1WQGA

Crystal structure of ribosome recycling factor from mycobacterium tuberculosis
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
184
structure length
184
Chain Sequence
IDEALFDAEEKMEKAVAVARDDLSTIRTGRANPGMFSRITIDYYGAATPITQLASINVPEARLVVIKPYEANQLRAIETAIRNSDLGVNPTNDGALIRVAVPQLTEERRRELVKQAKHKGEEAKVSVRNIRRKAMEELHRIRKEGEAGEDEVGRAEKDLDKTTHQYVTQIDELVKHKEGELLEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ribosome recycling factor
publication title X-ray structural studies of Mycobacterium tuberculosis RRF and a comparative study of RRFs of known structure. Molecular plasticity and biological implications
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Translation
total genus 70
structure length 184
sequence length 184
ec nomenclature
pdb deposition date 2004-09-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01765 RRF Ribosome recycling factor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.132.20 Mainly Alpha Orthogonal Bundle Topoisomerase I; Chain A, domain 4 Topoisomerase I; Chain A, domain 4 1wqgA01
3.30.1360.40 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 Gyrase A; domain 2 1wqgA02
3LF9A 3OEPA 3QX3A 1Y698 1BJTA 1AB4A 1ISEA 1EH1A 3LHPS 2ZFZA 3MMLB 5CJ9A 2XCQA 3VA7A 3FHZA 1EK8A 3LAPA 1WIHA 2RGRA 3L4JA 1XXAA 4KB2A 4KC6A 5JVOA 4G0VA 1ZVUA 4G0UA 5MLC9 1XXBA 3L4KA 4KAWX 1GE9A 3OPFA 4KDDA 4J3NA 4KB4A 4GFQA 3BUEA 4JLRC 1BGWA 3NUHA 3FOFA 4FM9A 3CAGA 4G0WA 1WQHA 1DD5A 2XCOA 3LPXA 4DDQA 5JSNB 1WQGA 1B4AA 1XXCA 2P5MA 4L8IA 2KWAA 3ERED 3V4GA 3LAJA 2XCRB 1IS1A 5JSBB 4OYDB 3OREA 3FOEA 2PHCB 1F9NA 2Y3PA 1B4BA 1WQFA
chains in the Genus database with same CATH superfamily
3OEPA 1AB4A 3BP3A 5CHPA 2ZFZA 3MMLB 3GTOK 3PO3K 4A3EC 3KYLA 5JFEA 4FGUA 4C2MC 4BY7K 3K5LA 2GSUA 3MAQA 4XLPA 3K58A 4KAWX 3K7AK 2A6HD 4A3MC 2PMZD 2A69A 1DD5A 5TJ3A 4IP9A 1VLOA 4Y52K 1EFWA 2XCRB 5C44K 4OYDB 2VUMC 5C4JC 2A6EA 2JA7K 3FKIC 3GDZA 1Y1VK 3GTKC 5EGHA 1ZQ1C 3GTQK 1F7VA 3K5MA 1IW7A 1YX2A 3A8IA 1ZVUA 4BY1K 1I50K 4KMUA 1IL2A 4C2MA 3TTGA 1PJ5A 4BLBA 2NVXC 3HOZK 2P8TA 1JQWA 2ZUFA 3GTMK 4BBSC 1JOEA 1K83A 2A68A 4LK1A 1LPQA 3FOEA 3K7AC 4YFNA 3SZZA 3S1MK 1HQMA 3SJRA 4BXXK 3T01A 3S2DK 3FHZA 2NVYK 4KMHA 1O2FB 5IYDC 1XZQB 2R92C 4YFKA 4A3LC 3TFIA 1VGXA 4BLAA 4A3BC 3ADAC 2B9SB 1YNNA 1L0WA 1VRQC 3TFHA 2E2JK 4Q5GA 4YG2A 4XLNA 1J6XA 3H0GK 5C4XK 4OIPA 4D3ZA 3S17C 2R4GA 1ZBSA 3HKZD 3AQOA 4NOMA 3K5OA 1WQGA 1BDFA 2P5MA 3CQZC 5IP9K 3I4NC 3GTOA 2O5JD 1K4TA 1G51A 1I50C 4A3JK 4BKWA 1ISEA 4ZH4A 2YU9C 1R5ZA 1MIUA 2NVTC 4KB2A 4AH6A 3WODA 3S14K 3DXJA 1ZXOA 1I6HC 1XZPB 3AD9C 4C3JC 4LLGA 3A8KA 4A3KC 3K5NA 4IP8A 3S0XA 4A3EK 2JA7A 3I4MK 4A3IC 1TWCC 4KMDA 1Y1VA 4C2MK 1DCHA 3SZYA 3GTQA 1TWHC 5M5XK 1B4BA 4A3FK 4XCHA 1BS2A 4A3MK 4JK1A 4AN8A 1TL8A 1I50A 4ILDA 4A3GC 1WIHA 1A31A 4LK0A 1Y1WC 2YU9A 4G0VA 1RR8C 1GE9A 3GTMA 5IYCC 2VUMK 4KB4A 5C4JK 4P5BA 3FKIK 3GTKK 5M5YK 1XPPA 2RH6A 2R7ZK 1B4AA 1EI6A 2A6HA 3H3VL 2PMZA 1USOA 1V5VA 1TWCA 5C3EC 1F93A 3S2HC 1RRJA 4GTCA 1SC7A 3VA7A 4WJ4A 2R93K 4KC6A 2NVXK 3I4MC 3GTGC 4BBSK 1EQRA 3H0GA 1XXBA 3M4OC 2JA8C 4KMAA 3DU5A 1ZYRD 4KDDA 4LMOA 3AQPA 4A3FC 2B63C 4JLRC 1V9MA 2PMZL 1J98A 2WB1D 3IAYA 1XZPA 3GEIA 4GZYA 5IYDK 1O28A 2R92K 4A3LK 2GAHC 4P5AA 2V6TA 3N3YA 3AD8C 4A3BK 1WSVA 4QCLA 1YNJD 3K57A 3NUHA 1DCPA 4PABA 1IQ0A 1TWGC 1X31C 4GTEA 2R7ZC 1TWFC 3S17K 3CQZK 4G0UA 3I4NK 3GTLC 4J3NA 4YFXA 4GTLA 4GTDA 1Q8IA 1O24A 5IYBC 2YU9K 1INNA 3S1NK 2R93C 4DDQA 2NVTK 1SMYD 4C3IC 2PHCB 4NOIA 1I6HK 3HOUC 3HKZA 4GTAA 3LHPS 4C3JK 4A3KK 5M5WK 2CW0A 2A69D 2JA5C 4KASA 2VUMA 3L4JA 2O5JA 4C3HC 4XSXA 3FKIA 1TWCK 3T00A 5FJ8K 3GTKA 4QJVB 4A3IK 1SFOC 1WCMC 2R7ZA 1TWHK 4QIWD 4AHCA 1PJ6A 3HOYK 1BGWA 3GTLA 4KATA 2PPBA 1WOSA 3LPXA 4A3GK 1USMA 4M1XA 1K4SA 1A36A 2E2IC 1Y1WK 2E2HC 3OREA 2EBBA 2R93A 2V6SA 2NVXA 5IORA 4FXDA 2Y0SA 5IYCK 4A3DC 3N0BA 3RZDC 2BE5A 5TMCA 4KN7A 3N0CA 1TWAC 1KQ4A 1EK8A 2RGRA 3S1NC 2PA8L 5M3FK 3BP8C 3GEHA 3M4AA 2JA5A 3EQLA 4A93C 2NVQC 2R92A 4A3CC 3FOFA 5C3EK 2GAGC 3S2HK 2Y0SL 1TGOA 3G4CA 1RU0A 3GTGK 4G7OA 1O2BA 3ERED 1WOPA 4MEYA 1IS1A 3M4OK 1F9NA 2JA8K 1A35A 3RZOC 3HOYC 3CQZA 3GTJC 2B63K 2E2HA 2XCQA 3JSTA 1XXAA 4X6AC 1WOOA 1I6VD 2CFAA 3L4KA 4GFQA 1WORA 3AD7C 3PO2C 2V6UA 4QJVA 3K59A 4G0WA 4EJ3A 2D6FC 3M3YC 1TWGK 4FYDA 2JA6C 3S1QC 1TWFK 1JVIA 1ZYRA 3IPJA 4Y7NK 3LAJA 4AYBD 3GTLK 2WAQD 4FM9A 2WB1A 5TMFA 3QX3A 5IOSA 4GT9A 5IYBK 1TWHA 5IOQA 3GTJA 4MEXA 5JVOA 1YNJA 3S15C 4C3IK 1NH3A 1VJEA 2FQTA 3HOUK 1Y1WA 4KARA 2F4QA 5L46A 2JH3A 2JA5K 5IP7K 4C3HK 2O5IA 4KM8A 1SFOK 2JA6A 1WCMK 4C45A 1Y698 5D4DA 5CQGA 1EH1A 3HOVC 1R9TC 1SMYA 3GTPC 4D3YA 3HOWC 5IOTA 4GTFA 3TFJA 4NOLA 5MLC9 1R49A 4Y7NC 1F7UA 2E2IK 5FLMC 2E2HK 3GTGA 1K83C 4A3DK 1IE0A 1I3QK 3RZDK 2XCOA 1TWAK 4Q5SA 2B63A 4H3TA 4QIWA 2KWAA 3GSIA 2Y3PA 4A93K 2NVQK 3S16C 3Q3QA 4A3CK 2CFAB 1DCOA 5IP7C 2ZUEA 1R9TA 3S1RC 1TWGA 3P9AA 3GTPA 4QIWL 4Q4ZA 2GSOA 1TWFA 1HI9A 3GTOC 3PO3C 3RZOK 3CAGA 3GTJK 5HL8A 2A6ED 3T02A 4OIOA 4BY7C 3GEEA 3HKZL 1XXCA 4L8IA 4X6AK 4NOKA 1UV7A 1IW7D 1WQFA 3AH5A 3PO2K 5CJ9A 1I3QC 4KM9A 1C0AA 3M3YK 1J6VA 4WILA 3HOXK 4Y52C 3G4AA 2JA6K 3S1QK 5C44C 4LR2A 2JA7C 2W7VA 2A68D 1EJ9A 4XSZA 3GIRA 1Y1VC 3HXAA 1O2AA 1HQMD 1WQHA 1I6VA 1O25A 4OIQA 3GTQC 1SFOA 4GTBA 1WCMA 2CW0D 4F3EA 5E68A 4BBRK 4Q5VA 3A8JA 4G7HA 4BY1C 3WVOA 1O26A 3S15K 2GSNA 3LF9A 1PJ7A 1BJTA 1O27A 1YNND 2E2IA 4FZBA 3HOZC 2PA8D 4LOWA 3LAPA 1WSRA 3GTMC 4AYBA 2WAQA 1I3QA 4OIRA 3S1MC 1T8IA 1YCLA 1TWAA 4BXXC 3S2DC 2NVYC 2Y0SD 4PAAA 1O29A 3HOVK 2BE5D 1R9TK 5M3MK 3HOXC 3GTPK 4OINA 3HOWK 4O2DA 3V4GA 2FQOA 4AYBL 5JSBB 4P9SA 2WAQL 1VH2A 5EGEA 5FLMK 2E2JC 4KN4A 3H0GC 1K83K 5C4XC 4LQYA 5IP9C 4LJZA 4BBRC 5C9HA 1XZQA 4A3JC 3DU6A 1J6WA 3OPFA 4MQ9A 3BUEA 4O26A 1SEUA 3S16K 2WB1L 3S14C 1IBAA 5JSNB 4WJ3M 2NVYA 3H3VD 4RMFA 4G7ZA 3S1RK
chains in the Genus database with same CATH topology
3OEPA 2Y0SA 1AB4A 3N0BA 2Y3PA 3Q3QA 2CFAB 2ZFZA 3MMLB 4AN8A 1TL8A 1I50A 4ILDA 3N0CA 3KYLA 1KQ4A 1EK8A 5JFEA 1WIHA 4FGUA 2RGRA 4C2MC 3M4AA 3K5LA 3MAQA 1A31A 2YU9A 2GSUA 4G0VA 1R9TA 1TWGA 3P9AA 3K58A 4KAWX 3GTPA 2JA5A 1RR8C 1GE9A 2A6HD 3GTMA 2GSOA 4KB4A 2R92A 1TWFA 3FOFA 4P5BA 3CAGA 1DD5A 2A6ED 1TGOA 5TJ3A 2RH6A 4IP9A 1B4AA 1XXCA 3G4CA 4L8IA 1O2BA 3ERED 4NOKA 2XCRB 1IS1A 4OYDB 2PMZA 1IW7D 1F9NA 5IORA 1A35A 1TWCA 1WQFA 3CQZA 3AH5A 1RRJA 4GTCA 1SC7A 5CJ9A 4KM9A 2E2HA 2XCQA 5EGHA 3VA7A 1XXAA 4KC6A 1I6VD 3K5MA 2CFAA 3G4AA 1ZVUA 3H0GA 1XXBA 4LR2A 5CHPA 3L4KA 4KMAA 2A68D 1ZYRD 3DU5A 4KDDA 4LMOA 4C2MA 4GFQA 1EJ9A 4JLRC 3AQPA 1V9MA 4G0WA 3K59A 1HQMD 1WQHA 1O2AA 4EJ3A 1O25A 1SFOA 4GTBA 4BLBA 3IAYA 1WCMA 4FYDA 2CW0D 1O28A 4F3EA 1K83A 4P5AA 4Q5VA 3N3YA 1LPQA 3WVOA 3LAJA 3FOEA 1O26A 2GSNA 2WB1A 1YNJD 3K57A 4QCLA 3SJRA 3NUHA 4FM9A 3LF9A 3QX3A 5IOSA 1BJTA 4GT9A 1O27A 1YNND 4KMHA 2E2IA 3FHZA 4FZBA 1TWHA 4GTEA 5IOQA 3LAPA 4AYBA 3GTJA 2WAQA 5JVOA 4BLAA 1I3QA 4G0UA 1T8IA 1TWAA 2B9SB 4J3NA 4GTLA 1NH3A 4GTDA 1Q8IA 4Q5GA 1Y1WA 1O24A 4KARA 1O29A 4D3ZA 2BE5D 2F4QA 2R4GA 1ZBSA 2JH3A 4NOMA 3K5OA 1WQGA 3AQOA 2P5MA 4DDQA 3GTOA 1SMYD 4C3IC 2O5JD 3V4GA 4KM8A 1K4TA 5JSBB 2PHCB 5EGEA 2JA6A 4BKWA 1Y698 3HKZA 4GTAA 1ISEA 5CQGA 1EH1A 3LHPS 4LQYA 1R5ZA 1MIUA 2A69D 4KASA 2VUMA 4D3YA 4KB2A 4C3HC 3L4JA 5IOTA 4GTFA 3FKIA 4NOLA 5MLC9 1R49A 3GTKA 5C9HA 1ZXOA 3DU6A 2R7ZA 3OPFA 4AHCA 3BUEA 3GTGA 4O26A 1BGWA 4C3JC 1SEUA 3GTLA 4KATA 2XCOA 3K5NA 4IP8A 3LPXA 3S0XA 2JA7A 5JSNB 4M1XA 1K4SA 2NVYA 2B63A 1Y1VA 4H3TA 4QIWA 1A36A 4KMDA 2KWAA 3GTQA 3OREA 2R93A 2NVXA 1B4BA 4FXDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3LF9 A;  3OEP A;  3QX3 A;  1Y69 8;  1BJT A;  1AB4 A;  1ISE A;  1EH1 A;  3LHP S;  2ZFZ A;  3MML B;  5CJ9 A;  2XCQ A;  3VA7 A;  3FHZ A;  1EK8 A;  3LAP A;  1WIH A;  2RGR A;  3L4J A;  1XXA A;  4KB2 A;  4KC6 A;  5JVO A;  4G0V A;  1ZVU A;  4G0U A;  5MLC 9;  1XXB A;  3L4K A;  4KAW X;  1GE9 A;  3OPF A;  4KDD A;  4J3N A;  4KB4 A;  4GFQ A;  3BUE A;  4JLR C;  1BGW A;  3NUH A;  3FOF A;  4FM9 A;  3CAG A;  4G0W A;  1WQH A;  1DD5 A;  2XCO A;  3LPX A;  4DDQ A;  5JSN B;  1WQG A;  1B4A A;  1XXC A;  2P5M A;  4L8I A;  2KWA A;  3ERE D;  3V4G A;  3LAJ A;  2XCR B;  1IS1 A;  5JSB B;  4OYD B;  3ORE A;  3FOE A;  2PHC B;  1F9N A;  2Y3P A;  1B4B A;  1WQF A; 
#chains in the Genus database with same CATH topology
 3OEP A;  1AB4 A;  3BP3 A;  5CHP A;  2ZFZ A;  3MML B;  3GTO K;  3PO3 K;  4A3E C;  3KYL A;  5JFE A;  4FGU A;  4C2M C;  4BY7 K;  3K5L A;  2GSU A;  3MAQ A;  4XLP A;  3K58 A;  4KAW X;  3K7A K;  2A6H D;  4A3M C;  2PMZ D;  2A69 A;  1DD5 A;  5TJ3 A;  4IP9 A;  1VLO A;  4Y52 K;  1EFW A;  2XCR B;  5C44 K;  4OYD B;  2VUM C;  5C4J C;  2A6E A;  2JA7 K;  3FKI C;  3GDZ A;  1Y1V K;  3GTK C;  5EGH A;  1ZQ1 C;  3GTQ K;  1F7V A;  3K5M A;  1IW7 A;  1YX2 A;  3A8I A;  1ZVU A;  4BY1 K;  1I50 K;  4KMU A;  1IL2 A;  4C2M A;  3TTG A;  1PJ5 A;  4BLB A;  2NVX C;  3HOZ K;  2P8T A;  1JQW A;  2ZUF A;  3GTM K;  4BBS C;  1JOE A;  1K83 A;  2A68 A;  4LK1 A;  1LPQ A;  3FOE A;  3K7A C;  4YFN A;  3SZZ A;  3S1M K;  1HQM A;  3SJR A;  4BXX K;  3T01 A;  3S2D K;  3FHZ A;  2NVY K;  4KMH A;  1O2F B;  5IYD C;  1XZQ B;  2R92 C;  4YFK A;  4A3L C;  3TFI A;  1VGX A;  4BLA A;  4A3B C;  3ADA C;  2B9S B;  1YNN A;  1L0W A;  1VRQ C;  3TFH A;  2E2J K;  4Q5G A;  4YG2 A;  4XLN A;  1J6X A;  3H0G K;  5C4X K;  4OIP A;  4D3Z A;  3S17 C;  2R4G A;  1ZBS A;  3HKZ D;  3AQO A;  4NOM A;  3K5O A;  1WQG A;  1BDF A;  2P5M A;  3CQZ C;  5IP9 K;  3I4N C;  3GTO A;  2O5J D;  1K4T A;  1G51 A;  1I50 C;  4A3J K;  4BKW A;  1ISE A;  4ZH4 A;  2YU9 C;  1R5Z A;  1MIU A;  2NVT C;  4KB2 A;  4AH6 A;  3WOD A;  3S14 K;  3DXJ A;  1ZXO A;  1I6H C;  1XZP B;  3AD9 C;  4C3J C;  4LLG A;  3A8K A;  4A3K C;  3K5N A;  4IP8 A;  3S0X A;  4A3E K;  2JA7 A;  3I4M K;  4A3I C;  1TWC C;  4KMD A;  1Y1V A;  4C2M K;  1DCH A;  3SZY A;  3GTQ A;  1TWH C;  5M5X K;  1B4B A;  4A3F K;  4XCH A;  1BS2 A;  4A3M K;  4JK1 A;  4AN8 A;  1TL8 A;  1I50 A;  4ILD A;  4A3G C;  1WIH A;  1A31 A;  4LK0 A;  1Y1W C;  2YU9 A;  4G0V A;  1RR8 C;  1GE9 A;  3GTM A;  5IYC C;  2VUM K;  4KB4 A;  5C4J K;  4P5B A;  3FKI K;  3GTK K;  5M5Y K;  1XPP A;  2RH6 A;  2R7Z K;  1B4A A;  1EI6 A;  2A6H A;  3H3V L;  2PMZ A;  1USO A;  1V5V A;  1TWC A;  5C3E C;  1F93 A;  3S2H C;  1RRJ A;  4GTC A;  1SC7 A;  3VA7 A;  4WJ4 A;  2R93 K;  4KC6 A;  2NVX K;  3I4M C;  3GTG C;  4BBS K;  1EQR A;  3H0G A;  1XXB A;  3M4O C;  2JA8 C;  4KMA A;  3DU5 A;  1ZYR D;  4KDD A;  4LMO A;  3AQP A;  4A3F C;  2B63 C;  4JLR C;  1V9M A;  2PMZ L;  1J98 A;  2WB1 D;  3IAY A;  1XZP A;  3GEI A;  4GZY A;  5IYD K;  1O28 A;  2R92 K;  4A3L K;  2GAH C;  4P5A A;  2V6T A;  3N3Y A;  3AD8 C;  4A3B K;  1WSV A;  4QCL A;  1YNJ D;  3K57 A;  3NUH A;  1DCP A;  4PAB A;  1IQ0 A;  1TWG C;  1X31 C;  4GTE A;  2R7Z C;  1TWF C;  3S17 K;  3CQZ K;  4G0U A;  3I4N K;  3GTL C;  4J3N A;  4YFX A;  4GTL A;  4GTD A;  1Q8I A;  1O24 A;  5IYB C;  2YU9 K;  1INN A;  3S1N K;  2R93 C;  4DDQ A;  2NVT K;  1SMY D;  4C3I C;  2PHC B;  4NOI A;  1I6H K;  3HOU C;  3HKZ A;  4GTA A;  3LHP S;  4C3J K;  4A3K K;  5M5W K;  2CW0 A;  2A69 D;  2JA5 C;  4KAS A;  2VUM A;  3L4J A;  2O5J A;  4C3H C;  4XSX A;  3FKI A;  1TWC K;  3T00 A;  5FJ8 K;  3GTK A;  4QJV B;  4A3I K;  1SFO C;  1WCM C;  2R7Z A;  1TWH K;  4QIW D;  4AHC A;  1PJ6 A;  3HOY K;  1BGW A;  3GTL A;  4KAT A;  2PPB A;  1WOS A;  3LPX A;  4A3G K;  1USM A;  4M1X A;  1K4S A;  1A36 A;  2E2I C;  1Y1W K;  2E2H C;  3ORE A;  2EBB A;  2R93 A;  2V6S A;  2NVX A;  5IOR A;  4FXD A;  2Y0S A;  5IYC K;  4A3D C;  3N0B A;  3RZD C;  2BE5 A;  5TMC A;  4KN7 A;  3N0C A;  1TWA C;  1KQ4 A;  1EK8 A;  2RGR A;  3S1N C;  2PA8 L;  5M3F K;  3BP8 C;  3GEH A;  3M4A A;  2JA5 A;  3EQL A;  4A93 C;  2NVQ C;  2R92 A;  4A3C C;  3FOF A;  5C3E K;  2GAG C;  3S2H K;  2Y0S L;  1TGO A;  3G4C A;  1RU0 A;  3GTG K;  4G7O A;  1O2B A;  3ERE D;  1WOP A;  4MEY A;  1IS1 A;  3M4O K;  1F9N A;  2JA8 K;  1A35 A;  3RZO C;  3HOY C;  3CQZ A;  3GTJ C;  2B63 K;  2E2H A;  2XCQ A;  3JST A;  1XXA A;  4X6A C;  1WOO A;  1I6V D;  2CFA A;  3L4K A;  4GFQ A;  1WOR A;  3AD7 C;  3PO2 C;  2V6U A;  4QJV A;  3K59 A;  4G0W A;  4EJ3 A;  2D6F C;  3M3Y C;  1TWG K;  4FYD A;  2JA6 C;  3S1Q C;  1TWF K;  1JVI A;  1ZYR A;  3IPJ A;  4Y7N K;  3LAJ A;  4AYB D;  3GTL K;  2WAQ D;  4FM9 A;  2WB1 A;  5TMF A;  3QX3 A;  5IOS A;  4GT9 A;  5IYB K;  1TWH A;  5IOQ A;  3GTJ A;  4MEX A;  5JVO A;  1YNJ A;  3S15 C;  4C3I K;  1NH3 A;  1VJE A;  2FQT A;  3HOU K;  1Y1W A;  4KAR A;  2F4Q A;  5L46 A;  2JH3 A;  2JA5 K;  5IP7 K;  4C3H K;  2O5I A;  4KM8 A;  1SFO K;  2JA6 A;  1WCM K;  4C45 A;  1Y69 8;  5D4D A;  5CQG A;  1EH1 A;  3HOV C;  1R9T C;  1SMY A;  3GTP C;  4D3Y A;  3HOW C;  5IOT A;  4GTF A;  3TFJ A;  4NOL A;  5MLC 9;  1R49 A;  4Y7N C;  1F7U A;  2E2I K;  5FLM C;  2E2H K;  3GTG A;  1K83 C;  4A3D K;  1IE0 A;  1I3Q K;  3RZD K;  2XCO A;  1TWA K;  4Q5S A;  2B63 A;  4H3T A;  4QIW A;  2KWA A;  3GSI A;  2Y3P A;  4A93 K;  2NVQ K;  3S16 C;  3Q3Q A;  4A3C K;  2CFA B;  1DCO A;  5IP7 C;  2ZUE A;  1R9T A;  3S1R C;  1TWG A;  3P9A A;  3GTP A;  4QIW L;  4Q4Z A;  2GSO A;  1TWF A;  1HI9 A;  3GTO C;  3PO3 C;  3RZO K;  3CAG A;  3GTJ K;  5HL8 A;  2A6E D;  3T02 A;  4OIO A;  4BY7 C;  3GEE A;  3HKZ L;  1XXC A;  4L8I A;  4X6A K;  4NOK A;  1UV7 A;  1IW7 D;  1WQF A;  3AH5 A;  3PO2 K;  5CJ9 A;  1I3Q C;  4KM9 A;  1C0A A;  3M3Y K;  1J6V A;  4WIL A;  3HOX K;  4Y52 C;  3G4A A;  2JA6 K;  3S1Q K;  5C44 C;  4LR2 A;  2JA7 C;  2W7V A;  2A68 D;  1EJ9 A;  4XSZ A;  3GIR A;  1Y1V C;  3HXA A;  1O2A A;  1HQM D;  1WQH A;  1I6V A;  1O25 A;  4OIQ A;  3GTQ C;  1SFO A;  4GTB A;  1WCM A;  2CW0 D;  4F3E A;  5E68 A;  4BBR K;  4Q5V A;  3A8J A;  4G7H A;  4BY1 C;  3WVO A;  1O26 A;  3S15 K;  2GSN A;  3LF9 A;  1PJ7 A;  1BJT A;  1O27 A;  1YNN D;  2E2I A;  4FZB A;  3HOZ C;  2PA8 D;  4LOW A;  3LAP A;  1WSR A;  3GTM C;  4AYB A;  2WAQ A;  1I3Q A;  4OIR A;  3S1M C;  1T8I A;  1YCL A;  1TWA A;  4BXX C;  3S2D C;  2NVY C;  2Y0S D;  4PAA A;  1O29 A;  3HOV K;  2BE5 D;  1R9T K;  5M3M K;  3HOX C;  3GTP K;  4OIN A;  3HOW K;  4O2D A;  3V4G A;  2FQO A;  4AYB L;  5JSB B;  4P9S A;  2WAQ L;  1VH2 A;  5EGE A;  5FLM K;  2E2J C;  4KN4 A;  3H0G C;  1K83 K;  5C4X C;  4LQY A;  5IP9 C;  4LJZ A;  4BBR C;  5C9H A;  1XZQ A;  4A3J C;  3DU6 A;  1J6W A;  3OPF A;  4MQ9 A;  3BUE A;  4O26 A;  1SEU A;  3S16 K;  2WB1 L;  3S14 C;  1IBA A;  5JSN B;  4WJ3 M;  2NVY A;  3H3V D;  4RMF A;  4G7Z A;  3S1R K; 
#chains in the Genus database with same CATH homology
 3OEP A;  2Y0S A;  1AB4 A;  3N0B A;  2Y3P A;  3Q3Q A;  2CFA B;  2ZFZ A;  3MML B;  4AN8 A;  1TL8 A;  1I50 A;  4ILD A;  3N0C A;  3KYL A;  1KQ4 A;  1EK8 A;  5JFE A;  1WIH A;  4FGU A;  2RGR A;  4C2M C;  3M4A A;  3K5L A;  3MAQ A;  1A31 A;  2YU9 A;  2GSU A;  4G0V A;  1R9T A;  1TWG A;  3P9A A;  3K58 A;  4KAW X;  3GTP A;  2JA5 A;  1RR8 C;  1GE9 A;  2A6H D;  3GTM A;  2GSO A;  4KB4 A;  2R92 A;  1TWF A;  3FOF A;  4P5B A;  3CAG A;  1DD5 A;  2A6E D;  1TGO A;  5TJ3 A;  2RH6 A;  4IP9 A;  1B4A A;  1XXC A;  3G4C A;  4L8I A;  1O2B A;  3ERE D;  4NOK A;  2XCR B;  1IS1 A;  4OYD B;  2PMZ A;  1IW7 D;  1F9N A;  5IOR A;  1A35 A;  1TWC A;  1WQF A;  3CQZ A;  3AH5 A;  1RRJ A;  4GTC A;  1SC7 A;  5CJ9 A;  4KM9 A;  2E2H A;  2XCQ A;  5EGH A;  3VA7 A;  1XXA A;  4KC6 A;  1I6V D;  3K5M A;  2CFA A;  3G4A A;  1ZVU A;  3H0G A;  1XXB A;  4LR2 A;  5CHP A;  3L4K A;  4KMA A;  2A68 D;  1ZYR D;  3DU5 A;  4KDD A;  4LMO A;  4C2M A;  4GFQ A;  1EJ9 A;  4JLR C;  3AQP A;  1V9M A;  4G0W A;  3K59 A;  1HQM D;  1WQH A;  1O2A A;  4EJ3 A;  1O25 A;  1SFO A;  4GTB A;  4BLB A;  3IAY A;  1WCM A;  4FYD A;  2CW0 D;  1O28 A;  4F3E A;  1K83 A;  4P5A A;  4Q5V A;  3N3Y A;  1LPQ A;  3WVO A;  3LAJ A;  3FOE A;  1O26 A;  2GSN A;  2WB1 A;  1YNJ D;  3K57 A;  4QCL A;  3SJR A;  3NUH A;  4FM9 A;  3LF9 A;  3QX3 A;  5IOS A;  1BJT A;  4GT9 A;  1O27 A;  1YNN D;  4KMH A;  2E2I A;  3FHZ A;  4FZB A;  1TWH A;  4GTE A;  5IOQ A;  3LAP A;  4AYB A;  3GTJ A;  2WAQ A;  5JVO A;  4BLA A;  1I3Q A;  4G0U A;  1T8I A;  1TWA A;  2B9S B;  4J3N A;  4GTL A;  1NH3 A;  4GTD A;  1Q8I A;  4Q5G A;  1Y1W A;  1O24 A;  4KAR A;  1O29 A;  4D3Z A;  2BE5 D;  2F4Q A;  2R4G A;  1ZBS A;  2JH3 A;  4NOM A;  3K5O A;  1WQG A;  3AQO A;  2P5M A;  4DDQ A;  3GTO A;  1SMY D;  4C3I C;  2O5J D;  3V4G A;  4KM8 A;  1K4T A;  5JSB B;  2PHC B;  5EGE A;  2JA6 A;  4BKW A;  1Y69 8;  3HKZ A;  4GTA A;  1ISE A;  5CQG A;  1EH1 A;  3LHP S;  4LQY A;  1R5Z A;  1MIU A;  2A69 D;  4KAS A;  2VUM A;  4D3Y A;  4KB2 A;  4C3H C;  3L4J A;  5IOT A;  4GTF A;  3FKI A;  4NOL A;  5MLC 9;  1R49 A;  3GTK A;  5C9H A;  1ZXO A;  3DU6 A;  2R7Z A;  3OPF A;  4AHC A;  3BUE A;  3GTG A;  4O26 A;  1BGW A;  4C3J C;  1SEU A;  3GTL A;  4KAT A;  2XCO A;  3K5N A;  4IP8 A;  3LPX A;  3S0X A;  2JA7 A;  5JSN B;  4M1X A;  1K4S A;  2NVY A;  2B63 A;  1Y1V A;  4H3T A;  4QIW A;  1A36 A;  4KMD A;  2KWA A;  3GTQ A;  3ORE A;  2R93 A;  2NVX A;  1B4B A;  4FXD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...