QHV A;  2R58 A;  5GMK e;  4DPG A;  2ZPI B;  1QP3 A;  4C0D C;  1W2B S;  4UP7 A;  5GAN 5;  1Q81 C;  1K9M C;  3M56 A;  4KR2 A;  4C5I A;  2A8E A;  3GOX A;  1PYS B;  3CMA T;  3LLR A;  1VQ4 T;  2E64 A;  3A8M B;  1Y96 A;  2XDD A;  2RHI A;  1KQS S;  4P72 A;  2I4O A;  4M7A C;  3JRZ A;  5DY9 A;  5IAY A;  3L4G A;  1W66 A;  2RK2 A;  3X26 B;  2PUO B;  5A0G A;  2VUB A;  3MF1 A;  2CZ0 B;  2A7Y A;  4G84 A;  4YCW A;  1KC8 C;  1PSF A;  5J39 A;  3CC4 A;  2I4M A;  1JJ2 A;  1G5I A;  3P8V A;  1P92 A;  3TEH A;  3JCM f;  2ZIM A;  2EQM A;  2JUF A;  4BDZ A;  4KQE A;  1EFW A;  2E70 A;  4MML A;  3QSU A;  5C6S A;  3LWH A;  1YFS A;  4YRQ A;  4XU1 A;  3TEG A;  1ASY A;  4J8O A;  4RDX A;  2FYK A;  4BW9 A;  1VIF A;  5GAM f;  1X6O A;  3X28 B;  3QHS A;  2ZPB B;  2JTF A;  1NJI U;  3CCU A;  3MEU A;  2EL9 A;  1K8A C;  1H4T A;  2JTM A;  5LJ5 f;  3M55 A;  1K73 C;  3QDR B;  4M7A F;  3J7A F;  4PJO C;  4Y28 E;  3KFU A;  3PTA A;  2DU7 A;  2DZ9 A;  3OW2 A;  1ZQ1 A;  2VYT A;  2LCL A;  1EVK A;  2I4N A;  1OZ2 A;  4FIB A;  1VQ5 T;  2QA4 A;  2RO0 A;  3UT1 A;  4V2S A;  4CI0 C;  4QQG A;  2M1H A;  3GNF B;  2IG0 A;  3OYG A;  4PHC A;  4M75 E;  3CCE A;  3ERR A;  4HVC A;  4J5Y A;  4M77 D;  4XEO A;  4HCC A;  4HCZ A;  4H2W A;  3QYH B;  4QQ6 A;  4LVL A;  2V8I A;  1VQN A;  3DKM A;  1NYQ A;  4A4K A;  2OTJ T;  1KHC A;  3SFM A;  3PMI A;  2ZZG A;  2OTL T;  1RI0 A;  1I4K 1;  2ZIO A;  2PMF A;  4C8Q C;  3CCS T;  4KR3 A;  2MWO A;  2GCX A;  1OYX A;  4OGC A;  4ELY C;  2CJA A;  5DM7 R;  2XID A;  3PT9 A;  3E9I A;  3GP8 A;  3G71 T;  3V8J A;  3JB9 F;  2DTH A;  1JRI A;  1M1K U;  4IKF A;  1VQO A;  4WJ3 M;  4YPF A;  2J3M A;  1UGP B;  1FXX A;  3PMT A;  3L2V A;  5K1P A;  3M57 A;  4J6X A;  1K73 U;  2HQE A;  4HWP A;  2AHJ B;  3HY0 A;  2FHD A;  3OYK A;  3UDC A;  3GIB A;  4LDV A;  4M7D C;  4WJ4 A;  1YFT A;  2ZT7 A;  3MEV A;  5HK3 A;  3VUZ A;  1LJO A;  2MF2 A;  4C92 G;  5GAO r;  2ZR2 A;  3LYI A;  3BY7 A;  1VQL T;  4C92 B;  3OYC A;  1QVF A;  3ASK A;  3CXC A;  4ZTU B;  4M78 E;  4Q5W A;  2P0Q A;  5GAM d;  1YJW A;  4RQF A;  1LYL A;  4L59 A;  2B8A A;  2XIC A;  3DLM A;  1NJ8 A;  4LD6 A;  2P4T A;  1YJ9 T;  3I56 A;  4KT0 E;  5GMK i;  2EJF A;  2GF7 A;  3QO5 A;  3HKS A;  3CC2 T;  1D3B A;  4H2X A;  2LNV A;  2E12 A;  4II1 A;  5GAO l;  3C94 A;  5J3B A;  4EMK A;  4A53 A;  3P8T A;  3OYE A;  4JLI A;  4EX5 A;  4F7U B;  4ZTJ A;  4YDQ A;  2DD4 A;  5CKE A;  2QDY B;  3RUX A;  3OYN A;  2LDM A;  3UWN A;  4M77 A;  4NS5 A;  3CPW A;  2VGN A;  1JBM A;  5D6X A;  1O9S A;  4XU0 A;  3EFR A;  3RL6 A;  2JNG A;  4XTY A;  3HXZ A;  3MF2 A;  4TQF A;  3M5A A;  3DSQ A;  1WPY A;  1M4Z A;  2E5Q A;  3SWN B;  2LVM A;  3DB4 A;  1WQ7 A;  3INZ A;  3BDU A;  2EQJ A;  3OS2 A;  2HQX A;  5HKC A;  2R5A A;  1N9S A;  5FRN A;  3HFN A;  2DIG A;  4J15 A;  1I81 A;  1OI1 A;  4XK8 E;  2P0P A;  2ZZE A;  2ZGW A;  4TVR A;  1ASZ A;  2RHU A;  4EDU A;  3JCM W;  1Q82 C;  3MEW A;  3A8L B;  2QHU A;  3M4Y A;  3CCV T;  1VUB A;  5CQX A;  3RKX A;  4P5N A;  1U1S A;  1WQW A;  1S72 T;  4LDX A;  2X4W A;  3HY1 A;  2Q5H A;  4CS2 A;  4IUU A;  4Q15 A;  4BI8 B;  2P0L A;  2CZ7 B;  3VYG A;  3P8H A;  4BY6 C;  2RHQ B;  1BBU A;  3FIF A;  4ZN1 A;  4A4E A;  1KG1 A;  2MMP A;  3C4S A;  4LNS A;  1YFR A;  3TUP A;  5GAM g;  2LT4 A;  3HTZ A;  4JRI A;  5FLX E;  2O4X B;  2MI6 A;  1OZ3 A;  5LJ5 g;  4AH6 A;  1Z7M A;  2L3R A;  4KUD K;  4XAX B;  2ODR D;  4C0D B;  4N0A C;  4H02 A;  1B34 A;  5FU7 C;  4JRP A;  1ZBX A;  2DU5 A;  3L1A A;  3IKM B;  3HSB A;  4TVY A;  1N27 A;  3V8K A;  4RQE A;  2LX9 A;  4C92 F;  3PIO A;  2KK4 A;  4M7A G;  2BIV A;  4M78 D;  1WU7 A;  5LJ3 j;  1X56 A;  3PZC A;  1UGS B;  4K86 A;  2VXE A;  3I55 A;  3QBY A;  3OS0 A;  3CBM A;  3G4S A;  4YYE A;  1SER A;  4P3O A;  1QVP A;  3VQX A;  1X01 A;  3PCO A;  4UP8 A;  4CH6 A;  3M4G A;  3HRS A;  4PNO A;  5CKB A;  4CH4 A;  3LGF A;  4A4H A;  4J6W A;  4HT4 A;  5M9O A;  1E22 A;  1U8R A;  4M75 A;  2RHS B;  3OYA A;  3CC7 T;  1VQ6 A;  4F7U F;  3G1Z A;  3CD6 A;  5E3I A;  2ALY B;  4Y91 A;  3JB9 I;  2ZPH B;  3QTC A;  2DXT A;  2AMC A;  2DXU A;  4P74 C;  4Q6G A;  3JCM b;  4GY5 A;  3TEE A;  3CCJ T;  2JN0 A;  4B9W A;  2RI3 A;  1H4V B;  2DQ0 A;  1G51 A;  4PJO G;  4PJO B;  3JCM c;  4IUV A;  1MGQ A;  3M59 A;  4JRQ A;  4CRI A;  2ODR C;  2CYZ B;  3FJP A;  1N8R U;  2ZT5 A;  1WJQ A;  2JOY A;  4XTU A;  3G6E T;  1H64 1;  3L2Q A;  3NET A;  4RMO A;  3VJP A;  3NEL A;  3LSQ A;  4A4F A;  2RA2 A;  2ART A;  2ZZF A;  1VQ4 A;  4FL6 A;  3OMC A;  1YI2 T;  3P8D A;  3BJU A;  4P74 A;  1VQ9 T;  2DO3 A;  3C12 A;  4O2D A;  2P0K A;  5GAN 7;  4YRS A;  3BFM A;  2K57 A;  2D6F A;  4XEM A;  4KUL A;  1I5L A;  3HFZ B;  4P3N A;  1GGM A;  4UPA A;  4H2V A;  3X20 B;  3CCR A;  3T9N A;  4JS4 A;  1WLE A;  3OBY A;  3HXW A;  4C8Q G;  3DB3 A;  4C8Q B;  3NTI A;  2WSF E;  3TU4 K;  5I2M A;  4HA8 A;  3KUF A;  2EKO A;  4M78 A;  4X5O A;  4E51 A;  3WQZ A;  2QQ9 A;  4BDY A;  4XU3 A;  4PL6 A;  5A2Q E;  5KCO A;  3GNG A;  1KD1 C;  2ZPF B;  4OVA A;  3IKL A;  2XU8 A;  3Q1J A;  5GAN d;  4PLI A;  2LCC A;  3CCQ T;  2EQK A;  4ZGD B;  4M7D G;  3F70 A;  5KH6 A;  4CS4 A;  3VQW A;  3TRE A;  4M7D B;  2I4L A;  4ZTF A;  1M1K C;  5HGQ A;  3ER0 A;  3VYH B;  5CCA A;  1PSE A;  2PU9 B;  5C51 B;  3JCM h;  3OMG A;  1VQ7 T;  3FRN A;  4P71 A;  4YRM A;  2LQ8 A;  2L8D A;  1G5H A;  2KVQ G;  1NYR A;  2K5I A;  2QHT A;  4WF2 A;  3CC4 T;  4C92 E;  4RKU E;  2J3L A;  1IRE B;  3H8Z A;  2P5I A;  4CH5 A;  5K1X A;  4H2S A;  3TCJ A;  1I8F A;  4CS3 A;  3HXX A;  2WSC E;  4BI4 A;  5HK0 A;  1QVG A;  1G3T A;  3QUI A;  3LWI A;  3UGQ A;  4YRI A;  3GLX A;  1NE8 A;  2KMT A;  3CCU T;  1VQM A;  1N6A A;  4QVZ A;  1E1T A;  4ATO A;  2CKK A;  4HKE A;  4F7U E;  2V8J A;  1KMN A;  3A7R A;  3G71 A;  3CBP A;  1KOG A;  5CK9 A;  5DLQ E;  4PJO F;  4RCB A;  1KD1 U;  4YRL A;  2RHZ A;  3REU A;  1JJC B;  2EQU A;  4ZGJ B;  5CIU A;  1N9W A;  1YJN T;  2XD0 A;  2QQR A;  2DTI A;  2ZZD A;  5L8R E;  2RD1 A;  2K5L A;  1M1G A;  5LJ3 h;  3CCE T;  2IY5 A;  3RER A;  1EIY A;  3CEY A;  1GXI E;  2OAU A;  1VQL A;  5GAN g;  4VUB A;  1O75 A;  1U1T A;  4JJN K;  2K2V A;  2ZPG B;  2PQW A;  3LSS A;  1QF6 A;  4ZGE B;  3JCM V;  3OSV A;  4OB3 B;  3A5Z B;  4YRK A;  2ZCE A;  4YCU A;  2QEX A;  1RL2 A;  5HY6 A;  5F5W A;  2IVW A;  3OYI A;  5GAN e;  4LVI A;  3KXT A;  1BIB A;  1PYS A;  4C8Q F;  1B70 B;  1HTT A;  4Z02 A;  4EMK C;  3PGG A;  2EYQ A;  1W4S A;  3QJ6 A;  1YJ9 A;  1HK9 A;  3V7C A;  3MHX A;  4BY6 B;  11AS A;  5CKH A;  5CKF A;  2E6N A;  3QO3 A;  3CC2 A;  1X54 A;  3O8V A;  2DPP B;  4HWT A;  3OB9 A;  4M77 C;  5GAN 8;  2GFA A;  1VQO T;  3OYD A;  4IUR A;  3RAC A;  4RG2 A;  3WXM B;  3QZ5 B;  2X4J A;  4J7I A;  2EIF A;  3CPF A;  2CIM A;  5KNN A;  5CKD A;  2DTO A;  1HC7 A;  3OSS C;  3FLG A;  1M8V A;  3CBO A;  2DDZ A;  4TQD A;  3JB9 J;  5A0L A;  3X25 B;  1KQ2 A;  3QNE A;  5A0D A;  2A3L A;  4M7D F;  2X4X A;  4F7U G;  5GAN 2;  5FU7 B;  3A5Y A;  3URG A;  4DQ2 A;  4C0G A;  2RJC A;  2DJZ A;  1KHI A;  2GFU A;  4XTZ A;  4C92 D;  3UFG A;  1YIT A;  4JDS A;  3M53 A;  2ZT8 A;  1XOV A;  4NL3 A;  3OA6 A;  4M7A E;  3FEO A;  2ARS A;  2LT1 A;  1YJW T;  4OB0 B;  4TVA B;  4J83 A;  4J6Y A;  4P3P A;  2CZ6 B;  2F69 A;  4M75 D;  2NLU A;  3OW2 S;  4YTL A;  1EOV A;  1NJ5 A;  1S72 A;  1C0A A;  4P73 A;  2R57 A;  1L0W A;  4C5G A;  4D6W A;  1VQ8 A;  1USY A;  1SSF A;  3A31 A;  3QJY A;  2E6Z A;  5C0M A;  1W2B A;  4XQ3 A;  3MP6 A;  4HCB A;  5GAM j;  3R07 A;  1JB0 E;  1XTD A;  4BE2 A;  3REX A;  4FT4 A;  1ADJ A;  1NPP A;  12AS A;  4LDW A;  5LJ5 j;  1SRY A;  4PKC C;  2F5K A;  2X4Y A;  1KQS A;  4PJO E;  3UGT A;  4RG8 A;  4NL2 A;  4NCX A;  1VQP A;  1Y96 B;  1N9R A;  4UC4 A;  3UPU A;  1M1F A;  3A74 A;  5FRM A;  3L4G B;  2XHC A;  2ARU A;  3M9Q A;  3ZBD A;  5GMK l;  1YIJ A;  4TVW A;  1YCY A;  1VQK T;  2KDS A;  4M78 B;  3M54 A;  3S3M A;  2RM4 A;  3P8Y A;  1N8R C;  3LW5 E;  1HXD A;  3P8B B;  3TEH B;  3A7U A;  1Y71 A;  2V8K A;  4FM4 B;  2RI5 A;  1LNX A;  3FDR A;  4BI3 A;  2ZPE B;  1DJ7 B;  4M75 C;  4QVC A;  2DZC A;  4K87 A;  1IZ6 A;  3EFS A;  4P75 A;  2H3J A;  5I21 A;  2YLB A;  5D6W A;  5GAN f;  3CCL T;  3R6O A;  2K5F A;  5GAO m;  3HXY A;  4C92 A;  4C8Q E;  3CC7 A;  4FU6 A;  3GPL A;  2D0Q B;  2EWN A;  4A4G A;  1QVF S;  1B7Y A;  3V7S A;  4UP9 A;  3ICA A;  2KAF A;  3CCJ A;  1YHQ A;  4HT9 A;  3CXC S;  4H2U A;  3E9G A;  2EFI A;  2Y4Y A;  4PLL A;  2Q7E A;  4C5E A;  3E9F A;  3CCM A;  1NZ9 A;  4M7D E;  2DD5 A;  2QQB A;  2CS7 A;  4M7A D;  3N5B B;  3L2W A;  5GMK j;  4LDY A;  3H6Z A;  4E7L A;  3I55 T;  4CH3 A;  3OS1 A;  2CZ1 B;  1VQZ A;  4C5H A;  4BAC A;  1H4Q A;  4XTW A;  3E9H A;  1G3S A;  2HBP A;  1WGS A;  1UGQ B;  5LJ3 e;  1M90 C;  1NJ6 A;  1UB4 A;  4ZN3 A;  3J81 E;  4TWA A;  3KBG A;  2RJD A;  3CPW S;  1B8A A;  4ELZ C;  3SWN A;  3FB9 A;  2PUK B;  1NJ1 A;  2O01 E;  1VQ6 T;  3CMA A;  2BUD A;  4HT8 A;  3CD6 T;  4M78 C;  1FX7 A;  3S3N A;  4YRJ A;  5GAO p;  2HNI A;  4XTX A;  5I2S A;  3HP9 A;  2HAX A;  3W3S A;  2M9U A;  4B9X A;  4JRK A;  2YLC A;  3HRU A;  4BB7 A;  2KSS A;  4PJO D;  3S3O A;  4OGE A;  4LVK A;  2EJ9 A;  1Q7Y U;  4QQD A;  2DK3 A;  2PME A;  3A32 A;  1NNH A;  2L5Q A;  1BIA A;  1YBY A;  2RHQ A;  2C7I A;  5D6Y A;  4P71 C;  3CCQ A;  2XGT A;  4YRR A;  3JB9 D;  3BDL A;  3CME T;  1EIF A;  2LQK A;  4LVJ A;  3L2U A;  3VUB A;  4E7H A;  4R55 A;  5AYF A;  1VQ7 A;  4M78 F;  3A8H B;  4O6J A;  2O4X A;  1QW1 A;  3HFV A;  5C52 B;  1WJS A;  3OS5 A;  4KBM B;  3HPW A;  1BI1 A;  5GAO q;  2FVU A;  1G3W A;  2Q5I A;  3CCR T;  1ZHI A;  1BI3 A;  1M90 U;  3EAE A;  3RIR A;  3RKY A;  3OYH A;  1Q86 C;  4MZP A;  3HFO A;  4C8Q D;  1D3B B;  4H2X B;  1BKB A;  2RHY A;  1VQ5 A;  1WJR A;  1Y07 A;  4EMK B;  4A54 A;  2I2L A;  2K3X A;  2XTI A;  5KCH A;  3NEM A;  4ZTZ B;  4YRO A;  5IN1 A;  4MZT A;  4M7A A;  4TTV A;  4M77 G;  4DOW A;  3S6W A;  5GAM h;  4M77 B;  3PFS A;  2NS6 A;  2ZXF A;  4OB2 B;  3A8O B;  3OYB A;  3MQZ A;  5GAO n;  4YRC A;  5LJ5 h;  2OTJ A;  3VV0 A;  1X2G A;  5CR2 A;  5FU6 C;  2DQ3 A;  2QQS A;  4DOV A;  3DLL A;  2OTL A;  2LRQ A;  2PVG B;  4M7D D;  3CCS A;  3RF1 A;  3RGL A;  3X24 B;  4MDW A;  2DXB A;  3SB2 A;  5DLO A;  2M0O A;  2XDB A;  1RIQ A;  2WSE E;  2RHS A;  3JCM J;  1K9M U;  1Q81 U;  5GAN 3;  2YHT A;  3OYM A;  2ZNJ A;  2ALY A;  1YJN A;  4O5V A;  1FWZ A;  2DVE A;  4EO4 A;  4KUI A;  3OYL A;  4L6V 5;  4C0Z A;  3I7F A;  3LH0 A;  4PJO A;  3VQY A;  5GAN j;  2YRV A;  2QA4 T;  1KC8 U;  1UGR B;  2AKW A;  5LJ3 f;  3QO7 A;  3MEA A;  3MEY A;  3QG1 A;  3ZFJ A;  2PVD B;  1NPR A;  2RHX A;  3OYY A;  2EJG A;  1VQM T;  2FB7 A;  2XKO C;  1Q86 U;  2K4Y A;  4OLF A;  2RH2 A;  1LOJ A;  2E10 A;  3PNW C;  2QXF A;  1VQN T;  1FYF A;  2L89 A;  4H2Y A;  2XDP A;  5CO7 A;  2CJ9 A;  3LGL A;  1K8A U;  2XI9 A;  4WI1 A;  2GQV A;  3HFZ A;  1H3Z A;  2RB6 A;  4BE1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...