1WQGA

Crystal structure of ribosome recycling factor from mycobacterium tuberculosis
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
184
structure length
184
Chain Sequence
b'IDEALFDAEEKMEKAVAVARDDLSTIRTGRANPGMFSRITIDYYGAATPITQLASINVPEARLVVIKPYEANQLRAIETAIRNSDLGVNPTNDGALIRVAVPQLTEERRRELVKQAKHKGEEAKVSVRNIRRKAMEELHRIRKEGEAGEDEVGRAEKDLDKTTHQYVTQIDELVKHKEGELLEV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ribosome recycling factor
publication title X-ray structural studies of Mycobacterium tuberculosis RRF and a comparative study of RRFs of known structure. Molecular plasticity and biological implications
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Translation
total genus 70
structure length 184
sequence length 184
ec nomenclature
pdb deposition date 2004-09-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01765 RRF Ribosome recycling factor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.132.20 Mainly Alpha Orthogonal Bundle Topoisomerase I; Chain A, domain 4 Topoisomerase I; Chain A, domain 4 1wqgA01
3.30.1360.40 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 Gyrase A; domain 2 1wqgA02
3NUHA 3VA7A 4JLRC 4KC6A 1WIHA 3V4GA 5MLC9 4DDQA 3LPXA 4J3NA 5CJ9A 1XXAA 3LF9A 1ZVUA 4GFQA 2ZFZA 3BUEA 4G0WA 4KB2A 3OPFA 4G0UA 3LHPS 3QX3A 1XXCA 2KWAA 1WQHA 1Y698 4G0VA 4OYDB 5JSBB 5JSNB 1B4AA 3LAJA 1BGWA 1GE9A 1F9NA 1WQGA 3LAPA 3L4KA 3L4JA 1ISEA 2Y3PA 3MMLB 4KDDA 3OEPA 4FM9A 2P5MA 3FOEA 3CAGA 4KAWX 1DD5A 3FOFA 2RGRA 4KB4A 2PHCB 3OREA 2XCOA 4L8IA 1AB4A 2XCQA 1IS1A 2XCRB 3ERED 1BJTA 1EK8A 1XXBA 1WQFA 1EH1A 3FHZA 5JVOA 1B4BA
chains in the Genus database with same CATH superfamily
3VA7A 3N0CA 4GTLA 2E2IC 1XZPB 2D6FC 5IYCC 3SZZA 4KM8A 4Q5VA 1J6WA 5IOSA 3HOYC 1WOOA 1K83C 1I3QK 2YU9A 2E2JC 1O2BA 3T01A 3FKIK 5C4XC 2NVYC 3OEPA 4KMUA 2PPBA 4GTDA 2RGRA 2A68D 1WCMA 2B9SB 1SEUA 1K83A 2XCQA 1IL2A 4C3HC 4OIOA 3K5MA 4A3KK 5M3FK 4KC6A 2V6UA 4Q5SA 2JA7C 3TFHA 5D4DA 1XXAA 4QJVB 1ZVUA 1ZYRD 3S16C 4GTAA 1XZQB 5M5WK 3GTPK 5IP7K 3K7AK 1I6VA 3HOZK 3GTGC 4NOMA 1Q8IA 1O26A 4Y7NC 1MIUA 1YNJA 4IP9A 1EJ9A 3GTOC 1IBAA 4LMOA 4XSXA 3AH5A 4BLBA 4A3JK 3GTKK 2YU9K 1TWAA 2R92A 3DU6A 5M3MK 4EJ3A 4Y52K 3TTGA 1RRJA 1K4TA 4A3GC 1Y1VC 3SZYA 1WCMK 1K83K 4C3IK 3EQLA 2JA5C 2O5JD 1SFOC 3P9AA 5E68A 4G0UA 3PO3C 3H0GK 4KARA 4G0VA 5JSNB 4A3DC 3AD7C 3S1RK 4GTCA 1TL8A 3TFIA 3BP3A 5CHPA 2Y3PA 4C3HK 3HOUK 1YNND 2P8TA 4PAAA 4FM9A 1VRQC 4BBRK 3M3YK 4GTBA 3RZDC 2XCRB 1WOSA 4MEXA 3GTLK 3S15K 3CQZA 1T8IA 1TWAK 3AQPA 5HL8A 2R92K 1G51A 1O27A 2PMZD 2ZUEA 1C0AA 1HQMA 1SMYA 4FYDA 4A3FC 1I50C 5EGHA 4C45A 3N0BA 3GIRA 3BUEA 3S1QC 4KB2A 1PJ7A 1I6HK 1WSRA 2CFAB 2A68A 2ZUFA 2B63A 3M4OK 4GT9A 1F9NA 5IP9C 3LAPA 1ISEA 3WVOA 1I50A 1TGOA 5IOQA 2GSUA 2BE5A 2NVXA 4A3BC 3Q3QA 3HOVC 4BY7C 4AYBD 2FQTA 4F3EA 3L4JA 1WOPA 4BY1K 3I4NC 4A3MK 4WJ3M 3S1NK 3GTJC 3LPXA 2R7ZC 3CQZK 3LF9A 4G7OA 1TWFC 1O29A 2JA6C 1O25A 3IPJA 1J6XA 4P9SA 2JA8K 2E2HA 5JSBB 2WB1A 2A6HA 3KYLA 2WAQD 2R7ZA 1V5VA 4JK1A 2B63K 4C2MA 4XLPA 3RZOC 1EI6A 4AYBL 2XCOA 1I50K 2Y0SD 4C3JC 1R9TC 2NVXK 1J6VA 1EH1A 4QIWD 1TWHC 2VUMC 4LLGA 1VH2A 4GFQA 4G0WA 1O2FB 1IW7A 1NH3A 4BXXC 3S2DC 5IOTA 1Y698 3ADAC 4A3BK 2A6ED 1RU0A 2WAQL 1JOEA 2E2IA 4OIPA 4A93K 2E2HK 5IYBC 5FJ8K 4P5BA 1XPPA 4XCHA 2PHCB 2Y0SL 2R7ZK 1PJ5A 4BBSC 4FGUA 4M1XA 4C2MK 3DU5A 1EK8A 4PABA 4QIWL 1X31C 1O2AA 1WIHA 3K5LA 4MQ9A 4LK1A 2GAGC 4GTFA 3I4MC 4A3EK 3GDZA 2NVYA 3GEIA 2O5IA 1Y1WC 1WSVA 3QX3A 4KN7A 2R93C 4RMFA 4G7HA 2JA7A 5FLMC 3PO2K 4FZBA 4GZYA 1Y1WA 2F4QA 3HKZD 2E2IK 3S14C 5IYCK 3GSIA 1IQ0A 3GTGA 3HOXC 4KATA 2A69D 3HOYK 3S2DK 3GTOA 3GTMC 4A3LC 1WQFA 2ZFZA 4YFNA 5C9HA 1TWGC 2E2JK 1XXCA 1INNA 3T02A 5C4XK 5IYBK 2NVYK 3K58A 3HOWC 1R5ZA 4H3TA 1Y1VA 1GE9A 1YCLA 3A8IA 4BBSK 3S1MC 1R49A 3GTMA 3JSTA 3WODA 1O28A 3HKZL 2JA5A 1SFOA 1TWGA 2JA7K 1AB4A 4NOIA 2CW0D 3DXJA 3G4CA 3K57A 3S16K 4KN4A 1A36A 3AD8C 4NOKA 3AQOA 4DDQA 5CJ9A 4BLAA 3GTGK 4Y7NK 5CQGA 5C4JC 2EBBA 3S17C 4Q5GA 4ILDA 3GTOK 5FLMK 1WQHA 3K5NA 1LPQA 4KM9A 1EQRA 2NVQC 3GTQC 2V6SA 4FXDA 4A3GK 1DD5A 3HOXK 1Y1VK 3FOFA 3N3YA 4L8IA 3ERED 1ZYRA 2JA5K 4A3CC 3FHZA 1SFOK 5EGEA 2PA8D 3PO3K 3H3VL 5IYDC 4X6AC 1TWCC 4A3DK 5TJ3A 4OIRA 4ZH4A 3GEHA 4LK0A 4OYDB 4AHCA 1ZBSA 4QJVA 3L4KA 3RZDK 4WJ4A 1JQWA 3GTJA 1I6VD 4KAWX 1TWFA 1PJ6A 2JA6A 3A8KA 3OREA 1EFWA 4BKWA 1YNJD 3FKIC 3IAYA 4A3FK 2O5JA 2PA8L 5JFEA 1A35A 3S0XA 2RH6A 5C4JK 3S1QK 4D3YA 4A3KC 5IP9K 1YNNA 1SC7A 5C3EC 4KMDA 4WILA 1R9TA 4LR2A 2CW0A 5M5XK 4LJZA 5IP7C 1TWHA 2VUMA 2V6TA 3K7AC 3GTPC 3HOVK 4BY7K 2PMZA 4YFKA 4GTEA 4YFXA 3I4NK 1ZQ1C 3S2HC 1BS2A 4X6AK 3GTJK 1XXBA 4P5AA 4A3JC 1BGWA 3GTKC 2YU9C 1TWFK 2JA6K 3GTPA 3NUHA 4Y52C 1VLOA 1F93A 3TFJA 1WCMC 3OPFA 4C3IC 1HQMD 1SMYD 3MAQA 3GTKA 3K59A 1L0WA 3RZOK 4AYBA 1WQGA 4OIQA 3H0GC 4C3JK 1R9TK 5TMFA 3S1RC 2CFAA 3M4AA 1TWHK 2VUMK 2NVTC 3HOUC 4XLNA 1IS1A 5M5YK 4NOLA 1BJTA 4BBRC 5IORA 4IP8A 2R93A 2BE5D 3M3YC 3H0GA 4BXXK 5C3EK 3GTLC 3S15C 1TWAC 4D3ZA 2R92C 4AN8A 2WAQA 3HXAA 4OINA 1J98A 1A31A 1F7UA 1DCOA 2Y0SA 3S2HK 1I6HC 4MEYA 4LQYA 3GTLA 4KDDA 4QIWA 4G7ZA 3M4OC 4YG2A 1DCPA 4KB4A 2WB1D 2A6HD 3I4MK 4XSZA 3AD9C 5JVOA 1B4BA 3T00A 4JLRC 1Y1WK 3SJRA 2A6EA 3H3VD 1IE0A 4BY1C 2R93K 5C44C 4A3MC 3S1NC 3CQZC 2R4GA 1B4AA 1XZPA 2NVTK 1K4SA 3S14K 2W7VA 2JA8C 1VGXA 3MMLB 1IW7D 2P5MA 1ZXOA 3G4AA 3FOEA 1USMA 2WB1L 2B63C 5TMCA 3GTMK 4A3LK 1DCHA 3GEEA 1TWGK 3V4GA 5MLC9 3A8JA 4J3NA 3GTQA 4A3IC 2NVXC 3BP8C 4KMHA 3HOWK 3LHPS 2KWAA 4AH6A 3S1MK 1BDFA 4KMAA 3HKZA 1WORA 2GSNA 4KASA 4LOWA 5L46A 3K5OA 1HI9A 1VJEA 4O2DA 1I3QC 1USOA 1KQ4A 1XZQA 1TWCA 2A69A 4A93C 1O24A 2E2HC 2PMZL 1UV7A 5C44K 4Q4ZA 4O26A 3S17K 4C2MC 1I3QA 2NVQK 1V9MA 3FKIA 3GTQK 4A3EC 2JH3A 3LAJA 1RR8C 3HOZC 3CAGA 4A3CK 2FQOA 1F7VA 3PO2C 4A3IK 1YX2A 2GSOA 5IYDK 1JVIA 2GAHC 1TWCK 4QCLA
chains in the Genus database with same CATH topology
4IP8A 2R93A 3N0CA 2BE5D 4GTLA 3VA7A 1A36A 3H0GA 4NOKA 3AQOA 3LPXA 4DDQA 4KM8A 4Q5VA 5CJ9A 4BLAA 3LF9A 4D3ZA 5IOSA 4AN8A 1O29A 5CQGA 2WAQA 4Q5GA 1O25A 4ILDA 1WQHA 3K5NA 2E2HA 5JSBB 1LPQA 1A31A 2WB1A 2YU9A 2Y0SA 3KYLA 4KM9A 1O2BA 2R7ZA 4LQYA 3GTLA 4KDDA 3OEPA 4QIWA 4C2MA 4FXDA 4GTDA 2RGRA 1DD5A 3FOFA 2A68D 4KB4A 1WCMA 2XCOA 2B9SB 1SEUA 1K83A 4L8IA 2A6HD 2XCQA 3N3YA 3ERED 4C3HC 4C3JC 1EH1A 3K5MA 5JVOA 3FHZA 1B4BA 5EGEA 4JLRC 4KC6A 3SJRA 1XXAA 1ZVUA 1ZYRD 4GFQA 5TJ3A 4G0WA 4GTAA 1NH3A 5IOTA 1Y698 4OYDB 4AHCA 4NOMA 1Q8IA 1O26A 2R4GA 1B4AA 2A6ED 1MIUA 4IP9A 1K4SA 1EJ9A 2E2IA 1ZBSA 3L4KA 4LMOA 3MMLB 1IW7D 3GTJA 3AH5A 1I6VD 1ZXOA 2P5MA 3G4AA 4BLBA 3FOEA 4P5BA 1TWAA 1TWFA 4KAWX 2R92A 2JA6A 3DU6A 2PHCB 3OREA 4BKWA 1YNJD 4EJ3A 3IAYA 4FGUA 4M1XA 1RRJA 3DU5A 1EK8A 5JFEA 1K4TA 1A35A 3S0XA 2RH6A 1O2AA 1WIHA 4D3YA 3V4GA 3K5LA 5MLC9 4GTFA 4J3NA 3GTQA 2NVYA 2O5JD 3P9AA 4KMHA 4G0UA 3LHPS 3QX3A 1SC7A 4QCLA 2KWAA 4KARA 4G0VA 4KMAA 4KMDA 5JSNB 3HKZA 4KASA 1R9TA 2GSNA 4LR2A 4GTCA 1TL8A 1TWHA 2VUMA 5CHPA 3K5OA 2Y3PA 2JA7A 1YNND 4FZBA 4FM9A 2PMZA 1KQ4A 4GTEA 1TWCA 1Y1WA 2F4QA 4GTBA 1O24A 2XCRB 1XXBA 4P5AA 3CQZA 1T8IA 3GTGA 1BGWA 3AQPA 3GTPA 1O27A 3NUHA 4O26A 4KATA 2A69D 4FYDA 3GTOA 5EGHA 4C2MC 1I3QA 3N0BA 2ZFZA 3BUEA 4KB2A 5C9HA 3OPFA 4C3IC 1XXCA 2CFAB 1HQMD 1SMYD 1V9MA 3FKIA 3MAQA 3GTKA 2B63A 2JH3A 3K58A 3K59A 4GT9A 3LAJA 1R5ZA 4AYBA 1RR8C 4H3TA 1F9NA 1Y1VA 1GE9A 1WQGA 3LAPA 3L4JA 1ISEA 3WVOA 1I50A 1TGOA 1R49A 5IOQA 3GTMA 2GSUA 2NVXA 1O28A 3CAGA 2JA5A 2CFAA 3M4AA 1SFOA 3Q3QA 1TWGA 1AB4A 1IS1A 2CW0D 4NOLA 1BJTA 2GSOA 3G4CA 1WQFA 3K57A 4F3EA 5IORA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3NUH A;  3VA7 A;  4JLR C;  4KC6 A;  1WIH A;  3V4G A;  5MLC 9;  4DDQ A;  3LPX A;  4J3N A;  5CJ9 A;  1XXA A;  3LF9 A;  1ZVU A;  4GFQ A;  2ZFZ A;  3BUE A;  4G0W A;  4KB2 A;  3OPF A;  4G0U A;  3LHP S;  3QX3 A;  1XXC A;  2KWA A;  1WQH A;  1Y69 8;  4G0V A;  4OYD B;  5JSB B;  5JSN B;  1B4A A;  3LAJ A;  1BGW A;  1GE9 A;  1F9N A;  1WQG A;  3LAP A;  3L4K A;  3L4J A;  1ISE A;  2Y3P A;  3MML B;  4KDD A;  3OEP A;  4FM9 A;  2P5M A;  3FOE A;  3CAG A;  4KAW X;  1DD5 A;  3FOF A;  2RGR A;  4KB4 A;  2PHC B;  3ORE A;  2XCO A;  4L8I A;  1AB4 A;  2XCQ A;  1IS1 A;  2XCR B;  3ERE D;  1BJT A;  1EK8 A;  1XXB A;  1WQF A;  1EH1 A;  3FHZ A;  5JVO A;  1B4B A; 
#chains in the Genus database with same CATH topology
 3VA7 A;  3N0C A;  4GTL A;  2E2I C;  1XZP B;  2D6F C;  5IYC C;  3SZZ A;  4KM8 A;  4Q5V A;  1J6W A;  5IOS A;  3HOY C;  1WOO A;  1K83 C;  1I3Q K;  2YU9 A;  2E2J C;  1O2B A;  3T01 A;  3FKI K;  5C4X C;  2NVY C;  3OEP A;  4KMU A;  2PPB A;  4GTD A;  2RGR A;  2A68 D;  1WCM A;  2B9S B;  1SEU A;  1K83 A;  2XCQ A;  1IL2 A;  4C3H C;  4OIO A;  3K5M A;  4A3K K;  5M3F K;  4KC6 A;  2V6U A;  4Q5S A;  2JA7 C;  3TFH A;  5D4D A;  1XXA A;  4QJV B;  1ZVU A;  1ZYR D;  3S16 C;  4GTA A;  1XZQ B;  5M5W K;  3GTP K;  5IP7 K;  3K7A K;  1I6V A;  3HOZ K;  3GTG C;  4NOM A;  1Q8I A;  1O26 A;  4Y7N C;  1MIU A;  1YNJ A;  4IP9 A;  1EJ9 A;  3GTO C;  1IBA A;  4LMO A;  4XSX A;  3AH5 A;  4BLB A;  4A3J K;  3GTK K;  2YU9 K;  1TWA A;  2R92 A;  3DU6 A;  5M3M K;  4EJ3 A;  4Y52 K;  3TTG A;  1RRJ A;  1K4T A;  4A3G C;  1Y1V C;  3SZY A;  1WCM K;  1K83 K;  4C3I K;  3EQL A;  2JA5 C;  2O5J D;  1SFO C;  3P9A A;  5E68 A;  4G0U A;  3PO3 C;  3H0G K;  4KAR A;  4G0V A;  5JSN B;  4A3D C;  3AD7 C;  3S1R K;  4GTC A;  1TL8 A;  3TFI A;  3BP3 A;  5CHP A;  2Y3P A;  4C3H K;  3HOU K;  1YNN D;  2P8T A;  4PAA A;  4FM9 A;  1VRQ C;  4BBR K;  3M3Y K;  4GTB A;  3RZD C;  2XCR B;  1WOS A;  4MEX A;  3GTL K;  3S15 K;  3CQZ A;  1T8I A;  1TWA K;  3AQP A;  5HL8 A;  2R92 K;  1G51 A;  1O27 A;  2PMZ D;  2ZUE A;  1C0A A;  1HQM A;  1SMY A;  4FYD A;  4A3F C;  1I50 C;  5EGH A;  4C45 A;  3N0B A;  3GIR A;  3BUE A;  3S1Q C;  4KB2 A;  1PJ7 A;  1I6H K;  1WSR A;  2CFA B;  2A68 A;  2ZUF A;  2B63 A;  3M4O K;  4GT9 A;  1F9N A;  5IP9 C;  3LAP A;  1ISE A;  3WVO A;  1I50 A;  1TGO A;  5IOQ A;  2GSU A;  2BE5 A;  2NVX A;  4A3B C;  3Q3Q A;  3HOV C;  4BY7 C;  4AYB D;  2FQT A;  4F3E A;  3L4J A;  1WOP A;  4BY1 K;  3I4N C;  4A3M K;  4WJ3 M;  3S1N K;  3GTJ C;  3LPX A;  2R7Z C;  3CQZ K;  3LF9 A;  4G7O A;  1TWF C;  1O29 A;  2JA6 C;  1O25 A;  3IPJ A;  1J6X A;  4P9S A;  2JA8 K;  2E2H A;  5JSB B;  2WB1 A;  2A6H A;  3KYL A;  2WAQ D;  2R7Z A;  1V5V A;  4JK1 A;  2B63 K;  4C2M A;  4XLP A;  3RZO C;  1EI6 A;  4AYB L;  2XCO A;  1I50 K;  2Y0S D;  4C3J C;  1R9T C;  2NVX K;  1J6V A;  1EH1 A;  4QIW D;  1TWH C;  2VUM C;  4LLG A;  1VH2 A;  4GFQ A;  4G0W A;  1O2F B;  1IW7 A;  1NH3 A;  4BXX C;  3S2D C;  5IOT A;  1Y69 8;  3ADA C;  4A3B K;  2A6E D;  1RU0 A;  2WAQ L;  1JOE A;  2E2I A;  4OIP A;  4A93 K;  2E2H K;  5IYB C;  5FJ8 K;  4P5B A;  1XPP A;  4XCH A;  2PHC B;  2Y0S L;  2R7Z K;  1PJ5 A;  4BBS C;  4FGU A;  4M1X A;  4C2M K;  3DU5 A;  1EK8 A;  4PAB A;  4QIW L;  1X31 C;  1O2A A;  1WIH A;  3K5L A;  4MQ9 A;  4LK1 A;  2GAG C;  4GTF A;  3I4M C;  4A3E K;  3GDZ A;  2NVY A;  3GEI A;  2O5I A;  1Y1W C;  1WSV A;  3QX3 A;  4KN7 A;  2R93 C;  4RMF A;  4G7H A;  2JA7 A;  5FLM C;  3PO2 K;  4FZB A;  4GZY A;  1Y1W A;  2F4Q A;  3HKZ D;  2E2I K;  3S14 C;  5IYC K;  3GSI A;  1IQ0 A;  3GTG A;  3HOX C;  4KAT A;  2A69 D;  3HOY K;  3S2D K;  3GTO A;  3GTM C;  4A3L C;  1WQF A;  2ZFZ A;  4YFN A;  5C9H A;  1TWG C;  2E2J K;  1XXC A;  1INN A;  3T02 A;  5C4X K;  5IYB K;  2NVY K;  3K58 A;  3HOW C;  1R5Z A;  4H3T A;  1Y1V A;  1GE9 A;  1YCL A;  3A8I A;  4BBS K;  3S1M C;  1R49 A;  3GTM A;  3JST A;  3WOD A;  1O28 A;  3HKZ L;  2JA5 A;  1SFO A;  1TWG A;  2JA7 K;  1AB4 A;  4NOI A;  2CW0 D;  3DXJ A;  3G4C A;  3K57 A;  3S16 K;  4KN4 A;  1A36 A;  3AD8 C;  4NOK A;  3AQO A;  4DDQ A;  5CJ9 A;  4BLA A;  3GTG K;  4Y7N K;  5CQG A;  5C4J C;  2EBB A;  3S17 C;  4Q5G A;  4ILD A;  3GTO K;  5FLM K;  1WQH A;  3K5N A;  1LPQ A;  4KM9 A;  1EQR A;  2NVQ C;  3GTQ C;  2V6S A;  4FXD A;  4A3G K;  1DD5 A;  3HOX K;  1Y1V K;  3FOF A;  3N3Y A;  4L8I A;  3ERE D;  1ZYR A;  2JA5 K;  4A3C C;  3FHZ A;  1SFO K;  5EGE A;  2PA8 D;  3PO3 K;  3H3V L;  5IYD C;  4X6A C;  1TWC C;  4A3D K;  5TJ3 A;  4OIR A;  4ZH4 A;  3GEH A;  4LK0 A;  4OYD B;  4AHC A;  1ZBS A;  4QJV A;  3L4K A;  3RZD K;  4WJ4 A;  1JQW A;  3GTJ A;  1I6V D;  4KAW X;  1TWF A;  1PJ6 A;  2JA6 A;  3A8K A;  3ORE A;  1EFW A;  4BKW A;  1YNJ D;  3FKI C;  3IAY A;  4A3F K;  2O5J A;  2PA8 L;  5JFE A;  1A35 A;  3S0X A;  2RH6 A;  5C4J K;  3S1Q K;  4D3Y A;  4A3K C;  5IP9 K;  1YNN A;  1SC7 A;  5C3E C;  4KMD A;  4WIL A;  1R9T A;  4LR2 A;  2CW0 A;  5M5X K;  4LJZ A;  5IP7 C;  1TWH A;  2VUM A;  2V6T A;  3K7A C;  3GTP C;  3HOV K;  4BY7 K;  2PMZ A;  4YFK A;  4GTE A;  4YFX A;  3I4N K;  1ZQ1 C;  3S2H C;  1BS2 A;  4X6A K;  3GTJ K;  1XXB A;  4P5A A;  4A3J C;  1BGW A;  3GTK C;  2YU9 C;  1TWF K;  2JA6 K;  3GTP A;  3NUH A;  4Y52 C;  1VLO A;  1F93 A;  3TFJ A;  1WCM C;  3OPF A;  4C3I C;  1HQM D;  1SMY D;  3MAQ A;  3GTK A;  3K59 A;  1L0W A;  3RZO K;  4AYB A;  1WQG A;  4OIQ A;  3H0G C;  4C3J K;  1R9T K;  5TMF A;  3S1R C;  2CFA A;  3M4A A;  1TWH K;  2VUM K;  2NVT C;  3HOU C;  4XLN A;  1IS1 A;  5M5Y K;  4NOL A;  1BJT A;  4BBR C;  5IOR A;  4IP8 A;  2R93 A;  2BE5 D;  3M3Y C;  3H0G A;  4BXX K;  5C3E K;  3GTL C;  3S15 C;  1TWA C;  4D3Z A;  2R92 C;  4AN8 A;  2WAQ A;  3HXA A;  4OIN A;  1J98 A;  1A31 A;  1F7U A;  1DCO A;  2Y0S A;  3S2H K;  1I6H C;  4MEY A;  4LQY A;  3GTL A;  4KDD A;  4QIW A;  4G7Z A;  3M4O C;  4YG2 A;  1DCP A;  4KB4 A;  2WB1 D;  2A6H D;  3I4M K;  4XSZ A;  3AD9 C;  5JVO A;  1B4B A;  3T00 A;  4JLR C;  1Y1W K;  3SJR A;  2A6E A;  3H3V D;  1IE0 A;  4BY1 C;  2R93 K;  5C44 C;  4A3M C;  3S1N C;  3CQZ C;  2R4G A;  1B4A A;  1XZP A;  2NVT K;  1K4S A;  3S14 K;  2W7V A;  2JA8 C;  1VGX A;  3MML B;  1IW7 D;  2P5M A;  1ZXO A;  3G4A A;  3FOE A;  1USM A;  2WB1 L;  2B63 C;  5TMC A;  3GTM K;  4A3L K;  1DCH A;  3GEE A;  1TWG K;  3V4G A;  5MLC 9;  3A8J A;  4J3N A;  3GTQ A;  4A3I C;  2NVX C;  3BP8 C;  4KMH A;  3HOW K;  3LHP S;  2KWA A;  4AH6 A;  3S1M K;  1BDF A;  4KMA A;  3HKZ A;  1WOR A;  2GSN A;  4KAS A;  4LOW A;  5L46 A;  3K5O A;  1HI9 A;  1VJE A;  4O2D A;  1I3Q C;  1USO A;  1KQ4 A;  1XZQ A;  1TWC A;  2A69 A;  4A93 C;  1O24 A;  2E2H C;  2PMZ L;  1UV7 A;  5C44 K;  4Q4Z A;  4O26 A;  3S17 K;  4C2M C;  1I3Q A;  2NVQ K;  1V9M A;  3FKI A;  3GTQ K;  4A3E C;  2JH3 A;  3LAJ A;  1RR8 C;  3HOZ C;  3CAG A;  4A3C K;  2FQO A;  1F7V A;  3PO2 C;  4A3I K;  1YX2 A;  2GSO A;  5IYD K;  1JVI A;  2GAH C;  1TWC K;  4QCL A; 
#chains in the Genus database with same CATH homology
 4IP8 A;  2R93 A;  3N0C A;  2BE5 D;  4GTL A;  3VA7 A;  1A36 A;  3H0G A;  4NOK A;  3AQO A;  3LPX A;  4DDQ A;  4KM8 A;  4Q5V A;  5CJ9 A;  4BLA A;  3LF9 A;  4D3Z A;  5IOS A;  4AN8 A;  1O29 A;  5CQG A;  2WAQ A;  4Q5G A;  1O25 A;  4ILD A;  1WQH A;  3K5N A;  2E2H A;  5JSB B;  1LPQ A;  1A31 A;  2WB1 A;  2YU9 A;  2Y0S A;  3KYL A;  4KM9 A;  1O2B A;  2R7Z A;  4LQY A;  3GTL A;  4KDD A;  3OEP A;  4QIW A;  4C2M A;  4FXD A;  4GTD A;  2RGR A;  1DD5 A;  3FOF A;  2A68 D;  4KB4 A;  1WCM A;  2XCO A;  2B9S B;  1SEU A;  1K83 A;  4L8I A;  2A6H D;  2XCQ A;  3N3Y A;  3ERE D;  4C3H C;  4C3J C;  1EH1 A;  3K5M A;  5JVO A;  3FHZ A;  1B4B A;  5EGE A;  4JLR C;  4KC6 A;  3SJR A;  1XXA A;  1ZVU A;  1ZYR D;  4GFQ A;  5TJ3 A;  4G0W A;  4GTA A;  1NH3 A;  5IOT A;  1Y69 8;  4OYD B;  4AHC A;  4NOM A;  1Q8I A;  1O26 A;  2R4G A;  1B4A A;  2A6E D;  1MIU A;  4IP9 A;  1K4S A;  1EJ9 A;  2E2I A;  1ZBS A;  3L4K A;  4LMO A;  3MML B;  1IW7 D;  3GTJ A;  3AH5 A;  1I6V D;  1ZXO A;  2P5M A;  3G4A A;  4BLB A;  3FOE A;  4P5B A;  1TWA A;  1TWF A;  4KAW X;  2R92 A;  2JA6 A;  3DU6 A;  2PHC B;  3ORE A;  4BKW A;  1YNJ D;  4EJ3 A;  3IAY A;  4FGU A;  4M1X A;  1RRJ A;  3DU5 A;  1EK8 A;  5JFE A;  1K4T A;  1A35 A;  3S0X A;  2RH6 A;  1O2A A;  1WIH A;  4D3Y A;  3V4G A;  3K5L A;  5MLC 9;  4GTF A;  4J3N A;  3GTQ A;  2NVY A;  2O5J D;  3P9A A;  4KMH A;  4G0U A;  3LHP S;  3QX3 A;  1SC7 A;  4QCL A;  2KWA A;  4KAR A;  4G0V A;  4KMA A;  4KMD A;  5JSN B;  3HKZ A;  4KAS A;  1R9T A;  2GSN A;  4LR2 A;  4GTC A;  1TL8 A;  1TWH A;  2VUM A;  5CHP A;  3K5O A;  2Y3P A;  2JA7 A;  1YNN D;  4FZB A;  4FM9 A;  2PMZ A;  1KQ4 A;  4GTE A;  1TWC A;  1Y1W A;  2F4Q A;  4GTB A;  1O24 A;  2XCR B;  1XXB A;  4P5A A;  3CQZ A;  1T8I A;  3GTG A;  1BGW A;  3AQP A;  3GTP A;  1O27 A;  3NUH A;  4O26 A;  4KAT A;  2A69 D;  4FYD A;  3GTO A;  5EGH A;  4C2M C;  1I3Q A;  3N0B A;  2ZFZ A;  3BUE A;  4KB2 A;  5C9H A;  3OPF A;  4C3I C;  1XXC A;  2CFA B;  1HQM D;  1SMY D;  1V9M A;  3FKI A;  3MAQ A;  3GTK A;  2B63 A;  2JH3 A;  3K58 A;  3K59 A;  4GT9 A;  3LAJ A;  1R5Z A;  4AYB A;  1RR8 C;  4H3T A;  1F9N A;  1Y1V A;  1GE9 A;  1WQG A;  3LAP A;  3L4J A;  1ISE A;  3WVO A;  1I50 A;  1TGO A;  1R49 A;  5IOQ A;  3GTM A;  2GSU A;  2NVX A;  1O28 A;  3CAG A;  2JA5 A;  2CFA A;  3M4A A;  1SFO A;  3Q3Q A;  1TWG A;  1AB4 A;  1IS1 A;  2CW0 D;  4NOL A;  1BJT A;  2GSO A;  3G4C A;  1WQF A;  3K57 A;  4F3E A;  5IOR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...