1WQGA

Crystal structure of ribosome recycling factor from mycobacterium tuberculosis
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
184
structure length
184
Chain Sequence
IDEALFDAEEKMEKAVAVARDDLSTIRTGRANPGMFSRITIDYYGAATPITQLASINVPEARLVVIKPYEANQLRAIETAIRNSDLGVNPTNDGALIRVAVPQLTEERRRELVKQAKHKGEEAKVSVRNIRRKAMEELHRIRKEGEAGEDEVGRAEKDLDKTTHQYVTQIDELVKHKEGELLEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title X-ray structural studies of Mycobacterium tuberculosis RRF and a comparative study of RRFs of known structure. Molecular plasticity and biological implications
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Translation
molecule keywords Ribosome recycling factor
total genus 70
structure length 184
sequence length 184
ec nomenclature
pdb deposition date 2004-09-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01765 RRF Ribosome recycling factor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.132.20 Mainly Alpha Orthogonal Bundle Topoisomerase I; Chain A, domain 4 Topoisomerase I; Chain A, domain 4 1wqgA01
3.30.1360.40 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 Gyrase A; domain 2 1wqgA02
5MLC9 5JSBB 3OREA 1WQFA 1AB4A 1XXAA 2ZFZA 4J3NA 2P5MA 4KC6A 4G0UA 3ERED 5CJ9A 4KDDA 2Y3PA 4KB4A 3FOEA 2KWAA 3OEPA 3L4KA 3LHPS 1EK8A 4GFQA 1XXBA 1IS1A 3CAGA 1ISEA 4L8IA 4KB2A 1WIHA 1BJTA 1ZVUA 3VA7A 3QX3A 2RGRA 1GE9A 1DD5A 3LF9A 4JLRC 3LPXA 3LAPA 4G0WA 1EH1A 1B4BA 2PHCB 3MMLB 3FOFA 3NUHA 3FHZA 2XCQA 1XXCA 3LAJA 1B4AA 3L4JA 3OPFA 1WQHA 5JVOA 2XCOA 4FM9A 1WQGA 5JSNB 1BGWA 4DDQA 3BUEA 4G0VA 3V4GA 4KAWX 2XCRB 1F9NA 4OYDB 1Y698
chains in the Genus database with same CATH superfamily
5IP7K 4A3FC 5FJ8K 5JFEA 1O2AA 4XSXA 3S1RC 3SZYA 1JVIA 3TFIA 1DCHA 3AD8C 1ZBSA 3GDZA 3H3VL 1A31A 3LHPS 2A69A 3GTPA 3S14K 4PABA 3H0GA 3S0XA 1ZVUA 3K57A 4C3JK 5IYBC 1MIUA 3K58A 1L0WA 4C3HC 4FGUA 5JVOA 3GTLA 3PO2K 2R7ZA 3PO3C 4IP8A 4MEXA 1HQMA 4KAWX 2V6UA 3HOVC 2PMZA 4BY7K 4KM8A 3GIRA 4KASA 1R9TK 2JA5C 2ZFZA 4FZBA 1YX2A 5IORA 1VLOA 3FKIK 2NVQK 3OEPA 4OIRA 2B9SB 3CAGA 3S15K 1YNNA 1WSRA 5IYCC 2VUMC 1TWFK 5M5WK 2JA6C 3S2DC 3BP8C 1IW7D 3DXJA 1TWGA 4C45A 1F7VA 4LLGA 3HOXC 4YFKA 2P5MA 2ZUFA 5C44K 2D6FC 2YU9A 1EJ9A 1WCMK 2E2HA 1I6HK 4A3IK 4ILDA 1WIHA 3S2HK 5C4JK 1O29A 1O24A 1DCPA 2A6ED 2PHCB 3GTJK 4QJVB 1Y1VA 4NOLA 4C3JC 5IYBK 2R4GA 5IOQA 5C44C 4A93C 3HOXK 1J6XA 1TWCK 3GSIA 4LR2A 3I4MK 2ZUEA 3M3YK 2NVXA 1VJEA 1IE0A 1USMA 1VRQC 2NVXC 3HOWC 4KARA 4Y7NC 3HOVK 4A3LK 3HOWK 4FXDA 4AYBL 4G0WA 1B4BA 1T8IA 4XCHA 4G7ZA 1Y1WA 1XXCA 3GEIA 1R9TA 4A3MC 3FKIC 4LJZA 2JH3A 2WB1L 1JOEA 1I6VD 1R9TC 4LK1A 3CQZC 4GTBA 3IPJA 3HKZA 3EQLA 4Q4ZA 4AHCA 3S17C 3GTJC 3I4NK 4H3TA 4L8IA 4BKWA 3HXAA 4GZYA 4QIWD 2O5JA 1TWGC 1IW7A 4BLBA 3L4JA 2EBBA 1XZPB 1IQ0A 2E2JC 4G0VA 1YNND 2WB1A 4C2MA 3GEHA 2E2IC 3S16K 4BY1K 4A3IC 1Y698 2PPBA 5MLC9 5IP7C 4J3NA 3FKIA 1I3QK 4A3FK 2GSNA 2A6HA 4YFXA 2E2IA 4KB4A 4Q5GA 1XZQB 5FLMC 2GSOA 1TWHK 4KMHA 2E2IK 1O25A 2A6EA 5IYCK 2VUMK 3VA7A 4D3YA 5IOSA 1C0AA 4A3EC 1I3QA 4MQ9A 5D4DA 3FOFA 1PJ7A 4A3BC 4KATA 4LOWA 5IP9K 1V5VA 4A3KC 3KYLA 4NOMA 2GSUA 4WJ4A 1O28A 4KMDA 4KN7A 3A8JA 2JA6A 4OYDB 2WAQA 2R93C 3S1QK 1EFWA 3RZDK 2A69D 2B63C 1O2BA 1SMYA 4QIWL 5EGHA 2NVTK 3GTLK 3SJRA 3GTMK 2NVYK 3WODA 3DU6A 2Y0SL 3PO3K 2WAQL 3S1NK 1YNJD 1F93A 2E2HC 3GTOC 1SMYD 3HOUK 1HQMD 2JA7A 3GTGA 2NVQC 2Y0SA 2BE5D 5TJ3A 2E2HK 5M5YK 4NOKA 3K5LA 5C3EK 4OIOA 3HKZL 2NVTC 1WOPA 3AH5A 4AYBD 5EGEA 4M1XA 4BBSK 4X6AK 4GFQA 5C4XC 4JK1A 1F7UA 4QCLA 1Y1WC 5TMCA 1SFOC 4Y7NK 3HKZD 1SC7A 4P9SA 4C2MC 4Y52C 4A3DK 3FHZA 1I50A 2FQOA 4KM9A 4YFNA 1BGWA 3RZDC 2A6HD 2PMZD 1TWAK 2NVYC 4LK0A 3GTMC 4A3JK 4KC6A 3GTJA 4KMAA 4EJ3A 3H0GK 1WORA 1I3QC 4AH6A 1ISEA 2R92A 1K83K 3ADAC 4A3GC 3MAQA 3T02A 4OIPA 1TL8A 3GTPC 1I6HC 3MMLB 2PMZL 4A3DC 3NUHA 5IYDK 1WCMC 1BS2A 2CW0A 3GTPK 1SFOA 4FM9A 2CFAA 2W7VA 2B63A 5JSBB 3S17K 1UV7A 3A8KA 3T01A 5M3FK 1NH3A 1RU0A 2Y3PA 3K5MA 4KB2A 2JA7C 3K59A 3N0CA 4MEYA 1ZQ1C 3S1MC 3LPXA 4GTAA 3S15C 5C4XK 3T00A 4GTLA 3GTKC 1TWHA 3K7AC 3GTOK 1I6VA 3S1MK 1WQGA 1SFOK 1O26A 1WCMA 2PA8D 4BBRK 2JA5K 3S14C 3I4NC 1Y1VK 2WAQD 2Y0SD 2V6TA 4GTDA 1TGOA 4LMOA 1USOA 2JA5A 2KWAA 3L4KA 4WILA 1LPQA 4G7HA 3HOYK 2YU9C 4GT9A 3QX3A 1DD5A 4AYBA 3G4CA 1EH1A 1JQWA 3JSTA 3TFHA 2WB1D 2NVYA 1A36A 3LAJA 4XSZA 3GTMA 3TTGA 4IP9A 4F3EA 1VH2A 2CFAB 1HI9A 4O2DA 4QJVA 3I4MC 1XZPA 1Y1VC 4AN8A 3OREA 1I50K 3G4AA 3ERED 1INNA 1IL2A 1TWCA 3K7AK 2A68A 3FOEA 1R5ZA 1V9MA 2R93A 1O2FB 3M3YC 1J98A 5TMFA 1SEUA 2R7ZK 2JA8C 1YCLA 1K83C 2R7ZC 5IYDC 5FLMK 4C2MK 4GTEA 1TWFC 2B63K 1K83A 2R92K 3GTGK 1R49A 4Q5VA 1I50C 4NOIA 3SZZA 3WVOA 3S16C 4G0UA 1ZYRA 4OINA 2O5IA 1Q8IA 3H0GC 4YG2A 4KMUA 4A3KK 1TWAA 2RH6A 2F4QA 4D3ZA 4XLNA 1XZQA 4OIQA 4BY1C 4A3CC 1TWGK 5M5XK 3N0BA 1J6WA 3DU5A 4A3MK 3LAPA 4C3HK 2JA6K 3S2DK 4Y52K 4BBSC 3GTQK 1B4AA 3RZOC 3OPFA 2PA8L 3CQZK 3AD7C 1EI6A 2XCRB 1PJ6A 1Y1WK 1F9NA 1WOOA 1K4SA 3BP3A 2YU9K 4X6AC 1YNJA 2GAHC 4C3IK 5CJ9A 4O26A 2GAGC 1RRJA 2VUMA 2R93K 2BE5A 3GTOA 1IS1A 3M4OC 1EQRA 5IOTA 2JA7K 3PO2C 3HOYC 3M4OK 3GTQC 3RZOK 4RMFA 4A3BK 3GEEA 1ZXOA 4GTCA 2XCOA 3S1RK 5C4JC 4DDQA 3GTQA 4C3IC 4A3LC 4P5AA 3S1QC 3GTKA 3TFJA 4A3CK 4Q5SA 1TWHC 2NVXK 4QIWA 1WQFA 1AB4A 4BBRC 1WOSA 4GTFA 5C3EC 3GTLC 1X31C 3P9AA 3AD9C 1KQ4A 4P5BA 3H3VD 3K5OA 3GTKK 1EK8A 2V6SA 3HOUC 4A3EK 3S1NC 3GTGC 5CQGA 2CW0D 2FQTA 3K5NA 3A8IA 3Q3QA 5IP9C 3IAYA 5M3MK 1WSVA 1A35A 2O5JD 4LQYA 1K4TA 3AQOA 1IBAA 4A3GK 1TWCC 3N3YA 1TWAC 4A93K 1XXAA 3HOZC 4BXXC 2R92C 4KDDA 2E2JK 1XPPA 1RR8C 4BXXK 2A68D 2P8TA 5E68A 3HOZK 3AQPA 4A3JC 3M4AA 5L46A 4KN4A 1XXBA 4ZH4A 4XLPA 4BY7C 4G7OA 1ZYRD 1BJTA 1O27A 1VGXA 3S2HC 2RGRA 1GE9A 1G51A 2JA8K 1TWFA 3LF9A 4JLRC 1DCOA 1PJ5A 4PAAA 1J6VA 4WJ3M 5CHPA 5HL8A 1WQHA 5C9HA 5JSNB 3BUEA 3CQZA 1BDFA 3V4GA 4BLAA 4FYDA 2XCQA
chains in the Genus database with same CATH topology
3WVOA 5JFEA 4KC6A 3GTJA 1O2AA 4KMAA 4G0UA 4GTBA 1Q8IA 4EJ3A 3HKZA 1ZBSA 1TWAA 2RH6A 2F4QA 4AHCA 4D3ZA 3LHPS 1A31A 3GTPA 1ISEA 3H0GA 2R92A 4H3TA 4L8IA 3MAQA 1ZVUA 4BKWA 3K57A 3S0XA 3N0BA 1TL8A 3DU5A 3LAPA 1MIUA 3MMLB 4BLBA 3K58A 3NUHA 4C3HC 1SFOA 1B4AA 3L4JA 3OPFA 4FGUA 5JVOA 4FM9A 3GTLA 4G0VA 2R7ZA 1YNND 4IP8A 2WB1A 2CFAA 4KAWX 4C2MA 2B63A 2PMZA 1F9NA 4KM8A 2XCRB 1K4SA 1Y698 5MLC9 5JSBB 4KASA 3FKIA 4J3NA 2ZFZA 2GSNA 4FZBA 1NH3A 5CJ9A 2E2IA 4O26A 5IORA 2Y3PA 1RRJA 4KB4A 4Q5GA 2VUMA 3K5MA 3OEPA 2GSOA 3GTOA 2B9SB 3CAGA 1IS1A 4KMHA 5IOTA 1O25A 4KB2A 3K59A 3VA7A 4D3YA 5IOSA 3N0CA 1I3QA 3LPXA 4GTAA 4GTLA 3FOFA 1TWHA 2XCQA 4KATA 1ZXOA 1IW7D 4GTCA 1TWGA 2XCOA 1WQGA 2JA7A 3KYLA 4NOMA 3GTQA 2GSUA 4P5AA 4C3IC 3GTKA 1O28A 1O26A 4KMDA 2JA6A 1WCMA 4OYDB 4QIWA 1WQFA 1AB4A 2WAQA 4GTFA 2P5MA 4GTDA 2YU9A 2A69D 3P9AA 1KQ4A 1EJ9A 1O2BA 1TGOA 4LMOA 4P5BA 5EGHA 2JA5A 3SJRA 3K5OA 2E2HA 2KWAA 1LPQA 3L4KA 1EK8A 3DU6A 4GT9A 4ILDA 1WIHA 3QX3A 5CQGA 2CW0D 1DD5A 4AYBA 1YNJD 3K5NA 1O29A 3G4CA 1SMYD 3Q3QA 3IAYA 1O24A 1EH1A 2A6ED 2PHCB 1HQMD 1A35A 1Y1VA 2NVYA 2Y0SA 4NOLA 1A36A 3GTGA 2BE5D 2O5JD 3GTMA 5TJ3A 4LQYA 1K4TA 2R4GA 4IP9A 4C3JC 3AQOA 5IOQA 4F3EA 2CFAB 4NOKA 3K5LA 4AN8A 3N3YA 3OREA 4LR2A 1XXAA 3G4AA 3ERED 2NVXA 4KDDA 3AH5A 4DDQA 5EGEA 1TWCA 1RR8C 4M1XA 2A68D 3FOEA 1R5ZA 1V9MA 2R93A 3AQPA 3M4AA 1XXBA 4GFQA 1SEUA 4QCLA 4KARA 1ZYRD 1BJTA 1O27A 2RGRA 1GE9A 3LAJA 1TWFA 4FXDA 1SC7A 3LF9A 4JLRC 4G0WA 1B4BA 1T8IA 4C2MC 1Y1WA 3FHZA 1I50A 1XXCA 1R9TA 4GTEA 5CHPA 4KM9A 1WQHA 5C9HA 5JSNB 1K83A 1BGWA 2JH3A 3CQZA 3BUEA 3V4GA 4BLAA 2A6HD 4FYDA 1R49A 4Q5VA 1I6VD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5MLC 9;  5JSB B;  3ORE A;  1WQF A;  1AB4 A;  1XXA A;  2ZFZ A;  4J3N A;  2P5M A;  4KC6 A;  4G0U A;  3ERE D;  5CJ9 A;  4KDD A;  2Y3P A;  4KB4 A;  3FOE A;  2KWA A;  3OEP A;  3L4K A;  3LHP S;  1EK8 A;  4GFQ A;  1XXB A;  1IS1 A;  3CAG A;  1ISE A;  4L8I A;  4KB2 A;  1WIH A;  1BJT A;  1ZVU A;  3VA7 A;  3QX3 A;  2RGR A;  1GE9 A;  1DD5 A;  3LF9 A;  4JLR C;  3LPX A;  3LAP A;  4G0W A;  1EH1 A;  1B4B A;  2PHC B;  3MML B;  3FOF A;  3NUH A;  3FHZ A;  2XCQ A;  1XXC A;  3LAJ A;  1B4A A;  3L4J A;  3OPF A;  1WQH A;  5JVO A;  2XCO A;  4FM9 A;  1WQG A;  5JSN B;  1BGW A;  4DDQ A;  3BUE A;  4G0V A;  3V4G A;  4KAW X;  2XCR B;  1F9N A;  4OYD B;  1Y69 8; 
#chains in the Genus database with same CATH topology
 5IP7 K;  4A3F C;  5FJ8 K;  5JFE A;  1O2A A;  4XSX A;  3S1R C;  3SZY A;  1JVI A;  3TFI A;  1DCH A;  3AD8 C;  1ZBS A;  3GDZ A;  3H3V L;  1A31 A;  3LHP S;  2A69 A;  3GTP A;  3S14 K;  4PAB A;  3H0G A;  3S0X A;  1ZVU A;  3K57 A;  4C3J K;  5IYB C;  1MIU A;  3K58 A;  1L0W A;  4C3H C;  4FGU A;  5JVO A;  3GTL A;  3PO2 K;  2R7Z A;  3PO3 C;  4IP8 A;  4MEX A;  1HQM A;  4KAW X;  2V6U A;  3HOV C;  2PMZ A;  4BY7 K;  4KM8 A;  3GIR A;  4KAS A;  1R9T K;  2JA5 C;  2ZFZ A;  4FZB A;  1YX2 A;  5IOR A;  1VLO A;  3FKI K;  2NVQ K;  3OEP A;  4OIR A;  2B9S B;  3CAG A;  3S15 K;  1YNN A;  1WSR A;  5IYC C;  2VUM C;  1TWF K;  5M5W K;  2JA6 C;  3S2D C;  3BP8 C;  1IW7 D;  3DXJ A;  1TWG A;  4C45 A;  1F7V A;  4LLG A;  3HOX C;  4YFK A;  2P5M A;  2ZUF A;  5C44 K;  2D6F C;  2YU9 A;  1EJ9 A;  1WCM K;  2E2H A;  1I6H K;  4A3I K;  4ILD A;  1WIH A;  3S2H K;  5C4J K;  1O29 A;  1O24 A;  1DCP A;  2A6E D;  2PHC B;  3GTJ K;  4QJV B;  1Y1V A;  4NOL A;  4C3J C;  5IYB K;  2R4G A;  5IOQ A;  5C44 C;  4A93 C;  3HOX K;  1J6X A;  1TWC K;  3GSI A;  4LR2 A;  3I4M K;  2ZUE A;  3M3Y K;  2NVX A;  1VJE A;  1IE0 A;  1USM A;  1VRQ C;  2NVX C;  3HOW C;  4KAR A;  4Y7N C;  3HOV K;  4A3L K;  3HOW K;  4FXD A;  4AYB L;  4G0W A;  1B4B A;  1T8I A;  4XCH A;  4G7Z A;  1Y1W A;  1XXC A;  3GEI A;  1R9T A;  4A3M C;  3FKI C;  4LJZ A;  2JH3 A;  2WB1 L;  1JOE A;  1I6V D;  1R9T C;  4LK1 A;  3CQZ C;  4GTB A;  3IPJ A;  3HKZ A;  3EQL A;  4Q4Z A;  4AHC A;  3S17 C;  3GTJ C;  3I4N K;  4H3T A;  4L8I A;  4BKW A;  3HXA A;  4GZY A;  4QIW D;  2O5J A;  1TWG C;  1IW7 A;  4BLB A;  3L4J A;  2EBB A;  1XZP B;  1IQ0 A;  2E2J C;  4G0V A;  1YNN D;  2WB1 A;  4C2M A;  3GEH A;  2E2I C;  3S16 K;  4BY1 K;  4A3I C;  1Y69 8;  2PPB A;  5MLC 9;  5IP7 C;  4J3N A;  3FKI A;  1I3Q K;  4A3F K;  2GSN A;  2A6H A;  4YFX A;  2E2I A;  4KB4 A;  4Q5G A;  1XZQ B;  5FLM C;  2GSO A;  1TWH K;  4KMH A;  2E2I K;  1O25 A;  2A6E A;  5IYC K;  2VUM K;  3VA7 A;  4D3Y A;  5IOS A;  1C0A A;  4A3E C;  1I3Q A;  4MQ9 A;  5D4D A;  3FOF A;  1PJ7 A;  4A3B C;  4KAT A;  4LOW A;  5IP9 K;  1V5V A;  4A3K C;  3KYL A;  4NOM A;  2GSU A;  4WJ4 A;  1O28 A;  4KMD A;  4KN7 A;  3A8J A;  2JA6 A;  4OYD B;  2WAQ A;  2R93 C;  3S1Q K;  1EFW A;  3RZD K;  2A69 D;  2B63 C;  1O2B A;  1SMY A;  4QIW L;  5EGH A;  2NVT K;  3GTL K;  3SJR A;  3GTM K;  2NVY K;  3WOD A;  3DU6 A;  2Y0S L;  3PO3 K;  2WAQ L;  3S1N K;  1YNJ D;  1F93 A;  2E2H C;  3GTO C;  1SMY D;  3HOU K;  1HQM D;  2JA7 A;  3GTG A;  2NVQ C;  2Y0S A;  2BE5 D;  5TJ3 A;  2E2H K;  5M5Y K;  4NOK A;  3K5L A;  5C3E K;  4OIO A;  3HKZ L;  2NVT C;  1WOP A;  3AH5 A;  4AYB D;  5EGE A;  4M1X A;  4BBS K;  4X6A K;  4GFQ A;  5C4X C;  4JK1 A;  1F7U A;  4QCL A;  1Y1W C;  5TMC A;  1SFO C;  4Y7N K;  3HKZ D;  1SC7 A;  4P9S A;  4C2M C;  4Y52 C;  4A3D K;  3FHZ A;  1I50 A;  2FQO A;  4KM9 A;  4YFN A;  1BGW A;  3RZD C;  2A6H D;  2PMZ D;  1TWA K;  2NVY C;  4LK0 A;  3GTM C;  4A3J K;  4KC6 A;  3GTJ A;  4KMA A;  4EJ3 A;  3H0G K;  1WOR A;  1I3Q C;  4AH6 A;  1ISE A;  2R92 A;  1K83 K;  3ADA C;  4A3G C;  3MAQ A;  3T02 A;  4OIP A;  1TL8 A;  3GTP C;  1I6H C;  3MML B;  2PMZ L;  4A3D C;  3NUH A;  5IYD K;  1WCM C;  1BS2 A;  2CW0 A;  3GTP K;  1SFO A;  4FM9 A;  2CFA A;  2W7V A;  2B63 A;  5JSB B;  3S17 K;  1UV7 A;  3A8K A;  3T01 A;  5M3F K;  1NH3 A;  1RU0 A;  2Y3P A;  3K5M A;  4KB2 A;  2JA7 C;  3K59 A;  3N0C A;  4MEY A;  1ZQ1 C;  3S1M C;  3LPX A;  4GTA A;  3S15 C;  5C4X K;  3T00 A;  4GTL A;  3GTK C;  1TWH A;  3K7A C;  3GTO K;  1I6V A;  3S1M K;  1WQG A;  1SFO K;  1O26 A;  1WCM A;  2PA8 D;  4BBR K;  2JA5 K;  3S14 C;  3I4N C;  1Y1V K;  2WAQ D;  2Y0S D;  2V6T A;  4GTD A;  1TGO A;  4LMO A;  1USO A;  2JA5 A;  2KWA A;  3L4K A;  4WIL A;  1LPQ A;  4G7H A;  3HOY K;  2YU9 C;  4GT9 A;  3QX3 A;  1DD5 A;  4AYB A;  3G4C A;  1EH1 A;  1JQW A;  3JST A;  3TFH A;  2WB1 D;  2NVY A;  1A36 A;  3LAJ A;  4XSZ A;  3GTM A;  3TTG A;  4IP9 A;  4F3E A;  1VH2 A;  2CFA B;  1HI9 A;  4O2D A;  4QJV A;  3I4M C;  1XZP A;  1Y1V C;  4AN8 A;  3ORE A;  1I50 K;  3G4A A;  3ERE D;  1INN A;  1IL2 A;  1TWC A;  3K7A K;  2A68 A;  3FOE A;  1R5Z A;  1V9M A;  2R93 A;  1O2F B;  3M3Y C;  1J98 A;  5TMF A;  1SEU A;  2R7Z K;  2JA8 C;  1YCL A;  1K83 C;  2R7Z C;  5IYD C;  5FLM K;  4C2M K;  4GTE A;  1TWF C;  2B63 K;  1K83 A;  2R92 K;  3GTG K;  1R49 A;  4Q5V A;  1I50 C;  4NOI A;  3SZZ A;  3WVO A;  3S16 C;  4G0U A;  1ZYR A;  4OIN A;  2O5I A;  1Q8I A;  3H0G C;  4YG2 A;  4KMU A;  4A3K K;  1TWA A;  2RH6 A;  2F4Q A;  4D3Z A;  4XLN A;  1XZQ A;  4OIQ A;  4BY1 C;  4A3C C;  1TWG K;  5M5X K;  3N0B A;  1J6W A;  3DU5 A;  4A3M K;  3LAP A;  4C3H K;  2JA6 K;  3S2D K;  4Y52 K;  4BBS C;  3GTQ K;  1B4A A;  3RZO C;  3OPF A;  2PA8 L;  3CQZ K;  3AD7 C;  1EI6 A;  2XCR B;  1PJ6 A;  1Y1W K;  1F9N A;  1WOO A;  1K4S A;  3BP3 A;  2YU9 K;  4X6A C;  1YNJ A;  2GAH C;  4C3I K;  5CJ9 A;  4O26 A;  2GAG C;  1RRJ A;  2VUM A;  2R93 K;  2BE5 A;  3GTO A;  1IS1 A;  3M4O C;  1EQR A;  5IOT A;  2JA7 K;  3PO2 C;  3HOY C;  3M4O K;  3GTQ C;  3RZO K;  4RMF A;  4A3B K;  3GEE A;  1ZXO A;  4GTC A;  2XCO A;  3S1R K;  5C4J C;  4DDQ A;  3GTQ A;  4C3I C;  4A3L C;  4P5A A;  3S1Q C;  3GTK A;  3TFJ A;  4A3C K;  4Q5S A;  1TWH C;  2NVX K;  4QIW A;  1WQF A;  1AB4 A;  4BBR C;  1WOS A;  4GTF A;  5C3E C;  3GTL C;  1X31 C;  3P9A A;  3AD9 C;  1KQ4 A;  4P5B A;  3H3V D;  3K5O A;  3GTK K;  1EK8 A;  2V6S A;  3HOU C;  4A3E K;  3S1N C;  3GTG C;  5CQG A;  2CW0 D;  2FQT A;  3K5N A;  3A8I A;  3Q3Q A;  5IP9 C;  3IAY A;  5M3M K;  1WSV A;  1A35 A;  2O5J D;  4LQY A;  1K4T A;  3AQO A;  1IBA A;  4A3G K;  1TWC C;  3N3Y A;  1TWA C;  4A93 K;  1XXA A;  3HOZ C;  4BXX C;  2R92 C;  4KDD A;  2E2J K;  1XPP A;  1RR8 C;  4BXX K;  2A68 D;  2P8T A;  5E68 A;  3HOZ K;  3AQP A;  4A3J C;  3M4A A;  5L46 A;  4KN4 A;  1XXB A;  4ZH4 A;  4XLP A;  4BY7 C;  4G7O A;  1ZYR D;  1BJT A;  1O27 A;  1VGX A;  3S2H C;  2RGR A;  1GE9 A;  1G51 A;  2JA8 K;  1TWF A;  3LF9 A;  4JLR C;  1DCO A;  1PJ5 A;  4PAA A;  1J6V A;  4WJ3 M;  5CHP A;  5HL8 A;  1WQH A;  5C9H A;  5JSN B;  3BUE A;  3CQZ A;  1BDF A;  3V4G A;  4BLA A;  4FYD A;  2XCQ A; 
#chains in the Genus database with same CATH homology
 3WVO A;  5JFE A;  4KC6 A;  3GTJ A;  1O2A A;  4KMA A;  4G0U A;  4GTB A;  1Q8I A;  4EJ3 A;  3HKZ A;  1ZBS A;  1TWA A;  2RH6 A;  2F4Q A;  4AHC A;  4D3Z A;  3LHP S;  1A31 A;  3GTP A;  1ISE A;  3H0G A;  2R92 A;  4H3T A;  4L8I A;  3MAQ A;  1ZVU A;  4BKW A;  3K57 A;  3S0X A;  3N0B A;  1TL8 A;  3DU5 A;  3LAP A;  1MIU A;  3MML B;  4BLB A;  3K58 A;  3NUH A;  4C3H C;  1SFO A;  1B4A A;  3L4J A;  3OPF A;  4FGU A;  5JVO A;  4FM9 A;  3GTL A;  4G0V A;  2R7Z A;  1YNN D;  4IP8 A;  2WB1 A;  2CFA A;  4KAW X;  4C2M A;  2B63 A;  2PMZ A;  1F9N A;  4KM8 A;  2XCR B;  1K4S A;  1Y69 8;  5MLC 9;  5JSB B;  4KAS A;  3FKI A;  4J3N A;  2ZFZ A;  2GSN A;  4FZB A;  1NH3 A;  5CJ9 A;  2E2I A;  4O26 A;  5IOR A;  2Y3P A;  1RRJ A;  4KB4 A;  4Q5G A;  2VUM A;  3K5M A;  3OEP A;  2GSO A;  3GTO A;  2B9S B;  3CAG A;  1IS1 A;  4KMH A;  5IOT A;  1O25 A;  4KB2 A;  3K59 A;  3VA7 A;  4D3Y A;  5IOS A;  3N0C A;  1I3Q A;  3LPX A;  4GTA A;  4GTL A;  3FOF A;  1TWH A;  2XCQ A;  4KAT A;  1ZXO A;  1IW7 D;  4GTC A;  1TWG A;  2XCO A;  1WQG A;  2JA7 A;  3KYL A;  4NOM A;  3GTQ A;  2GSU A;  4P5A A;  4C3I C;  3GTK A;  1O28 A;  1O26 A;  4KMD A;  2JA6 A;  1WCM A;  4OYD B;  4QIW A;  1WQF A;  1AB4 A;  2WAQ A;  4GTF A;  2P5M A;  4GTD A;  2YU9 A;  2A69 D;  3P9A A;  1KQ4 A;  1EJ9 A;  1O2B A;  1TGO A;  4LMO A;  4P5B A;  5EGH A;  2JA5 A;  3SJR A;  3K5O A;  2E2H A;  2KWA A;  1LPQ A;  3L4K A;  1EK8 A;  3DU6 A;  4GT9 A;  4ILD A;  1WIH A;  3QX3 A;  5CQG A;  2CW0 D;  1DD5 A;  4AYB A;  1YNJ D;  3K5N A;  1O29 A;  3G4C A;  1SMY D;  3Q3Q A;  3IAY A;  1O24 A;  1EH1 A;  2A6E D;  2PHC B;  1HQM D;  1A35 A;  1Y1V A;  2NVY A;  2Y0S A;  4NOL A;  1A36 A;  3GTG A;  2BE5 D;  2O5J D;  3GTM A;  5TJ3 A;  4LQY A;  1K4T A;  2R4G A;  4IP9 A;  4C3J C;  3AQO A;  5IOQ A;  4F3E A;  2CFA B;  4NOK A;  3K5L A;  4AN8 A;  3N3Y A;  3ORE A;  4LR2 A;  1XXA A;  3G4A A;  3ERE D;  2NVX A;  4KDD A;  3AH5 A;  4DDQ A;  5EGE A;  1TWC A;  1RR8 C;  4M1X A;  2A68 D;  3FOE A;  1R5Z A;  1V9M A;  2R93 A;  3AQP A;  3M4A A;  1XXB A;  4GFQ A;  1SEU A;  4QCL A;  4KAR A;  1ZYR D;  1BJT A;  1O27 A;  2RGR A;  1GE9 A;  3LAJ A;  1TWF A;  4FXD A;  1SC7 A;  3LF9 A;  4JLR C;  4G0W A;  1B4B A;  1T8I A;  4C2M C;  1Y1W A;  3FHZ A;  1I50 A;  1XXC A;  1R9T A;  4GTE A;  5CHP A;  4KM9 A;  1WQH A;  5C9H A;  5JSN B;  1K83 A;  1BGW A;  2JH3 A;  3CQZ A;  3BUE A;  3V4G A;  4BLA A;  2A6H D;  4FYD A;  1R49 A;  4Q5V A;  1I6V D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...