1WQ7A

Crystal structure of biotin-(acetyl-coa-carboxylase) ligase from pyrococcus horikoshii ot3
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
235
structure length
229
Chain Sequence
MLGLKTSIIGRRVIYFQEITSTNEFAKTSYLEEGTVIVADKQTMGHGESPEGGLWLSIVLSPKVPQKDLPKIVFLGAVGVVETLKEFSIDGRIKWPNDVLVNYKKIAGVLVEGKGDKIVLGIGLNVNNKVPNGATSMKLELGSEVPLLSVFRSLITNLDRLYLNFLKNPMDILNLVRDNMILGVRVKILGDGSFEGIAEDIDDFGRLIIRLDSGEVKKVIYGDVSLRFL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structures of Biotin Protein Ligase from Pyrococcus horikoshii OT3 and its Complexes: Structural Basis of Biotin Activation
pubmed doi rcsb
source organism Pyrococcus horikoshii
molecule tags Ligase
molecule keywords biotin--[acetyl-CoA-carboxylase] ligase
total genus 76
structure length 229
sequence length 235
chains with identical sequence B
ec nomenclature ec 6.3.4.15: Biotin--[biotin carboxyl-carrier protein] ligase.
pdb deposition date 2004-09-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02237 BPL_C Biotin protein ligase C terminal domain
A PF03099 BPL_LplA_LipB Biotin/lipoate A/B protein ligase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 1wq7A02
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 1wq7A01
1E1OA 1E1TA 4XU1A 2P0LA 3RACA 3L2ZA 4X9DA 5E3IA 1EOVA 3RESA 2PMFA 2QHVA 1BBUA 5LJ3f 4HWOA 1X01A 3MEYA 1WPYA 4YCWA 5LJ3j 2FYKA 1HC7A 3JCMJ 2E3CA 2EJGA 3FB9A 4YCUA 3HXZA 1NJ6A 4K87A 2E5AA 2DTIA 4WF2A 1VQZA 1WYDA 3HXYA 4XTWA 4P72A 1H4QA 2C8MA 4XU0A 1KMNA 4M75D 2K57A 4TQFA 2ZT7A 4UP8A 3EFRA 2ARSA 2AMCB 2CJAA 4YCVA 4N0AC 1B7YB 4EO4A 4P3NA 3HRIA 3NEMA 5GAN2 3JCMP 3JB9I 5GAOm 4J5YA 4CS3A 1NYRA 1IL2A 3W3SA 4YRTA 2VXFA 5LJ3h 1EVLA 5GAMf 4TVWA 3V7SA 4QVCA 2DU7A 4M75C 1BIAA 4YRJA 5GAOr 5GAMj 4HWSA 5GMKj 4M7AE 3HFNA 5LJ3g 4CH6A 4RCCA 4YRCA 2RD1A 2E64A 4WJ4A 4M7DD 1WNLA 4M7DC 4JLIA 1D3BA 1NYQA 4M78G 1LOJA 5GAN6 3UFGA 4UP9A 4XU3A 4J6XA 3HXWA 4P73A 4TQDA 3VQWA 3IG2A 5GAOp 2ZT5A 5F5WA 2EWNA 4P71A 3RIRA 4P75A 1KMMA 2ZTGA 4YRIA 3BDUA 2ARTA 4YP0A 3A7AA 2DZCA 3JCMV 4M7DA 5GAMh 4P75C 4H2VA 4BW9A 4M75B 3TEHB 4P73C 2ZIOA 3JCMQ 4RMFA 1JJCB 4M78D 5GAMg 2EJ9A 1BIBA 2I4OA 11ASA 1N9SA 4M77C 3RKXA 4HT8A 2DQ3A 4C8QG 4C8QD 3JB9G 4K88A 5GAN4 4XTZA 4DPGA 5LJ3d 1G5IA 4PJOB 1N9WA 4NOYA 3REUA 4PHCA 2YLCA 3P8TA 5GAN5 3NETA 5GAN3 4C92G 4PG3A 4KR3A 4C92D 5K1XA 5GMKh 3RKWA 2G4CA 3M4QA 4H2UA 2VXEA 4YRNA 2DKGA 4M7DB 3A32A 3RL6A 3QSUA 4M7AF 2ALYB 2CIMA 1B7YA 1USYC 4TVAA 5GAOl 1HXDA 1Y96A 4X9CA 3JB9H 3RF1A 4C92F 3JCMX 2I4MA 5KNNA 3RUXA 4P3PA 2DVEA 2AMCA 1KOGA 3JCMe 4XTXA 2P5IA 2ZXFA 4CH5A 3QUIA 2Q5IA 3OD1A 3LSSA 4C8QF 1NJ8A 4OP0A 5GAMd 3VBBA 4PJOG 4M75E 2ZCEA 4MMLA 3V7RA 2DXTA 4M78A 4C8QB 3HXXA 4PNOA 4TVYA 1M5Q1 1YGBA 3V8KA 4HVCA 3IKMB 4EMGA 4M7DF 4O2DA 2YHTA 4WI1A 4XEOA 4UP7A 5LJ5h 5GMKl 4Q6GA 3VQXA 3E9HA 1I4K1 2RA2A 4P3OA 3JCMc 4CS4A 4F7UB 4H2TA 3SWNB 1EQRA 2RHQA 1U1SA 1E24A 3M4GA 4PJOC 5GANh 3VU3C 3PGGA 1EVKA 4C92E 4CH4A 2ZIMA 3IALA 2DXUA 4DQ2A 5GMKm 3QO3A 3HFZB 4YRFA 5LJ5j 2QHUA 3JCMf 3QO7A 2JN0A 4LNSA 3VQYA 3VQVA 5I21A 5LJ5g 1EIYB 4A54A 2I2LA 5CAIA 4C8QA 1L0WA 5C51B 2I4LA 3QO5A 4M77F 4Q15A 4M78E 4RDXA 2E1HA 4M7AB 1YCYA 4M75A 5LJ5f 1ATIA 2ZZGA 2ZZFA 3RKYA 5GMKe 1H4TA 2VC8A 1G51A 1ASZA 1X54A 5GMKi 1FYFA 3UGQA 5GANf 1J5WA 3BJUA 5DY9A 3REXA 2QHTA 4XTUA 1QF6A 2RB6A 2ODRC 2E65A 4ZTZB 2CJ9A 2ZT6A 3P8VA 3L1AA 1M8VA 4MMKA 3JCMh 4M7AC 2ZR3A 3DSQA 2DJZA 1NNHA 4L87A 4YROA 3INZA 4G85A 2RHQB 2DTOA 4K86A 4YRPA 4M7AD 3IKLA 1LJOA 4YRQA 2E41A 3A5YA 1SRYA 4YREA 2ODRD 2ZNIA 4XTYA 3SB2A 1KQ1A 3JB9D 5LJ5e 3ICAA 4OLFA 3RERA 4JRKA 3AHUA 2Q7EA 4PJOE 2ZT8A 2XGTA 4H2XA 5GANg 2ZGWA 3ERRA 3PCOA 3BY7A 2I4NA 5ELOA 2XTIA 5GANe 3V7CA 3A7UA 3BFMA 3QO8A 2C7IA 3HY0A 3HRKA 2DU5A 1NJ2A 1PYSA 5GAN8 4H2SA 1G5HA 3V8LA 4M78F 1WU7A 3HSBA 4HWPA 3HY1A 2EAYA 2IY5B 5LJ5d 1YB3A 2CGHA 1WQ7A 3SWNA 5C52B 4HA8A 4EMKA 1YFTA 1HK9A 1WLEA 3NENA 1H641 3NELA 3A31A 3JCMd 4F7UA 1ADYA 4PJOD 3RGLA 2ARUA 4NL3A 5GAOq 3UH0A 2DEQA 4M75F 3JCMb 2Y90A 1B34A 4M7AA 2RHSB 2QTXA 5ELNA 4P74A 4E51A 3A74A 4NL2A 1B8AA 2ZZEA 4NCXA 1ASYA 3LSQA 4XEMA 1EFWA 1X55A 4EX5A 2EJFA 4XU2A 1X2GA 2QHSA 3G1ZA 1TH7A 2DTHA 2AKWA 1ADJA 3SWNC 1C0AA 2YLBA 1NJ1A 1H4SA 4YDQA 4M7DG 1X56A 1Z7NA 1B76A 2IY5A 3L4GB 4KR2A 4ZIBA 1SESA 1N9RA 3I7FA 4N0AA 2CJBA 4P74C 1E22A 1GGMA 1YFSA 4UPAA 4M7DE 2RM4A 12ASA 4BWAA 2PMEA 5GAOn 3E9IA 3QTCA 5HGQA 4RQEA 4YRSA 3A7RA 1QE0A 3A5ZA 4YPFA 4KQEA 4G84A 1I8FA 2Q7GA 4TWAA 1SERA 5K1PA 4YRGA 4YRMA 4M78B 1B70A 4F7UE 5GANd 5GAMe 4EMKC 4J6YA 1Z7MA 4EMHA 3FIFA 4C92B 1LYLA 4H2WA 4M77G 3PZCA 4WJ3M 1JBMA 2ZR2A 4HWRA 1B34B 1H4VB 4J6WA 2E10A 4C8QC 4HT9A 3TEHA 4XTVA 1JRIA 3QHSA 1W66A 4J15A 1RIQA 1LNXA 1PYSB 4H2XB 4JRIA 5GAN7 4RQFA 1USYA 4M78C 4XQ3A 1YFRA 2Q5HA 3LC0A 3CMQA 3HFZA 4M77B 3JCMg 3PCOB 4PJOA 4TTVA 1X2HA 4M7AG 1EIYA 3JCMW 2DDZA 4V2SA 1B70B 2HNIA 5GANj 3UGTA 2J3LA 4F7UF 4CS2A 1I5LA 1D3BB 4C92C 3WQZA 2RHSA 4ZTUB 3GIBA 2Q7HA 3P8YA 3TUPA 4TVAB 3MF1A 3BW1A 3KFUA 2FB7A 3HTZA 3JB9J 2DZ9A 4YYEA 3V8JA 4A53A 3EFSA 4M77D 1KQ2A 4YRKA 4CH3A 4C92A 4JUVA 3HXVA 1WQWA 3HXUA 4P72C 4EMKB 1NJ5A 2J3MA 5LJ3e 4PJOF 1JJCA 2ALYA 4Y91A 3M4PA 4YRLA 2AKWB 3QNEA 1U1TA 1Y96B 2ZINA 4P71C 4AH6A 3JB9F 3HFOA 4M75G 3L4GA 4QVDA 4M77E 3R07A 1MGQA 4M77A 1BBWA 4C8QE 4F7UG 4H02A 2DQ0A 2ZNJA 1SETA 4H2YA 4X5OA 4RCBA 1I81A 3MF2A 3HFVA 2EL9A 4HWTA 3TEGA 4YRRA 5C53B 3FJPA 1HTTA
chains in the Genus database with same CATH superfamily
1E1TA 2K9GA 3FJ5A 1TSFA 4IUUA 3VS1A 2XG8D 2JNGA 1EZZB 2EYYA 5LJ3j 1BCMA 4J9EA 3UA7A 2MWOA 1NJ6A 2DBKA 4WF2A 1VQZA 4FYWB 2WSCE 1N8RU 2C8MA 2D0QB 4TQFA 1WIEA 2ZT7A 4BDYA 3LX7A 4N0AC 4LDYA 4C5IA 1JJ2S 2FZGB 3NEMA 5J26A 2KRSA 2SRCA 4ANJA 1YHQQ 1NYRA 2HD0A 1OOTA 4YRTA 5FU6C 2GTJA 5LJ3h 1Q86C 2R58A 1OZ2A 1QW1A 2JW4A 5HCKA 2QYZA 2E5QA 4HWSA 5GMKj 3HFNA 4YRCA 2KT8A 1HD3A 4J9HA 2LT1A 3FC3A 1FMVA 2F2WA 1W70A 1GCPA 4M78G 1LOJA 5GAN6 5CK9A 1WHGA 2P4RA 1YIJQ 4J6XA 2P0QA 1OZ3A 3UA6A 3LWIA 2E12A 3G7ZA 2OX7A 4PJLA 4P73A 5F5WA 3X28B 1KMMA 2KGTA 4OMLA 4AFSC 2RJDA 1ZLMA 5IXFA 1TUDA 2VGMA 3BDUA 2G3RA 2LC4A 3QYHB 1YI2A 1GCQC 3M9QA 1UJYA 1KG1A 3OB9A 5GAMh 4RKUE 4ZGDB 4H2VA 3HL8A 2NUTA 2C06A 2QQSA 2ZIOA 5GAMg 3H9NA 2DPPB 3TVTA 2NUPB 11ASA 1M9SA 2LJ1A 1IREB 1M3AA 3S3NA 2DQ3A 4C8QD 2D1XA 3CXCA 1N9WA 4PHCA 3M55A 1VQ9T 3QZ5B 2XK0A 4C92G 5GAN3 4PG3A 4KR3A 2DL5A 5K1XA 3RKWA 1JB0E 1UGPB 4II1A 2G4CA 3CCJQ 1PRLC 2VXEA 3PMIA 2K3XA 2PVOB 2X3WD 4RTXA 1QWEA 4M7AF 2ALYB 2CIMA 4X1VA 1GBQA 1HXDA 4X9CA 4N4HA 2IG0A 3CD6A 5KNNA 3I56Q 2FPEA 5CIUA 1ABOA 2RJEA 1WHJA 1Y07A 2P5IA 2ZXFA 3QUIA 4C8QF 3GP8A 3VBBA 4PJOG 1ACMB 2X4XA 2XDPA 1VQKQ 2DXTA 4C8QB 2OTJQ 4TVYA 3V8KA 2K79A 3CCLQ 3MKDA 5I22A 3IKMB 4EMGA 2EBPA 2KY9A 4IUTA 1BU1A 4AMCA 4O2DA 1ZA2B 4QQDA 3VQXA 4P3OA 2L3SA 3PIOA 1Q81C 3A8MB 2MF2A 3NTHA 1OPLA 4H2TA 2K3BA 1VQ4T 3SWNB 4NS5A 3RBBB 1WDXA 3VU3C 2DX1A 4KRTA 3CCJT 3QYGB 4YRFA 2L3PA 1I5OB 3QO7A 2JN0A 3CBOA 1MV0B 3VQVA 4PJNA 4C8QA 3CPWP 1X6GA 3HKSA 1UHFA 3C0CA 2HCKA 1YCYA 3H0HA 4M75A 5LJ5f 1RAGB 2VC8A 5HK3A 2HQEA 5FU7B 3WVEB 5GMKi 4FM4B 3UGQA 5DY9A 1FXXA 2QHTA 1M90U 1QKWA 3FLGA 3SHWA 2OI3A 4KUIA 1GFCA 2RB6A 2ODRC 4JPBW 3M0RA 2K7AA 2CJ9A 3P8VA 1OU8A 4D8KA 3P8HA 3CCSQ 2ZR3A 4A63B 1CKBA 1ZQ1A 2DJZA 3QJYA 3EG9A 2BUDA 2QA4T 4K86A 4M7AD 7AT1B 3LH0A 1D0XA 4PK4A 3LGFA 1BB9A 2E41A 1RAHB 3OYLA 2ZNIA 2O2OA 2KR3A 3SB2A 2ZCFB 3ICAA 4JRKA 3RR6A 2QQAA 4PJOE 1HSQA 2LP5A 4DBFA 2KRMA 1QVPA 3FRNA 4H2XA 1IHVA 4HCKA 1VQLT 3PCOA 2XTIA 2KE9A 1YITT 1UUEA 1H3HA 5GANe 2MYSA 3V7CA 3BFMA 3QO8A 2EQJA 1I0CA 2X51A 3MEAA 4O5VA 3M0SA 5FLXE 2OTLQ 4M78F 3QXEB 4LDWA 2HKQB 4MZTA 2QTVA 4FW2A 3L2RA 2EAYA 1WQ7A 1IGQA 2DEUA 1HK9A 2PZ1A 2Y4XA 1H641 2G6FX 4LDUA 3NELA 5DLQE 2E6NA 4F7UA 3VS7A 1KQSP 2KYBA 3RGLA 1PNJA 2ARUA 1K8AU 1UTIA 2DEQA 1W2BA 3CC2T 4M7AA 4B6MA 2K5LA 2BE7D 2ENMA 4MZPA 2L2PA 5IN1A 4FW1A 2BIVA 2ZZEA 3LSQA 4HCBA 1YI2T 1VIEA 1WZOA 1JXMA 1PSEA 2HSEB 2RI2A 2EJFA 1WHMA 3I5RA 2DTHA 4JJNK 3OBWA 2YLBA 3J81E 3GNFB 3FDRA 2COWA 2JT4A 2YSQA 1Z7NA 1C6VX 4KR2A 1SESA 3E9FA 2L0AA 2HQXA 1GGMA 4UPAA 4K11A 2FG0A 2RM4A 2M51A 4M7DE 2WACA 5GAOn 2PTKA 1YJNQ 5ECAA 4RQEA 1K73C 3A7RA 2AKKA 3OYEA 3A5ZA 1Y7XA 1UECA 4KQEA 5C6SA 5I2SA 2B86A 1SERA 3HP9A 4LUEA 3CMAA 4PLIA 1MUZA 2AT1B 5FWBA 1MMNA 4M78B 3OY9A 2VVKA 3HRUA 1H92A 4LVMA 4EMKC 4OGEA 1YWOA 4XAXB 4AG1C 3CXCP 3URGA 3OYMA 4H2WA 3I55T 4HWRA 1B34B 3EG2A 4J6WA 2E10A 2YUNA 4P5NA 1Q95G 3TEHA 1W1FA 4XTVA 1M4ZA 3QHSA 1W66A 4J15A 1CKAA 2MIOA 1PYSB 4JRIA 1TG0A 1X43A 4RG8A 4J83A 3CCVA 1NLPC 1KK7A 1PRMC 4JLGA 3HRTA 3HTRA 3SFMA 4M77B 3JCMg 2KNBB 1WJQA 1X2HA 4M7AG 2FL7A 1EIYA 1AEYA 2HNIA 3UGTA 1I5LA 3QWXX 2LTOA 1NLOC 5LL6S 2XU8A 4ZTUB 2FO0A 1QQJA 2Q7HA 4LVIA 3P8YA 4XK8E 2ZPFB 3MF1A 1Q82R 1VQPQ 4FSSA 5IHIA 1LVKA 3JB9J 3CCJA 3CMAQ 3EG3A 1VQOA 2WSEE 3NTKA 3V8JA 2RPNA 4RG2A 4E7JA 4CH3A 4BY6C 1BK2A 1AWWA 1KC8R 2MOXA 2EVRA 2LQNA 3ASKA 1ZSZB 2BZYA 1Y96B 2CP3A 2D6FA 4AH6A 1K9AA 2CP7A 1N6AA 1YI2Q 3L4GA 2DLPA 3E19A 2GTOA 1MGQA 1K76A 3I5SA 4F7UG 2V8IA 4E47A 1BCOA 2DK3A 3CD6T 1I81A 1QVFS 5CKFA 1Y71A 2EL9A 2MI6A 1VIFA 4HWTA 3TEGA 1VQMA 1W6XA 1T3SA 3EH1A 1VQ6A 1HTTA 3SEMA 1GBRA 2OJ2A 2CDTA 2PMFA 1OU9A 2QHVA 4HCCA 1VQ7A 1QKXA 4ORZA 4HWOA 2H8HA 4PJMA 4YCWA 1HC7A 3JCMJ 2E3CA 1GFDA 1JJ2P 2EJGA 3FB9A 1M2OA 4QQ6A 4MZMA 2EIFA 2D0NA 3HXYA 2V1RA 1Z9ZA 3BDLA 4BI3A 1C0MA 4BI8B 2XICA 5CQXA 2AMCB 2CJAA 4VUBA 3N5BB 2NUPA 3ZFJA 3JCMP 4MDWA 4ZTFA 3CC7A 5KH6A 3HHTB 2VASA 2VWFA 1JJ2A 4KH1B 3P8BB 2VXFA 4OB1B 4E7IA 1VQ9A 4TVWA 5GAMf 4M75C 3RMQA 4FU6A 4HT4A 5LJ3g 5J3BA 2PUOB 4A4KA 2XI9A 2MAMA 2A36A 2RD1A 4PFOA 2E64A 2H3JA 4M7DD 3G71Q 1WNLA 1K4US 4M7DC 1QVFA 1M27C 4Y92A 4JLIA 4E6RA 3VJPA 1KHCA 1VQOQ 3L2QA 1D09B 2RQRA 3CPFA 1T3LA 5HK0A 1OX9A 2CZ1B 1QWFA 3HXWA 2H3EB 3VQWA 3VS6A 1NZ9A 2LZ6B 3RIRA 2BKDN 4P75A 2FZKB 1UGRB 4YP0A 1O75A 2GCXA 2FPFA 4DEYA 1DJ7B 2QA4A 2GQIA 3OW2P 4M7DA 2RMOA 1VQKA 3QDRB 4P73C 2DFUA 3OYKA 4RMFA 3MHXA 4JJDA 2YUPA 1BIBA 2V26A 4M77C 2ZPBB 2O4XA 3CMAT 2A0FB 2D8JA 4K88A 2VUBA 4XTZA 5GAN4 2O9VA 1YJ9A 3LLRA 1G5IA 1JQQA 4PJOB 4LVLA 2FEIA 5KYXB 2YLCA 1QP3A 4QVZA 1MV3A 3CEYA 2RQTA 1LCKA 1I07A 3M56A 1EX4A 2EYXA 2WSFE 2OTLT 3TSZA 3VV0A 2GFAA 2DKGA 4M7DB 3A32A 1VQ6T 3OS5A 4J8OA 1USYC 4TVAA 3CCMA 3AT1B 2YRVA 3RF1A 2F5TX 2I4MA 4C0FA 2ZPGB 2KAFA 2CYZB 2AKLA 3H0IA 2LT4A 2YUOA 4R0KA 4P3PA 2KBTA 3L2VA 4CC3A 1WGSA 4XTXA 3OS1A 3OD1A 4CH5A 3M57A 2BZ8A 2RJCA 3LSSA 1NJ8A 5GAMd 1NPRA 3EGXB 1X69A 4DA4A 3SD4A 1M1FA 2EPDA 1P92A 3OYCA 1E6HA 2V1QA 2YHTA 4WI1A 5GMKl 1W2BP 1SKUB 1I4K1 2CS7A 1BI1A 4MDXA 5KYUA 5IH2A 2HL3A 2DA9A 3CC7T 1RLPC 5GJVB 4PJOC 4OMFB 2W10A 1YITQ 1EVKA 4C92E 2EQIA 4RTZA 1GXIE 4O6JA 2P84A 4DQ2A 5HKCA 4AT1B 1PG5B 3QO3A 2K5FA 3QWYA 1KC8U 3HFZB 2COZA 4WCIA 2XKOC 2DIGA 4ZTJA 4LNSA 1QP2A 5I21A 2AZVA 3E1SA 5CAIA 1L0WA 5C51B 3R6OA 2I4LA 4M78E 2E1HA 4LXCA 3CCUQ 4J9CA 3EAEA 5FRMA 3A8LB 3M5AA 2J7IA 2ZZGA 5KYYA 2PVGB 2QI2A 5GJWB 3RKYA 3I56A 1WJRA 3CD6Q 2OAUA 1BYMA 4PLLA 2ZZDA 3DLMA 1FYFA 1OPKA 2JMAA 1KIKA 3BJUA 9ATCB 4BDZA 4XTUA 1E7OA 1R0BG 3GPLA 4ZTZB 3I55Q 1M8VA 3JCMh 1UGQB 4L87A 3DB3A 1ZX6A 4G85A 4YROA 2O4XB 5IHKA 2EYZA 2DTOA 4C0DB 1PKTA 3OYIA 2JM8A 2XD0A 4EDUA 4YRQA 3MEUA 1PWTA 4F17A 2ODRD 2M16A 1YBYA 2CT4A 3UT1A 1YHQA 2KI7A 1KQSS 1KQ1A 2RQWA 5LJ5e 2YRCA 5L23A 1WHHA 4OLFA 4BD3A 2RI3A 3VRYA 2Q7EA 2LCCA 2E70A 2ZT8A 2XGTA 2ZGWA 8AT1B 1G83A 3CPWA 3A7UA 3CMEQ 2C7IA 2D8HA 2DU5A 3CCMT 1NJ2A 4H2SA 1X75C 3MJXA 4LE9A 4E7SA 2HAXA 4J9FA 3V8LA 1FYNA 5M9OA 3HSBA 4BI4A 4CC4B 2EGEA 3MEWA 1IRXA 5LJ5d 1YB3A 1IZ6A 3SWNA 2LX7A 1PC0A 3EGXA 4J9DA 4EMKA 3X20B 1NJIR 2IVWA 1M3BA 2DF6A 3JCMd 1PD0A 3I55A 4PJOD 4NL3A 4B9WA 4IUPA 3ZBDA 1IO6A 5FU6B 2JXBA 3JCMb 1B34A 4RTVA 4P74A 5EC7A 3M0UA 4KGZB 3G1JA 2HQHA 4HKEA 3EGDA 3QJ6A 1EFWA 2DE0X 4EX5A 1WYXA 2AHJB 1X2GA 2EKHA 3G1ZA 1B7TA 2A8EA 3M0TA 1NE8A 1C0AA 2CP5A 1NJ1A 2R5MA 4M7DG 1B3QA 5D6XA 3REBB 2VYTA 1X56A 2RO0A 1B76A 3MP6A 4ZIBA 1N9RA 1VQLA 4P74C 2DL7A 12ASA 2PMEA 3CCUA 3QTCA 4M4ZA 4YRSA 2X4YA 4ATOA 1QE0A 2KT1A 4J9IA 4IURA 3CCET 4B9XA 1J3TA 1WLPB 4YRMA 3OQ5A 4BACA 5A0LA 4J7FA 3X25B 1Z7MA 1X6BA 5FU7C 5AT1B 1K9MC 1LYLA 1UJ0A 2PUKB 4M77G 3PNWC 2QXFA 2NUZA 1JBMA 3M0QA 3VKIA 1TXQA 4OMOA 2ZR2A 2KSSA 3MP8A 2F5KA 3NTIA 2F1LA 4C8QC 2NUTB 2QDYB 2BTTA 3CBMA 2EQUA 2PVDB 2X9HA 3OYBA 4H2XB 3PVLA 1Q81U 4RQFA 1PM3A 1KHIA 1D0ZA 2RQUA 1YWPA 1WHLA 1YFRA 3LC0A 2E3HA 1PKSA 3PCOB 4JS4A 2EKOA 3JCMW 4LN2A 3CCMQ 2OTJT 3M54A 2ROLA 5GANj 4ME7A 1ZA1B 4F7UF 3CCVQ 4CS2A 1O9SA 3VS2A 2KDSA 4JRQA 1VOMA 2A08A 1OEBA 2K3YA 4UC4A 1VQ8Q 1M1KU 2DZ9A 5CKHA 1NG2A 4YRKA 1YFNA 4JUVA 1KD1R 3HXVA 4EMKB 2XMFA 2M0OA 2ALYA 5DLOA 1M2VB 3LW5E 2ZINA 3M53A 4P71C 1XQHA 4PL6A 2OTLA 3JB9F 5J39A 4QVDA 2RH2A 3C95A 3NHNA 4M77E 3R07A 1RABB 3DLLA 3CC7Q 3EGDB 2QGFB 1AOJA 4DBQA 3GOXA 1SETA 1MMDA 3A5ZB 3MF2A 1G3SA 3HFVA 3GLXA 4YRRA 2JJ9A 4LD9K 1H3ZA 1E1OA 4XU1A 4OVAA 2LQWA 1VQNQ 3RACA 2HKNA 1M1KR 2JOYA 4X9DA 3A8HB 5E3IA 1EOVA 3RESA 1ZHIA 1WXUA 2FRWA 1Q86R 1FX7A 1U8RA 1KD1U 5LJ3f 1MNDA 1X01A 4OB0B 3S3OA 1WPYA 2AZSA 4AFUC 4C5GA 5CKDA 2JUFA 2KXDA 2E5AA 4N4IA 1MMGA 2CUBA 5CKBA 2O9SA 1NM7A 1WYDA 3NGPA 2LDMA 1QMCA 4XTWA 4P72A 1IHWA 2YT6A 4XU0A 3L42A 1KMNA 2K57A 2QASA 4UP8A 2ARSA 4YCVA 4HVVA 2FHDA 4PJJA 4L6V5 2QEXA 3QZ9B 1B7YB 5A0GA 4EO4A 1VQ4A 1K8AC 3EHQA 3JB9I 2XHCA 2RHYA 4A4GA 1K73U 4J5YA 3VS5A 3CMET 1IL2A 4KBMB 3TREA 3W3SA 1PCXA 3CCRA 4QVCA 1KD1C 1BIAA 3QKJA 4YRJA 4OF1A 2CKKA 5GAOr 4IIMA 3A1PA 3I56T 4M7AE 5KYWB 4CH6A 1UB4A 1EFNA 1M8MA 1YN8A 8ATCB 2VKNA 3PE0A 5CO7A 4C5HA 3VS3A 1YJNT 1VQ6Q 3UFGA 1QVFP 4XU3A 3M58A 3WXMB 1T0HA 2PNIA 1QCOA 1FMWA 4CC7A 2GF7A 2RN8A 1BBZA 3IG2A 2V8JA 5GAOp 2X3XD 2ZTGA 4YRIA 2HZYA 2ARTA 1S72T 3A7AA 4JRPA 3KUFA 3H6ZA 3JCMV 1OQKA 2NWMA 1YJWT 2R5AA 4P75C 2GFUA 3VS4A 4Y28E 3KBGA 5CKEA 3EFOA 3THKA 1EIFA 1CSKA 3OYDA 3JCMQ 4C0DC 5KE3A 5DM7R 3TU4K 1RI9A 2EJ9A 1JEGA 1A0NB 2I4OA 2EGAA 2JS0A 3QIIA 3WVDB 4LUDA 4FYXB 2RF0A 3A98A 4C8QG 1VQPT 1QVGP 3JB9G 1TUCA 2BE9B 4DPGA 5LJ3d 4NOYA 2LX9A 3REUA 2IPOB 5GAN5 3NETA 2P0PA 1VQNA 3T9NA 2J6OA 2CREA 2CSQA 5EG2A 3J7AF 2FPDA 3OSSC 3GBQA 2HBWA 1VQMQ 2YRDA 1YIJT 3M4QA 4H2UA 1KFZA 3QSUA 3F70A 4C92F 2EYWA 3VYGA 4BE0A 3L2WA 2AMCA 3JCMe 2J6KA 3JV3A 4BE2A 2OTJA 4OP0A 3G71T 1NBEB 4M75E 2DL8A 5HY6A 1OV3A 2E5KA 2HEQA 2ZCEA 4R55A 3V7RA 1TWBA 4M78A 3D7SB 4PNOA 1YGBA 2M9UA 4A4HA 1UGSB 2K4YA 4FL6A 2FRYA 3G6ET 4XEOA 4UP7A 2ECZA 5LJ5h 2ZPIB 1RAAB 1K9MU 2RA2A 2O88A 4AG2C 2Y4YA 2XDDA 1EQRA 2LVMA 1E24A 3PGGA 1K0XA 4FSXA 4LD6A 2DILA 2DM1A 3QG1A 2ZIMA 4CH4A 1TOVA 2DXUA 3JRZA 2MCNA 3G4SA 5GMKm 3RNJA 3PIPA 2QHUA 5AYFA 2QGGA 1X27A 3VQYA 5LJ5g 1EIYB 2I2LA 2VB6A 4IUQA 1QVGA 1S72Q 3QO5A 3KFVA 4PKCC 4Q15A 4RDXA 1AVZC 1M30A 1SHFA 3J80E 1ATIA 1WI7A 2X4WA 5GMKe 1H8KA 1VQLQ 4IUVA 1X54A 4GBQA 2MPXC 4PFZA 1NPPA 2EFIA 1SRLA 5GANf 2KXCA 1J5WA 1SG5A 2K6DA 3L2UA 3MQZA 4DBHA 3H8ZA 1QF6A 4JZ3A 5D7UA 3CCQA 1VQ5A 3L1AA 4MMKA 5FWCA 4M7AC 3M59A 3TSWA 1W2BS 2RHQB 2LJ3A 2CT3A 4E2FB 2MMPA 1ARKA 1VQ9Q 2LNVA 1KQSA 1RAFB 4F14A 2L3RA 4WTOB 1VQKT 4E7ZA 3A5YA 3QPHA 4XTYA 2CZ7B 1SHGA 4Z88A 5A0DA 1RUWA 2M02A 2YUQA 1G2BA 1N27A 3FEOA 5GANg 3ERRA 5ELOA 1Q7YR 3OSVA 2MK5A 2DYBA 4ZNXA 4JZ4A 3HY0A 3HRKA 4OB2B 5GAN8 2VV5A 4KGVB 1G5HA 3M0PA 2KRNA 1RACB 4D8DA 3CCEA 1WU7A 3X26B 2RNAA 1ZUYA 2K2VA 3BE3A 3CCST 2CGHA 3UF4A 4HA8A 2AK5A 3G71A 4ZN1A 3JSCA 3NENA 2E3IA 4HXJA 2FVUA 1BI0A 4E7KA 4OMPA 3UH0A 2L8DA 1QLYA 2RHSB 2QTXA 1AWOA 5ELNA 3IQLA 4E51A 3PTAA 2QDLA 2DNUA 2JM9A 4BY6B 4NCXA 2NLUA 2ABLA 2GBQA 1AD5A 4BUGA 4XEMA 3LGLA 4XU2A 4CRIA 2QEXQ 1PSFA 4F16A 3CC2Q 1RADB 1VQMT 1ZUKA 2AKWA 3MO8A 3SWNC 1Q7YU 1QCNA 1H4SA 1JO8A 1WXTA 2JZ2A 2HMAA 2RK2A 3EHRA 1GL5A 2X35A 2A37A 4JJCA 4N0AA 2CJBA 2QG9B 2LCLA 3QDFA 4RTWA 3E9IA 1JU5C 5HGQA 1UEBA 1XOVA 2LNHB 4RTTA 3G4SQ 4G84A 4QT7A 2A3LA 4TWAA 2ROTA 1ABQA 3X24B 2C0TA 4QW2A 1B70A 3I9QA 1UHCA 2JVVA 1D0YA 2DAQA 3CCQQ 1VQ5Q 2EW3A 1XNIA 1KSWA 3S6WA 1HYOA 4WJ3M 4LDVA 2KROA 3QBYA 4A4EA 1QCFA 1H4VB 1T0JA 2SEMA 4QQGA 3EH2A 3OYHA 2DMOA 1JRIA 1LNXA 1M1GA 4FT2A 1ZBJA 5IT9E 4F04B 1WHKA 3OYNA 4M78C 4XQ3A 1YJNA 2Q5HA 1C1AA 1AT1B 4LVJA 4PJOA 2DD4A 1ZSZC 4TTVA 3CCLT 2QQRA 2DXBA 4JS5A 1B70B 4C5EA 1YNZA 4HVWA 3OS0A 2J3LA 3CXCS 1D3BB 1WA7A 3EG0A 2EQMA 5KE2A 4C92C 3WQZA 4FCYA 2LMJA 2NYSA 1YITA 1R0CB 5KCOA 3DKMA 2XIDA 4TVAB 3RDVA 3KFUA 1OI1A 3EG9B 5KYXA 2FB7A 3HTZA 1UE9A 1NJIU 3OYAA 1D1BA 4C92A 4P72C 5IXBA 4L59A 4EIKA 1NJ5A 2B8AA 5KYNA 5LJ3e 1N8RC 1JJCA 1IGUA 4YRLA 4Y91A 2E4HA 3OYGA 1U1TA 2RI5A 3LWHA 4J9BA 2QEXT 2J6FA 1TUGB 4GY5A 2JTFA 1MMAA 1OYXA 1U3OA 3CMEA 2Z0WA 4ZGEB 5C0MA 1VQ4Q 1BBWA 2O01E 1TTHB 2CZ6B 4H02A 2DXCA 2EGCA 2DQ0A 4H2YA 4X5OA 1V1CA 3ZEHA 1Q7YC 1K0SA 2F69A 3Q1JA 2LQKA 3FJPA 2DVJA 5KYWA 2P0LA 1Q82U 3L2ZA 1PD1A 5KYUB 1WX6A 1U5SA 4RTYA 4Q5WA 1BBUA 3ZL7C 4BE1A 4FIBA 3MEYA 3DB4A 3OMCA 1OX8A 2EYQA 2FYKA 3MEVA 1YP5A 5FRNA 5KYYB 4L5GA 1D1AA 4YCUA 2C0IA 3HXZA 2AIRB 4K87A 2DTIA 3OYFA 1YJWA 2RQVA 1G5VA 3EGUA 1H4QA 2M1HA 1SEMA 4M75D 1Z9QA 3A8GB 3EFRA 3TEEA 2RK1A 3R6NA 1VQ8T 1Q81R 4P3NA 2L3QA 3HRIA 5GAN2 2RHIA 1SSHA 1NYFA 5GAOm 1AZGB 4CS3A 1EVLA 3M4YA 2P0KA 3V7SA 2DU7A 6AT1B 1G8XA 1VQ7Q 2HBPA 3GNGA 5GAMj 3CQTA 4RCCA 4WJ4A 3UPUA 1QVGS 2L89A 1M90R 4N4GA 1D3BA 1NYQA 1TS9A 1AZEA 4UP9A 2M0YA 3SDZA 1E6GA 4TQDA 3G6EQ 2ZT5A 2EWNA 2OAWA 4P71A 3E2UA 3I35A 1X2KA 1VQOT 2HDAA 1M2VA 4DOWA 2DZCA 4BW9A 2CUDA 1UGVA 2JMCA 2CP2A 4M75B 3TEHB 1TU0B 3MPUB 4ELZC 1JJCB 2FZCB 4M78D 5CQYA 1N9SA 4GLKA 3RKXA 4HT8A 4FYYB 3UATA 2JTMA 1FMKA 3VS0A 4DBRA 3CCUT 3GF5A 3P8TA 2V8KA 2DRKA 3CCRT 1XJWB 4C92D 2CSIA 4PFPA 2EQKA 5GMKh 2CZ0B 4Z8AA 2IIMA 1V76A 4YRNA 4HCZA 3RL6A 4A4FA 4JJBA 4TVRA 1VA7A 1ZSZA 3TCJA 1B7YA 2YXYA 5GAOl 1M1KC 5IHNA 1Y96A 3JB9H 1G3WA 3JAME 1W4SA 3JCMX 4D6WA 3RUXA 2DVEA 3KXTA 1VQ7T 1KOGA 4CC2A 4EPCA 2Q5IA 1N8RR 1K1ZA 2CH4A 5CVIA 2JS2A 2KEAA 1Y0MA 4MMLA 4DOVA 3HXXA 2ESWA 2KK4A 4RUGA 1BI3A 1M5Q1 4HVCA 3CCQT 1VQ5T 2ZPHB 4M7DF 4LDXA 4Q6GA 2ED0A 1X2QA 3E9HA 2DJQA 3JCMc 1VQ8A 4OB3B 4CS4A 2RHXA 4F7UB 1VQPA 3RMSA 4AFZC 4HVUA 1U1SA 2RHQA 3M4GA 1IXDA 3EG1A 5GANh 3LH5A 2PQWA 2ZPEB 3IALA 2LQ8A 1G3TA 5LJ5j 2DL4A 3JCMf 4C0GA 2PU9B 3PFSA 2DO3A 1RAEB 4Z02A 4A54A 2R57A 2QQ9A 1YCSB 2GNCA 2ED1A 2YDLA 2QAZA 5IAYA 1R8OB 4M77F 4ZN3A 1K73R 1BKBA 5A2QE 2ATCB 4M7AB 4ESRA 4KUDK 3OW2A 1KJWA 2GQVA 3CPWS 3EFOB 3NPFA 2ZZFA 1H4TA 2J05A 1B07A 1G51A 1ASZA 5D6WA 1UDLA 2DBMA 3TQ7P 2XDBA 3CC4T 5FW9A 4R56A 4J9GA 4KULA 3REXA 1WFWA 4J7IA 1X6OA 1MNEA 5CR2A 3ME9A 2E65A 4OMMA 2ZT6A 4YTLA 3G6EA 1M3CA 3DSQA 1NNHA 3INZA 2ZAEA 1XTDA 1Q86U 1RI0A 1UG1A 4OMQA 4YRPA 3CCRQ 3IKLA 4RMOA 1LJOA 1U06A 1NJIC 1SRYA 4YREA 2JTEA 3CCEQ 1YJ9T 4E7LA 4GLMA 3G4ST 4ELYC 1M90C 4CI0C 2K5IA 2KVQG 1GRIA 3O8VA 3JB9D 1SPKA 5D6YA 3RERA 1UFFA 2DIQA 3AHUA 3OA6A 2W0ZA 2RHZA 1NYGA 2KYMA 3BY7A 4IKFA 5I11A 2I4NA 3H41A 1F1BB 3REAB 1AHJB 1RLQC 2DERA 3O5ZA 1Q82C 1PYSA 5L8RE 4LNPA 1JXOA 2A28A 1VUBA 3U23A 3OYJA 4HWPA 1YIJA 3HY1A 2F2XA 3OBYA 2DYIA 2IY5B 1KC8C 3OMGA 5C52B 1YFTA 1WLEA 3A31A 1ADYA 2CP0A 3MP1A 5GAOq 4M75F 1VYVA 2Y90A 4Z89A 1VYTA 3MCAB 5KCHA 3A8OB 3A74A 2L5QA 4NL2A 1B8AA 3NFCA 3VYHB 1ASYA 2QQBA 3CCVT 1X55A 4FT4A 3OW2S 1SSFA 2QHSA 3VRZA 3ULRB 1TH7A 5CCAA 1RL2A 1ADJA 2E6ZA 2HSPA 3C94A 3P8DA 3CCLA 4YDQA 1NEBA 1SF9A 1S72A 3S3MA 1G3YA 2IY5A 3L4GB 3UWNA 2A7YA 3I7FA 1D1CA 1AWJA 3PT9A 1E22A 1YFSA 4BWAA 1RAIB 1BI2A 2CP6A 1SRMA 4IIOA 1OULA 3H0FA 2C0OA 2GGRA 3UDCA 4YPFA 3VUZA 4OMNA 1I8FA 1GCQA 2DD5A 1R77A 2Q7GA 2YWWA 5K1PA 4YRGA 5FROA 2I0NA 1N5ZA 4LVKA 4F7UE 5GANd 3E9GA 3CCSA 5GAMe 4J6YA 4EMHA 3HRSA 3FIFA 1FWZA 2BZXA 2CH4W 4C92B 2KQWA 3CC4A 4FYVB 5I2MA 3CBPA 3PZCA 3NMZC 1MHNA 1PHTA 1ZSGA 2QK0A 4HT9A 2K2MA 1Y57A 4ZGJB 3HPWA 2RJFA 1ZBXA 1YJ9Q 4OGCA 1RIQA 4DEXA 4QKUA 5GAN7 2P4TA 3PVQA 2LJ0A 1USYA 4AFQC 3CMQA 3HFZA 3OYYA 1V29B 2DETA 4C0ZA 1WXBA 1YHQT 2COYA 2DDZA 4V2SA 2MWPA 2DL3A 2QA4Q 2DRMA 4E7HA 4KGXB 2RHSA 3GIBA 4RTUA 2KMTA 1K9MR 1LPLA 3TUPA 4BB7A 3BW1A 2NS6A 3OS2A 4KT0E 2RHUA 1NEGA 2D9TA 1HJDA 1VYUA 4YYEA 4A53A 3EFSA 4M77D 1KQ2A 1WQWA 2J06A 3HXUA 2O31A 2X4JA 3PMTA 2J3MA 4PJOF 1ZUUA 3M4PA 3META 1S1NA 2AKWB 3QNEA 1I1JA 3VUBA 4JDSA 3HFOA 4M75G 3C12A 1IB8A 2VGNA 2LCSA 4M77A 4C8QE 1VQNT 2ZNJA 1WJSA 1AWXA 4RCBA 2LRQA 2HL5C 2F2VA 3LYIA 3CC2A 4KH0B 3C4SA 3ER0A 5C53B 1K8AR 3CC4Q 1YJWQ 4X34A
chains in the Genus database with same CATH topology
1E1TA 4IUUA 2XG8D 2JNGA 5LJ3j 2MWOA 1NJ6A 4WF2A 1VQZA 2WSCE 1N8RU 2C8MA 2D0QB 4TQFA 2ZT7A 4BDYA 3LX7A 4N0AC 4LDYA 4C5IA 1JJ2S 3NEMA 5J26A 1NYRA 2HD0A 4YRTA 5FU6C 5LJ3h 1Q86C 2R58A 1OZ2A 1QW1A 2E5QA 4HWSA 5GMKj 3HFNA 4YRCA 2LT1A 3FC3A 5CK9A 4M78G 1LOJA 5GAN6 4J6XA 2P0QA 1OZ3A 3LWIA 2E12A 3G7ZA 4P73A 5F5WA 3X28B 1KMMA 2RJDA 2VGMA 3BDUA 2G3RA 2LC4A 3QYHB 1YI2A 3M9QA 1KG1A 3OB9A 5GAMh 4RKUE 4ZGDB 4H2VA 3HL8A 2C06A 2QQSA 2ZIOA 5GAMg 2DPPB 11ASA 1M9SA 1IREB 3S3NA 2DQ3A 4C8QD 3CXCA 1N9WA 4PHCA 3M55A 1VQ9T 3QZ5B 2XK0A 4C92G 5GAN3 4PG3A 4KR3A 5K1XA 3RKWA 1JB0E 1UGPB 4II1A 2G4CA 2VXEA 3PMIA 2K3XA 2PVOB 4M7AF 2ALYB 2CIMA 1HXDA 4X9CA 4N4HA 2IG0A 3CD6A 5KNNA 5CIUA 2RJEA 1Y07A 2P5IA 2ZXFA 3QUIA 4C8QF 3GP8A 3VBBA 4PJOG 2X4XA 2XDPA 2DXTA 4C8QB 4TVYA 3V8KA 3IKMB 4EMGA 2KY9A 4O2DA 4IUTA 4QQDA 3VQXA 4P3OA 3PIOA 1Q81C 3A8MB 2MF2A 3NTHA 4H2TA 1VQ4T 3SWNB 4NS5A 3VU3C 3CCJT 3QYGB 4YRFA 3QO7A 2JN0A 3CBOA 3VQVA 4C8QA 3HKSA 1YCYA 4M75A 5LJ5f 2VC8A 5HK3A 2HQEA 5FU7B 3WVEB 5GMKi 4FM4B 3UGQA 5DY9A 1FXXA 2QHTA 1M90U 3FLGA 4KUIA 2RB6A 2ODRC 2CJ9A 3P8VA 2ZR3A 3P8HA 1ZQ1A 2DJZA 3QJYA 2BUDA 2QA4T 4K86A 4M7AD 3LH0A 3LGFA 2E41A 3OYLA 2ZNIA 3SB2A 2ZCFB 3ICAA 4JRKA 2QQAA 4PJOE 3FRNA 1QVPA 4H2XA 1VQLT 3PCOA 2XTIA 1YITT 5GANe 3V7CA 3BFMA 3QO8A 2EQJA 3MEAA 4O5VA 5FLXE 4M78F 3QXEB 4LDWA 4MZTA 3L2RA 2EAYA 1WQ7A 1HK9A 2Y4XA 1H641 4LDUA 3NELA 5DLQE 2E6NA 4F7UA 3RGLA 2ARUA 1K8AU 2DEQA 1W2BA 3CC2T 4M7AA 2K5LA 4MZPA 5IN1A 2BIVA 2ZZEA 3LSQA 4HCBA 1YI2T 1VIEA 2RI2A 1PSEA 2EJFA 2DTHA 4JJNK 3OBWA 2YLBA 3J81E 3GNFB 3FDRA 1Z7NA 4KR2A 1SESA 3E9FA 2HQXA 1GGMA 4UPAA 4M7DE 2RM4A 2WACA 5GAOn 4RQEA 1K73C 3A7RA 3OYEA 3A5ZA 1Y7XA 4KQEA 5C6SA 5I2SA 1SERA 3HP9A 3CMAA 4PLIA 4M78B 3OY9A 3HRUA 4LVMA 4EMKC 4OGEA 4XAXB 3URGA 3OYMA 4H2WA 3I55T 4HWRA 1B34B 4J6WA 2E10A 4P5NA 3TEHA 4XTVA 1M4ZA 3QHSA 1W66A 4J15A 1PYSB 4JRIA 4RG8A 4J83A 3CCVA 4JLGA 3HRTA 3SFMA 4M77B 3JCMg 1WJQA 1X2HA 4M7AG 2FL7A 1EIYA 2HNIA 3UGTA 1I5LA 2LTOA 5LL6S 2XU8A 4ZTUB 2Q7HA 4LVIA 3P8YA 4XK8E 2ZPFB 3MF1A 3JB9J 3CCJA 1VQOA 2WSEE 3NTKA 3V8JA 4RG2A 4E7JA 4CH3A 4BY6C 3ASKA 1Y96B 2D6FA 4AH6A 1N6AA 3L4GA 3E19A 1MGQA 4F7UG 2V8IA 4E47A 2DK3A 3CD6T 1I81A 1QVFS 5CKFA 1Y71A 2EL9A 2MI6A 1VIFA 4HWTA 3TEGA 1VQMA 1VQ6A 1HTTA 2PMFA 2QHVA 4HCCA 1VQ7A 4HWOA 4YCWA 1HC7A 3JCMJ 2E3CA 2EJGA 3FB9A 4QQ6A 4MZMA 2EIFA 3HXYA 3BDLA 4BI3A 4BI8B 2XICA 5CQXA 2AMCB 2CJAA 4VUBA 3N5BB 3ZFJA 3JCMP 4MDWA 4ZTFA 3CC7A 5KH6A 3HHTB 1JJ2A 3P8BB 2VXFA 4OB1B 4E7IA 1VQ9A 4TVWA 5GAMf 4M75C 3RMQA 4FU6A 4HT4A 5LJ3g 5J3BA 2PUOB 4A4KA 2XI9A 2MAMA 2RD1A 2E64A 2H3JA 4M7DD 1WNLA 4M7DC 1QVFA 4JLIA 3VJPA 1KHCA 3L2QA 3CPFA 5HK0A 2CZ1B 3HXWA 3VQWA 1NZ9A 3RIRA 2BKDN 4P75A 1UGRB 4YP0A 1O75A 2GCXA 1DJ7B 2QA4A 4M7DA 1VQKA 3QDRB 4P73C 3OYKA 4RMFA 3MHXA 1BIBA 4M77C 2ZPBB 2O4XA 3CMAT 4K88A 2VUBA 4XTZA 5GAN4 1YJ9A 3LLRA 1G5IA 4PJOB 4LVLA 2YLCA 1QP3A 4QVZA 3CEYA 3M56A 2WSFE 2OTLT 3VV0A 2GFAA 2DKGA 4M7DB 3A32A 1VQ6T 3OS5A 4J8OA 1USYC 4TVAA 3CCMA 2YRVA 3RF1A 2F5TX 2I4MA 4C0FA 2ZPGB 2KAFA 2CYZB 2LT4A 4P3PA 3L2VA 1WGSA 4XTXA 3OS1A 3OD1A 4CH5A 3M57A 2RJCA 3LSSA 1NJ8A 5GAMd 1NPRA 4DA4A 3SD4A 1M1FA 1P92A 3OYCA 2YHTA 4WI1A 5GMKl 1I4K1 2CS7A 1BI1A 4MDXA 3CC7T 4PJOC 4OMFB 1EVKA 4C92E 1GXIE 4O6JA 5HKCA 4DQ2A 3QO3A 2K5FA 3HFZB 1KC8U 2XKOC 2DIGA 4ZTJA 4LNSA 1QP2A 5I21A 5CAIA 3E1SA 1L0WA 5C51B 3R6OA 2I4LA 4M78E 2E1HA 3EAEA 5FRMA 3A8LB 3M5AA 2ZZGA 2PVGB 2QI2A 3RKYA 3I56A 1WJRA 2OAUA 1BYMA 4PLLA 2ZZDA 3DLMA 1FYFA 3BJUA 4BDZA 4XTUA 3GPLA 4ZTZB 1M8VA 3JCMh 1UGQB 4L87A 3DB3A 4YROA 4G85A 2O4XB 2DTOA 4C0DB 3OYIA 2XD0A 4EDUA 4YRQA 3MEUA 2ODRD 2M16A 1YBYA 3UT1A 1YHQA 1KQSS 1KQ1A 5LJ5e 4OLFA 4BD3A 2RI3A 2Q7EA 2LCCA 2E70A 2ZT8A 2XGTA 2ZGWA 3CPWA 3A7UA 2C7IA 2DU5A 3CCMT 1NJ2A 4H2SA 1X75C 2HAXA 3V8LA 5M9OA 3HSBA 4BI4A 3MEWA 5LJ5d 1YB3A 1IZ6A 3SWNA 4EMKA 3X20B 2IVWA 3JCMd 3I55A 4PJOD 4NL3A 4B9WA 4IUPA 3ZBDA 5FU6B 3JCMb 1B34A 4P74A 4HKEA 3QJ6A 1EFWA 4EX5A 2AHJB 1X2GA 3G1ZA 2A8EA 1NE8A 1C0AA 1NJ1A 2R5MA 4M7DG 5D6XA 1X56A 2VYTA 2RO0A 1B76A 3MP6A 4ZIBA 1N9RA 1VQLA 4P74C 12ASA 2PMEA 3CCUA 3QTCA 4YRSA 2X4YA 4ATOA 1QE0A 4IURA 3CCET 4B9XA 4YRMA 3OQ5A 4BACA 5A0LA 4J7FA 3X25B 1Z7MA 5FU7C 1K9MC 1LYLA 2PUKB 4M77G 3PNWC 2QXFA 3VKIA 1JBMA 2ZR2A 2KSSA 3MP8A 2F5KA 3NTIA 4C8QC 2QDYB 3CBMA 2EQUA 2PVDB 3OYBA 4H2XB 1Q81U 4RQFA 1KHIA 1YFRA 3LC0A 3PCOB 4JS4A 2EKOA 3JCMW 2OTJT 3M54A 5GANj 4ME7A 4F7UF 4CS2A 1O9SA 2KDSA 4JRQA 2K3YA 4UC4A 1M1KU 2DZ9A 5CKHA 4YRKA 4JUVA 3HXVA 4EMKB 2M0OA 2ALYA 5DLOA 3LW5E 2ZINA 3M53A 4P71C 1XQHA 4PL6A 2OTLA 3JB9F 5J39A 4QVDA 2RH2A 3C95A 4M77E 3R07A 3DLLA 3GOXA 1SETA 3A5ZB 3MF2A 1G3SA 3HFVA 3GLXA 4YRRA 4LD9K 1H3ZA 1E1OA 4XU1A 4OVAA 3RACA 2JOYA 4X9DA 3A8HB 5E3IA 1EOVA 3RESA 1ZHIA 1FX7A 1U8RA 1KD1U 5LJ3f 1X01A 4OB0B 3S3OA 1WPYA 4C5GA 5CKDA 2JUFA 2E5AA 4N4IA 5CKBA 1WYDA 2LDMA 4XTWA 4P72A 4XU0A 3L42A 1KMNA 2K57A 4UP8A 2ARSA 4YCVA 2FHDA 4L6V5 2QEXA 3QZ9B 1B7YB 5A0GA 4EO4A 1VQ4A 1K8AC 3JB9I 2XHCA 2RHYA 4A4GA 1K73U 4J5YA 3CMET 1IL2A 4KBMB 3TREA 3W3SA 3CCRA 4QVCA 1KD1C 1BIAA 3QKJA 4YRJA 4OF1A 2CKKA 5GAOr 3I56T 4M7AE 4CH6A 1UB4A 5CO7A 4C5HA 1YJNT 3UFGA 4XU3A 3M58A 3WXMB 2GF7A 3IG2A 2V8JA 5GAOp 2ZTGA 4YRIA 2ARTA 1S72T 3A7AA 4JRPA 3KUFA 3H6ZA 3JCMV 1YJWT 2R5AA 4P75C 2GFUA 4Y28E 3KBGA 5CKEA 1EIFA 3OYDA 3JCMQ 4C0DC 5KE3A 5DM7R 3TU4K 2EJ9A 2I4OA 3QIIA 3WVDB 4C8QG 1VQPT 3JB9G 4DPGA 5LJ3d 4NOYA 2LX9A 3REUA 5GAN5 3NETA 2P0PA 1VQNA 3T9NA 5EG2A 3J7AF 3OSSC 3M4QA 1YIJT 4H2UA 3QSUA 3F70A 4C92F 3VYGA 4BE0A 3L2WA 2AMCA 3JCMe 4BE2A 2OTJA 4OP0A 3G71T 4M75E 5HY6A 2ZCEA 4R55A 3V7RA 4M78A 4PNOA 1YGBA 2M9UA 4A4HA 1UGSB 2K4YA 4FL6A 3G6ET 4XEOA 4UP7A 5LJ5h 2ZPIB 1K9MU 2RA2A 2Y4YA 2XDDA 1EQRA 2LVMA 1E24A 3PGGA 4FSXA 4LD6A 3QG1A 4CH4A 2ZIMA 3JRZA 2DXUA 3G4SA 5GMKm 3PIPA 2QHUA 5AYFA 3VQYA 5LJ5g 1EIYB 2I2LA 4IUQA 1QVGA 3QO5A 4PKCC 4Q15A 4RDXA 3J80E 1ATIA 2X4WA 5GMKe 4IUVA 1X54A 1NPPA 2EFIA 5GANf 1J5WA 3L2UA 3MQZA 3H8ZA 1QF6A 3CCQA 1VQ5A 3L1AA 4MMKA 4M7AC 3M59A 1W2BS 2RHQB 2MMPA 2LNVA 1KQSA 2L3RA 1VQKT 3A5YA 3QPHA 4XTYA 2CZ7B 5A0DA 1N27A 3FEOA 5GANg 3ERRA 5ELOA 3OSVA 3HY0A 3HRKA 4OB2B 5GAN8 2VV5A 1G5HA 3CCEA 1WU7A 3X26B 2K2VA 3CCST 2CGHA 4HA8A 3G71A 4ZN1A 3JSCA 3NENA 2FVUA 1BI0A 4E7KA 3UH0A 2L8DA 2RHSB 2QTXA 5ELNA 4E51A 3PTAA 4BY6B 4NCXA 2NLUA 4BUGA 4XEMA 3LGLA 4XU2A 4CRIA 1PSFA 2AKWA 1VQMT 3MO8A 3SWNC 1Q7YU 1H4SA 2JZ2A 2RK2A 2X35A 4N0AA 2CJBA 2LCLA 3E9IA 5HGQA 1UEBA 1XOVA 4G84A 2A3LA 4TWAA 3X24B 4QW2A 1B70A 2JVVA 2DAQA 1XNIA 3S6WA 4WJ3M 4LDVA 3QBYA 4A4EA 1H4VB 4QQGA 3OYHA 1JRIA 1LNXA 1M1GA 4FT2A 5IT9E 3OYNA 4M78C 4XQ3A 1YJNA 2Q5HA 4LVJA 4PJOA 2DD4A 4TTVA 3CCLT 2QQRA 2DXBA 4JS5A 1B70B 4C5EA 2J3LA 3OS0A 3CXCS 1D3BB 2EQMA 5KE2A 4C92C 3WQZA 1YITA 5KCOA 3DKMA 2XIDA 4TVAB 3KFUA 1OI1A 2FB7A 3HTZA 1NJIU 3OYAA 4C92A 4P72C 4L59A 1NJ5A 2B8AA 5LJ3e 1N8RC 1JJCA 4YRLA 4Y91A 3OYGA 1U1TA 2RI5A 3LWHA 2QEXT 4GY5A 2JTFA 1OYXA 3CMEA 4ZGEB 5C0MA 1BBWA 2O01E 2CZ6B 4H02A 2DXCA 2DQ0A 4X5OA 4H2YA 3ZEHA 1Q7YC 2F69A 3Q1JA 2LQKA 3FJPA 2P0LA 1Q82U 3L2ZA 4Q5WA 1BBUA 4BE1A 4FIBA 3MEYA 3DB4A 3OMCA 2EYQA 2FYKA 3MEVA 5FRNA 4L5GA 4YCUA 3HXZA 4K87A 2DTIA 3OYFA 1YJWA 1G5VA 1H4QA 2M1HA 4M75D 3A8GB 3EFRA 3TEEA 2RK1A 1VQ8T 4P3NA 3HRIA 5GAN2 2RHIA 5GAOm 4CS3A 1EVLA 3M4YA 2P0KA 3V7SA 2DU7A 2HBPA 3GNGA 5GAMj 4RCCA 4WJ4A 3UPUA 1QVGS 2L89A 4N4GA 1D3BA 1NYQA 4UP9A 3SDZA 4TQDA 2ZT5A 2EWNA 4P71A 1VQOT 4DOWA 2DZCA 4BW9A 4M75B 3TEHB 4ELZC 1JJCB 4M78D 5CQYA 1N9SA 4GLKA 3RKXA 4HT8A 2JTMA 3CCUT 3GF5A 3P8TA 2V8KA 3CCRT 4C92D 2EQKA 5GMKh 2CZ0B 4YRNA 4HCZA 3RL6A 4A4FA 3TCJA 4TVRA 1B7YA 5GAOl 1M1KC 1Y96A 3JB9H 1G3WA 3JAME 1W4SA 3JCMX 4D6WA 3RUXA 2DVEA 3KXTA 1VQ7T 1KOGA 4EPCA 2Q5IA 5CVIA 4MMLA 4DOVA 3HXXA 2KK4A 1BI3A 1M5Q1 4HVCA 3CCQT 1VQ5T 2ZPHB 4M7DF 4LDXA 4Q6GA 3E9HA 3JCMc 1VQ8A 4OB3B 4CS4A 2RHXA 4F7UB 1VQPA 3RMSA 2RHQA 1U1SA 3M4GA 5GANh 2PQWA 2ZPEB 3IALA 2LQ8A 1G3TA 5LJ5j 3JCMf 4C0GA 2PU9B 3PFSA 2DO3A 4Z02A 4A54A 2R57A 2QQ9A 5IAYA 1R8OB 4M77F 4ZN3A 1BKBA 5A2QE 4M7AB 4KUDK 3OW2A 2GQVA 3CPWS 2ZZFA 1H4TA 1G51A 1ASZA 5D6WA 2XDBA 3CC4T 4R56A 4KULA 3REXA 4J7IA 1X6OA 5CR2A 3ME9A 2E65A 2ZT6A 4YTLA 3G6EA 3DSQA 1NNHA 3INZA 1XTDA 1Q86U 1RI0A 4YRPA 3IKLA 4RMOA 1LJOA 1NJIC 1SRYA 4YREA 1YJ9T 4E7LA 3G4ST 4ELYC 1M90C 4CI0C 2K5IA 2KVQG 3O8VA 3JB9D 5D6YA 3RERA 2DIQA 3AHUA 3OA6A 2RHZA 3BY7A 4IKFA 2I4NA 1AHJB 1Q82C 1PYSA 5L8RE 1VUBA 3OYJA 4HWPA 1YIJA 3HY1A 3OBYA 2IY5B 1KC8C 3OMGA 5C52B 1YFTA 1WLEA 3A31A 1ADYA 3MP1A 5GAOq 4M75F 2Y90A 5KCHA 3MCAB 3A8OB 3A74A 2L5QA 4NL2A 1B8AA 3NFCA 3VYHB 1ASYA 2QQBA 3CCVT 1X55A 4FT4A 3OW2S 1SSFA 2QHSA 1TH7A 5CCAA 1RL2A 1ADJA 2E6ZA 3C94A 3P8DA 3CCLA 4YDQA 1S72A 3S3MA 1G3YA 2IY5A 3L4GB 3UWNA 2A7YA 3I7FA 3PT9A 1E22A 1YFSA 4BWAA 1BI2A 3UDCA 4YPFA 3VUZA 1I8FA 2DD5A 2Q7GA 5K1PA 4YRGA 5FROA 4LVKA 4F7UE 5GANd 3E9GA 3CCSA 5GAMe 4J6YA 4EMHA 3HRSA 3FIFA 1FWZA 4C92B 2KQWA 3CC4A 5I2MA 3CBPA 3PZCA 1MHNA 4HT9A 4ZGJB 3HPWA 2RJFA 1ZBXA 4OGCA 1RIQA 5GAN7 2P4TA 1USYA 3CMQA 3HFZA 3OYYA 1V29B 4C0ZA 1YHQT 2DDZA 4V2SA 2MWPA 4E7HA 2RHSA 3GIBA 2KMTA 3TUPA 4BB7A 3BW1A 2NS6A 3OS2A 4KT0E 2RHUA 2D9TA 4YYEA 4A53A 3EFSA 4M77D 1KQ2A 1WQWA 3HXUA 2X4JA 3PMTA 2J3MA 4PJOF 3M4PA 3META 2AKWB 3QNEA 3VUBA 4JDSA 3HFOA 4M75G 3C12A 2VGNA 4M77A 4C8QE 1VQNT 2ZNJA 1WJSA 4RCBA 2LRQA 3LYIA 3CC2A 3C4SA 3ER0A 5C53B 4X34A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1E1O A;  1E1T A;  4XU1 A;  2P0L A;  3RAC A;  3L2Z A;  4X9D A;  5E3I A;  1EOV A;  3RES A;  2PMF A;  2QHV A;  1BBU A;  5LJ3 f;  4HWO A;  1X01 A;  3MEY A;  1WPY A;  4YCW A;  5LJ3 j;  2FYK A;  1HC7 A;  3JCM J;  2E3C A;  2EJG A;  3FB9 A;  4YCU A;  3HXZ A;  1NJ6 A;  4K87 A;  2E5A A;  2DTI A;  4WF2 A;  1VQZ A;  1WYD A;  3HXY A;  4XTW A;  4P72 A;  1H4Q A;  2C8M A;  4XU0 A;  1KMN A;  4M75 D;  2K57 A;  4TQF A;  2ZT7 A;  4UP8 A;  3EFR A;  2ARS A;  2AMC B;  2CJA A;  4YCV A;  4N0A C;  1B7Y B;  4EO4 A;  4P3N A;  3HRI A;  3NEM A;  5GAN 2;  3JCM P;  3JB9 I;  5GAO m;  4J5Y A;  4CS3 A;  1NYR A;  1IL2 A;  3W3S A;  4YRT A;  2VXF A;  5LJ3 h;  1EVL A;  5GAM f;  4TVW A;  3V7S A;  4QVC A;  2DU7 A;  4M75 C;  1BIA A;  4YRJ A;  5GAO r;  5GAM j;  4HWS A;  5GMK j;  4M7A E;  3HFN A;  5LJ3 g;  4CH6 A;  4RCC A;  4YRC A;  2RD1 A;  2E64 A;  4WJ4 A;  4M7D D;  1WNL A;  4M7D C;  4JLI A;  1D3B A;  1NYQ A;  4M78 G;  1LOJ A;  5GAN 6;  3UFG A;  4UP9 A;  4XU3 A;  4J6X A;  3HXW A;  4P73 A;  4TQD A;  3VQW A;  3IG2 A;  5GAO p;  2ZT5 A;  5F5W A;  2EWN A;  4P71 A;  3RIR A;  4P75 A;  1KMM A;  2ZTG A;  4YRI A;  3BDU A;  2ART A;  4YP0 A;  3A7A A;  2DZC A;  3JCM V;  4M7D A;  5GAM h;  4P75 C;  4H2V A;  4BW9 A;  4M75 B;  3TEH B;  4P73 C;  2ZIO A;  3JCM Q;  4RMF A;  1JJC B;  4M78 D;  5GAM g;  2EJ9 A;  1BIB A;  2I4O A;  11AS A;  1N9S A;  4M77 C;  3RKX A;  4HT8 A;  2DQ3 A;  4C8Q G;  4C8Q D;  3JB9 G;  4K88 A;  5GAN 4;  4XTZ A;  4DPG A;  5LJ3 d;  1G5I A;  4PJO B;  1N9W A;  4NOY A;  3REU A;  4PHC A;  2YLC A;  3P8T A;  5GAN 5;  3NET A;  5GAN 3;  4C92 G;  4PG3 A;  4KR3 A;  4C92 D;  5K1X A;  5GMK h;  3RKW A;  2G4C A;  3M4Q A;  4H2U A;  2VXE A;  4YRN A;  2DKG A;  4M7D B;  3A32 A;  3RL6 A;  3QSU A;  4M7A F;  2ALY B;  2CIM A;  1B7Y A;  1USY C;  4TVA A;  5GAO l;  1HXD A;  1Y96 A;  4X9C A;  3JB9 H;  3RF1 A;  4C92 F;  3JCM X;  2I4M A;  5KNN A;  3RUX A;  4P3P A;  2DVE A;  2AMC A;  1KOG A;  3JCM e;  4XTX A;  2P5I A;  2ZXF A;  4CH5 A;  3QUI A;  2Q5I A;  3OD1 A;  3LSS A;  4C8Q F;  1NJ8 A;  4OP0 A;  5GAM d;  3VBB A;  4PJO G;  4M75 E;  2ZCE A;  4MML A;  3V7R A;  2DXT A;  4M78 A;  4C8Q B;  3HXX A;  4PNO A;  4TVY A;  1M5Q 1;  1YGB A;  3V8K A;  4HVC A;  3IKM B;  4EMG A;  4M7D F;  4O2D A;  2YHT A;  4WI1 A;  4XEO A;  4UP7 A;  5LJ5 h;  5GMK l;  4Q6G A;  3VQX A;  3E9H A;  1I4K 1;  2RA2 A;  4P3O A;  3JCM c;  4CS4 A;  4F7U B;  4H2T A;  3SWN B;  1EQR A;  2RHQ A;  1U1S A;  1E24 A;  3M4G A;  4PJO C;  5GAN h;  3VU3 C;  3PGG A;  1EVK A;  4C92 E;  4CH4 A;  2ZIM A;  3IAL A;  2DXU A;  4DQ2 A;  5GMK m;  3QO3 A;  3HFZ B;  4YRF A;  5LJ5 j;  2QHU A;  3JCM f;  3QO7 A;  2JN0 A;  4LNS A;  3VQY A;  3VQV A;  5I21 A;  5LJ5 g;  1EIY B;  4A54 A;  2I2L A;  5CAI A;  4C8Q A;  1L0W A;  5C51 B;  2I4L A;  3QO5 A;  4M77 F;  4Q15 A;  4M78 E;  4RDX A;  2E1H A;  4M7A B;  1YCY A;  4M75 A;  5LJ5 f;  1ATI A;  2ZZG A;  2ZZF A;  3RKY A;  5GMK e;  1H4T A;  2VC8 A;  1G51 A;  1ASZ A;  1X54 A;  5GMK i;  1FYF A;  3UGQ A;  5GAN f;  1J5W A;  3BJU A;  5DY9 A;  3REX A;  2QHT A;  4XTU A;  1QF6 A;  2RB6 A;  2ODR C;  2E65 A;  4ZTZ B;  2CJ9 A;  2ZT6 A;  3P8V A;  3L1A A;  1M8V A;  4MMK A;  3JCM h;  4M7A C;  2ZR3 A;  3DSQ A;  2DJZ A;  1NNH A;  4L87 A;  4YRO A;  3INZ A;  4G85 A;  2RHQ B;  2DTO A;  4K86 A;  4YRP A;  4M7A D;  3IKL A;  1LJO A;  4YRQ A;  2E41 A;  3A5Y A;  1SRY A;  4YRE A;  2ODR D;  2ZNI A;  4XTY A;  3SB2 A;  1KQ1 A;  3JB9 D;  5LJ5 e;  3ICA A;  4OLF A;  3RER A;  4JRK A;  3AHU A;  2Q7E A;  4PJO E;  2ZT8 A;  2XGT A;  4H2X A;  5GAN g;  2ZGW A;  3ERR A;  3PCO A;  3BY7 A;  2I4N A;  5ELO A;  2XTI A;  5GAN e;  3V7C A;  3A7U A;  3BFM A;  3QO8 A;  2C7I A;  3HY0 A;  3HRK A;  2DU5 A;  1NJ2 A;  1PYS A;  5GAN 8;  4H2S A;  1G5H A;  3V8L A;  4M78 F;  1WU7 A;  3HSB A;  4HWP A;  3HY1 A;  2EAY A;  2IY5 B;  5LJ5 d;  1YB3 A;  2CGH A;  1WQ7 A;  3SWN A;  5C52 B;  4HA8 A;  4EMK A;  1YFT A;  1HK9 A;  1WLE A;  3NEN A;  1H64 1;  3NEL A;  3A31 A;  3JCM d;  4F7U A;  1ADY A;  4PJO D;  3RGL A;  2ARU A;  4NL3 A;  5GAO q;  3UH0 A;  2DEQ A;  4M75 F;  3JCM b;  2Y90 A;  1B34 A;  4M7A A;  2RHS B;  2QTX A;  5ELN A;  4P74 A;  4E51 A;  3A74 A;  4NL2 A;  1B8A A;  2ZZE A;  4NCX A;  1ASY A;  3LSQ A;  4XEM A;  1EFW A;  1X55 A;  4EX5 A;  2EJF A;  4XU2 A;  1X2G A;  2QHS A;  3G1Z A;  1TH7 A;  2DTH A;  2AKW A;  1ADJ A;  3SWN C;  1C0A A;  2YLB A;  1NJ1 A;  1H4S A;  4YDQ A;  4M7D G;  1X56 A;  1Z7N A;  1B76 A;  2IY5 A;  3L4G B;  4KR2 A;  4ZIB A;  1SES A;  1N9R A;  3I7F A;  4N0A A;  2CJB A;  4P74 C;  1E22 A;  1GGM A;  1YFS A;  4UPA A;  4M7D E;  2RM4 A;  12AS A;  4BWA A;  2PME A;  5GAO n;  3E9I A;  3QTC A;  5HGQ A;  4RQE A;  4YRS A;  3A7R A;  1QE0 A;  3A5Z A;  4YPF A;  4KQE A;  4G84 A;  1I8F A;  2Q7G A;  4TWA A;  1SER A;  5K1P A;  4YRG A;  4YRM A;  4M78 B;  1B70 A;  4F7U E;  5GAN d;  5GAM e;  4EMK C;  4J6Y A;  1Z7M A;  4EMH A;  3FIF A;  4C92 B;  1LYL A;  4H2W A;  4M77 G;  3PZC A;  4WJ3 M;  1JBM A;  2ZR2 A;  4HWR A;  1B34 B;  1H4V B;  4J6W A;  2E10 A;  4C8Q C;  4HT9 A;  3TEH A;  4XTV A;  1JRI A;  3QHS A;  1W66 A;  4J15 A;  1RIQ A;  1LNX A;  1PYS B;  4H2X B;  4JRI A;  5GAN 7;  4RQF A;  1USY A;  4M78 C;  4XQ3 A;  1YFR A;  2Q5H A;  3LC0 A;  3CMQ A;  3HFZ A;  4M77 B;  3JCM g;  3PCO B;  4PJO A;  4TTV A;  1X2H A;  4M7A G;  1EIY A;  3JCM W;  2DDZ A;  4V2S A;  1B70 B;  2HNI A;  5GAN j;  3UGT A;  2J3L A;  4F7U F;  4CS2 A;  1I5L A;  1D3B B;  4C92 C;  3WQZ A;  2RHS A;  4ZTU B;  3GIB A;  2Q7H A;  3P8Y A;  3TUP A;  4TVA B;  3MF1 A;  3BW1 A;  3KFU A;  2FB7 A;  3HTZ A;  3JB9 J;  2DZ9 A;  4YYE A;  3V8J A;  4A53 A;  3EFS A;  4M77 D;  1KQ2 A;  4YRK A;  4CH3 A;  4C92 A;  4JUV A;  3HXV A;  1WQW A;  3HXU A;  4P72 C;  4EMK B;  1NJ5 A;  2J3M A;  5LJ3 e;  4PJO F;  1JJC A;  2ALY A;  4Y91 A;  3M4P A;  4YRL A;  2AKW B;  3QNE A;  1U1T A;  1Y96 B;  2ZIN A;  4P71 C;  4AH6 A;  3JB9 F;  3HFO A;  4M75 G;  3L4G A;  4QVD A;  4M77 E;  3R07 A;  1MGQ A;  4M77 A;  1BBW A;  4C8Q E;  4F7U G;  4H02 A;  2DQ0 A;  2ZNJ A;  1SET A;  4H2Y A;  4X5O A;  4RCB A;  1I81 A;  3MF2 A;  3HFV A;  2EL9 A;  4HWT A;  3TEG A;  4YRR A;  5C53 B;  3FJP A;  1HTT A; 
#chains in the Genus database with same CATH topology
 1E1T A;  2K9G A;  3FJ5 A;  1TSF A;  4IUU A;  3VS1 A;  2XG8 D;  2JNG A;  1EZZ B;  2EYY A;  5LJ3 j;  1BCM A;  4J9E A;  3UA7 A;  2MWO A;  1NJ6 A;  2DBK A;  4WF2 A;  1VQZ A;  4FYW B;  2WSC E;  1N8R U;  2C8M A;  2D0Q B;  4TQF A;  1WIE A;  2ZT7 A;  4BDY A;  3LX7 A;  4N0A C;  4LDY A;  4C5I A;  1JJ2 S;  2FZG B;  3NEM A;  5J26 A;  2KRS A;  2SRC A;  4ANJ A;  1YHQ Q;  1NYR A;  2HD0 A;  1OOT A;  4YRT A;  5FU6 C;  2GTJ A;  5LJ3 h;  1Q86 C;  2R58 A;  1OZ2 A;  1QW1 A;  2JW4 A;  5HCK A;  2QYZ A;  2E5Q A;  4HWS A;  5GMK j;  3HFN A;  4YRC A;  2KT8 A;  1HD3 A;  4J9H A;  2LT1 A;  3FC3 A;  1FMV A;  2F2W A;  1W70 A;  1GCP A;  4M78 G;  1LOJ A;  5GAN 6;  5CK9 A;  1WHG A;  2P4R A;  1YIJ Q;  4J6X A;  2P0Q A;  1OZ3 A;  3UA6 A;  3LWI A;  2E12 A;  3G7Z A;  2OX7 A;  4PJL A;  4P73 A;  5F5W A;  3X28 B;  1KMM A;  2KGT A;  4OML A;  4AFS C;  2RJD A;  1ZLM A;  5IXF A;  1TUD A;  2VGM A;  3BDU A;  2G3R A;  2LC4 A;  3QYH B;  1YI2 A;  1GCQ C;  3M9Q A;  1UJY A;  1KG1 A;  3OB9 A;  5GAM h;  4RKU E;  4ZGD B;  4H2V A;  3HL8 A;  2NUT A;  2C06 A;  2QQS A;  2ZIO A;  5GAM g;  3H9N A;  2DPP B;  3TVT A;  2NUP B;  11AS A;  1M9S A;  2LJ1 A;  1IRE B;  1M3A A;  3S3N A;  2DQ3 A;  4C8Q D;  2D1X A;  3CXC A;  1N9W A;  4PHC A;  3M55 A;  1VQ9 T;  3QZ5 B;  2XK0 A;  4C92 G;  5GAN 3;  4PG3 A;  4KR3 A;  2DL5 A;  5K1X A;  3RKW A;  1JB0 E;  1UGP B;  4II1 A;  2G4C A;  3CCJ Q;  1PRL C;  2VXE A;  3PMI A;  2K3X A;  2PVO B;  2X3W D;  4RTX A;  1QWE A;  4M7A F;  2ALY B;  2CIM A;  4X1V A;  1GBQ A;  1HXD A;  4X9C A;  4N4H A;  2IG0 A;  3CD6 A;  5KNN A;  3I56 Q;  2FPE A;  5CIU A;  1ABO A;  2RJE A;  1WHJ A;  1Y07 A;  2P5I A;  2ZXF A;  3QUI A;  4C8Q F;  3GP8 A;  3VBB A;  4PJO G;  1ACM B;  2X4X A;  2XDP A;  1VQK Q;  2DXT A;  4C8Q B;  2OTJ Q;  4TVY A;  3V8K A;  2K79 A;  3CCL Q;  3MKD A;  5I22 A;  3IKM B;  4EMG A;  2EBP A;  2KY9 A;  4IUT A;  1BU1 A;  4AMC A;  4O2D A;  1ZA2 B;  4QQD A;  3VQX A;  4P3O A;  2L3S A;  3PIO A;  1Q81 C;  3A8M B;  2MF2 A;  3NTH A;  1OPL A;  4H2T A;  2K3B A;  1VQ4 T;  3SWN B;  4NS5 A;  3RBB B;  1WDX A;  3VU3 C;  2DX1 A;  4KRT A;  3CCJ T;  3QYG B;  4YRF A;  2L3P A;  1I5O B;  3QO7 A;  2JN0 A;  3CBO A;  1MV0 B;  3VQV A;  4PJN A;  4C8Q A;  3CPW P;  1X6G A;  3HKS A;  1UHF A;  3C0C A;  2HCK A;  1YCY A;  3H0H A;  4M75 A;  5LJ5 f;  1RAG B;  2VC8 A;  5HK3 A;  2HQE A;  5FU7 B;  3WVE B;  5GMK i;  4FM4 B;  3UGQ A;  5DY9 A;  1FXX A;  2QHT A;  1M90 U;  1QKW A;  3FLG A;  3SHW A;  2OI3 A;  4KUI A;  1GFC A;  2RB6 A;  2ODR C;  4JPB W;  3M0R A;  2K7A A;  2CJ9 A;  3P8V A;  1OU8 A;  4D8K A;  3P8H A;  3CCS Q;  2ZR3 A;  4A63 B;  1CKB A;  1ZQ1 A;  2DJZ A;  3QJY A;  3EG9 A;  2BUD A;  2QA4 T;  4K86 A;  4M7A D;  7AT1 B;  3LH0 A;  1D0X A;  4PK4 A;  3LGF A;  1BB9 A;  2E41 A;  1RAH B;  3OYL A;  2ZNI A;  2O2O A;  2KR3 A;  3SB2 A;  2ZCF B;  3ICA A;  4JRK A;  3RR6 A;  2QQA A;  4PJO E;  1HSQ A;  2LP5 A;  4DBF A;  2KRM A;  1QVP A;  3FRN A;  4H2X A;  1IHV A;  4HCK A;  1VQL T;  3PCO A;  2XTI A;  2KE9 A;  1YIT T;  1UUE A;  1H3H A;  5GAN e;  2MYS A;  3V7C A;  3BFM A;  3QO8 A;  2EQJ A;  1I0C A;  2X51 A;  3MEA A;  4O5V A;  3M0S A;  5FLX E;  2OTL Q;  4M78 F;  3QXE B;  4LDW A;  2HKQ B;  4MZT A;  2QTV A;  4FW2 A;  3L2R A;  2EAY A;  1WQ7 A;  1IGQ A;  2DEU A;  1HK9 A;  2PZ1 A;  2Y4X A;  1H64 1;  2G6F X;  4LDU A;  3NEL A;  5DLQ E;  2E6N A;  4F7U A;  3VS7 A;  1KQS P;  2KYB A;  3RGL A;  1PNJ A;  2ARU A;  1K8A U;  1UTI A;  2DEQ A;  1W2B A;  3CC2 T;  4M7A A;  4B6M A;  2K5L A;  2BE7 D;  2ENM A;  4MZP A;  2L2P A;  5IN1 A;  4FW1 A;  2BIV A;  2ZZE A;  3LSQ A;  4HCB A;  1YI2 T;  1VIE A;  1WZO A;  1JXM A;  1PSE A;  2HSE B;  2RI2 A;  2EJF A;  1WHM A;  3I5R A;  2DTH A;  4JJN K;  3OBW A;  2YLB A;  3J81 E;  3GNF B;  3FDR A;  2COW A;  2JT4 A;  2YSQ A;  1Z7N A;  1C6V X;  4KR2 A;  1SES A;  3E9F A;  2L0A A;  2HQX A;  1GGM A;  4UPA A;  4K11 A;  2FG0 A;  2RM4 A;  2M51 A;  4M7D E;  2WAC A;  5GAO n;  2PTK A;  1YJN Q;  5ECA A;  4RQE A;  1K73 C;  3A7R A;  2AKK A;  3OYE A;  3A5Z A;  1Y7X A;  1UEC A;  4KQE A;  5C6S A;  5I2S A;  2B86 A;  1SER A;  3HP9 A;  4LUE A;  3CMA A;  4PLI A;  1MUZ A;  2AT1 B;  5FWB A;  1MMN A;  4M78 B;  3OY9 A;  2VVK A;  3HRU A;  1H92 A;  4LVM A;  4EMK C;  4OGE A;  1YWO A;  4XAX B;  4AG1 C;  3CXC P;  3URG A;  3OYM A;  4H2W A;  3I55 T;  4HWR A;  1B34 B;  3EG2 A;  4J6W A;  2E10 A;  2YUN A;  4P5N A;  1Q95 G;  3TEH A;  1W1F A;  4XTV A;  1M4Z A;  3QHS A;  1W66 A;  4J15 A;  1CKA A;  2MIO A;  1PYS B;  4JRI A;  1TG0 A;  1X43 A;  4RG8 A;  4J83 A;  3CCV A;  1NLP C;  1KK7 A;  1PRM C;  4JLG A;  3HRT A;  3HTR A;  3SFM A;  4M77 B;  3JCM g;  2KNB B;  1WJQ A;  1X2H A;  4M7A G;  2FL7 A;  1EIY A;  1AEY A;  2HNI A;  3UGT A;  1I5L A;  3QWX X;  2LTO A;  1NLO C;  5LL6 S;  2XU8 A;  4ZTU B;  2FO0 A;  1QQJ A;  2Q7H A;  4LVI A;  3P8Y A;  4XK8 E;  2ZPF B;  3MF1 A;  1Q82 R;  1VQP Q;  4FSS A;  5IHI A;  1LVK A;  3JB9 J;  3CCJ A;  3CMA Q;  3EG3 A;  1VQO A;  2WSE E;  3NTK A;  3V8J A;  2RPN A;  4RG2 A;  4E7J A;  4CH3 A;  4BY6 C;  1BK2 A;  1AWW A;  1KC8 R;  2MOX A;  2EVR A;  2LQN A;  3ASK A;  1ZSZ B;  2BZY A;  1Y96 B;  2CP3 A;  2D6F A;  4AH6 A;  1K9A A;  2CP7 A;  1N6A A;  1YI2 Q;  3L4G A;  2DLP A;  3E19 A;  2GTO A;  1MGQ A;  1K76 A;  3I5S A;  4F7U G;  2V8I A;  4E47 A;  1BCO A;  2DK3 A;  3CD6 T;  1I81 A;  1QVF S;  5CKF A;  1Y71 A;  2EL9 A;  2MI6 A;  1VIF A;  4HWT A;  3TEG A;  1VQM A;  1W6X A;  1T3S A;  3EH1 A;  1VQ6 A;  1HTT A;  3SEM A;  1GBR A;  2OJ2 A;  2CDT A;  2PMF A;  1OU9 A;  2QHV A;  4HCC A;  1VQ7 A;  1QKX A;  4ORZ A;  4HWO A;  2H8H A;  4PJM A;  4YCW A;  1HC7 A;  3JCM J;  2E3C A;  1GFD A;  1JJ2 P;  2EJG A;  3FB9 A;  1M2O A;  4QQ6 A;  4MZM A;  2EIF A;  2D0N A;  3HXY A;  2V1R A;  1Z9Z A;  3BDL A;  4BI3 A;  1C0M A;  4BI8 B;  2XIC A;  5CQX A;  2AMC B;  2CJA A;  4VUB A;  3N5B B;  2NUP A;  3ZFJ A;  3JCM P;  4MDW A;  4ZTF A;  3CC7 A;  5KH6 A;  3HHT B;  2VAS A;  2VWF A;  1JJ2 A;  4KH1 B;  3P8B B;  2VXF A;  4OB1 B;  4E7I A;  1VQ9 A;  4TVW A;  5GAM f;  4M75 C;  3RMQ A;  4FU6 A;  4HT4 A;  5LJ3 g;  5J3B A;  2PUO B;  4A4K A;  2XI9 A;  2MAM A;  2A36 A;  2RD1 A;  4PFO A;  2E64 A;  2H3J A;  4M7D D;  3G71 Q;  1WNL A;  1K4U S;  4M7D C;  1QVF A;  1M27 C;  4Y92 A;  4JLI A;  4E6R A;  3VJP A;  1KHC A;  1VQO Q;  3L2Q A;  1D09 B;  2RQR A;  3CPF A;  1T3L A;  5HK0 A;  1OX9 A;  2CZ1 B;  1QWF A;  3HXW A;  2H3E B;  3VQW A;  3VS6 A;  1NZ9 A;  2LZ6 B;  3RIR A;  2BKD N;  4P75 A;  2FZK B;  1UGR B;  4YP0 A;  1O75 A;  2GCX A;  2FPF A;  4DEY A;  1DJ7 B;  2QA4 A;  2GQI A;  3OW2 P;  4M7D A;  2RMO A;  1VQK A;  3QDR B;  4P73 C;  2DFU A;  3OYK A;  4RMF A;  3MHX A;  4JJD A;  2YUP A;  1BIB A;  2V26 A;  4M77 C;  2ZPB B;  2O4X A;  3CMA T;  2A0F B;  2D8J A;  4K88 A;  2VUB A;  4XTZ A;  5GAN 4;  2O9V A;  1YJ9 A;  3LLR A;  1G5I A;  1JQQ A;  4PJO B;  4LVL A;  2FEI A;  5KYX B;  2YLC A;  1QP3 A;  4QVZ A;  1MV3 A;  3CEY A;  2RQT A;  1LCK A;  1I07 A;  3M56 A;  1EX4 A;  2EYX A;  2WSF E;  2OTL T;  3TSZ A;  3VV0 A;  2GFA A;  2DKG A;  4M7D B;  3A32 A;  1VQ6 T;  3OS5 A;  4J8O A;  1USY C;  4TVA A;  3CCM A;  3AT1 B;  2YRV A;  3RF1 A;  2F5T X;  2I4M A;  4C0F A;  2ZPG B;  2KAF A;  2CYZ B;  2AKL A;  3H0I A;  2LT4 A;  2YUO A;  4R0K A;  4P3P A;  2KBT A;  3L2V A;  4CC3 A;  1WGS A;  4XTX A;  3OS1 A;  3OD1 A;  4CH5 A;  3M57 A;  2BZ8 A;  2RJC A;  3LSS A;  1NJ8 A;  5GAM d;  1NPR A;  3EGX B;  1X69 A;  4DA4 A;  3SD4 A;  1M1F A;  2EPD A;  1P92 A;  3OYC A;  1E6H A;  2V1Q A;  2YHT A;  4WI1 A;  5GMK l;  1W2B P;  1SKU B;  1I4K 1;  2CS7 A;  1BI1 A;  4MDX A;  5KYU A;  5IH2 A;  2HL3 A;  2DA9 A;  3CC7 T;  1RLP C;  5GJV B;  4PJO C;  4OMF B;  2W10 A;  1YIT Q;  1EVK A;  4C92 E;  2EQI A;  4RTZ A;  1GXI E;  4O6J A;  2P84 A;  4DQ2 A;  5HKC A;  4AT1 B;  1PG5 B;  3QO3 A;  2K5F A;  3QWY A;  1KC8 U;  3HFZ B;  2COZ A;  4WCI A;  2XKO C;  2DIG A;  4ZTJ A;  4LNS A;  1QP2 A;  5I21 A;  2AZV A;  3E1S A;  5CAI A;  1L0W A;  5C51 B;  3R6O A;  2I4L A;  4M78 E;  2E1H A;  4LXC A;  3CCU Q;  4J9C A;  3EAE A;  5FRM A;  3A8L B;  3M5A A;  2J7I A;  2ZZG A;  5KYY A;  2PVG B;  2QI2 A;  5GJW B;  3RKY A;  3I56 A;  1WJR A;  3CD6 Q;  2OAU A;  1BYM A;  4PLL A;  2ZZD A;  3DLM A;  1FYF A;  1OPK A;  2JMA A;  1KIK A;  3BJU A;  9ATC B;  4BDZ A;  4XTU A;  1E7O A;  1R0B G;  3GPL A;  4ZTZ B;  3I55 Q;  1M8V A;  3JCM h;  1UGQ B;  4L87 A;  3DB3 A;  1ZX6 A;  4G85 A;  4YRO A;  2O4X B;  5IHK A;  2EYZ A;  2DTO A;  4C0D B;  1PKT A;  3OYI A;  2JM8 A;  2XD0 A;  4EDU A;  4YRQ A;  3MEU A;  1PWT A;  4F17 A;  2ODR D;  2M16 A;  1YBY A;  2CT4 A;  3UT1 A;  1YHQ A;  2KI7 A;  1KQS S;  1KQ1 A;  2RQW A;  5LJ5 e;  2YRC A;  5L23 A;  1WHH A;  4OLF A;  4BD3 A;  2RI3 A;  3VRY A;  2Q7E A;  2LCC A;  2E70 A;  2ZT8 A;  2XGT A;  2ZGW A;  8AT1 B;  1G83 A;  3CPW A;  3A7U A;  3CME Q;  2C7I A;  2D8H A;  2DU5 A;  3CCM T;  1NJ2 A;  4H2S A;  1X75 C;  3MJX A;  4LE9 A;  4E7S A;  2HAX A;  4J9F A;  3V8L A;  1FYN A;  5M9O A;  3HSB A;  4BI4 A;  4CC4 B;  2EGE A;  3MEW A;  1IRX A;  5LJ5 d;  1YB3 A;  1IZ6 A;  3SWN A;  2LX7 A;  1PC0 A;  3EGX A;  4J9D A;  4EMK A;  3X20 B;  1NJI R;  2IVW A;  1M3B A;  2DF6 A;  3JCM d;  1PD0 A;  3I55 A;  4PJO D;  4NL3 A;  4B9W A;  4IUP A;  3ZBD A;  1IO6 A;  5FU6 B;  2JXB A;  3JCM b;  1B34 A;  4RTV A;  4P74 A;  5EC7 A;  3M0U A;  4KGZ B;  3G1J A;  2HQH A;  4HKE A;  3EGD A;  3QJ6 A;  1EFW A;  2DE0 X;  4EX5 A;  1WYX A;  2AHJ B;  1X2G A;  2EKH A;  3G1Z A;  1B7T A;  2A8E A;  3M0T A;  1NE8 A;  1C0A A;  2CP5 A;  1NJ1 A;  2R5M A;  4M7D G;  1B3Q A;  5D6X A;  3REB B;  2VYT A;  1X56 A;  2RO0 A;  1B76 A;  3MP6 A;  4ZIB A;  1N9R A;  1VQL A;  4P74 C;  2DL7 A;  12AS A;  2PME A;  3CCU A;  3QTC A;  4M4Z A;  4YRS A;  2X4Y A;  4ATO A;  1QE0 A;  2KT1 A;  4J9I A;  4IUR A;  3CCE T;  4B9X A;  1J3T A;  1WLP B;  4YRM A;  3OQ5 A;  4BAC A;  5A0L A;  4J7F A;  3X25 B;  1Z7M A;  1X6B A;  5FU7 C;  5AT1 B;  1K9M C;  1LYL A;  1UJ0 A;  2PUK B;  4M77 G;  3PNW C;  2QXF A;  2NUZ A;  1JBM A;  3M0Q A;  3VKI A;  1TXQ A;  4OMO A;  2ZR2 A;  2KSS A;  3MP8 A;  2F5K A;  3NTI A;  2F1L A;  4C8Q C;  2NUT B;  2QDY B;  2BTT A;  3CBM A;  2EQU A;  2PVD B;  2X9H A;  3OYB A;  4H2X B;  3PVL A;  1Q81 U;  4RQF A;  1PM3 A;  1KHI A;  1D0Z A;  2RQU A;  1YWP A;  1WHL A;  1YFR A;  3LC0 A;  2E3H A;  1PKS A;  3PCO B;  4JS4 A;  2EKO A;  3JCM W;  4LN2 A;  3CCM Q;  2OTJ T;  3M54 A;  2ROL A;  5GAN j;  4ME7 A;  1ZA1 B;  4F7U F;  3CCV Q;  4CS2 A;  1O9S A;  3VS2 A;  2KDS A;  4JRQ A;  1VOM A;  2A08 A;  1OEB A;  2K3Y A;  4UC4 A;  1VQ8 Q;  1M1K U;  2DZ9 A;  5CKH A;  1NG2 A;  4YRK A;  1YFN A;  4JUV A;  1KD1 R;  3HXV A;  4EMK B;  2XMF A;  2M0O A;  2ALY A;  5DLO A;  1M2V B;  3LW5 E;  2ZIN A;  3M53 A;  4P71 C;  1XQH A;  4PL6 A;  2OTL A;  3JB9 F;  5J39 A;  4QVD A;  2RH2 A;  3C95 A;  3NHN A;  4M77 E;  3R07 A;  1RAB B;  3DLL A;  3CC7 Q;  3EGD B;  2QGF B;  1AOJ A;  4DBQ A;  3GOX A;  1SET A;  1MMD A;  3A5Z B;  3MF2 A;  1G3S A;  3HFV A;  3GLX A;  4YRR A;  2JJ9 A;  4LD9 K;  1H3Z A;  1E1O A;  4XU1 A;  4OVA A;  2LQW A;  1VQN Q;  3RAC A;  2HKN A;  1M1K R;  2JOY A;  4X9D A;  3A8H B;  5E3I A;  1EOV A;  3RES A;  1ZHI A;  1WXU A;  2FRW A;  1Q86 R;  1FX7 A;  1U8R A;  1KD1 U;  5LJ3 f;  1MND A;  1X01 A;  4OB0 B;  3S3O A;  1WPY A;  2AZS A;  4AFU C;  4C5G A;  5CKD A;  2JUF A;  2KXD A;  2E5A A;  4N4I A;  1MMG A;  2CUB A;  5CKB A;  2O9S A;  1NM7 A;  1WYD A;  3NGP A;  2LDM A;  1QMC A;  4XTW A;  4P72 A;  1IHW A;  2YT6 A;  4XU0 A;  3L42 A;  1KMN A;  2K57 A;  2QAS A;  4UP8 A;  2ARS A;  4YCV A;  4HVV A;  2FHD A;  4PJJ A;  4L6V 5;  2QEX A;  3QZ9 B;  1B7Y B;  5A0G A;  4EO4 A;  1VQ4 A;  1K8A C;  3EHQ A;  3JB9 I;  2XHC A;  2RHY A;  4A4G A;  1K73 U;  4J5Y A;  3VS5 A;  3CME T;  1IL2 A;  4KBM B;  3TRE A;  3W3S A;  1PCX A;  3CCR A;  4QVC A;  1KD1 C;  1BIA A;  3QKJ A;  4YRJ A;  4OF1 A;  2CKK A;  5GAO r;  4IIM A;  3A1P A;  3I56 T;  4M7A E;  5KYW B;  4CH6 A;  1UB4 A;  1EFN A;  1M8M A;  1YN8 A;  8ATC B;  2VKN A;  3PE0 A;  5CO7 A;  4C5H A;  3VS3 A;  1YJN T;  1VQ6 Q;  3UFG A;  1QVF P;  4XU3 A;  3M58 A;  3WXM B;  1T0H A;  2PNI A;  1QCO A;  1FMW A;  4CC7 A;  2GF7 A;  2RN8 A;  1BBZ A;  3IG2 A;  2V8J A;  5GAO p;  2X3X D;  2ZTG A;  4YRI A;  2HZY A;  2ART A;  1S72 T;  3A7A A;  4JRP A;  3KUF A;  3H6Z A;  3JCM V;  1OQK A;  2NWM A;  1YJW T;  2R5A A;  4P75 C;  2GFU A;  3VS4 A;  4Y28 E;  3KBG A;  5CKE A;  3EFO A;  3THK A;  1EIF A;  1CSK A;  3OYD A;  3JCM Q;  4C0D C;  5KE3 A;  5DM7 R;  3TU4 K;  1RI9 A;  2EJ9 A;  1JEG A;  1A0N B;  2I4O A;  2EGA A;  2JS0 A;  3QII A;  3WVD B;  4LUD A;  4FYX B;  2RF0 A;  3A98 A;  4C8Q G;  1VQP T;  1QVG P;  3JB9 G;  1TUC A;  2BE9 B;  4DPG A;  5LJ3 d;  4NOY A;  2LX9 A;  3REU A;  2IPO B;  5GAN 5;  3NET A;  2P0P A;  1VQN A;  3T9N A;  2J6O A;  2CRE A;  2CSQ A;  5EG2 A;  3J7A F;  2FPD A;  3OSS C;  3GBQ A;  2HBW A;  1VQM Q;  2YRD A;  1YIJ T;  3M4Q A;  4H2U A;  1KFZ A;  3QSU A;  3F70 A;  4C92 F;  2EYW A;  3VYG A;  4BE0 A;  3L2W A;  2AMC A;  3JCM e;  2J6K A;  3JV3 A;  4BE2 A;  2OTJ A;  4OP0 A;  3G71 T;  1NBE B;  4M75 E;  2DL8 A;  5HY6 A;  1OV3 A;  2E5K A;  2HEQ A;  2ZCE A;  4R55 A;  3V7R A;  1TWB A;  4M78 A;  3D7S B;  4PNO A;  1YGB A;  2M9U A;  4A4H A;  1UGS B;  2K4Y A;  4FL6 A;  2FRY A;  3G6E T;  4XEO A;  4UP7 A;  2ECZ A;  5LJ5 h;  2ZPI B;  1RAA B;  1K9M U;  2RA2 A;  2O88 A;  4AG2 C;  2Y4Y A;  2XDD A;  1EQR A;  2LVM A;  1E24 A;  3PGG A;  1K0X A;  4FSX A;  4LD6 A;  2DIL A;  2DM1 A;  3QG1 A;  2ZIM A;  4CH4 A;  1TOV A;  2DXU A;  3JRZ A;  2MCN A;  3G4S A;  5GMK m;  3RNJ A;  3PIP A;  2QHU A;  5AYF A;  2QGG A;  1X27 A;  3VQY A;  5LJ5 g;  1EIY B;  2I2L A;  2VB6 A;  4IUQ A;  1QVG A;  1S72 Q;  3QO5 A;  3KFV A;  4PKC C;  4Q15 A;  4RDX A;  1AVZ C;  1M30 A;  1SHF A;  3J80 E;  1ATI A;  1WI7 A;  2X4W A;  5GMK e;  1H8K A;  1VQL Q;  4IUV A;  1X54 A;  4GBQ A;  2MPX C;  4PFZ A;  1NPP A;  2EFI A;  1SRL A;  5GAN f;  2KXC A;  1J5W A;  1SG5 A;  2K6D A;  3L2U A;  3MQZ A;  4DBH A;  3H8Z A;  1QF6 A;  4JZ3 A;  5D7U A;  3CCQ A;  1VQ5 A;  3L1A A;  4MMK A;  5FWC A;  4M7A C;  3M59 A;  3TSW A;  1W2B S;  2RHQ B;  2LJ3 A;  2CT3 A;  4E2F B;  2MMP A;  1ARK A;  1VQ9 Q;  2LNV A;  1KQS A;  1RAF B;  4F14 A;  2L3R A;  4WTO B;  1VQK T;  4E7Z A;  3A5Y A;  3QPH A;  4XTY A;  2CZ7 B;  1SHG A;  4Z88 A;  5A0D A;  1RUW A;  2M02 A;  2YUQ A;  1G2B A;  1N27 A;  3FEO A;  5GAN g;  3ERR A;  5ELO A;  1Q7Y R;  3OSV A;  2MK5 A;  2DYB A;  4ZNX A;  4JZ4 A;  3HY0 A;  3HRK A;  4OB2 B;  5GAN 8;  2VV5 A;  4KGV B;  1G5H A;  3M0P A;  2KRN A;  1RAC B;  4D8D A;  3CCE A;  1WU7 A;  3X26 B;  2RNA A;  1ZUY A;  2K2V A;  3BE3 A;  3CCS T;  2CGH A;  3UF4 A;  4HA8 A;  2AK5 A;  3G71 A;  4ZN1 A;  3JSC A;  3NEN A;  2E3I A;  4HXJ A;  2FVU A;  1BI0 A;  4E7K A;  4OMP A;  3UH0 A;  2L8D A;  1QLY A;  2RHS B;  2QTX A;  1AWO A;  5ELN A;  3IQL A;  4E51 A;  3PTA A;  2QDL A;  2DNU A;  2JM9 A;  4BY6 B;  4NCX A;  2NLU A;  2ABL A;  2GBQ A;  1AD5 A;  4BUG A;  4XEM A;  3LGL A;  4XU2 A;  4CRI A;  2QEX Q;  1PSF A;  4F16 A;  3CC2 Q;  1RAD B;  1VQM T;  1ZUK A;  2AKW A;  3MO8 A;  3SWN C;  1Q7Y U;  1QCN A;  1H4S A;  1JO8 A;  1WXT A;  2JZ2 A;  2HMA A;  2RK2 A;  3EHR A;  1GL5 A;  2X35 A;  2A37 A;  4JJC A;  4N0A A;  2CJB A;  2QG9 B;  2LCL A;  3QDF A;  4RTW A;  3E9I A;  1JU5 C;  5HGQ A;  1UEB A;  1XOV A;  2LNH B;  4RTT A;  3G4S Q;  4G84 A;  4QT7 A;  2A3L A;  4TWA A;  2ROT A;  1ABQ A;  3X24 B;  2C0T A;  4QW2 A;  1B70 A;  3I9Q A;  1UHC A;  2JVV A;  1D0Y A;  2DAQ A;  3CCQ Q;  1VQ5 Q;  2EW3 A;  1XNI A;  1KSW A;  3S6W A;  1HYO A;  4WJ3 M;  4LDV A;  2KRO A;  3QBY A;  4A4E A;  1QCF A;  1H4V B;  1T0J A;  2SEM A;  4QQG A;  3EH2 A;  3OYH A;  2DMO A;  1JRI A;  1LNX A;  1M1G A;  4FT2 A;  1ZBJ A;  5IT9 E;  4F04 B;  1WHK A;  3OYN A;  4M78 C;  4XQ3 A;  1YJN A;  2Q5H A;  1C1A A;  1AT1 B;  4LVJ A;  4PJO A;  2DD4 A;  1ZSZ C;  4TTV A;  3CCL T;  2QQR A;  2DXB A;  4JS5 A;  1B70 B;  4C5E A;  1YNZ A;  4HVW A;  3OS0 A;  2J3L A;  3CXC S;  1D3B B;  1WA7 A;  3EG0 A;  2EQM A;  5KE2 A;  4C92 C;  3WQZ A;  4FCY A;  2LMJ A;  2NYS A;  1YIT A;  1R0C B;  5KCO A;  3DKM A;  2XID A;  4TVA B;  3RDV A;  3KFU A;  1OI1 A;  3EG9 B;  5KYX A;  2FB7 A;  3HTZ A;  1UE9 A;  1NJI U;  3OYA A;  1D1B A;  4C92 A;  4P72 C;  5IXB A;  4L59 A;  4EIK A;  1NJ5 A;  2B8A A;  5KYN A;  5LJ3 e;  1N8R C;  1JJC A;  1IGU A;  4YRL A;  4Y91 A;  2E4H A;  3OYG A;  1U1T A;  2RI5 A;  3LWH A;  4J9B A;  2QEX T;  2J6F A;  1TUG B;  4GY5 A;  2JTF A;  1MMA A;  1OYX A;  1U3O A;  3CME A;  2Z0W A;  4ZGE B;  5C0M A;  1VQ4 Q;  1BBW A;  2O01 E;  1TTH B;  2CZ6 B;  4H02 A;  2DXC A;  2EGC A;  2DQ0 A;  4H2Y A;  4X5O A;  1V1C A;  3ZEH A;  1Q7Y C;  1K0S A;  2F69 A;  3Q1J A;  2LQK A;  3FJP A;  2DVJ A;  5KYW A;  2P0L A;  1Q82 U;  3L2Z A;  1PD1 A;  5KYU B;  1WX6 A;  1U5S A;  4RTY A;  4Q5W A;  1BBU A;  3ZL7 C;  4BE1 A;  4FIB A;  3MEY A;  3DB4 A;  3OMC A;  1OX8 A;  2EYQ A;  2FYK A;  3MEV A;  1YP5 A;  5FRN A;  5KYY B;  4L5G A;  1D1A A;  4YCU A;  2C0I A;  3HXZ A;  2AIR B;  4K87 A;  2DTI A;  3OYF A;  1YJW A;  2RQV A;  1G5V A;  3EGU A;  1H4Q A;  2M1H A;  1SEM A;  4M75 D;  1Z9Q A;  3A8G B;  3EFR A;  3TEE A;  2RK1 A;  3R6N A;  1VQ8 T;  1Q81 R;  4P3N A;  2L3Q A;  3HRI A;  5GAN 2;  2RHI A;  1SSH A;  1NYF A;  5GAO m;  1AZG B;  4CS3 A;  1EVL A;  3M4Y A;  2P0K A;  3V7S A;  2DU7 A;  6AT1 B;  1G8X A;  1VQ7 Q;  2HBP A;  3GNG A;  5GAM j;  3CQT A;  4RCC A;  4WJ4 A;  3UPU A;  1QVG S;  2L89 A;  1M90 R;  4N4G A;  1D3B A;  1NYQ A;  1TS9 A;  1AZE A;  4UP9 A;  2M0Y A;  3SDZ A;  1E6G A;  4TQD A;  3G6E Q;  2ZT5 A;  2EWN A;  2OAW A;  4P71 A;  3E2U A;  3I35 A;  1X2K A;  1VQO T;  2HDA A;  1M2V A;  4DOW A;  2DZC A;  4BW9 A;  2CUD A;  1UGV A;  2JMC A;  2CP2 A;  4M75 B;  3TEH B;  1TU0 B;  3MPU B;  4ELZ C;  1JJC B;  2FZC B;  4M78 D;  5CQY A;  1N9S A;  4GLK A;  3RKX A;  4HT8 A;  4FYY B;  3UAT A;  2JTM A;  1FMK A;  3VS0 A;  4DBR A;  3CCU T;  3GF5 A;  3P8T A;  2V8K A;  2DRK A;  3CCR T;  1XJW B;  4C92 D;  2CSI A;  4PFP A;  2EQK A;  5GMK h;  2CZ0 B;  4Z8A A;  2IIM A;  1V76 A;  4YRN A;  4HCZ A;  3RL6 A;  4A4F A;  4JJB A;  4TVR A;  1VA7 A;  1ZSZ A;  3TCJ A;  1B7Y A;  2YXY A;  5GAO l;  1M1K C;  5IHN A;  1Y96 A;  3JB9 H;  1G3W A;  3JAM E;  1W4S A;  3JCM X;  4D6W A;  3RUX A;  2DVE A;  3KXT A;  1VQ7 T;  1KOG A;  4CC2 A;  4EPC A;  2Q5I A;  1N8R R;  1K1Z A;  2CH4 A;  5CVI A;  2JS2 A;  2KEA A;  1Y0M A;  4MML A;  4DOV A;  3HXX A;  2ESW A;  2KK4 A;  4RUG A;  1BI3 A;  1M5Q 1;  4HVC A;  3CCQ T;  1VQ5 T;  2ZPH B;  4M7D F;  4LDX A;  4Q6G A;  2ED0 A;  1X2Q A;  3E9H A;  2DJQ A;  3JCM c;  1VQ8 A;  4OB3 B;  4CS4 A;  2RHX A;  4F7U B;  1VQP A;  3RMS A;  4AFZ C;  4HVU A;  1U1S A;  2RHQ A;  3M4G A;  1IXD A;  3EG1 A;  5GAN h;  3LH5 A;  2PQW A;  2ZPE B;  3IAL A;  2LQ8 A;  1G3T A;  5LJ5 j;  2DL4 A;  3JCM f;  4C0G A;  2PU9 B;  3PFS A;  2DO3 A;  1RAE B;  4Z02 A;  4A54 A;  2R57 A;  2QQ9 A;  1YCS B;  2GNC A;  2ED1 A;  2YDL A;  2QAZ A;  5IAY A;  1R8O B;  4M77 F;  4ZN3 A;  1K73 R;  1BKB A;  5A2Q E;  2ATC B;  4M7A B;  4ESR A;  4KUD K;  3OW2 A;  1KJW A;  2GQV A;  3CPW S;  3EFO B;  3NPF A;  2ZZF A;  1H4T A;  2J05 A;  1B07 A;  1G51 A;  1ASZ A;  5D6W A;  1UDL A;  2DBM A;  3TQ7 P;  2XDB A;  3CC4 T;  5FW9 A;  4R56 A;  4J9G A;  4KUL A;  3REX A;  1WFW A;  4J7I A;  1X6O A;  1MNE A;  5CR2 A;  3ME9 A;  2E65 A;  4OMM A;  2ZT6 A;  4YTL A;  3G6E A;  1M3C A;  3DSQ A;  1NNH A;  3INZ A;  2ZAE A;  1XTD A;  1Q86 U;  1RI0 A;  1UG1 A;  4OMQ A;  4YRP A;  3CCR Q;  3IKL A;  4RMO A;  1LJO A;  1U06 A;  1NJI C;  1SRY A;  4YRE A;  2JTE A;  3CCE Q;  1YJ9 T;  4E7L A;  4GLM A;  3G4S T;  4ELY C;  1M90 C;  4CI0 C;  2K5I A;  2KVQ G;  1GRI A;  3O8V A;  3JB9 D;  1SPK A;  5D6Y A;  3RER A;  1UFF A;  2DIQ A;  3AHU A;  3OA6 A;  2W0Z A;  2RHZ A;  1NYG A;  2KYM A;  3BY7 A;  4IKF A;  5I11 A;  2I4N A;  3H41 A;  1F1B B;  3REA B;  1AHJ B;  1RLQ C;  2DER A;  3O5Z A;  1Q82 C;  1PYS A;  5L8R E;  4LNP A;  1JXO A;  2A28 A;  1VUB A;  3U23 A;  3OYJ A;  4HWP A;  1YIJ A;  3HY1 A;  2F2X A;  3OBY A;  2DYI A;  2IY5 B;  1KC8 C;  3OMG A;  5C52 B;  1YFT A;  1WLE A;  3A31 A;  1ADY A;  2CP0 A;  3MP1 A;  5GAO q;  4M75 F;  1VYV A;  2Y90 A;  4Z89 A;  1VYT A;  3MCA B;  5KCH A;  3A8O B;  3A74 A;  2L5Q A;  4NL2 A;  1B8A A;  3NFC A;  3VYH B;  1ASY A;  2QQB A;  3CCV T;  1X55 A;  4FT4 A;  3OW2 S;  1SSF A;  2QHS A;  3VRZ A;  3ULR B;  1TH7 A;  5CCA A;  1RL2 A;  1ADJ A;  2E6Z A;  2HSP A;  3C94 A;  3P8D A;  3CCL A;  4YDQ A;  1NEB A;  1SF9 A;  1S72 A;  3S3M A;  1G3Y A;  2IY5 A;  3L4G B;  3UWN A;  2A7Y A;  3I7F A;  1D1C A;  1AWJ A;  3PT9 A;  1E22 A;  1YFS A;  4BWA A;  1RAI B;  1BI2 A;  2CP6 A;  1SRM A;  4IIO A;  1OUL A;  3H0F A;  2C0O A;  2GGR A;  3UDC A;  4YPF A;  3VUZ A;  4OMN A;  1I8F A;  1GCQ A;  2DD5 A;  1R77 A;  2Q7G A;  2YWW A;  5K1P A;  4YRG A;  5FRO A;  2I0N A;  1N5Z A;  4LVK A;  4F7U E;  5GAN d;  3E9G A;  3CCS A;  5GAM e;  4J6Y A;  4EMH A;  3HRS A;  3FIF A;  1FWZ A;  2BZX A;  2CH4 W;  4C92 B;  2KQW A;  3CC4 A;  4FYV B;  5I2M A;  3CBP A;  3PZC A;  3NMZ C;  1MHN A;  1PHT A;  1ZSG A;  2QK0 A;  4HT9 A;  2K2M A;  1Y57 A;  4ZGJ B;  3HPW A;  2RJF A;  1ZBX A;  1YJ9 Q;  4OGC A;  1RIQ A;  4DEX A;  4QKU A;  5GAN 7;  2P4T A;  3PVQ A;  2LJ0 A;  1USY A;  4AFQ C;  3CMQ A;  3HFZ A;  3OYY A;  1V29 B;  2DET A;  4C0Z A;  1WXB A;  1YHQ T;  2COY A;  2DDZ A;  4V2S A;  2MWP A;  2DL3 A;  2QA4 Q;  2DRM A;  4E7H A;  4KGX B;  2RHS A;  3GIB A;  4RTU A;  2KMT A;  1K9M R;  1LPL A;  3TUP A;  4BB7 A;  3BW1 A;  2NS6 A;  3OS2 A;  4KT0 E;  2RHU A;  1NEG A;  2D9T A;  1HJD A;  1VYU A;  4YYE A;  4A53 A;  3EFS A;  4M77 D;  1KQ2 A;  1WQW A;  2J06 A;  3HXU A;  2O31 A;  2X4J A;  3PMT A;  2J3M A;  4PJO F;  1ZUU A;  3M4P A;  3MET A;  1S1N A;  2AKW B;  3QNE A;  1I1J A;  3VUB A;  4JDS A;  3HFO A;  4M75 G;  3C12 A;  1IB8 A;  2VGN A;  2LCS A;  4M77 A;  4C8Q E;  1VQN T;  2ZNJ A;  1WJS A;  1AWX A;  4RCB A;  2LRQ A;  2HL5 C;  2F2V A;  3LYI A;  3CC2 A;  4KH0 B;  3C4S A;  3ER0 A;  5C53 B;  1K8A R;  3CC4 Q;  1YJW Q;  4X34 A; 
#chains in the Genus database with same CATH homology
 1E1T A;  4IUU A;  2XG8 D;  2JNG A;  5LJ3 j;  2MWO A;  1NJ6 A;  4WF2 A;  1VQZ A;  2WSC E;  1N8R U;  2C8M A;  2D0Q B;  4TQF A;  2ZT7 A;  4BDY A;  3LX7 A;  4N0A C;  4LDY A;  4C5I A;  1JJ2 S;  3NEM A;  5J26 A;  1NYR A;  2HD0 A;  4YRT A;  5FU6 C;  5LJ3 h;  1Q86 C;  2R58 A;  1OZ2 A;  1QW1 A;  2E5Q A;  4HWS A;  5GMK j;  3HFN A;  4YRC A;  2LT1 A;  3FC3 A;  5CK9 A;  4M78 G;  1LOJ A;  5GAN 6;  4J6X A;  2P0Q A;  1OZ3 A;  3LWI A;  2E12 A;  3G7Z A;  4P73 A;  5F5W A;  3X28 B;  1KMM A;  2RJD A;  2VGM A;  3BDU A;  2G3R A;  2LC4 A;  3QYH B;  1YI2 A;  3M9Q A;  1KG1 A;  3OB9 A;  5GAM h;  4RKU E;  4ZGD B;  4H2V A;  3HL8 A;  2C06 A;  2QQS A;  2ZIO A;  5GAM g;  2DPP B;  11AS A;  1M9S A;  1IRE B;  3S3N A;  2DQ3 A;  4C8Q D;  3CXC A;  1N9W A;  4PHC A;  3M55 A;  1VQ9 T;  3QZ5 B;  2XK0 A;  4C92 G;  5GAN 3;  4PG3 A;  4KR3 A;  5K1X A;  3RKW A;  1JB0 E;  1UGP B;  4II1 A;  2G4C A;  2VXE A;  3PMI A;  2K3X A;  2PVO B;  4M7A F;  2ALY B;  2CIM A;  1HXD A;  4X9C A;  4N4H A;  2IG0 A;  3CD6 A;  5KNN A;  5CIU A;  2RJE A;  1Y07 A;  2P5I A;  2ZXF A;  3QUI A;  4C8Q F;  3GP8 A;  3VBB A;  4PJO G;  2X4X A;  2XDP A;  2DXT A;  4C8Q B;  4TVY A;  3V8K A;  3IKM B;  4EMG A;  2KY9 A;  4O2D A;  4IUT A;  4QQD A;  3VQX A;  4P3O A;  3PIO A;  1Q81 C;  3A8M B;  2MF2 A;  3NTH A;  4H2T A;  1VQ4 T;  3SWN B;  4NS5 A;  3VU3 C;  3CCJ T;  3QYG B;  4YRF A;  3QO7 A;  2JN0 A;  3CBO A;  3VQV A;  4C8Q A;  3HKS A;  1YCY A;  4M75 A;  5LJ5 f;  2VC8 A;  5HK3 A;  2HQE A;  5FU7 B;  3WVE B;  5GMK i;  4FM4 B;  3UGQ A;  5DY9 A;  1FXX A;  2QHT A;  1M90 U;  3FLG A;  4KUI A;  2RB6 A;  2ODR C;  2CJ9 A;  3P8V A;  2ZR3 A;  3P8H A;  1ZQ1 A;  2DJZ A;  3QJY A;  2BUD A;  2QA4 T;  4K86 A;  4M7A D;  3LH0 A;  3LGF A;  2E41 A;  3OYL A;  2ZNI A;  3SB2 A;  2ZCF B;  3ICA A;  4JRK A;  2QQA A;  4PJO E;  3FRN A;  1QVP A;  4H2X A;  1VQL T;  3PCO A;  2XTI A;  1YIT T;  5GAN e;  3V7C A;  3BFM A;  3QO8 A;  2EQJ A;  3MEA A;  4O5V A;  5FLX E;  4M78 F;  3QXE B;  4LDW A;  4MZT A;  3L2R A;  2EAY A;  1WQ7 A;  1HK9 A;  2Y4X A;  1H64 1;  4LDU A;  3NEL A;  5DLQ E;  2E6N A;  4F7U A;  3RGL A;  2ARU A;  1K8A U;  2DEQ A;  1W2B A;  3CC2 T;  4M7A A;  2K5L A;  4MZP A;  5IN1 A;  2BIV A;  2ZZE A;  3LSQ A;  4HCB A;  1YI2 T;  1VIE A;  2RI2 A;  1PSE A;  2EJF A;  2DTH A;  4JJN K;  3OBW A;  2YLB A;  3J81 E;  3GNF B;  3FDR A;  1Z7N A;  4KR2 A;  1SES A;  3E9F A;  2HQX A;  1GGM A;  4UPA A;  4M7D E;  2RM4 A;  2WAC A;  5GAO n;  4RQE A;  1K73 C;  3A7R A;  3OYE A;  3A5Z A;  1Y7X A;  4KQE A;  5C6S A;  5I2S A;  1SER A;  3HP9 A;  3CMA A;  4PLI A;  4M78 B;  3OY9 A;  3HRU A;  4LVM A;  4EMK C;  4OGE A;  4XAX B;  3URG A;  3OYM A;  4H2W A;  3I55 T;  4HWR A;  1B34 B;  4J6W A;  2E10 A;  4P5N A;  3TEH A;  4XTV A;  1M4Z A;  3QHS A;  1W66 A;  4J15 A;  1PYS B;  4JRI A;  4RG8 A;  4J83 A;  3CCV A;  4JLG A;  3HRT A;  3SFM A;  4M77 B;  3JCM g;  1WJQ A;  1X2H A;  4M7A G;  2FL7 A;  1EIY A;  2HNI A;  3UGT A;  1I5L A;  2LTO A;  5LL6 S;  2XU8 A;  4ZTU B;  2Q7H A;  4LVI A;  3P8Y A;  4XK8 E;  2ZPF B;  3MF1 A;  3JB9 J;  3CCJ A;  1VQO A;  2WSE E;  3NTK A;  3V8J A;  4RG2 A;  4E7J A;  4CH3 A;  4BY6 C;  3ASK A;  1Y96 B;  2D6F A;  4AH6 A;  1N6A A;  3L4G A;  3E19 A;  1MGQ A;  4F7U G;  2V8I A;  4E47 A;  2DK3 A;  3CD6 T;  1I81 A;  1QVF S;  5CKF A;  1Y71 A;  2EL9 A;  2MI6 A;  1VIF A;  4HWT A;  3TEG A;  1VQM A;  1VQ6 A;  1HTT A;  2PMF A;  2QHV A;  4HCC A;  1VQ7 A;  4HWO A;  4YCW A;  1HC7 A;  3JCM J;  2E3C A;  2EJG A;  3FB9 A;  4QQ6 A;  4MZM A;  2EIF A;  3HXY A;  3BDL A;  4BI3 A;  4BI8 B;  2XIC A;  5CQX A;  2AMC B;  2CJA A;  4VUB A;  3N5B B;  3ZFJ A;  3JCM P;  4MDW A;  4ZTF A;  3CC7 A;  5KH6 A;  3HHT B;  1JJ2 A;  3P8B B;  2VXF A;  4OB1 B;  4E7I A;  1VQ9 A;  4TVW A;  5GAM f;  4M75 C;  3RMQ A;  4FU6 A;  4HT4 A;  5LJ3 g;  5J3B A;  2PUO B;  4A4K A;  2XI9 A;  2MAM A;  2RD1 A;  2E64 A;  2H3J A;  4M7D D;  1WNL A;  4M7D C;  1QVF A;  4JLI A;  3VJP A;  1KHC A;  3L2Q A;  3CPF A;  5HK0 A;  2CZ1 B;  3HXW A;  3VQW A;  1NZ9 A;  3RIR A;  2BKD N;  4P75 A;  1UGR B;  4YP0 A;  1O75 A;  2GCX A;  1DJ7 B;  2QA4 A;  4M7D A;  1VQK A;  3QDR B;  4P73 C;  3OYK A;  4RMF A;  3MHX A;  1BIB A;  4M77 C;  2ZPB B;  2O4X A;  3CMA T;  4K88 A;  2VUB A;  4XTZ A;  5GAN 4;  1YJ9 A;  3LLR A;  1G5I A;  4PJO B;  4LVL A;  2YLC A;  1QP3 A;  4QVZ A;  3CEY A;  3M56 A;  2WSF E;  2OTL T;  3VV0 A;  2GFA A;  2DKG A;  4M7D B;  3A32 A;  1VQ6 T;  3OS5 A;  4J8O A;  1USY C;  4TVA A;  3CCM A;  2YRV A;  3RF1 A;  2F5T X;  2I4M A;  4C0F A;  2ZPG B;  2KAF A;  2CYZ B;  2LT4 A;  4P3P A;  3L2V A;  1WGS A;  4XTX A;  3OS1 A;  3OD1 A;  4CH5 A;  3M57 A;  2RJC A;  3LSS A;  1NJ8 A;  5GAM d;  1NPR A;  4DA4 A;  3SD4 A;  1M1F A;  1P92 A;  3OYC A;  2YHT A;  4WI1 A;  5GMK l;  1I4K 1;  2CS7 A;  1BI1 A;  4MDX A;  3CC7 T;  4PJO C;  4OMF B;  1EVK A;  4C92 E;  1GXI E;  4O6J A;  5HKC A;  4DQ2 A;  3QO3 A;  2K5F A;  3HFZ B;  1KC8 U;  2XKO C;  2DIG A;  4ZTJ A;  4LNS A;  1QP2 A;  5I21 A;  5CAI A;  3E1S A;  1L0W A;  5C51 B;  3R6O A;  2I4L A;  4M78 E;  2E1H A;  3EAE A;  5FRM A;  3A8L B;  3M5A A;  2ZZG A;  2PVG B;  2QI2 A;  3RKY A;  3I56 A;  1WJR A;  2OAU A;  1BYM A;  4PLL A;  2ZZD A;  3DLM A;  1FYF A;  3BJU A;  4BDZ A;  4XTU A;  3GPL A;  4ZTZ B;  1M8V A;  3JCM h;  1UGQ B;  4L87 A;  3DB3 A;  4YRO A;  4G85 A;  2O4X B;  2DTO A;  4C0D B;  3OYI A;  2XD0 A;  4EDU A;  4YRQ A;  3MEU A;  2ODR D;  2M16 A;  1YBY A;  3UT1 A;  1YHQ A;  1KQS S;  1KQ1 A;  5LJ5 e;  4OLF A;  4BD3 A;  2RI3 A;  2Q7E A;  2LCC A;  2E70 A;  2ZT8 A;  2XGT A;  2ZGW A;  3CPW A;  3A7U A;  2C7I A;  2DU5 A;  3CCM T;  1NJ2 A;  4H2S A;  1X75 C;  2HAX A;  3V8L A;  5M9O A;  3HSB A;  4BI4 A;  3MEW A;  5LJ5 d;  1YB3 A;  1IZ6 A;  3SWN A;  4EMK A;  3X20 B;  2IVW A;  3JCM d;  3I55 A;  4PJO D;  4NL3 A;  4B9W A;  4IUP A;  3ZBD A;  5FU6 B;  3JCM b;  1B34 A;  4P74 A;  4HKE A;  3QJ6 A;  1EFW A;  4EX5 A;  2AHJ B;  1X2G A;  3G1Z A;  2A8E A;  1NE8 A;  1C0A A;  1NJ1 A;  2R5M A;  4M7D G;  5D6X A;  1X56 A;  2VYT A;  2RO0 A;  1B76 A;  3MP6 A;  4ZIB A;  1N9R A;  1VQL A;  4P74 C;  12AS A;  2PME A;  3CCU A;  3QTC A;  4YRS A;  2X4Y A;  4ATO A;  1QE0 A;  4IUR A;  3CCE T;  4B9X A;  4YRM A;  3OQ5 A;  4BAC A;  5A0L A;  4J7F A;  3X25 B;  1Z7M A;  5FU7 C;  1K9M C;  1LYL A;  2PUK B;  4M77 G;  3PNW C;  2QXF A;  3VKI A;  1JBM A;  2ZR2 A;  2KSS A;  3MP8 A;  2F5K A;  3NTI A;  4C8Q C;  2QDY B;  3CBM A;  2EQU A;  2PVD B;  3OYB A;  4H2X B;  1Q81 U;  4RQF A;  1KHI A;  1YFR A;  3LC0 A;  3PCO B;  4JS4 A;  2EKO A;  3JCM W;  2OTJ T;  3M54 A;  5GAN j;  4ME7 A;  4F7U F;  4CS2 A;  1O9S A;  2KDS A;  4JRQ A;  2K3Y A;  4UC4 A;  1M1K U;  2DZ9 A;  5CKH A;  4YRK A;  4JUV A;  3HXV A;  4EMK B;  2M0O A;  2ALY A;  5DLO A;  3LW5 E;  2ZIN A;  3M53 A;  4P71 C;  1XQH A;  4PL6 A;  2OTL A;  3JB9 F;  5J39 A;  4QVD A;  2RH2 A;  3C95 A;  4M77 E;  3R07 A;  3DLL A;  3GOX A;  1SET A;  3A5Z B;  3MF2 A;  1G3S A;  3HFV A;  3GLX A;  4YRR A;  4LD9 K;  1H3Z A;  1E1O A;  4XU1 A;  4OVA A;  3RAC A;  2JOY A;  4X9D A;  3A8H B;  5E3I A;  1EOV A;  3RES A;  1ZHI A;  1FX7 A;  1U8R A;  1KD1 U;  5LJ3 f;  1X01 A;  4OB0 B;  3S3O A;  1WPY A;  4C5G A;  5CKD A;  2JUF A;  2E5A A;  4N4I A;  5CKB A;  1WYD A;  2LDM A;  4XTW A;  4P72 A;  4XU0 A;  3L42 A;  1KMN A;  2K57 A;  4UP8 A;  2ARS A;  4YCV A;  2FHD A;  4L6V 5;  2QEX A;  3QZ9 B;  1B7Y B;  5A0G A;  4EO4 A;  1VQ4 A;  1K8A C;  3JB9 I;  2XHC A;  2RHY A;  4A4G A;  1K73 U;  4J5Y A;  3CME T;  1IL2 A;  4KBM B;  3TRE A;  3W3S A;  3CCR A;  4QVC A;  1KD1 C;  1BIA A;  3QKJ A;  4YRJ A;  4OF1 A;  2CKK A;  5GAO r;  3I56 T;  4M7A E;  4CH6 A;  1UB4 A;  5CO7 A;  4C5H A;  1YJN T;  3UFG A;  4XU3 A;  3M58 A;  3WXM B;  2GF7 A;  3IG2 A;  2V8J A;  5GAO p;  2ZTG A;  4YRI A;  2ART A;  1S72 T;  3A7A A;  4JRP A;  3KUF A;  3H6Z A;  3JCM V;  1YJW T;  2R5A A;  4P75 C;  2GFU A;  4Y28 E;  3KBG A;  5CKE A;  1EIF A;  3OYD A;  3JCM Q;  4C0D C;  5KE3 A;  5DM7 R;  3TU4 K;  2EJ9 A;  2I4O A;  3QII A;  3WVD B;  4C8Q G;  1VQP T;  3JB9 G;  4DPG A;  5LJ3 d;  4NOY A;  2LX9 A;  3REU A;  5GAN 5;  3NET A;  2P0P A;  1VQN A;  3T9N A;  5EG2 A;  3J7A F;  3OSS C;  3M4Q A;  1YIJ T;  4H2U A;  3QSU A;  3F70 A;  4C92 F;  3VYG A;  4BE0 A;  3L2W A;  2AMC A;  3JCM e;  4BE2 A;  2OTJ A;  4OP0 A;  3G71 T;  4M75 E;  5HY6 A;  2ZCE A;  4R55 A;  3V7R A;  4M78 A;  4PNO A;  1YGB A;  2M9U A;  4A4H A;  1UGS B;  2K4Y A;  4FL6 A;  3G6E T;  4XEO A;  4UP7 A;  5LJ5 h;  2ZPI B;  1K9M U;  2RA2 A;  2Y4Y A;  2XDD A;  1EQR A;  2LVM A;  1E24 A;  3PGG A;  4FSX A;  4LD6 A;  3QG1 A;  4CH4 A;  2ZIM A;  3JRZ A;  2DXU A;  3G4S A;  5GMK m;  3PIP A;  2QHU A;  5AYF A;  3VQY A;  5LJ5 g;  1EIY B;  2I2L A;  4IUQ A;  1QVG A;  3QO5 A;  4PKC C;  4Q15 A;  4RDX A;  3J80 E;  1ATI A;  2X4W A;  5GMK e;  4IUV A;  1X54 A;  1NPP A;  2EFI A;  5GAN f;  1J5W A;  3L2U A;  3MQZ A;  3H8Z A;  1QF6 A;  3CCQ A;  1VQ5 A;  3L1A A;  4MMK A;  4M7A C;  3M59 A;  1W2B S;  2RHQ B;  2MMP A;  2LNV A;  1KQS A;  2L3R A;  1VQK T;  3A5Y A;  3QPH A;  4XTY A;  2CZ7 B;  5A0D A;  1N27 A;  3FEO A;  5GAN g;  3ERR A;  5ELO A;  3OSV A;  3HY0 A;  3HRK A;  4OB2 B;  5GAN 8;  2VV5 A;  1G5H A;  3CCE A;  1WU7 A;  3X26 B;  2K2V A;  3CCS T;  2CGH A;  4HA8 A;  3G71 A;  4ZN1 A;  3JSC A;  3NEN A;  2FVU A;  1BI0 A;  4E7K A;  3UH0 A;  2L8D A;  2RHS B;  2QTX A;  5ELN A;  4E51 A;  3PTA A;  4BY6 B;  4NCX A;  2NLU A;  4BUG A;  4XEM A;  3LGL A;  4XU2 A;  4CRI A;  1PSF A;  2AKW A;  1VQM T;  3MO8 A;  3SWN C;  1Q7Y U;  1H4S A;  2JZ2 A;  2RK2 A;  2X35 A;  4N0A A;  2CJB A;  2LCL A;  3E9I A;  5HGQ A;  1UEB A;  1XOV A;  4G84 A;  2A3L A;  4TWA A;  3X24 B;  4QW2 A;  1B70 A;  2JVV A;  2DAQ A;  1XNI A;  3S6W A;  4WJ3 M;  4LDV A;  3QBY A;  4A4E A;  1H4V B;  4QQG A;  3OYH A;  1JRI A;  1LNX A;  1M1G A;  4FT2 A;  5IT9 E;  3OYN A;  4M78 C;  4XQ3 A;  1YJN A;  2Q5H A;  4LVJ A;  4PJO A;  2DD4 A;  4TTV A;  3CCL T;  2QQR A;  2DXB A;  4JS5 A;  1B70 B;  4C5E A;  2J3L A;  3OS0 A;  3CXC S;  1D3B B;  2EQM A;  5KE2 A;  4C92 C;  3WQZ A;  1YIT A;  5KCO A;  3DKM A;  2XID A;  4TVA B;  3KFU A;  1OI1 A;  2FB7 A;  3HTZ A;  1NJI U;  3OYA A;  4C92 A;  4P72 C;  4L59 A;  1NJ5 A;  2B8A A;  5LJ3 e;  1N8R C;  1JJC A;  4YRL A;  4Y91 A;  3OYG A;  1U1T A;  2RI5 A;  3LWH A;  2QEX T;  4GY5 A;  2JTF A;  1OYX A;  3CME A;  4ZGE B;  5C0M A;  1BBW A;  2O01 E;  2CZ6 B;  4H02 A;  2DXC A;  2DQ0 A;  4X5O A;  4H2Y A;  3ZEH A;  1Q7Y C;  2F69 A;  3Q1J A;  2LQK A;  3FJP A;  2P0L A;  1Q82 U;  3L2Z A;  4Q5W A;  1BBU A;  4BE1 A;  4FIB A;  3MEY A;  3DB4 A;  3OMC A;  2EYQ A;  2FYK A;  3MEV A;  5FRN A;  4L5G A;  4YCU A;  3HXZ A;  4K87 A;  2DTI A;  3OYF A;  1YJW A;  1G5V A;  1H4Q A;  2M1H A;  4M75 D;  3A8G B;  3EFR A;  3TEE A;  2RK1 A;  1VQ8 T;  4P3N A;  3HRI A;  5GAN 2;  2RHI A;  5GAO m;  4CS3 A;  1EVL A;  3M4Y A;  2P0K A;  3V7S A;  2DU7 A;  2HBP A;  3GNG A;  5GAM j;  4RCC A;  4WJ4 A;  3UPU A;  1QVG S;  2L89 A;  4N4G A;  1D3B A;  1NYQ A;  4UP9 A;  3SDZ A;  4TQD A;  2ZT5 A;  2EWN A;  4P71 A;  1VQO T;  4DOW A;  2DZC A;  4BW9 A;  4M75 B;  3TEH B;  4ELZ C;  1JJC B;  4M78 D;  5CQY A;  1N9S A;  4GLK A;  3RKX A;  4HT8 A;  2JTM A;  3CCU T;  3GF5 A;  3P8T A;  2V8K A;  3CCR T;  4C92 D;  2EQK A;  5GMK h;  2CZ0 B;  4YRN A;  4HCZ A;  3RL6 A;  4A4F A;  3TCJ A;  4TVR A;  1B7Y A;  5GAO l;  1M1K C;  1Y96 A;  3JB9 H;  1G3W A;  3JAM E;  1W4S A;  3JCM X;  4D6W A;  3RUX A;  2DVE A;  3KXT A;  1VQ7 T;  1KOG A;  4EPC A;  2Q5I A;  5CVI A;  4MML A;  4DOV A;  3HXX A;  2KK4 A;  1BI3 A;  1M5Q 1;  4HVC A;  3CCQ T;  1VQ5 T;  2ZPH B;  4M7D F;  4LDX A;  4Q6G A;  3E9H A;  3JCM c;  1VQ8 A;  4OB3 B;  4CS4 A;  2RHX A;  4F7U B;  1VQP A;  3RMS A;  2RHQ A;  1U1S A;  3M4G A;  5GAN h;  2PQW A;  2ZPE B;  3IAL A;  2LQ8 A;  1G3T A;  5LJ5 j;  3JCM f;  4C0G A;  2PU9 B;  3PFS A;  2DO3 A;  4Z02 A;  4A54 A;  2R57 A;  2QQ9 A;  5IAY A;  1R8O B;  4M77 F;  4ZN3 A;  1BKB A;  5A2Q E;  4M7A B;  4KUD K;  3OW2 A;  2GQV A;  3CPW S;  2ZZF A;  1H4T A;  1G51 A;  1ASZ A;  5D6W A;  2XDB A;  3CC4 T;  4R56 A;  4KUL A;  3REX A;  4J7I A;  1X6O A;  5CR2 A;  3ME9 A;  2E65 A;  2ZT6 A;  4YTL A;  3G6E A;  3DSQ A;  1NNH A;  3INZ A;  1XTD A;  1Q86 U;  1RI0 A;  4YRP A;  3IKL A;  4RMO A;  1LJO A;  1NJI C;  1SRY A;  4YRE A;  1YJ9 T;  4E7L A;  3G4S T;  4ELY C;  1M90 C;  4CI0 C;  2K5I A;  2KVQ G;  3O8V A;  3JB9 D;  5D6Y A;  3RER A;  2DIQ A;  3AHU A;  3OA6 A;  2RHZ A;  3BY7 A;  4IKF A;  2I4N A;  1AHJ B;  1Q82 C;  1PYS A;  5L8R E;  1VUB A;  3OYJ A;  4HWP A;  1YIJ A;  3HY1 A;  3OBY A;  2IY5 B;  1KC8 C;  3OMG A;  5C52 B;  1YFT A;  1WLE A;  3A31 A;  1ADY A;  3MP1 A;  5GAO q;  4M75 F;  2Y90 A;  5KCH A;  3MCA B;  3A8O B;  3A74 A;  2L5Q A;  4NL2 A;  1B8A A;  3NFC A;  3VYH B;  1ASY A;  2QQB A;  3CCV T;  1X55 A;  4FT4 A;  3OW2 S;  1SSF A;  2QHS A;  1TH7 A;  5CCA A;  1RL2 A;  1ADJ A;  2E6Z A;  3C94 A;  3P8D A;  3CCL A;  4YDQ A;  1S72 A;  3S3M A;  1G3Y A;  2IY5 A;  3L4G B;  3UWN A;  2A7Y A;  3I7F A;  3PT9 A;  1E22 A;  1YFS A;  4BWA A;  1BI2 A;  3UDC A;  4YPF A;  3VUZ A;  1I8F A;  2DD5 A;  2Q7G A;  5K1P A;  4YRG A;  5FRO A;  4LVK A;  4F7U E;  5GAN d;  3E9G A;  3CCS A;  5GAM e;  4J6Y A;  4EMH A;  3HRS A;  3FIF A;  1FWZ A;  4C92 B;  2KQW A;  3CC4 A;  5I2M A;  3CBP A;  3PZC A;  1MHN A;  4HT9 A;  4ZGJ B;  3HPW A;  2RJF A;  1ZBX A;  4OGC A;  1RIQ A;  5GAN 7;  2P4T A;  1USY A;  3CMQ A;  3HFZ A;  3OYY A;  1V29 B;  4C0Z A;  1YHQ T;  2DDZ A;  4V2S A;  2MWP A;  4E7H A;  2RHS A;  3GIB A;  2KMT A;  3TUP A;  4BB7 A;  3BW1 A;  2NS6 A;  3OS2 A;  4KT0 E;  2RHU A;  2D9T A;  4YYE A;  4A53 A;  3EFS A;  4M77 D;  1KQ2 A;  1WQW A;  3HXU A;  2X4J A;  3PMT A;  2J3M A;  4PJO F;  3M4P A;  3MET A;  2AKW B;  3QNE A;  3VUB A;  4JDS A;  3HFO A;  4M75 G;  3C12 A;  2VGN A;  4M77 A;  4C8Q E;  1VQN T;  2ZNJ A;  1WJS A;  4RCB A;  2LRQ A;  3LYI A;  3CC2 A;  3C4S A;  3ER0 A;  5C53 B;  4X34 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...