1WQGA

Crystal structure of ribosome recycling factor from mycobacterium tuberculosis
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
184
structure length
184
Chain Sequence
IDEALFDAEEKMEKAVAVARDDLSTIRTGRANPGMFSRITIDYYGAATPITQLASINVPEARLVVIKPYEANQLRAIETAIRNSDLGVNPTNDGALIRVAVPQLTEERRRELVKQAKHKGEEAKVSVRNIRRKAMEELHRIRKEGEAGEDEVGRAEKDLDKTTHQYVTQIDELVKHKEGELLEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title X-ray structural studies of Mycobacterium tuberculosis RRF and a comparative study of RRFs of known structure. Molecular plasticity and biological implications
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Translation
molecule keywords Ribosome recycling factor
total genus 70
structure length 184
sequence length 184
ec nomenclature
pdb deposition date 2004-09-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01765 RRF Ribosome recycling factor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.132.20 Mainly Alpha Orthogonal Bundle Topoisomerase I; Chain A, domain 4 Topoisomerase I; Chain A, domain 4 1wqgA01
3.30.1360.40 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 Gyrase A; domain 2 1wqgA02
2P5MA 5JVOA 4G0UA 4JLRC 1WQGA 2XCOA 2ZFZA 3LAPA 1XXBA 2PHCB 3L4KA 3OEPA 4G0VA 1BJTA 3LF9A 3VA7A 1B4BA 3FHZA 1ZVUA 1EK8A 4KB2A 1F9NA 4J3NA 3NUHA 1WIHA 3OPFA 1ISEA 3LPXA 1WQFA 1GE9A 3BUEA 5JSBB 4KAWX 2RGRA 2Y3PA 1WQHA 1AB4A 1XXCA 3QX3A 2XCQA 4OYDB 5JSNB 3CAGA 3FOEA 1Y698 3ERED 4G0WA 1DD5A 1EH1A 4GFQA 3MMLB 4FM9A 1B4AA 4DDQA 4KB4A 3LHPS 3L4JA 3FOFA 2KWAA 1XXAA 5MLC9 2XCRB 3V4GA 3OREA 4L8IA 3LAJA 1BGWA 4KDDA 5CJ9A 1IS1A 4KC6A
chains in the Genus database with same CATH superfamily
3HKZA 2FQOA 4G0UA 2EBBA 3M3YC 1R9TC 1BDFA 4QIWD 4LQYA 4BBSC 3LAJA 1IW7D 3H3VL 2NVQC 2W7VA 4XSZA 1TWAC 3GTMA 2JA5A 4M1XA 3I4NK 3CQZA 3GTLK 4Q5SA 1JVIA 1TWAA 2E2HK 3PO3K 4A3DK 5IP7C 4GTAA 1RRJA 4GTBA 3T00A 4GFQA 4A3JK 1Y1WK 2NVYA 4A3LK 3K7AC 2CFAB 3HOYC 1YNND 3DU6A 4A3FK 4YG2A 3PO2K 3FHZA 1YX2A 4A3IK 4X6AC 1TWHA 1WOSA 4KB2A 1HQMA 5TMCA 1XZPA 3OPFA 3FKIC 2FQTA 4Q5VA 4IP9A 4AYBA 1I50K 1Y698 4GTFA 4GTLA 3TFHA 3M4OK 4YFXA 3L4JA 4BBSK 1I3QC 2A69A 1WCMC 4PAAA 2R92A 1WSVA 1YNJA 2WB1D 4C3IC 2JA7A 2V6TA 4WILA 2PA8D 2PHCB 2R93C 3HOZC 1IL2A 1J6XA 2NVXK 1I6VD 3GTOK 3S14C 3Q3QA 3S2DC 3S1QK 4GTEA 1K83K 4P5AA 4C2MC 4BY7K 4OYDB 3GEHA 3P9AA 1PJ6A 1TWHK 3A8IA 4OIPA 5IORA 3TFJA 3DU5A 3GTMK 4A3KK 1I50C 3GTQA 1SMYA 3GTLC 4D3YA 1WCMA 3DXJA 2R7ZC 4C3HK 1SFOC 2JA7K 2ZUEA 5CHPA 2F4QA 2WAQL 2JA5K 2BE5A 3GTPK 3GTLA 5IYBC 4BBRK 2R92C 4A3JC 1Y1WC 4BBRC 2R92K 3S1RC 4WJ4A 1O27A 5IP7K 3S0XA 5CQGA 1WQFA 3BUEA 2R93A 4KN7A 2A69D 3K7AK 4LLGA 4A93K 4KM8A 1WSRA 2GSNA 2JA8K 2CW0D 3GDZA 1DD5A 4GZYA 2WB1L 3LHPS 5C44C 1IW7A 1IBAA 4BY7C 2RH6A 4NOMA 3TFIA 4OIRA 1I6VA 2V6UA 3FOFA 1BS2A 2B9SB 2E2IC 5JVOA 1A35A 1NH3A 2XCOA 2R7ZA 2VUMA 2Y0SD 4KMAA 1KQ4A 1EK8A 3RZDK 1Y1VC 2P8TA 4F3EA 4KATA 2B63A 1Y1VA 3JSTA 2Y3PA 1TWFC 4LOWA 4XSXA 3WODA 2B63C 1VJEA 3GIRA 2GAHC 3GTJK 4AYBD 1WOPA 3KYLA 2E2JK 1ZYRD 1V5VA 1INNA 3M4AA 4G7HA 5M5XK 2E2IK 4KC6A 3SZYA 4C3JC 1WCMK 4QIWA 1TWGK 1YNNA 5FLMC 4XLNA 4QJVB 4Q4ZA 3H0GK 1IQ0A 4GT9A 4J3NA 3NUHA 3GTGC 4O26A 1K4TA 3RZOK 3AH5A 3HKZL 3BP3A 5C3EK 4D3ZA 4KASA 1I6HC 3HOXK 4OIOA 5IOTA 4KB4A 4A3GK 4FXDA 4A3FC 1J6VA 4ILDA 1DCPA 1A31A 1Q8IA 2D6FC 3HKZD 4FYDA 1O28A 1R9TK 4C2MK 4C3JK 1T8IA 2RGRA 3CQZC 3I4NC 4Y7NC 4MQ9A 4ZH4A 4OIQA 3AD8C 1TWGA 3G4AA 2NVQK 5C4JC 3GTGK 4FM9A 1TWGC 5FLMK 4AN8A 1DCOA 3N3YA 5TJ3A 3I4MK 2R4GA 1XXBA 3IAYA 4JLRC 4BY1K 2O5JA 4QIWL 2PA8L 3RZDC 4G0VA 1BJTA 3GTJA 1TL8A 3GEEA 5IYDK 3T02A 4BY1C 4KMHA 1O2BA 2PMZD 2PPBA 3GTKK 3S15K 5JSBB 4AYBL 2A68D 3FKIK 2XCQA 2VUMC 4YFNA 1EH1A 1VGXA 1V9MA 1EQRA 5C4JK 2JA6A 3S16C 3H0GA 1R49A 1I50A 1EFWA 4AHCA 3S17C 3N0BA 5IYCK 1XZPB 2JA6C 5EGEA 1SFOA 3I4MC 3S2HC 1UV7A 3OEPA 4A3EC 1IE0A 2O5IA 2WB1A 4Y52K 2GSOA 1VLOA 1ZBSA 1YCLA 4BXXK 5FJ8K 2Y0SL 1R9TA 4XCHA 4A3LC 2A6EA 3MMLB 4A3IC 1TWHC 5E68A 5L46A 4NOLA 1RU0A 4BLAA 2JA8C 1K83C 4LK0A 1SEUA 2JA5C 3FKIA 4KDDA 1HQMD 1TGOA 3S1QC 4BKWA 1C0AA 4LJZA 4XLPA 3S1RK 3H0GC 4A3GC 4A3KC 4KN4A 1O26A 3S2HK 4P5BA 1WIHA 3K58A 4C3HC 5M3MK 1SFOK 2JA7C 4BXXC 4IP8A 4KAWX 5IYCC 3GTKC 1WORA 3N0CA 1WQHA 4EJ3A 3GTOC 3S14K 4YFKA 1O2AA 4NOKA 1WOOA 2NVXC 1X31C 1B4AA 4GTCA 1F7UA 4A3EK 3GTJC 4QJVA 3SZZA 3S1MC 3AD7C 1HI9A 1ZXOA 1BGWA 3S15C 2JA6K 2E2IA 3IPJA 5M5WK 3S17K 2A6HD 5IYDC 3GTQK 3SJRA 5C9HA 4LR2A 4PABA 4MEXA 4P9SA 2O5JD 4A3BC 1ZYRA 2VUMK 5TMFA 1TWFK 4KM9A 3S1NC 1F93A 3K5OA 3A8JA 5IOQA 4OINA 4QCLA 4G0WA 3HOYK 1O29A 4LK1A 1WQGA 4A3MC 2WAQD 4NOIA 3HOWK 2WAQA 3LF9A 3HOVC 4X6AK 2A6HA 5M5YK 3PO2C 3GTGA 4A3MK 2GAGC 5C3EC 5IP9C 3WVOA 3MAQA 2CW0A 3ERED 3GTPA 3EQLA 4DDQA 3HOXC 1USOA 2NVYK 2NVTK 3GEIA 1EJ9A 1SC7A 2E2HC 3PO3C 4A3DC 1XPPA 3V4GA 3GTPC 2E2HA 1A36A 5CJ9A 3AQPA 1F7VA 2GSUA 4Y52C 3GTKA 3L4KA 3GTOA 4JK1A 3HOUK 1DCHA 1F9NA 3HOZK 3AQOA 3H3VD 3AD9C 1ISEA 2YU9C 1GE9A 1VRQC 1R5ZA 3K5MA 2YU9K 5C4XC 5EGHA 2E2JC 1LPQA 3T01A 3S16K 3M4OC 4C45A 3GTQC 4LMOA 4L8IA 4GTDA 3K5LA 2P5MA 1XZQA 2ZFZA 1Y1VK 1TWCA 1I3QK 1B4BA 1SMYD 3ADAC 3VA7A 5D4DA 2PMZL 1K4SA 4AH6A 3LPXA 4A93C 3G4CA 4G7OA 5IP9K 4MEYA 2YU9A 2A6ED 1AB4A 1XXCA 5HL8A 3FOEA 5C44K 4KMUA 4RMFA 1RR8C 1USMA 3HOUC 4BLBA 3HOVK 4Y7NK 3OREA 3CQZK 1K83A 1TWAK 1MIUA 3RZOC 2CFAA 3LAPA 5IOSA 1JOEA 3HXAA 1Y1WA 1O2FB 1YNJD 1TWCK 4A3CC 2NVYC 1I3QA 1G51A 1O25A 2ZUFA 1TWCC 4FZBA 4A3CK 2BE5D 3GSIA 5IYBK 1I6HK 1PJ5A 1EI6A 4G7ZA 4FGUA 2V6SA 3S2DK 3QX3A 3BP8C 5JSNB 3CAGA 3K59A 2A68A 4Q5GA 5JFEA 1ZQ1C 2R93K 3HOWC 2PMZA 4H3TA 1O24A 1JQWA 3M3YK 1IS1A 1XZQB 2R7ZK 4C2MA 3K5NA 3S1MK 4A3BK 4O2DA 1J6WA 1L0WA 4KMDA 4WJ3M 1ZVUA 3S1NK 3GTMC 1J98A 2B63K 5C4XK 1TWFA 3TTGA 4C3IK 4KARA 1PJ7A 2JH3A 2NVTC 3A8KA 2NVXA 2KWAA 3K57A 5MLC9 1VH2A 2XCRB 2Y0SA 1XXAA 5M3FK
chains in the Genus database with same CATH topology
5JVOA 3HKZA 1A35A 4G0UA 1SFOA 1NH3A 2XCOA 2R7ZA 2GSUA 2VUMA 4KMAA 3GTKA 3L4KA 3OEPA 1KQ4A 3GTOA 4LQYA 3LAJA 1IW7D 1EK8A 1F9NA 3AQOA 4F3EA 2WB1A 2GSOA 4KATA 1ISEA 2B63A 1ZBSA 3GTMA 2JA5A 1Y1VA 4M1XA 1GE9A 1R5ZA 3CQZA 3K5MA 2Y3PA 1R9TA 5EGHA 1TWAA 1LPQA 4GTAA 1RRJA 4GTBA 3MMLB 4GFQA 3KYLA 2NVYA 4NOLA 4BLAA 1ZYRD 1SEUA 4LMOA 3M4AA 4L8IA 4GTDA 3FKIA 4KDDA 1HQMD 1TGOA 3K5LA 4KC6A 4BKWA 2CFAB 2P5MA 4C3JC 1YNND 3DU6A 2ZFZA 1TWCA 3VA7A 4QIWA 1SMYD 1B4BA 3FHZA 1TWHA 4KB2A 1K4SA 1O26A 4GT9A 4J3NA 3NUHA 4P5BA 4O26A 1WIHA 1K4TA 3K58A 3OPFA 3AH5A 3LPXA 4C3HC 3G4CA 4IP8A 4KAWX 4Q5VA 4IP9A 3N0CA 1WQHA 4EJ3A 2A6ED 4AYBA 2YU9A 1AB4A 1XXCA 1O2AA 3FOEA 4NOKA 4D3ZA 1Y698 4GTLA 4GTFA 4KASA 5IOTA 1B4AA 4GTCA 4KB4A 1RR8C 3L4JA 4BLBA 1XXAA 2R92A 3OREA 4FXDA 1K83A 1ZXOA 2JA7A 4C3IC 1BGWA 4ILDA 2E2IA 1MIUA 2CFAA 3LAPA 1A31A 2PHCB 5IOSA 2A6HD 1Q8IA 1Y1WA 1YNJD 3SJRA 5C9HA 4LR2A 1I3QA 1O25A 4FZBA 2BE5D 2O5JD 4FYDA 1I6VD 1O28A 4FGUA 3Q3QA 1T8IA 4GTEA 2RGRA 3QX3A 4P5AA 3G4AA 1TWGA 4C2MC 4OYDB 3P9AA 5JSNB 3K59A 3CAGA 4KM9A 2E2HA 5IORA 4FM9A 3DU5A 4Q5GA 3K5OA 5JFEA 4AN8A 3GTQA 3N3YA 5TJ3A 2PMZA 4H3TA 5IOQA 1O24A 4QCLA 4D3YA 1WCMA 2R4GA 4G0WA 1IS1A 3IAYA 1O29A 1XXBA 5CHPA 4JLRC 2F4QA 1WQGA 4C2MA 3K5NA 3GTLA 4G0VA 2WAQA 3LF9A 1BJTA 3GTJA 4KMDA 1TL8A 1ZVUA 1O27A 3GTGA 4KMHA 1O2BA 3S0XA 5CQGA 1WQFA 1TWFA 3WVOA 3MAQA 2R93A 5JSBB 3BUEA 2A69D 4KARA 2A68D 4KM8A 2GSNA 2JH3A 2CW0D 2XCQA 3ERED 1DD5A 1EH1A 2NVXA 3GTPA 4DDQA 1V9MA 3LHPS 2KWAA 3K57A 2JA6A 1EJ9A 1SC7A 3H0GA 5MLC9 4NOMA 1I50A 4AHCA 1R49A 2RH6A 3N0BA 3V4GA 2XCRB 3FOFA 2Y0SA 1A36A 5CJ9A 5EGEA 3AQPA 2B9SB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2P5M A;  5JVO A;  4G0U A;  4JLR C;  1WQG A;  2XCO A;  2ZFZ A;  3LAP A;  1XXB A;  2PHC B;  3L4K A;  3OEP A;  4G0V A;  1BJT A;  3LF9 A;  3VA7 A;  1B4B A;  3FHZ A;  1ZVU A;  1EK8 A;  4KB2 A;  1F9N A;  4J3N A;  3NUH A;  1WIH A;  3OPF A;  1ISE A;  3LPX A;  1WQF A;  1GE9 A;  3BUE A;  5JSB B;  4KAW X;  2RGR A;  2Y3P A;  1WQH A;  1AB4 A;  1XXC A;  3QX3 A;  2XCQ A;  4OYD B;  5JSN B;  3CAG A;  3FOE A;  1Y69 8;  3ERE D;  4G0W A;  1DD5 A;  1EH1 A;  4GFQ A;  3MML B;  4FM9 A;  1B4A A;  4DDQ A;  4KB4 A;  3LHP S;  3L4J A;  3FOF A;  2KWA A;  1XXA A;  5MLC 9;  2XCR B;  3V4G A;  3ORE A;  4L8I A;  3LAJ A;  1BGW A;  4KDD A;  5CJ9 A;  1IS1 A;  4KC6 A; 
#chains in the Genus database with same CATH topology
 3HKZ A;  2FQO A;  4G0U A;  2EBB A;  3M3Y C;  1R9T C;  1BDF A;  4QIW D;  4LQY A;  4BBS C;  3LAJ A;  1IW7 D;  3H3V L;  2NVQ C;  2W7V A;  4XSZ A;  1TWA C;  3GTM A;  2JA5 A;  4M1X A;  3I4N K;  3CQZ A;  3GTL K;  4Q5S A;  1JVI A;  1TWA A;  2E2H K;  3PO3 K;  4A3D K;  5IP7 C;  4GTA A;  1RRJ A;  4GTB A;  3T00 A;  4GFQ A;  4A3J K;  1Y1W K;  2NVY A;  4A3L K;  3K7A C;  2CFA B;  3HOY C;  1YNN D;  3DU6 A;  4A3F K;  4YG2 A;  3PO2 K;  3FHZ A;  1YX2 A;  4A3I K;  4X6A C;  1TWH A;  1WOS A;  4KB2 A;  1HQM A;  5TMC A;  1XZP A;  3OPF A;  3FKI C;  2FQT A;  4Q5V A;  4IP9 A;  4AYB A;  1I50 K;  1Y69 8;  4GTF A;  4GTL A;  3TFH A;  3M4O K;  4YFX A;  3L4J A;  4BBS K;  1I3Q C;  2A69 A;  1WCM C;  4PAA A;  2R92 A;  1WSV A;  1YNJ A;  2WB1 D;  4C3I C;  2JA7 A;  2V6T A;  4WIL A;  2PA8 D;  2PHC B;  2R93 C;  3HOZ C;  1IL2 A;  1J6X A;  2NVX K;  1I6V D;  3GTO K;  3S14 C;  3Q3Q A;  3S2D C;  3S1Q K;  4GTE A;  1K83 K;  4P5A A;  4C2M C;  4BY7 K;  4OYD B;  3GEH A;  3P9A A;  1PJ6 A;  1TWH K;  3A8I A;  4OIP A;  5IOR A;  3TFJ A;  3DU5 A;  3GTM K;  4A3K K;  1I50 C;  3GTQ A;  1SMY A;  3GTL C;  4D3Y A;  1WCM A;  3DXJ A;  2R7Z C;  4C3H K;  1SFO C;  2JA7 K;  2ZUE A;  5CHP A;  2F4Q A;  2WAQ L;  2JA5 K;  2BE5 A;  3GTP K;  3GTL A;  5IYB C;  4BBR K;  2R92 C;  4A3J C;  1Y1W C;  4BBR C;  2R92 K;  3S1R C;  4WJ4 A;  1O27 A;  5IP7 K;  3S0X A;  5CQG A;  1WQF A;  3BUE A;  2R93 A;  4KN7 A;  2A69 D;  3K7A K;  4LLG A;  4A93 K;  4KM8 A;  1WSR A;  2GSN A;  2JA8 K;  2CW0 D;  3GDZ A;  1DD5 A;  4GZY A;  2WB1 L;  3LHP S;  5C44 C;  1IW7 A;  1IBA A;  4BY7 C;  2RH6 A;  4NOM A;  3TFI A;  4OIR A;  1I6V A;  2V6U A;  3FOF A;  1BS2 A;  2B9S B;  2E2I C;  5JVO A;  1A35 A;  1NH3 A;  2XCO A;  2R7Z A;  2VUM A;  2Y0S D;  4KMA A;  1KQ4 A;  1EK8 A;  3RZD K;  1Y1V C;  2P8T A;  4F3E A;  4KAT A;  2B63 A;  1Y1V A;  3JST A;  2Y3P A;  1TWF C;  4LOW A;  4XSX A;  3WOD A;  2B63 C;  1VJE A;  3GIR A;  2GAH C;  3GTJ K;  4AYB D;  1WOP A;  3KYL A;  2E2J K;  1ZYR D;  1V5V A;  1INN A;  3M4A A;  4G7H A;  5M5X K;  2E2I K;  4KC6 A;  3SZY A;  4C3J C;  1WCM K;  4QIW A;  1TWG K;  1YNN A;  5FLM C;  4XLN A;  4QJV B;  4Q4Z A;  3H0G K;  1IQ0 A;  4GT9 A;  4J3N A;  3NUH A;  3GTG C;  4O26 A;  1K4T A;  3RZO K;  3AH5 A;  3HKZ L;  3BP3 A;  5C3E K;  4D3Z A;  4KAS A;  1I6H C;  3HOX K;  4OIO A;  5IOT A;  4KB4 A;  4A3G K;  4FXD A;  4A3F C;  1J6V A;  4ILD A;  1DCP A;  1A31 A;  1Q8I A;  2D6F C;  3HKZ D;  4FYD A;  1O28 A;  1R9T K;  4C2M K;  4C3J K;  1T8I A;  2RGR A;  3CQZ C;  3I4N C;  4Y7N C;  4MQ9 A;  4ZH4 A;  4OIQ A;  3AD8 C;  1TWG A;  3G4A A;  2NVQ K;  5C4J C;  3GTG K;  4FM9 A;  1TWG C;  5FLM K;  4AN8 A;  1DCO A;  3N3Y A;  5TJ3 A;  3I4M K;  2R4G A;  1XXB A;  3IAY A;  4JLR C;  4BY1 K;  2O5J A;  4QIW L;  2PA8 L;  3RZD C;  4G0V A;  1BJT A;  3GTJ A;  1TL8 A;  3GEE A;  5IYD K;  3T02 A;  4BY1 C;  4KMH A;  1O2B A;  2PMZ D;  2PPB A;  3GTK K;  3S15 K;  5JSB B;  4AYB L;  2A68 D;  3FKI K;  2XCQ A;  2VUM C;  4YFN A;  1EH1 A;  1VGX A;  1V9M A;  1EQR A;  5C4J K;  2JA6 A;  3S16 C;  3H0G A;  1R49 A;  1I50 A;  1EFW A;  4AHC A;  3S17 C;  3N0B A;  5IYC K;  1XZP B;  2JA6 C;  5EGE A;  1SFO A;  3I4M C;  3S2H C;  1UV7 A;  3OEP A;  4A3E C;  1IE0 A;  2O5I A;  2WB1 A;  4Y52 K;  2GSO A;  1VLO A;  1ZBS A;  1YCL A;  4BXX K;  5FJ8 K;  2Y0S L;  1R9T A;  4XCH A;  4A3L C;  2A6E A;  3MML B;  4A3I C;  1TWH C;  5E68 A;  5L46 A;  4NOL A;  1RU0 A;  4BLA A;  2JA8 C;  1K83 C;  4LK0 A;  1SEU A;  2JA5 C;  3FKI A;  4KDD A;  1HQM D;  1TGO A;  3S1Q C;  4BKW A;  1C0A A;  4LJZ A;  4XLP A;  3S1R K;  3H0G C;  4A3G C;  4A3K C;  4KN4 A;  1O26 A;  3S2H K;  4P5B A;  1WIH A;  3K58 A;  4C3H C;  5M3M K;  1SFO K;  2JA7 C;  4BXX C;  4IP8 A;  4KAW X;  5IYC C;  3GTK C;  1WOR A;  3N0C A;  1WQH A;  4EJ3 A;  3GTO C;  3S14 K;  4YFK A;  1O2A A;  4NOK A;  1WOO A;  2NVX C;  1X31 C;  1B4A A;  4GTC A;  1F7U A;  4A3E K;  3GTJ C;  4QJV A;  3SZZ A;  3S1M C;  3AD7 C;  1HI9 A;  1ZXO A;  1BGW A;  3S15 C;  2JA6 K;  2E2I A;  3IPJ A;  5M5W K;  3S17 K;  2A6H D;  5IYD C;  3GTQ K;  3SJR A;  5C9H A;  4LR2 A;  4PAB A;  4MEX A;  4P9S A;  2O5J D;  4A3B C;  1ZYR A;  2VUM K;  5TMF A;  1TWF K;  4KM9 A;  3S1N C;  1F93 A;  3K5O A;  3A8J A;  5IOQ A;  4OIN A;  4QCL A;  4G0W A;  3HOY K;  1O29 A;  4LK1 A;  1WQG A;  4A3M C;  2WAQ D;  4NOI A;  3HOW K;  2WAQ A;  3LF9 A;  3HOV C;  4X6A K;  2A6H A;  5M5Y K;  3PO2 C;  3GTG A;  4A3M K;  2GAG C;  5C3E C;  5IP9 C;  3WVO A;  3MAQ A;  2CW0 A;  3ERE D;  3GTP A;  3EQL A;  4DDQ A;  3HOX C;  1USO A;  2NVY K;  2NVT K;  3GEI A;  1EJ9 A;  1SC7 A;  2E2H C;  3PO3 C;  4A3D C;  1XPP A;  3V4G A;  3GTP C;  2E2H A;  1A36 A;  5CJ9 A;  3AQP A;  1F7V A;  2GSU A;  4Y52 C;  3GTK A;  3L4K A;  3GTO A;  4JK1 A;  3HOU K;  1DCH A;  1F9N A;  3HOZ K;  3AQO A;  3H3V D;  3AD9 C;  1ISE A;  2YU9 C;  1GE9 A;  1VRQ C;  1R5Z A;  3K5M A;  2YU9 K;  5C4X C;  5EGH A;  2E2J C;  1LPQ A;  3T01 A;  3S16 K;  3M4O C;  4C45 A;  3GTQ C;  4LMO A;  4L8I A;  4GTD A;  3K5L A;  2P5M A;  1XZQ A;  2ZFZ A;  1Y1V K;  1TWC A;  1I3Q K;  1B4B A;  1SMY D;  3ADA C;  3VA7 A;  5D4D A;  2PMZ L;  1K4S A;  4AH6 A;  3LPX A;  4A93 C;  3G4C A;  4G7O A;  5IP9 K;  4MEY A;  2YU9 A;  2A6E D;  1AB4 A;  1XXC A;  5HL8 A;  3FOE A;  5C44 K;  4KMU A;  4RMF A;  1RR8 C;  1USM A;  3HOU C;  4BLB A;  3HOV K;  4Y7N K;  3ORE A;  3CQZ K;  1K83 A;  1TWA K;  1MIU A;  3RZO C;  2CFA A;  3LAP A;  5IOS A;  1JOE A;  3HXA A;  1Y1W A;  1O2F B;  1YNJ D;  1TWC K;  4A3C C;  2NVY C;  1I3Q A;  1G51 A;  1O25 A;  2ZUF A;  1TWC C;  4FZB A;  4A3C K;  2BE5 D;  3GSI A;  5IYB K;  1I6H K;  1PJ5 A;  1EI6 A;  4G7Z A;  4FGU A;  2V6S A;  3S2D K;  3QX3 A;  3BP8 C;  5JSN B;  3CAG A;  3K59 A;  2A68 A;  4Q5G A;  5JFE A;  1ZQ1 C;  2R93 K;  3HOW C;  2PMZ A;  4H3T A;  1O24 A;  1JQW A;  3M3Y K;  1IS1 A;  1XZQ B;  2R7Z K;  4C2M A;  3K5N A;  3S1M K;  4A3B K;  4O2D A;  1J6W A;  1L0W A;  4KMD A;  4WJ3 M;  1ZVU A;  3S1N K;  3GTM C;  1J98 A;  2B63 K;  5C4X K;  1TWF A;  3TTG A;  4C3I K;  4KAR A;  1PJ7 A;  2JH3 A;  2NVT C;  3A8K A;  2NVX A;  2KWA A;  3K57 A;  5MLC 9;  1VH2 A;  2XCR B;  2Y0S A;  1XXA A;  5M3F K; 
#chains in the Genus database with same CATH homology
 5JVO A;  3HKZ A;  1A35 A;  4G0U A;  1SFO A;  1NH3 A;  2XCO A;  2R7Z A;  2GSU A;  2VUM A;  4KMA A;  3GTK A;  3L4K A;  3OEP A;  1KQ4 A;  3GTO A;  4LQY A;  3LAJ A;  1IW7 D;  1EK8 A;  1F9N A;  3AQO A;  4F3E A;  2WB1 A;  2GSO A;  4KAT A;  1ISE A;  2B63 A;  1ZBS A;  3GTM A;  2JA5 A;  1Y1V A;  4M1X A;  1GE9 A;  1R5Z A;  3CQZ A;  3K5M A;  2Y3P A;  1R9T A;  5EGH A;  1TWA A;  1LPQ A;  4GTA A;  1RRJ A;  4GTB A;  3MML B;  4GFQ A;  3KYL A;  2NVY A;  4NOL A;  4BLA A;  1ZYR D;  1SEU A;  4LMO A;  3M4A A;  4L8I A;  4GTD A;  3FKI A;  4KDD A;  1HQM D;  1TGO A;  3K5L A;  4KC6 A;  4BKW A;  2CFA B;  2P5M A;  4C3J C;  1YNN D;  3DU6 A;  2ZFZ A;  1TWC A;  3VA7 A;  4QIW A;  1SMY D;  1B4B A;  3FHZ A;  1TWH A;  4KB2 A;  1K4S A;  1O26 A;  4GT9 A;  4J3N A;  3NUH A;  4P5B A;  4O26 A;  1WIH A;  1K4T A;  3K58 A;  3OPF A;  3AH5 A;  3LPX A;  4C3H C;  3G4C A;  4IP8 A;  4KAW X;  4Q5V A;  4IP9 A;  3N0C A;  1WQH A;  4EJ3 A;  2A6E D;  4AYB A;  2YU9 A;  1AB4 A;  1XXC A;  1O2A A;  3FOE A;  4NOK A;  4D3Z A;  1Y69 8;  4GTL A;  4GTF A;  4KAS A;  5IOT A;  1B4A A;  4GTC A;  4KB4 A;  1RR8 C;  3L4J A;  4BLB A;  1XXA A;  2R92 A;  3ORE A;  4FXD A;  1K83 A;  1ZXO A;  2JA7 A;  4C3I C;  1BGW A;  4ILD A;  2E2I A;  1MIU A;  2CFA A;  3LAP A;  1A31 A;  2PHC B;  5IOS A;  2A6H D;  1Q8I A;  1Y1W A;  1YNJ D;  3SJR A;  5C9H A;  4LR2 A;  1I3Q A;  1O25 A;  4FZB A;  2BE5 D;  2O5J D;  4FYD A;  1I6V D;  1O28 A;  4FGU A;  3Q3Q A;  1T8I A;  4GTE A;  2RGR A;  3QX3 A;  4P5A A;  3G4A A;  1TWG A;  4C2M C;  4OYD B;  3P9A A;  5JSN B;  3K59 A;  3CAG A;  4KM9 A;  2E2H A;  5IOR A;  4FM9 A;  3DU5 A;  4Q5G A;  3K5O A;  5JFE A;  4AN8 A;  3GTQ A;  3N3Y A;  5TJ3 A;  2PMZ A;  4H3T A;  5IOQ A;  1O24 A;  4QCL A;  4D3Y A;  1WCM A;  2R4G A;  4G0W A;  1IS1 A;  3IAY A;  1O29 A;  1XXB A;  5CHP A;  4JLR C;  2F4Q A;  1WQG A;  4C2M A;  3K5N A;  3GTL A;  4G0V A;  2WAQ A;  3LF9 A;  1BJT A;  3GTJ A;  4KMD A;  1TL8 A;  1ZVU A;  1O27 A;  3GTG A;  4KMH A;  1O2B A;  3S0X A;  5CQG A;  1WQF A;  1TWF A;  3WVO A;  3MAQ A;  2R93 A;  5JSB B;  3BUE A;  2A69 D;  4KAR A;  2A68 D;  4KM8 A;  2GSN A;  2JH3 A;  2CW0 D;  2XCQ A;  3ERE D;  1DD5 A;  1EH1 A;  2NVX A;  3GTP A;  4DDQ A;  1V9M A;  3LHP S;  2KWA A;  3K57 A;  2JA6 A;  1EJ9 A;  1SC7 A;  3H0G A;  5MLC 9;  4NOM A;  1I50 A;  4AHC A;  1R49 A;  2RH6 A;  3N0B A;  3V4G A;  2XCR B;  3FOF A;  2Y0S A;  1A36 A;  5CJ9 A;  5EGE A;  3AQP A;  2B9S B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...