1WQVT

Human factor viia-tissue factor complexed with propylsulfonamide-d-thr-met-p-aminobenzamidine
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
205
structure length
191
Chain Sequence
TVAAYNLTWKSTNFKTILEWEPKPVNQVYTVQISTKSGDWKSKCFYTTDTECDLTDEIVKDVKQTYLARVFSYPEPLYENSPEFTPYLETNLGQPTIQSFEQVGTKVNVTVEDERTLVRRNNTFLSLRDVFGKDLIYTLYYWKSGKKTAKTNTNEFLIDVDKGENYCFSVQAVIPSRTVNRKSTDSPVECM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of human factor VIIa/tissue factor in complex with peptide mimetic inhibitor
pubmed doi rcsb
molecule keywords Coagulation factor VII
molecule tags Hydrolase/hydrolase inhibitor
source organism Homo sapiens
total genus 42
structure length 191
sequence length 205
ec nomenclature
pdb deposition date 2004-10-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
T PF09294 Interfer-bind Interferon-alpha/beta receptor, fibronectin type III
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1wqvT01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1wqvT02
1A7NL 3QIUC 3MJ8A 3MO1B 3I6LD 4P2RD 1AGFA 4H88H 1KENL 1PLGL 1DDHB 1JZ3A 2EKJA 4XVSH 1F4WL 4G9FB 2WW8A 5CEYB 5T3ZL 1M4KA 4ZD3H 2DQDL 5KTEH 3QNZB 1NGPL 5IW6A 4XRCA 3DV6B 1RZJH 4JQVC 1P4LB 4JRXE 4AT6A 1VADB 1DUZA 2FX7H 4JFPB 3RIFF 1OAXH 1K8IA 1OW0A 1T20B 4Y88A 2V9QA 4J23A 4JPIB 2NPLX 5I66B 1QBLH 4U3HA 3LOWA 3N1FC 4BZYA 3MA9H 3IFLL 3CCHA 2WMPA 5FKAA 5MEPA 3WE6B 5CMAB 3FB7B 3LB6D 3OAYK 1CFTB 5JHDE 2GK2A 4QRPB 5HHPA 3Q1SH 2WIIB 1YC8A 3FQWB 4ZOEA 4XP1L 4X6CF 3RPIB 4PTUA 1K4CB 3GBML 4JPVH 1FZJB 5HGBB 2AERT 1YUHA 1A7QH 1OVZA 3B9AA 4RAUB 4JRWA 5JIHA 4JZOA 5I17A 4PJCF 4X98B 1ZXQA 2F74B 2P47B 5TQ2H 5JORA 5FYKH 1DBMH 1OP3H 4LLUA 3FB5A 3O2DA 4O2FA 4JKLA 5BRZE 5FV2A 2C1OA 1T2XA 5HI3D 3GJFA 1NEZA 5ITFB 4PREB 3T3MF 2AJ3B 5I8OH 1IKNC 2Y1VA 1A6UL 1BECA 3I6KA 4O9HL 2G75B 4HGWA 5IKCB 5LXGL 3BT2L 4FQXD 5DJXB 2Q7NA 35C8H 4P4KC 4PRHD 1J10A 3MOBL 1TMCB 1IAKA 1G7MA 1EXUA 4HLZH 4ZFGH 1UT9A 2YC1B 1TTFA 5DRZA 1P9MA 1B4JL 4DFHA 4P2OC 3QZWB 5HVHB 2NY0C 3U7WL 2XZCL 5EOQL 2X4PA 4NKDA 4RISH 2DQTH 1MRCH 5C0NC 5FDWA 1S7UB 1TCRA 5J13C 3RX8A 1RD6A 3MLVH 2CK0L 4QHNB 4GO6B 3UXFA 3HNTH 3WFEL 1XGYL 5D2NE 2V2TA 4XCNA 2IH3B 2X1QA 1KJVA 1LEIA 4NHUB 1U8MB 4I3RH 2UZXB 1NCDH 4HDIA 3W9DB 1KJ3L 1XGTA 4Z95H 1J8HD 1JHKH 3HAEB 3IYLW 3FQTA 3L3DA 3RVUC 5H8DA 3EO1A 3OB8A 2V2WB 4HCRA 5DJAB 1SBSL 4HX1A 1FLTX 3OV6A 3HPJB 5GSRA 4PPTA 1R24A 4RBPH 3D9AH 1OARH 4XCFL 4IRSC 2YWZA 2XNAA 3UJJL 3KPQA 3MNWA 4JM2B 3PGFH 3M1BA 4C55A 4L29B 2JELH 3WN5C 4LVEA 2ENSA 1FCCA 3LD8B 2R4RL 4G8EA 4F33B 4LCUB 4OQTA 3TBVA 2VLMD 2YD5A 5DI8B 4HKZA 4NQCD 1EGJL 2AK1H 3Q5TA 5FECB 3SQOL 1HINL 2W60A 5ILTL 4OV6F 2P5EE 2IMNA 1D6VL 1LO0H 2YD2A 3DOSA 5CJXA 4KJWC 4RMVA 3QPQD 4U1GB 5H37H 1J88A 5LQBH 4HIHA 3U7YH 3E6FA 1F6FB 2X4OB 1A4KB 3KPMA 3OKNA 1A6WH 3NVQA 4FQ1L 3UEZA 2PUQT 4QXTB 4FP8L 4JRYB 5C0BD 4QHUA 2B0SL 3H3PL 1U8JB 3T1FB 3T65B 1FZOA 2UWEE 1MRFH 4KUCD 4YGVA 4NM8H 3T0BA 1I9RH 4EBQH 3HCVA 4XPGH 5JPNB 4BUHA 3ARBD 1EMTL 4LSTH 3QQ9D 4M3JA 2ZUWA 4HXBH 3HFMH 4LEXL 1TFHA 5SWZD 2FL5B 3BMVA 4PBXA 5EUKB 4XHJD 3NFNB 4I3SH 1N8ZB 1JGLL 3ULVE 1HZHL 5IT2L 1OTSC 2EC9T 2YSSB 4X9GA 1ORSB 2GW5A 1OF2B 3P9MA 3C5SA 2AK4B 2G9HB 4Z7VF 1II4E 2OMNA 5EOCJ 3TO2B 1J0IA 4LVHB 4EN3D 2ZOLB 3OGOE 4ZNEE 5D8JL 5IB3A 5I1AB 1I8KB 2BSTB 5D71H 1N6QH 2AW2A 5FFLA 3VCLB 3O9WD 5ICZB 4OCMC 1F2XK 2XFXA 3IU3A 4UZGA 1ES0B 5EO0A 2Q7YA 1KCVL 2JB5H 2A83A 1YJDC 3RRQA 3VWKB 4WI6A 1R5VA 1S9VB 4WFGD 3RWJB 1UB5A 1TVHA 3QWRA 4NNYB 1YEGH 32C2A 4ZAKA 1LDPH 3ARYA 2R4SL 4ZODA 1DZBA 1HNGA 3FT3B 4JJ5A 2AGJL 4S2SB 5J11C 2GJ6B 3HPLA 3ET9F 4TSBL 2FX9H 1ZLWH 4MWFA 3CX2A 4PG9B 5EPMB 1ACYL 5C70A 2E7LC 1MCKA 3FT4A 1PYWB 4LU5L 5DRNA 3L7EB 2P46B 4LQFH 1IL1B 4QHLB 3KHOA 3SDAC 5JW5B 4XP5H 2JCCB 2EDKA 3X14A 5EU5B 2EZ0C 3CVIL 1L6XA 4LSVL 4BZ1H 4NN5C 5HVWA 3U6RB 1KIPB 5MERA 1ZHLA 4GAGH 5DJZB 4XC1H 3LKRA 1T7VA 4PP2B 3BQUD 4XNUH 5ICYB 1T66D 5IJVB 4OM1L 2W65A 2YMXL 4XBEL 4PR5B 3UYPA 4I18B 1NLDL 1R5IA 3IDMB 4I0CC 1OAKL 4RA3A 1Z9OA 1DVFA 1KTLA 4DOHB 4F57L 3DTXB 5H35A 2W9LA 2VXVL 1IZKA 4I5BB 4OLXL 5CHNB 4QOKB 1QYGL 5MENE 5C09B 3WFCL 4PP1C 3IDNB 4MXVF 2Z35A 4LCCB 1A7PH 3WUWA 4NN7B 5AZEL 4L3EE 1IM3B 4QTHB 3EBAA 4YFLI 2OP4L 1NCUA 4KK6C 3VE0B 4FQ2L 1MI5E 3D2UA 4GBXC 4WEBL 2C3GA 3LZFH 4N0UA 5L8LB 2NW3B 5ICXB 4EOWH 4U0RB 1BJ1H 3D0VB 3O8XD 2FATL 1A4JA 1YEIL 2FJGB 3LPWA 4JHWL 1XZ0B 3DI2B 4C4KT 3T04D 4F7CB 4RWYL 3JV6A 3TT3H 2BNUB 4TVPD 4PJBB 2A2QT 4TNWF 2KDGA 1Y18B 1NMBH 3I3DA 4UNUA 4OCLC 5BZDA 3QIBD 1M05B 1I8MB 1Y0LB 1U8NA 3CDCA 4R4FH 3QFJE 3EYQD 3ULVF 4MJ6A 5DXWA 1QLEH 1CVSC 5T3XD 1WISA 4G3YL 1H3PL 2GJZB 4K2UL 2X70B 2DMCA 4ZFOA 3DPBA 1AD9A 3W81A 4ONGH 3HI5H 2PYFA 3BRDA 2OSLB 1E28A 2I60H 3F8UB 2AEIT 3LKQA 2YPVH 2VR5A 4PJGA 3KPOA 1U8OB 3GI9H 5IB5A 1UVQB 4X7TB 1MPAH 3BZ4A 4I9WD 1U8LA 4FHBD 2IJ0C 5I9QB 1NAMA 4UMGA 2HAZA 3NBNA 1QQDA 3KVQA 5E5MB 5KSUB 3MRGB 1RIVH 2VAAA 4NO0D 4MNGA 2YPLA 1CDIA 1KLGA 1FIGL 4U7SA 2Y9RT 4AIOA 5TF0A 1B0RA 3L3IB 2R29H 1A0QH 4LSRH 3KXFB 4LDLB 5E7FA 3ARGD 3TYFB 4H88L 5ESQB 1F4YH 3W39A 5DD1H 1MAML 5HHMD 1ADQL 2DRUA 3D85D 5A2KH 2DYPB 4JANB 1UEYA 5KTEL 5K9KA 1SJEA 1Q0YH 4R7DB 1WFTA 3UC0L 2YA1A 1AQKH 4OBSA 3PV6B 3OKLB 4ELKA 1HILB 4GG8A 4RIRB 5E94A 1OAXL 4ETQA 4Z76B 3D18B 4JDVA 1BJMA 3VD3A 1KGCD 2P8MA 4I1NB 3TJHD 1QBLL 5IJKA 1EHAA 2J7LA 3E3QC 5EOTA 1NC2D 3MA9L 3PIQA 3VD4A 1SEBA 5DO2C 4Y4FB 3U0TA 1NPUA 3Q1SL 5C3LD 1HI6A 3JWOC 5F3BA 2LFGA 3C87A 3NPSC 1W0VA 5L88L 3HE6A 4B41A 4NKIH 3HG1E 3TM6A 3ETBF 4JPVL 1GOFA 1KIRB 4X99B 4N0CC 2DIJA 3LIZL 1JP5A 4L4TA 1XGQB 3O4LA 1A7QL 4X9HA 1IZJA 1AIFA 4JDZB 3BGAA 4OLWH 4P46D 4JFZL 3KNBB 1K3ZA 5TQ2L 5FYKL 4GW1B 3EYUH 2YUXA 1MUJB 4FQHB 4HF5H 1VGEH 4OAWA 1N6UA 3DVNA 1I8IA 2X2YA 1KXVC 4HMEA 4MD5B 1HIMH 4U3XA 2QHLA 2VMFA 4ZPTA 4YXLH 3HZKA 5I8OL 2Y07H 5E8EB 1WBZA 4JFQB 1BAFH 5D4QA 3MNVB 4LAQL 3O6ML 1I8LA 2H45A 35C8L 5CINH 4NKOA 4FXLA 3RY4A 4DVBB 4F2MB 5FKPB 4NRZB 3V6ZA 3MACH 7FABH 5FO7B 4LVNB 4HIEA 4ZFGL 3QHZL 4LLVB 4OZFH 4DTGH 1F11A 2VL4A 3O3BB 4PJFB 1HYSC 2W0FA 3ARUA 3QI9D 3QEQE 4JZNA 2CO7B 3BKCH 4RISL 3S4SG 2DQTL 2K1MA 1UYWH 4MNHB 2ESVD 1U8PB 3TCXA 5CP3A 1FJ1A 1FO0B 4KKLD 4G9DB 4ZDHB 5F89A 4NC2B 1KJ2H 4BFGA 2W59A 3HNTL 2HFFB 5IVXB 3FAWA 1A21A 2ITDA 2VLLA 1BZ7B 1ZWIA 5DHVA 1JHTA 1WBYA 1F97A 1CFNA 2AJSH 5IMKB 4I3RL 1NCDL 1A5FL 1EAPA 1GGUA 4KKNA 5CGYC 4Z95L 1KB5H 1JHKL 4ZNCD 3L3GB 2EH8L 2CLRA 1S7RA 1MHCA 4C83B 4WU7B 3NOIA 4YPJA 1DLHA 4LKXA 4NQVB 3T4AA 4RCAA 3S97C 1EHNA 5TPWL 2HJLA 4KV5F 3D9AL 3QA3A 1OARL 1MJ8H 4NFDA 1T7XA 2EO9A 1ONQB 3DVGA 3FMGH 5JOEA 3L6FB 4AQ1B 4GRLC 5DJCA 5DRXB 5HHOB 5D7LB 3PGFL 4NFBA 2DI9A 1HHHA 1UCBL 2I24N 1QSEA 1SJHA 3MUGA 4OLEA 4OFDA 3CX5K 4WTZA 5I1LB 1IJ9A 4JO3H 1A9EB 5E6IC 4U1LA 5I2IA 2C3WA 3TPKA 2UZYB 1NEUA 4K7FA 2R56H 1AGDB 5EC1A 5BQ7A 1B0WA 2Q6WB 4YXHH 4H26B 8FABB 3QUZD 2AK1L 5JQHC 4G8GE 3RY5A 1BIIB 2QKIA 3RWEB 4XVUD 1KPRB 5IGXH 3C5ZB 1QLFB 3BRFA 4J6RH 5I0DA 3OB0H 5TH2A 5LQBL 3U7YL 2DOCA 3TV3L 4I2XA 3QXDA 5F7MC 1UB6B 2J3SA 1A6WL 5FM5M 4CNIB 2PYEA 3CD4A 4RGOL 5ID1B 2QADD 5D1XB 5IUSA 2X7LA 1HKFA 1UXWB 1MRFL 3RY6A 4NM8L 3PHOB 2OX5A 3RZCB 1I9RL 4JFEE 5HVHC 4EBQL 1C5BH 4XPGL 3DBXB 1RJLA 4MQ7B 4LSTL 1ZVHA 4FFVD 3S88H 1TLKA 3Q5OA 2ARJA 3JV0A 4HXBL 3HFML 3MRMA 4PJ9D 4NZTH 1LP9A 3B2UC 1C16B 5JR1H 1ZA3A 3T2OA 1I7TB 4YHOH 5AUMB 4YEEA 2DD8H 4WENB 4X0KB 1UXSB 5E03A 4C59B 5EORH 4HWBL 3RAJL 1J05A 3FZUC 4JFDE 1Q9KA 4HMDA 3VI3F 5D71L 1D6EA 1RZGB 4PFEA 1FQ9C 2JB5L 4Y2DD 3VXMA 4P5TB 3THML 4FMKA 2EEDA 5IM7B 4I0PD 5E8DH 3GJEB 4OI7A 4KI1A 3MV9D 3V4PH 3M8OH 1LDPL 4Z77B 3KLAB 2VZOA 4CADB 5B3JE 2NXZB 3MLPA 1CYGA 4XBPB 5ESVB 1Q94A 3MBEB 2FX9L 1FFOB 4X4YA 3CC5B 2VIRB 4RAHA 5GS2D 4G6FD 4GKZB 3A67H 1JPTH 2H9GA 1S7TA 5D5MB 3OGCA 3F7VB 1A1MB 5GIRB 1AQDB 3L3JB 1IGTB 4XP5L 2N56A 5LJYH 1FV1A 2X9WA 3IDGB 3H7LA 1TZIA 4QRRD 4P2RB 4BZ1L 5E9DB 1HXYB 3MCKA 4GAGL 1IGIH 1EGJA 4XC1L 4XNUL 5J89A 2WBKA 3X3GH 3HC3H 5DZNA 4PLKC 5IHBA 2Z91A 3U4EB 5I8CA 3BZEA 4CBPA 3OBAA 5LWYL 1GH7A 1RZ7H 3Q6FB 2ZUXA 4O02H 2EIZA 1X5HA 2D7MA 2DL9A 1W72B 1LE5B 3VXRD 3RX5A 2FJHB 1A7PL 4TQEH 4OCYH 3T2NH 5IEKA 2Y6SD 2XPGA 1CXHA 3LKOB 3KYOA 3LZFL 4FZEH 1FBIH 4EOWL 3CSPA 3QCVH 5KSBB 3MJ7A 3UTQA 5D6DC 4C54A 5GRUH 5FGSA 1KTDB 4P57B 4R3SB 5CSZB 4KKCD 3CFEB 4RBPK 2BCKA 5AYUH 2MHAB 3PE9A 3TT3L 2D4DA 2FZ3A 1AKJA 1H3GA 3QQ4B 5JW4N 4PY8J 1K2DB 1KNOA 5F1KC 3SO3C 1BVZA 1BOGA 3VWJD 3OPZL 5T1LD 2OL3B 2Q87A 3UTSE 4R4FL 5FCUH 3DROB 3SDXB 1DQJB 1QLEL 1YMMA 2AI0L 2A6IB 5LGHH 3ILQC 1GOHA 2CD0A 4YE4H 4ZTOH 1JN6A 1CE6B 2VC2H 1MRDL 4Q0XH 5KANG 4TUOA 1J0HA 3G6JB 3HI5L 4ONGL 5A1AA 5JDSB 1U92A 2I60L 4G6AC 3B5GA 3VWKC 4QLRA 2IAMA 4PUBH 3F5WB 2YPVL 3VDBA 1OTUC 2VLKE 3RGVB 3T0XA 4MAYA 4FQXB 3IJHA 4BH7B 4EEEA 4PRHB 4YAQA 1K8DA 4Z78B 3MRLB 5T5FH 3W5NA 1RIVL 4CRPA 4R2GD 1YECH 3NCFB 4L3AA 3BP6B 4V2CB 5CJXC 4M8QB 4PGJA 4XAKE 5F88A 1A0QL 1LEKB 2CKBB 2VITA 4MJ2A 1D5ZB 1Z3GH 4MCYA 3VXUA 4HKJA 2VXTH 1F4YL 4YHYC 5DD1L 4LSDA 2X05A 1HQRB 1IEAB 4NQXA 2GSGB 2Q76B 3G08A 1Q0YL 1BBDH 3LN4B 3ORJA 3LCYA 4YO0A 1AQKL 1AGEB 4MXQD 1JGUL 1IQDB 1VFMA 4LMQE 4OQ1A 2C5DC 1NLBH 5IWLC 1J8HB 2IALB 1FNGA 3IGAA 1XF2A 1NL0L 3V4VL 1Q38A 4HS6A 4M6ML 3B9EA 3MCG1 3QWOB 1ITBB 4Z0BH 3S37H 2ARJQ 3BAEH 1F3RB 5IV2B 3O9WA 4RMUA 3RJDA 3VFGL 1T21B 2FHBA 2VKXA 1NDMA 1YY8B 4NKIL 4BKLB 1HSBA 2A73A 1QRNE 4N9GB 4Z7OF 5JIKA 5L6YH 3QP3A 2VQ1A 5GGQH 3BD5A 1V8HA 4OLWL 1Q9OB 5TDPA 1FG2B 4NQCB 4QEGA 4JLRB 1R3LB 4ZAKC 4ODWA 3EYUL 4KRLB 3TO4A 1RHFA 5H94A 1VGEL 2ZG1A 3VFUB 1X7QA 4XP4H 3FOLA 4N8VA 3MROB 1MCLA 1N6VA 1HIML 2D0HA 3MCLH 1BAFL 2P45B 3W2DH 1JGEA 1UZ8A 5DMJB 5DK3A 4PIRF 1SYVA 5F1IB 4ONOA 4PJHB 1A6TA 5CINL 4S10A 5C0BB 3WDIA 3GK8H 2XA3A 1N4XH 7FABL 2EDOA 2EDWA 1XT5A 2XXCB 4PJBF 2YOCA 4P2QD 4DTGL 3WFDH 3ARBB 1PGRB 2RQ8A 3MRNA 5HPMA 3RL1A 4NPYB 3MMEA 3BKCL 5SWZB 3U46B 4RFEA 1Q0XH 1DQMH 4UU9A 4JCLA 2JKXA 1DVFC 1HSAA 1UYWL 2LU7A 5HYQA 3ZSTA 2DI8A 2FLBT 1IMHC 4HUXB 1KJ2L 4OGYH 2W0PA 5FM8A 3U9UA 2H2SC 3QR2A 1JNJA 1FSKB 3F7RA 4PJ5A 4G5ZH 5MI0B 3ZKNC 4EN3B 3QDMA 3GMPA 5IQ9A 3KPRD 1QSZA 1GC1C 4AH2B 1AR1C 4DAGH 4UTAH 5DJ0B 4QRTA 2AJSL 4FQLH 1RPQA 4DQOH 4R4BB 4BYHA 3U7AA 2YBRB 4WJ5A 5D1ZD 3BH8A 1KB5L 2XTLA 4PTTB 2ADFH 2XZAH 5ACZB 4WUUA 2QSCH 1CR9H 5C71A 1B2WH 1G9NC 4WI8A 3TIDA 5TF1H 1IAMA 2IANE 5EFIA 3GSVB 4AJ0A 1MJ8L 5FO8A 1UWXH 5CS7A 1P7QD 2VWEC 1UADC 3EDFA 1U8QB 2N1KA 3QEUA 4CVWA 3S36X 4PJIB 1NKOA 4K8RH 4JKKA 5C3TA 4L4JA 4R4ND 5BV7L 43CAB 2OJEA 2BY3A 3BGFB 3MGTB 3OTTA 5D1QA 3HZVB 4ODTH 4OUUB 3RUGB 2BVUA 2VXQH 1XCTA 2R56L 4KRPD 1CICA 5IHUH 2F53D 4YXHL 1KUMA 3BQUB 4KJQD 3VMPA 1EV2E 2L7UA 1LEGA 1RZIB 3HA0A 4K07A 4NJAH 4HH9A 4WO4B 2ICCA 3GFUA 4LL9A 5IGXL 1IE5A 4XT1C 4J6RL 4LCYB 5EU7C 2LVEA 3JWDC 3QDJD 3P11H 4F9PA 3CH8A 1AO7A 2FJFB 3C6LD 1KCLA 3HE7D 3TNMB 2BY2A 4JO2H 3RPKA 4LVNC 2BC4B 2GTZB 2E9WA 3WMSA 3GKWH 3Q2CA 1U8HA 5E4IA 1C5BL 3FRUA 3PWVB 2BOCB 3IVKB 2ADIA 4ZUSA 4IHOB 3VFMA 4Y19E 3S88L 1JNHB 4Z7NE 3EDJA 3WNMA 1OLLA 2IBZY 5DK2A 2UZIL 2O5YL 2VLRA 3ULUD 4NZTL 2IQAA 3O8XB 3RBSA 3QJHB 5JR1L 4JAMB 1QR4A 3TH3T 5F71A 1FVDB 2WV3A 5HHQA 2HTKC 4YX2H 1CDHA 4M93B 4GFTB 2DD8L 2E7HA 3QIBB 5EORL 2YA0A 3Q0HA 1RAMA 3MA7B 3UMTA 2BSRB 1HHIB 3LQZA 4K3EH 2WBJD 1D5XA 2BP3A 2NNAA 4QWWD 1N59A 4Y5XB 2NXYD 1YYLH 4TUJB 2Y7QB 5DJ8A 1QEWA 2ZUSA 3U0PA 1NGXA 5D2LB 1C12B 4PYHA 4HPOH 3CFKA 5E8DL 4XMKH 1I85A 3V4PL 5FGBC 3M8OL 3AROA 3VH8G 3MRJB 1D9KA 3QO1A 1RUMH 2GT9B 3U2SA 5CJQH 5IOPB 4R96A 3W0WE 1MHEB 1HEZB 1FAIH 1NFDE 5J12B 1BVKA 4U7KA 3BKYH 3OKEB 4M48H 3D3VE 4D9RD 3KYKH 4NO0B 5CBEA 2XQYG 5L8JB 3A67L 1JPTL 3O3DA 2CUHA 5JO5B 1QFWL 4Q9QH 5C07E 1QP1A 3C9NB 3CSYA 2R1XA 5SWSA 4ODVH 4RQQA 4F7TB 3ULSB 3S35H 5ABDE 5DMYA 3ARGB 3RVVC 3B9KC 5C08E 4LCWD 1I8LC 1J5OH 3EHBC 5HHMB 3OR6A 1IGIL 1T1ZA 3MJ6A 3D85B 1DN0A 2F19H 2J8HA 4L4VD 3TVMA 2EXWC 5JLZA 3X3GL 3QI9A 1B90A 4UUJB 1G7PA 4YDJA 3HUJA 4IDLA 1EJOH 3LN5A 1G9MH 3H9SD 5HDBF 1RQ5A 2CLVB 3RNKA 4P4RB 1RZ7L 1HHJB 4O02L 5GPRA 4OIAA 1A9BB 2DQFB 4QCIA 2IPKB 3R0MA 1OGAD 4HJGB 1WFUA 6CGTA 1NC2B 1K3IA 1ZOXA 4TQEL 4OCYL 4KUZH 3T2NL 4Q6YA 5DJDB 3MXVL 4L1DA 3MJ8B 4D9QE 1PSKH 3UAJC 1JPSH 1DSFL 3QCVL 4U1IB 5FDYA 5GRUL 4K7PX 4X6DA 4NP4H 3FTGB 3L95B 4QRQB 2YN3A 5AYUL 3V8OA 5F3HB 1L9MA 1WAAE 2FH8A 5IW6B 2C4FU 5EULV 3LH2L 4Z7NF 5JW4Q 1H0DB 4KY1H 2J6EH 4Z7WB 1MQ8A 4MA7H 4AIZA 3U36B 5I16B 2XN9E 4HWBA 5DD5H 5FCUL 5GS1A 4U1HA 5CKAA 3BP4B 4WWKD 3I2CH 3EFFA 4ZTOL 2VC2L 4Q0XL 1G9EA 4MD4A 1MCCA 1TTGA 3CFDB 4KTEH 2OBGA 5JOPD 2HLFC 4PUBL 1BVLB 1OP5K 4UAOB 3PQYB 4Y4HA 1OHQA 4NOFA 12E8H 2NXZC 2Y23A 3RWCB 5HYSA 2AV1A 4OGAD 3FRPG 3AS2A 4PJDE 5BS0A 1SQ2N 2R8SL 3WEXB 5L0QB 5T5FL 3OHXA 1RY7B 2A0LD 5J06A 4U1NB 3AAZA 4X4ME 4XNXH 4ZFZB 1QPXA 1AGCB 4JFXA 3JTTB 1DBBH 1JGVH 1NFDF 3EYVA 4HS8H 2BHUA 2ESVB 4W6YB 1Z3GL 2PO6D 3G5ZB 4KKAC 2VXTL 5D72L 2BNQB 3VXSE 5C86A 1NEZB 3I6GA 4M8VA 1ZHBA 2N7BA 1FL6B 1CF8H 2C3VA 4Y1AE 5CIPH 1JWMB 2CMRH 3MLXH 1U8KB 1BBDL 4PRNB 3RY6C 3SDDD 5IG7A 3RBGA 2DQEH 1IVLA 3BW9B 1PY4A 4QGTA 5J9PB 4LAJH 1NLBL 4HC1H 5E8PB 2ZOKA 4FTVE 2V7NB 2A74A 4GRWE 1ZA6A 3MODH 5HI4C 4JREC 3UPRA 4TPRH 2E8YA 1MH5B 1MVFA 4Z0BL 3LB6C 3BAEL 5KAQG 3EJYD 1V5JA 3DVFA 2N4IA 3EW3B 5ANME 3TA3A 4NNPH 2VLJD 4G8IB 4QKXB 2WQ8A 2DB8A 4Z7UE 3U83A 1AXTH 1MCIA 1LO4H 3VI4E 2R2BB 1RVFH 3IAGC 2JIXD 5HYJA 2XTJD 4M7KH 1KELH 1UM5H 4H1LH 3T8XB 5L6YL 1X6NA 5DEGB 5GGQL 4P5MA 1DANU 1KJVB 1NUFA 4GAYB 5INDA 1F8TL 2P5EA 5C0DB 1RURH 3A6CH 3QUZB 1INEL 2CIIA 4MA1B 3B6SB 4MJ4A 1OPGH 5GISH 4XP4L 1ZHKA 1CLCA 3LQAH 5IHLB 1MCWM 4UIMA 1HE7A 1KIQB 2V5YA 3SCMA 3W2DL 3D1MC 4FQXC 2UWEA 4K8RD 3S96A 3JTSA 2AXGA 3UZEA 4I48B 3W11C 4PV8B 3KPSD 4LGRB 2QADB 4UV4H 1IGMH 3GK8L 1J1XH 4WCYH 1PZ5B 5FA4A 2CXKA 2FIKA 5I1IH 2Y5EA 3EOAA 5GJTL 3WFDL 4QHKI 4U1JB 3CFIC 1BFOB 4OD2A 3SJVE 2IWGA 4PJDF 4PJ9B 1FP5A 1Q0XL 3NIDE 3VXRA 3BKMH 3FB6B 4LHJB 4NQDA 3G6JF 2C3XA 1JI1A 3VMNA 4OGYL 3PHQB 4ZXBA 2PXYD 2EDJA 4G5ZL 2DTSA 4JY6B 1QUNA 3CIQA 1CD0A 4OSUH 4UQ2B 1YPZB 3ZE1E 4XCEB 4UTAL 5DRWB 4FQLL 2BJMH 5C7XL 3QZWG 4DQOL 1Q1JH 3HR5B 4YDLB 1MJJB 4OFYA 3AS0A 4O51A 1QLRB 4ZUUA 5GS0H 1EUTA 1KTKE 2IPTH 3UTPD 3NH7H 4I0PB 2QSCL 1CR9L 3AU1A 3BP7A 4N8CH 1B2WL 5HXMA 5DHYB 4WFED 4HKXB 5EIQA 5TF1L 3IDXH 5IBUB 1PG7H 1IILE 4DN3H 1Z9LA 2J88H 5EC2A 1R3HA 2X41A 5C8JB 5EU6A 1G7HA 4QXGH 4W4OC 2IADB 3T77A 4OZIA 4XPTH 2ID5A 5F9JB 4G6FB 4D0CB 5GGSB 1FVEB 2EC8A 2CIKA 1TXKA 1G7JB 4KAQL 3MC0A 4NWTH 1OSZA 4ODTL 1YQ2A 3UJTL 3FFCA 5BZWA 1N2RB 3HAEG 2VXQL 4Q2ZA 3E1F1 1OWWA 4QRRB 2H3NA 4YPGB 2VZ3A 3EDDA 3TT1H 1NBVH 3MV7A 4W4NA 3T0VA 4MAYC 1CGTA 5IHUL 4YNYA 4XPFH 5TGBB 5FEBA 1X9QA 4DCQA 1FL5A 5BJTB 4F7EB 3E3QE 2P5WE 3MFFB 2AJVH 1MY5A 4NJAL 3EDEA 3B2VH 1OGTA 2XG4A 5KSAA 3ARWA 4U1KA 1JYXA 4O2EB 2JJVA 4M3KB 3KLHD 2YD3A 4L3EA 1TNMA 4QNPF 3P11L 4UT6H 4E0RB 2VOTA 4J3OC 4HK0B 3MLUH 2DMBA 4JO2L 2FEDD 5CUSH 2H32H 2QTEA 4LNRB 1XF4A 2P7TA 5DRNB 5DK0A 1YMHA 2G60H 4PBWD 3GKWL 4OZFA 4U2ZA 1JMZA 2F5BL 3QQ9C 1RUKH 1AXSA 1CXIA 2ZJSH 3J8F7 4CW1A 5I19L 1EO7A 4FQPA 5IVNA 4C56D 4IBLT 2E27H 4JVUA 1ZLUH 2YWYA 1H8NA 1FFNB 1WZ1L 3BDBA 3RTQD 4QY8A 4GXVH 1AP2A 2EECA 4YX2L 2NY5H 1VDGA 2CRYA 2NY6D 1KJ2A 2PR4H 5MI0C 3VWJB 2GUOA 5T1LB 3NIDF 4K3EL 4PJHF 4KDVA 4XPBH 5I1DA 3O9WC 3W9EA 1YYLL 5CZVH 3MRFB 4O2CA 3VJ6B 3KJ4C 1T1XA 5GHWL 1KB5A 2QQNH 3AB0B 5ESAB 3I02A 4HPOL 2R15A 4BQ8A 4XMKL 3SQBA 3IETB 1BGXH 1A1OA 1XH3B 5ISZE 1B3JA 1EFXD 3MR9A 4XI5D 1FNAA 1RUML 5H2BA 3CPLB 3O6LH 4HPYH 1FAIL 1T89A 4G9FE 4S1QH 3QSKB 1CDGA 3BKYL 5GGRA 1IAOA 4M48L 3IFNH 1SM3L 4NQEE 1A2YA 3QT2A 3HMWH 4R2GB 3BGFC 1V7NH 1K5NA 3D0LA 1I1AA 5B8CA 5KS9E 5D6CA 4ODVL 3CXHJ 4ODXA 1LE9B 3ES6A 3MGOA 3S35L 3VFSB 1VSCA 1IEBB 2J8UA 1QG3A 5E5UB 2YHGA 4MDIB 3G6DH 1J5OL 4P2QA 2ORBH 4E41D 4M00A 4L9DA 1T66C 2F19L 1OB1A 4OJFH 3MREB 1I9JH 3EAKA 5IHZB 4GW5A 2GSIB 4QRPE 1TIUA 2DWDA 4N5EC 1MQKH 2A6DA 1G9ML 5DS8B 5MHSE 4CVZA 4PJ8A 4IS6A 5F9WB 1NAMB 4KRMB 3S35X 4DW2H 1ZSDA 1LQSR 2DM7A 4NT6A 4H0HB 3BWAB 1S7QB 3VFVA 5DEFA 1XIWD 1RJYA 1YEJH 2YPLB 2DM4A 4FQJH 2VE6A 1CQKA 3HG1A 3NN8B 4KUZL 3WXVH 3RUGF 2NX5A 1V3KA 2OS7A 4RMRA 5F1NB 2EDTA 1PSKL 1IRAY 1JPSL 1FC2D 1NMCB 4GW4A 4MGXA 3VFNB 1RZJC 3N0PB 4JRXD 3QUMB 3CZFB 4NP4L 1HYRC 3QJFA 4KQ3L 3X13A 1A47A 4M93C 2FGWH 4UDTA 5A3ID 2WIMA 3AFLA 5F72S 3CDFA 4KY1L 3HZMA 5EBMA 4EI5D 4ELMF 5EO1A 4LLDA 5F6IB 1HOCB 5IK3A 4MA7L 5EIVA 3VFPB 1L6ZA 5DD5L 1PG7W 4X6BB 4YHMH 4MB5A 4Y5XC 5J8OA 5JHDD 3EGSB 1D5MB 5FF6A 5CEXB 4CVXA 1MHHA 1F6AB 3QUYA 4M7LT 3WSQH 1ZT7A 5KVGH 1QSFA 3AMLA 1CD9B 1AC0A 4XMPH 4LHUB 5D1QC 3LV3A 1ACZA 3RNQB 4PJAB 12E8L 4FZ8H 5EN2A 4BSVB 3GSXA 3MRKA 5J12C 2Q8BH 1NCTA 2HTLD 5FYLE 1UFUA 3PG2A 4LRNH 1CXKA 4M6OL 3GMOB 4N5UA 3P0VH 5FCSH 3BDYL 4F8TA 3SGEH 4XX1G 4JZJA 4Q97A 1KYOK 3EYSH 1UKTA 1V3LA 2Z31D 4X80H 5MEOA 1HN1A 2BOBB 1ND0A 1CF8L 1IARB 5KS9F 4PJ7A 3WS3B 4IJ3B 3KPRB 3MLXL 3PDOB 3SY0B 5L2KA 2P8PB 1JZ2A 2VISA 4QRUA 1T7ZA 1ZT1B 5CZXD 3QNYA 2DQEL 4NKOB 5GZND 1ZHNA 5D1ZB 1FYHB 2BSSB 4HC1L 3H0TB 3TJHC 1MLBB 3GGWB 3BIKA 3MODL 2KZ1B 4BH8B 1CDBA 4TPRL 1R3KA 2NY4C 1LNUA 5DA4A 5KVDH 1Q9WB 4W70A 2XKSA 1VEOA 4CN1A 3KPNB 3GMMA 3QCUL 4Y7MA 2DQJL 3P4NA 1CBVH 1P7QB 3DLQR 4NNPL 2DDQH 5KANI 1DQDH 3H3BC 1D5BA 3MRCA 4CMHB 4UQ3A 1W8NA 4P2YA 1KBGH 2Z92A 1C8PA 3T4YA 3QUXA 3PP3K 5IEHB 1LO4L 5E24E 1P2CB 3QO0B 1RVFL 2AJYH 1IGYB 5I1CH 4M7KL 2ITDB 1KELL 1UM5L 4PJEB 4MSWA 1UH2A 5IFJB 4P46C 1FE8H 5CGMA 3CMOH 3PWNB 4M62H 3ZT7A 5GS0D 1I85C 2F53B 3I50L 1RURL 3WIHH 1EEQA 3VFOB 4JRYE 2ZSWA 4MHHG 3C60D 3NA9L 5IB2B 1ZGLP 3TPUA 1CDUA 1OPGL 5GISL 3DXAA 2BK8A 3LQAL 3T1WA 1KB9K 1DLHB 2HT3C 3VFRB 4J3SA 2VSCA 3MRPB 4EVNA 3STZA 4WV1B 5T5NG 3ILPA 4QO1A 1SEQH 3QDJB 1UACH 1GZQB 5E4EB 5FYJH 3ECBB 3C6LB 1TJIH 3HE7B 2OTPA 4UV4L 1IGML 1J1XL 2AS5M 4K3DH 4WCYL 4WI2A 3PWUB 1FHGA 4RFOH 5I1IL 2AK4E 4ENED 1VFAA 1NGQH 1Z0NA 3L3OB 1KCUH 3GUTA 1Q9LA 3QI9C 1CTOA 5KVEH 4Z7WF 1G7LB 1YYMH 2VDOH 3CGTA 4P5KB 3JXAA 1FCGA 5E2JA 2HVKB 4G43B 3BKML 4GXUN 4KKLC 5C0IA 5EUOB 3HRZB 2QKIB 1DE4B 5EBLA 3LMJL 4J1UB 5TH2B 1OAQH 1J7VR 2OTWA 3H42H 2WBJB 5JNYB 1YN6B 4EXKA 3ZDXF 2PYEB 3EOBA 2BJML 2IBGA 4WDIA 3V0VB 4P23D 1O5DT 1R6VA 2IPTL 3BVNB 3NH7L 4N8CL 4UTBH 1OD9A 3BJLA 4M61B 2HMIC 1BD2A 3ULVD 4LK4A 2ARJB 3S8WA 1YNTB 3IDXL 2HKFH 4G7YH 1PG7L 5D9SA 4DN3L 2J88L 4XBGA 4Y16A 1TVDA 4LSUH 4QXGL 1LK3H 2J1KA 5D7SH 4XPTL 4UB0H 1A14H 3G5VA 5ERWA 3V6BR 4ZQKB 5L8KB 4HAGA 1E6OH 5F21B 1YJDL 4K94H 5J1AA 4NDMA 4ZUWB 3OJMB 5EO9A 5D7JA 4P48A 2GAZB 1NBVL 4LCWB 3PWPD 4U6XA 5C09E 3TT1L 5J4MA 4DN4H 3G5YB 3OG6B 5BXFB 4XPFL 5I8KH 4L4VB 1IC1A 5E99H 4W81A 5INCA 1GGIH 3OG4B 5DT1H 2LABA 1T0MB 2EIDA 3OX8B 2AJVL 1A7BA 2XA8H 3B2VL 4D2NA 4XZUB 2I9TB 2Y36H 4XNMA 3NFSL 3H9SB 1GRWA 4XXCC 15C8H 1Z5LB 1C5DA 2RB8A 2CRMA 5FO9A 4UT6L 4RMQA 4XNZB 1QVOA 2QADC 4POUB 4WW1A 1OGAB 4ODUA 3EUUA 3MLUL 2LAGB 3WLWC 5CUSL 3GI8H 1BFVL 4GAJH 5HDQH 1QR1A 1AHWA 3QFDA 4FQQA 2G60L 3TNNB 2OQJA 2HRPH 3GSOB 3HZYA 5DJYB 3IDIB 3S4SA 4HK3N 3BN9D 1VGKA 4Y5YB 1RUKL 4PGCB 1YQVH 2ZJSL 4MNQD 1X5AA 4PJ9C 1GVIA 2E27L 4GUPA 3FQXA 5I75B 1T5WB 4WUKH 4PGZA 4HZLB 3DUUA 2WBWB 1H8OA 3BP5A 4BSWA 3KS0H 4XX1E 5JZ7D 4GXVL 1S9KC 2HJFB 3TBSA 1A64A 4BQ9A 3MOAH 5I8CB 5MEND 3LSOB 4JGJA 2PR4L 3VW3H 2EDYA 3F12B 4CKVX 1QO3B 1H3UA 5K59E 3VRJA 3C09B 4LSSL 3TCLB 5GRVL 4Q9BA 1I1FA 1NBZA 4PRID 4WWKB 4CN6A 4XPBL 4YDLC 1MI5D 3EDKA 5CZVL 3BO8A 3VXNB 1S9YA 5A2JH 1S7SB 4Y2DC 5DURD 4KK9C 1JV5A 4RGND 1FH5L 4I0PC 2QQNL 3GIVA 5IEKB 2BRRH 1P1ZB 4OF6A 2X4NB 4N0RA 2XRAH 1BGXL 5IMLB 1C7TA 1DN2A 4OF3A 1KPUA 2EYTA 4J8RB 4PRAA 5FHAH 4AENB 3O6LL 4HPYL 1JUFA 4MB3A 3BE1H 4PGDA 5C92A 4GT7A 1F4XH 5FOBB 4XCYB 3BYYA 3IFNL 4QT5B 4HIIB 4M6AA 1BBJA 3HMWL 4HFWB 5ID0A 3TN0D 3NZHH 1V7NL 1R3JA 3DX6A 4OLVH 4FFZH 1YPZF 2GK0A 1KCRH 3WHXA 5F96H 3HNVH 1RK1B 1G7IB 1MCPH 5D7KD 4JO4H 4N0UE 3SCMC 5M7QA 4YFEA 2PO6B 4ISVB 3G6DL 3ZSSA 2ORBL 1YEEH 4U6HB 1RZKH 3D39B 3SE4A 3V6OA 5C0JB 5BVJB 3WUZA 3NTCL 1P7KA 1WWBX 1I9JL 3SDDB 1RJZA 3CAFA 3K4DA 2OYPA 1MQKL 4N8PA 5T1MA 5LBSL 3OAZK 4OT1L 2VDQH 1XF1A 3PNWB 1G6RL 2PXYA 4WI4A 5F9AC 1ORQB 2CDFB 1BQUA 4WHTB 1M7DB 3UTTA 4HS3A 4OI9A 3KWWB 3I84A 1JF5A 1F3JA 4Y8AA 5IF0A 2Y6SC 5C9KA 1QNZH 5I1EH 3WXVL 5CEZE 4PJGE 5C0CB 5E1AB 1TQBB 4XXDB 2VLJB 1D5IH 4NKMB 1EZVY 5E2TH 3TZVD 3X12A 2C7UA 3RWFB 4LQ1A 4D0DB 1E4WL 1U3HA 4KKCC 2JIXB 3ARED 5LAXA 3REWA 3MRQA 1YY9D 2XTJB 1JZ5A 5F7HA 1F00I 2FGZA 3MXWH 1NFKA 5C9JA 2FGWL 3ARPA 1JWUA 1M7IB 4MNGE 4ZYKB 4XPAH 1WBXA 4LF3A 5DQ9B 1M6OA 3JWOL 5DDHB 1U58A 4YHML 5A2FA 2R23A 1YNLH 4ZSOB 2ZCKL 4XNYH 4KK5D 2Y06H 3AB0C 2VR4A 3PWLA 4M7ZB 4LPUA 4XMPL 5KZCD 5DSCA 3LRSB 4JFOB 1B9ZA 2F58H 3KPSB 4FZ8L 4N0FA 2R2CA 3JUYA 5C0AA 4U6YA 2PTUA 5KSVB 5ITBH 2Q8BL 1EVUA 2R2HB 4KGLA 4OGXH 4CMMA 4LRNL 4QRSB 3VGFA 4F8QA 5GGVH 5MEQB 1CIDA 1FRGL 3P0VL 4HIJA 3SE3A 3S9DB 5DC9B 2CUIA 3QEHA 1OSPH 1T83A 4M03A 1FZMA 3ZE0E 5KSAC 3VXTB 5I71B 3HS0A 5H94B 4GKNB 2LTQC 3R8BB 3EYSL 2QQQA 4EI6B 3T0ED 5AYQA 3QXWA 4TNWK 4LCIH 2A77H 4X80L 5FYJU 1U2CA 5FYJD 4L4TE 4PRPA 5IMOA 3BFOA 2RCSH 3O4LE 4NBXB 5I73B 4MXQC 1JGEB 3PXHA 5B3NA 3IDYC 1T3FA 3WFHA 5F9WC 1TZHB 3WFZA 5HHOE 2IANA 4F3FA 3QEQD 3QIUA 2YZ1A 1G7QB 2RBLA 2Y4SA 5C0EA 4GS7B 4B7IA 5B39A 3BPLC 5T1KA 4G80A 1C1EH 2PTTA 4PG2C 3VG0H 4LP5A 1H3VA 1GC1H 1CBVL 1S78C 1DQDL 3UPCA 4JQVA 4EQ2A 3DV4A 4H8WC 1KBGL 3EO0A 2J5LB 1MHPH 5IW1B 5I8EB 1WC7A 2XKNB 5GQBA 3ARDA 1JF1B 4PJGF 5EIIA 4XP6H 1XGPA 3VGHA 1FE8L 5GGSY 3CMOL 4DKFH 4WW2B 2GY5A 4M62L 1I3UA 2J6EA 1DQLL 2H6PA 2XWJA 4OFVA 5DTFB 2OTUB 3QCTH 3C5JB 4YHLH 3ZKSD 43C9A 2B5IC 1M1SA 4ZUTA 1CFSB 3L5XH 4XH2B 1FYTA 3C6SA 1Z6JT 2DLTA 3MRBA 2CO6B 1IM9A 4ZTPH 4PY7A 5EFIB 3IFPB 3OAYH 5KVFH 1SEQL 1UACL 1T80A 3H7BA 1J1OH 3SGEI 4ODBD 4LLWB 1GZPB 1XGUA 3DGCR 4PD4K 1KG0B 2CDEA 3WIIH 4RFOL 3ROOA 1L4IA 5C0GB 2BSED 3FFDB 3ZKQD 1A3RH 1NGQL 5IFAH 2FYYA 3L9RB 1ZEAH 1NH6A 5KVEL 3NACH 3T2PA 4C56B 4G8GD 2G5BA 1L7IH 1IKNA 3MYJB 1CICB 3GSRA 1Y6MR 4WU5B 1FFPB 3MRHB 3O2VH 4NYLA 4HKBB 3RTQB 5GGTH 2ICEA 3DYOA 3RZWA 1JZ6A 3DX7B 2BNRD 1FNSL 2NY6B 1QSEE 2NLJA 3KYNB 3P77A 4NCDA 5CD3B 4NUJA 4JQXA 2Z4QA 4X6CB 4YDVA 4YBLC 5CIPA 1OAQL 3VFTA 1LO5A 4L8CB 4P2OA 5DMKB 1J1PL 1CG9B 4KDTC 4NO3B 3IDUA 4Z5RA 4JFED 4BM7A 5DFVD 2WINB 5D7IA 4PJCB 1JPGB 4HC1A 1FO0H 3RKDC 5DYOB 1JIBA 4HWZA 2ADIB 2PW1B 4P9HH 3M45A 3R8QA 1EFXB 4YJZL 3D3VA 2HKFL 3LEXA 4G7YL 4P2RE 3STBA 4YR6A 4HV8B 4M43H 3CLEH 1MIEH 4I2XE 4K23H 4V1DD 2DAVA 1BJ8A 1LK3L 1U42A 2ED9A 3IJSB 1KJMB 5HYFA 4XMLH 5D7SL 4IMLB 4R4NC 4UB0L 1A14L 1U93A 4JFDD 1RK0B 3NFPA 1E6OL 1WVZA 1BQHB 1CFQB 1NFIA 4K94L 2I07A 3DRTA 4RDQF 3QUYC 4OCRH 1MVUB 3AGVA 4ZUVB 4KRPC 5TE4H 1BJ1J 4DN4L 4E41B 5AD0A 1CK0H 1S8DA 2OJZH 3TFKC 2HT4D 5I8KL 4IRSA 5E99L 3GZKA 5E8NB 5DT1L 4EKXA 2QV2A 4Q6IB 1NAKH 2XA8L 3OKKB 3G6AA 5IVZB 2Y36L 3CUPA 3MV8D 4WV1C 1T2JA 1ZGLB 1FNFA 2RR3A 3V0AC 1WK0A 2DWEB 4R96B 5KSBE 4LLQB 3FONB 3INUH 3C6LC 3DI3B 3HE7C 1INQA 2ZZUT 4JZJC 5K93A 2O5ZH 3GI8L 4HUWB 5F7EH 4GAJL 5HDQL 3OJDA 4MJID 3VXME 5TE6H 4OZHA 2HRPL 4PJEF 4L8BB 5A16B 3WIFB 2XZQL 4YHKH 2BVPA 1MCOL 1YQVL 5CAYB 3HLAA 3ULUC 4OLZH 1CL7H 1S7VB 3BEWA 3FQUB 1NGZB 4JRXB 1YNKH 1FGVH 3ARFD 2XN9A 3IRZA 4IIQB 3MOAL 4EI5B 1PQZB 1ZT4B 3VW3L 2XXMB 2HLAB 1R5WB 2WBJC 3RDTA 4QWWC 1S9XA 5GRZA 2DLIA 1MLCB 2RFXB 2NXYC 5JHDB 3H9HA 4F7PB 3WKMH 2MCPH 1I3RA 3NAAH 1AI1H 2BRRL 4HLJA 1LK2B 2XRAL 1RZFH 3BYTA 3MX0A 1IEHA 3SKJH 4NCC1 5FHAL 1DUYA 1AGBB 4JJHA 1KN2H 3BE1L 2I26N 1VCAA 3RWIB 2V5TA 4MDJA 3C8KB 4OCXH 2APFA 1F4XL 1GHFH 2FIRT 3UTSD 4GRMA 3FQRB 5DUBA 5EUOF 3LY6A 5A2IH 4UT9H 1G0YR 2R9HD 3EKCA 5BRZB 5J6GA 3NZHL 4Z9KB 3DIFB 2UYLA 1U91A 3VXSA 3BUYB 2DJSA 4FFZL 4X5LA 3NGBB 1WITA 1KCRL 3NIFF 5F96L 1S5HA 4F7MB 4JN2B 1SVCP 1MCPL 4JO4L 1ZANH 3DMMD 2JJSA 3HNSH 3QUKB 2VLKD 2Z31B 2WSKA 5JXEA 3HC4H 1RZKL 3GIZH 3L3KB 4ZO7A 3ZZ1A 3BPCB 3VA2C 4MA8L 3ROLA 4AEIH 3IJYB 2D31B 2YK1H 1LP9F 3HRPA 4FXKA 3CDGB 3SDAA 4M6NH 5SX5K 1YMME 3LEVL 1CT8B 4I77H 3WDHA 4S1RH 3RVWD 4XAKD 5DD6A 2X9YA 1B6UA 2O61B 2H32A 2VLME 2H1PH 1QNZL 4PRDB 4Y5YC 1TCMA 5EU3B 2APBA 1D5IL 5E2TL 1GGBH 3MV11 1ZS8B 3FO2B 1T4KA 5D2NB 3O41B 1FNEA 2LAAA 2GCYA 1U6AH 1I1YB 1KTRL 3MPCA 2ZKHH 3MRIB 3VDCA 2OR7A 1ZVSA 4HLZG 1W72H 5IMMA 2AJZB 1CFVH 3MXWL 2NTFA 2A6KB 2V7HB 1NKRA 1ZV5A 3CFBB 2F54D 5CSBA 1ERNA 4XPAL 2AQ2A 1XGRA 2C1PB 3C09C 1XR8A 1T0NA 5C0BE 3C60B 2D7TH 5JXAH 2NMSA 1CDYA 1ZAGA 1JE6A 1XCQB 4WWKC 5DLMH 3K2MC 3BZFB 1VEMA 3VXUE 3SDCA 2ZUQB 1YNLL 3V5HA 4LASL 4XNYL 1R0AH 2F8OA 2Y06L 1PDKA 4ZPVB 1KOAA 4LSPH 2MOVA 1SBBA 3VH8A 1PX3A 2IBZX 1IQWH 1QRND 1F4HA 3FB8B 1T5XA 2F58L 2EICA 2MKWA 5JMRA 2YS4A 2OL3H 1A6ZB 4AL8H 5D7JC 4OGAC 1VERA 4KJPC 2MQ3A 4NM4H 3MLRH 2A0LC 5TDOB 3SJVA 5ITBL 1IC5H 2SEBB 4H20H 4KMTH 4Y4FD 4OGXL 2X40A 4R97B 1HHKA 1HNFA 4JHAH 1T22A 4MX7B 5GGVL 1OAYH 1TDQA 2G5RA 2JJTC 2A6JA 1OSPL 3G5XB 4BELD 3RWHB 3TYGH 2X42A 3HMXH 2PO6C 4HUMB 3QULB 1K4DA 3IFOA 4LCIL 2A77L 4PJXA 4JKMA 2W07A 3ELAT 2GYSA 3WLBA 4Z18A 2DQUH 2PNDA 5J6HA 3EZJB 1EVTC 3SDDC 4DUWA 2RCSL 3WD5H 1AHWC 3NIGF 2AXGB 1I9IH 4POZD 3S5LB 3ARXA 4P23B 4Q9RH 2VABA 2CKBH 4NC1C 2BMKB 3FO1A 3EOAB 1G6RA 4P3DA 1NMAL 3UZQA 3FN3A 1T1YA 3T0WA 4IRJD 3QG6A 1DR9A 4YFLF 1WZMA 3EJYC 3HR6A 1C1EL 3VG0L 5ECJE 4LOUC 5CWSA 1GC1L 5EZLB 4AY0A 1TETH 1NJ9B 4MB4A 4EDXB 4FQIL 4OZGA 3VXQA 3FO9B 2YKLH 1SYSB 1MHPL 3F58H 2XTJC 4JFHD 2I9LA 2QBWA 3ZDYE 3BH9A 3L1OH 3I85A 4K9EH 4NSKB 4XP6L 4H0IA 2P43B 3DURB 4DKFL 3FOMB 1CD1A 2KQMA 4AM0A 4IRZH 4TVSa 2P5WA 3PWPB 3ARSA 1IT9H 1OTTD 4TN9A 4KQ4H 3QCTL 4YHLL 4IM8A 4KTDL 5F7NC 1GGCH 3QDGA 5FK9B 2DJ4A 3L5WA 1MEXH 4RMSA 1ETZA 5I1GH 3OF6A 4ZTPL 1EEUA 4MJ5B 4K8RC 5KVFL 3QDME 5CEZL 1J1OL 3FRPA 1IGFH 4K3JH 2HFTA 3KYMB 2P24B 2H26B 3P0GB 3SKOB 1QSVA 1RUAL 3QH3A 1C7SA 1Q8MA 2NW2B 2YEZA 3P73A 1VFUA 4XB7A 3V6OC 3SE4C 3NPZB 5IFAL 5FUZH 4WUUE 4NQUA 4MNQB 5AZ2H 3NACL 3B83A 4JFFA 3NCJH 1A7RH 4UI2A 3RL2B 4ZOCA 3JWDL 3ZYOA 3BMWA 3O2VL 3EIFA 5GGTL 2R0WH 5I1JH 1AFVH 5D2LE 5MENB 2PXYC 3DRQB 5JPMB 2LU4A 5K9OB 5I73C 3C2AH 1GGYA 1XF5A 4I9WE 3ZTJH 3HI1A 5IB1B 2GHWB 4PRIB 2QR0A 3I75B 3P4OB 1SHMA 1MI5B 5DJ6A 5FYKE 4OZ4B 4Y19D 5DURB 1U3HC 4RGNB 1EIBA 3C5ZD 3MO1A 4Y0GA 5E70A 3S7GA 1FO0L 1UZ6E 4HUVB 3RWDB 3RVTD 2E6PA 1DDHA 4GS7C 4G9FA 5CEYA 3BSZH 4MHHI 4U3CA 2R0LH 1GOGA 3QNZA 5JQ6H 5D1XD 3QRGH 4MLIA 3TH2T 4M43L 3CLEL 1MIEL 4K23L 2QJDA 3DV6A 4MXWL 4ESKA 1P4LA 5FAAA 4XMLL 5KG9B 1VADA 4JFPA 1AO7E 3QFJB 1T20A 2Q3ZA 4XP9H 1WF5A 3TN0B 4HFUH 4XNQB 3EYOB 4JPIA 2J12B 2ZP0T 5I66A 2GUOB 2X09A 1H5BB 4OV5B 4IDJH 3I3EA 2FD6H 5TE4L 2R1YB 1X44A 2D3VA 4HBCH 2NY0D 4XVTL 3WE6A 2GITA 5CMAA 3FB7A 1KGCE 3M17B 3ZLQC 4QRPA 5HVFB 2OJZL 2DLFH 4HXAH 3ZDYF 3EOYG 2WIIA 3FQWA 4JQIH 2IG2H 1NAKL 3I02B 1K4CA 3RPIA 3W0WD 4YZFE 3V5DB 1FZJA 2VR9A 5HGBA 3KLHC 2FDBP 4P0DA 4RAUA 1PFCA 2X4QB 3SE3C 4X98A 3A6BH 3PWJB 5C07D 3INUL 4P5TD 4JY4A 2F74A 5GGRB 1M7XA 1J18A 4L9LB 2G2RB 3O2WH 3LKSB 1QRKA 4WIQA 5T33L 5F7EL 1A02N 5C08D 5TE6L 3V4UH 4JPKH 3RVUD 4WW2F 5ITFA 4PREA 1EH9A 2AJ3A 4QHMB 3L7FB 4X7CC 4OLZL 1CL7L 2G75A 5IKCA 2IPUK 3AREB 3UTZB 1ZGLM 5DJXA 1KEGH 3RTQC 2HN7B 1FGVL 1G0XA 4RMTA 1CS6A 2X4TB 1MF2L 1NDGB 4WFFD 1DBAH 2DQIH 5E9DD 3ZT6A 3QZWA 1JHLH 5SWSE 1T03L 2YD4A 3TEUA 3SBWC 1RJCA 4Y5VB 2X4UB 1HH6B 4QF1B 2MCPL 4D9QD 3PGDB 1S7UA 5IQ7H 2ICWB 3BPOC 4TVPH 4QHKJ 1EO8H 1AI1L 5KZCB 4PGBA 3VRIB 3ARDC 3HUJE 1RZFL 4QHNA 2H8PB 4XI5C 3AC0A 2MWCA 4X4XB 3SKJL 3P30H 3SKMB 4GW4B 4PBVC 4KJWD 1YEDB 2XG5A 3KLSA 3SOBH 5T3XH 3NA4A 3O6FB 2IH3A 4OCXL 4NHUA 1U8MA 3PL6D 1GHFL 1NBQA 3W9DA 4UT9L 3MJ9H 1MCWW 3BIBX 4LBEB 4LKCB 3HAEA 4HD9A 2A38A 5DQJB 2PETA 4R7NB 3EYFB 4JR9H 2V2WA 5DJAA 2EDBA 4OKDA 3HPJA 1ZANL 5E8OB 3T0EB 3HNSL 4KI5C 5J3HD 3HC4L 3GIZL 1FFQA 4HWNA 1QA9B 4JGUA 3QIWD 4K71B 4X6DE 4D0BB 1RIUL 4YK4C 5L7XH 4JM2A 2KPNA 4FFWC 4Q6IC 1CN4A 4AEIL 5F7DB 4QGYA 3O4OB 1ZLSH 2AKRB 4L29A 2Z93B 1OCWL 2EEBA 3DUHA 1JYWA 2YK1L 3DX8B 4F33A 4LCUA 5A43C 1GYAA 3MRKB 4M6NL 1S9WB 1CL7I 3QEQB 4RZCB 5DI8A 1I7UB 1JI2A 3HC0B 3MRDB 1XIWC 3AXLB 4YZFF 1CU4H 4ORGB 3RGVD 3TC9A 1MELA 4WHYG 5FECA 4WFHE 4PRBB 4LGSB 2H1PL 2IFGA 2AABH 2E6JA 5HDLA 4LFHD 4JQXC 1GGBL 1TZGL 3C08L 1CD8A 1U6AL 1LD9B 2AEPH 1P4IH 3JV4B 2X4OA 3KDMB 1A4KA 5BS0E 4CDGC 1W72L 4OZFG 1P84K 2Q86B 1CFVL 4UOW0 1WCBB 4QXTA 4JRYA 1FN4B 4IIQC 3VGAC 4EI5C 1U8JA 3T1FA 3T65A 4FTVD 1V7MH 5B4MD 5E6YA 4DGYH 5C2BH 4DGVH 3LEYH 4G42B 5JPNA 5C0FB 2D7TL 3WHE0 5I74B 5DLML 5FHBH 2RAMA 3GO1L 2FL5A 4MAUH 3GBLA 5D6DA 5EUKA 3NFNA 3NZ8B 1R0AL 1I3GH 1N8ZA 1IAIH 4LSPL 4JHZA 3E6HB 3G04B 4YDKH 2YSSA 1ORSA 4Y4KD 1IQWL 3TP4A 1OF2A 4EDWH 2AK4A 2G9HA 2I5YH 3TO2A 2YZ8A 4AL8L 2ZOLA 4NM4L 2VJXA 3MLRL 2NY7L 5I1AA 5CLWA 2HTLC 1IC5L 1I8KA 4H20L 4K3GA 3UZVB 2BSTA 3MLYH 4KMTL 4PGEB 1TJHH 3HUJF 4PP1D 5ICZA 3FT2B 1ES0A 1OAYL 2E7CA 5D96B 3SKNB 4G8GB 3VWKA 1CXLA 1S9VA 3LQAC 3RWJA 4KU1A 5HDOA 3N1QC 4NNYA 3ZYIA 2PW2B 3CU7A 3TYGL 4NQSB 3HMXL 2Z31C 3FT3A 2BNRB 2L7JA 3NCBB 4ETYA 4S2SA 4OD3H 2GJ6A 3MV9E 2DTML 5HYJE 4EVNB 5SWQB 1CE1H 4PG9A 5EPMA 1UM4H 3WD5L 5K9JH 2NY2C 5CZXC 1P7HL 1IGCL 1CCZA 1PYWA 1KT2B 4JFEB 3L7EA 1IL1A 1FZKB 4QHLA 5JW5A 2JCCA 4M4PA 4X6DF 5EU5A 2CKBL 1BF2A 5IIEB 2CRZA 3U6RA 1KIPA 3PABB 3VXPB 5DJZA 4KGJA 4PP2A 3MLSH 2VXSH 5ICYA 4NHCH 5IJVA 4LIQH 1B0GB 1NC4D 3O0RH 3O6KH 4PR5A 4APQB 4I18A 3GSNB 4V1DB 1TETL 3IDMA 5EZJB 4XWOC 5ADOH 2YKLL 3DTXA 4X8JB 3RDTC 4JFDB 4EXPX 4I5BA 3F58L 1NGYB 5CHNA 3P9LB 4QOKA 5FA3B 1KXQE 5IWLA 5C09A 4BFBD 3X11B 3L1OL 4WWID 2EO1A 3IDNA 2ZUVA 4LCCA 5GS0C 3GB7B 1IM3A 4QTHA 4IRZL 3MUJA 1IT9L 3CFJB 3VE0A 4KQ4L 5LGJB 4MVBD 3VXRE 4L8SB 1ZTXL 2NW3A 5ICXA 2X4RB 1BZ9B 2ZUQC 1JBJA 4NQDE 1GGCL 3WJLA 1MEXL 3K3QA 3D0VA 4EZMA 2K7QA 2FJGA 3VXOB 2N7AA 1XZ0A 5TDNB 3MV8B 4TSAL 4F7CA 3BHBB 5HI5C 5D9SB 2BNUA 4HG4J 4P2CG 5JW4R 4KZDL 1Y18A 3MLTB 5GSVA 4BQBA 2VDPH 4R9HA 1M05A 1IGFL 4K3JL 1I8MA 3KPPB 1Y0LA 2JJSC 1W0WB 5C2UB 4ENEC 4MJIB 2UVEA 4PLOB 1YC7A 2GJZA 5JOFB 2X70A 2ZCHH 4IOFD 4R97C 5JXEC 5FUZL 2A9NH 1EEYB 2OSLA 3E8UH 3TBTB 3U4BH 5I6XB 5DD3H 5FB8B 2DQCH 3K1KC 3HI6L 3NCJL 1A7RL 1U8OA 3D25B 5DO2D 4RRPG 2J4WL 2XY1A 1UVQA 4LPYA 4MMXC 4X7TA 4KVNL 5EU6E 3O3AB 3ARFB 4OZIE 1MAKA 5AWNH 2R0WL 1U36A 1AFVL 4HK3J 4HUUA 5HHVH 5HGAB 4R8WH 1D7FA 5E5MA 5KSUA 3MRGA 3C2AL 3GSQA 3MOQA 2QHRH 2VZ1A 3FFCE 3DGGB 4NZDA 5ALBH 1EK3A 3WS6C 4P23C 2A1WH 3MV7E 3JVGC 1A6VL 2CK2A 4WO4D 3KJ6H 3L3IA 1GPOH 3KXFA 3V9FA 3TYFA 4PS4H 5ESQA 4OF5A 4MD0B 1AR2A 3ULVC 2D7QA 3DO7B 2DYPA 4JANA 4KTYA 2NY3D 4U1MB 2R0LL 5JQ6L 3QRGL 2NY5C 4R7DA 5M95B 4LLMB 2EYRB 4X6EB 3PV6A 3R06A 1P84J 4BSWB 3OKLA 2MTPA 3UTSB 1HILA 4RIRA 3ZKXC 2FR4B 4J4PD 2L4OA 2FX8H 4LPCA 4Z76A 3D18A 4XP9L 4HFUL 2K3TA 3SDCC 3BXNB 3IF1B 2HVJB 2UWEF 4IDJL 3GHEH 4HBCL 2D03L 3DMMB 2W1NA 1HYSD 2VLKB 3P4MB 2XI9A 1HH9B 1XAUA 1QFHA 3B3IB 3LKPB 1S9YB 1DBJH 5ISZD 3E2HC 5GS2H 4JQIL 3V7AG 1ULVA 5C0RH 2IG2L 1S7XB 1KIRA 1YN7B 4X99A 1FG9C 3CMGA 1I1CA 1XGQA 2R0KH 1DEEB 4UDUB 4NQED 4JDZA 3A6BL 2RHEA 4TTDD 3KNBA 5I76B 1FL3B 4GW1A 3O2WL 3O3EB 1MUJA 4FQHA 2ZNWA 5CGYD 5D93B 2HH0H 3BN9C 3V4UL 2R2EB 2Q3AA 4UINL 4MD5A 4FMFA 2Z8SA 5E8EA 2ERJC 4JFQA 4KHXL 1CGSH 3MNVA 2VNCA 3GKZA 1YEHH 2V5RA 5JZ7C 1RUQH 4DVBA 4F2MA 2HG5A 5FKPA 5GGTA 4RNRB 2F54B 4NRZA 2W91A 5FO7A 2CRIA 4F15C 3N9GH 1DBAL 2DQIL 4LLVA 4J12A 4W68A 4JEGB 4PJAE 4TSCH 3O3BA 4PJFA 4XVSL 1JHLL 5EZIH 2B2XH 5E6ID 4ZD3L 3T0AA 1AJ7H 2J8UE 4P2QE 1RZJL 5KN5B 4RGNC 5IQ7L 1F42A 5EBWB 4KDWA 1OM3H 2FX7L 4MNHA 4TVPL 4WY7H 1EO8L 1U8PA 2XT1B 1FO0A 1XEDA 4G9DA 1QRNB 4ZDHA 2FEEL 4R0LB 2I25N 1IGJB 2HFFA 5IVXA 2FSEB 3P30L 4XGZB 1CFBA 3MFGB 2BVQB 1BZ7A 4LLYA 5T3XL 2JB6B 4JO1H 1N0LA 4OFKA 3UDWC 5IMKA 2YD7A 1JCKA 2H2PD 3GMLB 5E2UH 4WNQB 3MJ9L 3VFWB 4AEHH 3L3GA 1H5BC 1WTLA 5BVPH 3WFBH 2CLZB 2BDNH 4O4YH 2NX5E 5JA9A 4C83A 4WU7A 1T6VN 4HWUA 1WLHA 4NQVA 4UOW1 5FGBA 2B4CC 1JGDB 1CLYH 4JM4H 3P0YH 3BD4A 2XQYK 4CU7A 1ONQA 1R3IH 3L6FA 5F7WC 4Q7DA 1DBML 5L7XL 5DRXA 5HHOA 5D7LA 3HN3A 3MBXH 5FGCE 3GMRB 1ZLSL 4ZFFB 3MNZB 1CQYA 3MUHL 4A2MA 2APVA 4ONHB 5I1LA 3SN6N 3EO9H 2M1KA 5FYLD 1BWWA 5KW9H 1A9EA 4D3CH 1UCTA 3F6IA 4WHYH 1AGDA 2BZDA 2Q6WA 4L9LC 3PQYD 3B9KA 4H26A 1CU4L 4IRJB 8FABA 5DR5H 3R0NA 1EJ6A 1MREH 1QSFE 1VB9A 1T7YA 1BIIA 4YHIB 3TZVC 3RWEA 4S11A 1JZ7A 4DVRH 1KPRA 3C5ZA 1QLFA 1NAMH 4U49A 5CILH 2UUDK 2AEPL 1P4IL 3AREC 1YY9C 2MQCA 1UB6A 3ZHDA 4CNIA 2W9DH 1MRCL 2EDFA 5D1XA 3K8LA 2BY0A 1NGWA 1UXWA 1V7ML 2FEEI 3QDJE 3PHOA 1VACB 1WZLA 2YXMA 4DGYL 3MLVL 3RZCA 4DGVL 2EE3A 3ZDZE 3LEYL 2BNQD 3DBXA 4MQXC 4MQ7A 1ED3B 3MJGX 4U2YA 4FXGB 3FQNA 4YWGH 2OR9H 2K7PA 4H8WH 1BZQK 4KK5C 1C16A 3G9AB 3QUMH 5ENWB 2FHFA 2ATKB 1NBYB 1WUNT 2DI7A 5CD5D 3BGMB 4Z8FH 3UJIH 4YDKL 3OKMB 1BHGA 4PJ7E 5AUMA 1G1YA 5L2KE 3LS5H 4PLKD 3ULUE 2YPKB 4EDWL 1F45A 4L3CB 4X0KA 1UXSA 4GG6E 2I5YL 1MWAB 4V2BA 4TTGA 3DARA 2FECI 3MLYL 1TJHL 4B50A 1RZGA 1DQTA 1M71B 1WTGT 2GFBB 5ETUA 4P5TA 3IDJB 5IM7A 2JELL 3GJEA 4NBZB 4G6MH 3OXRB 1SVZA 2VZUA 3T0EC 4Z77A 2LV4A 3KLAA 1A7OH 4CADA 3CSBA 4XBPA 5ESVA 4OD3L 3MBEA 1E27B 4KKBD 1FFOA 1CE1L 1OP5H 1OLZA 3CC5A 2VIRA 1UM4L 5K9JL 1IKFH 3O4OC 4GKZA 3V7AE 1FAKT 4YIQA 5D5MA 3ZE2E 3VRLE 3F7VA 2CJUH 1A1MA 5GIRA 1AQDA 1LO0L 3L3JA 1IGTA 4Y19B 1BM3H 3IDGA 5EH1A 2CUMA 4P2RA 3JV5A 4X4ZA 1JTPA 2Y5TB 1HXYA 3DXAE 1RZ8B 1XR9B 4LPTA 2VXSL 4NHCL 4MS8D 4LIQL 3O0RL 3O6KL 3U4EA 3PJSB 1OTUD 4L4VE 5ADOL 4P4KB 4OLUH 3Q6FA 1N64H 2XWBB 4JG1H 5JUEH 1W72A 1LE5A 3MLWH 2GJJA 2BVOB 5HGHB 3V79C 4I3SL 2FJHA 4M5ZH 2NY0B 4WRLA 4GKSB 1OGAE 2ITCB 1O7SA 3LKOA 5J13B 2ZUUA 5KSBA 3W0WB 1JWSB 1NFDB 3TGXA 1MCJA 1KTDA 4P57A 3NCYS 4R3SA 5CSZA 1U2HA 3CFEA 1U8IB 1N6QL 1EZVX 4NRXB 2MHAA 3D3VB 3LEXB 4M9OA 4YHNB 5L2JB 4X83A 5C07B 3QQ4A 4K94C 1K2DA 4KK8C 2X4SB 2VDPL 3GBNH 4U4BA 2OL3A 1KACB 1YEGL 2MFNA 3DROA 2LQRA 3NFPB 3SDXA 1DQJA 4QYOB 5C08B 4PJ7F 4X7DC 1BLNB 1CE6A 4LDOB 4MZ2A 3G6JA 2A9NL 5JDSA 5I18H 1TJGH 3E8UL 4ZG1A 4JM2C 5D96C 3TF7C 2X10A 1DQQB 3U4BL 1BD2E 4NFCA 5DD3L 3F5WA 3P9WB 4EUPB 2FCBA 3RGVA 4BH7A 4FQXA 3LD8C 5IB4B 4LQFL 4PRHA 2E9BA 1KLUB 3HMXA 4IOIB 5AWNL 5EBGA 4NUGH 3V95A 3GBMH 4M7LH 4I8DA 3GMQB 4Z78A 1KCSH 3MRLA 1VKXA 5HHVL 3WN5B 4R8WL 3N1PC 1NUNB 2BHZA 3FCTB 3MGAA 4PB0H 5ALBL 3ULUH 1WFOA 1KEMH 3BP6A 2XWTB 4B53A 3QWRD 4M8QA 3UX9B 4U1GC 1GPOL 1I7RB 3V52H 1LEKA 2CKBA 1VEPA 4RGMB 1D5ZA 4PS4L 1MAJA 4WI5A 2WWKO 1PKQB 1HQRA 1IEAA 2GSGA 4HAFA 2Q76A 2V2XB 3VRLF 5L9DH 1OD7A 4YBQD 3RX7A 4C57C 4O9HH 3LN4A 1AGEA 3PL6B 2Z8RA 4BFEA 1IQDA 5GRJH 3MOBH 3IAQA 4LARH 4CGTA 5B39G 3DX9B 4U1SB 2FX8L 5GGUB 1J8HA 2IALA 2PCPB 2EYSB 2P8LB 4D8PB 4H5SB 1VFBB 2HJKB 4IOSD 1PKOA 4RX4D 2F8XC 4Z0XB 3QXAB 2JK5B 3GHEL 3U79A 1NCWH 5EOQH 4NC1E 1RHHB 2CH8A 3H9HB 2HT4C 4L8SC 1EUUA 5IV2A 1I3RB 1NMBL 1DBJL 3QIWB 3O11B 4LVHC 2ADGB 1T21A 4W4OA 1YY8A 4PJDB 4BKLA 4YDIH 4HMCA 4NO2B 2VLJE 4N9GA 2CXGA 3GSWB 3WFEH 2R0KL 4RAVB 4MCZB 1BQHG 3ARVA 2ZG3A 2XY2A 1UQSB 4HWEH 1AR1D 1Q9OA 1FG2A 3GEWB 4NQCA 3GI9L 1F58H 4JLRA 2XTJE 1R3LA 5DF0A 2GTWA 3D2UD 4JFYB 1MPAL 1WT5A 3VFUA 1AC6A 2IBBA 2HH0L 2NY1D 2CGRH 2Z9TA 2VL5A 4R26H 5CKGA 1RZKC 4HHAB 3EFDH 3MROA 4Y1AB 5IBTH 3GJFK 1EBAA 3PGCB 2ZNXA 2EDHA 3REVB 3HTLX 1RIHH 1YEHL 4ZSOE 1A6AB 3ARFC 5F1IA 4PJHA 5B3JF 3GSUB 5C0BA 4DZBB 3ROLB 2R29L 4FTVB 4LSRL 2HA1A 3N9GL 3MRRB 4N68A 4G6JH 4TSCL 4DKDC 3ARBA 4WHDA 2B2XL 4NPYA 1AJ7L 4BFIB 3V7MA 5ANMB 4I18C 5SWZA 3U46A 2X1PA 5DD6B 3V6OE 2OR8A 1OM3L 3SQOH 4Z7UB 4WY7L 5EU4B 3MQIA 4Y4KB 5HHNB 4HUXA 1X5IA 2EDEA 1X5XA 5B38B 2YD8A 4OKVB 3DETD 1BF8A 4LCCC 4RMWA 4TNVK 4EN3A 1EEZB 4NN7C 4YQXH 1OT1A 4X9FA 1YDPB 4AH2A 2YPLD 5DJ0A 3OKDA 5LKNA 1KF9B 4R4BA 2R9HC 1T04B 5F93C 2B0SH 3H3PH 5E2UL 2QEJA 3TBYB 1FVCB 3UTTE 4U0RC 4AEHL 5K9QG 1HHGB 4PTTA 3OJVC 3FJTA 3WJLC 5ACZA 2CPCA 5FV1L 5BVPL 3WFBL 2YUVA 4O4YL 4GBXB 3O45B 1PBYA 3GSVA 4K3HA 4JM4L 3P0YL 4LEXH 3UTPE 4UBDC 4A6YB 1R3IL 4X5WA 3L3HB 1U8QA 5IT2H 4PJIA 4WFEE 4H1LG 3MBXL 5CCKH 4HF5L 4YHPB 43CAA 3MGTA 1DTUA 3EO9L 3HZVA 1GXEA 4LEOB 4OUUA 4FABH 4H25B 4UNTA 4D3CL 3RUGA 5D8JH 4YXLL 25C8H 2Y07L 3Q5YA 3RVWC 4I4WB 2P49B 1AD0B 1HHKB 1H3XA 5HYIA 4LHUD 3BQUA 4L8DB 5D93C 5I9QC 3HE6D 1NC4B 1MREL 1WWAX 3MACL 3Q3GB 1BPVA 4WO4A 3WJJC 4L4TD 4DVRL 2P48B 4UNVA 2R4SH 5FUOH 1DFBH 1NCCH 5CILL 3CH1B 4LCYA 1O7VA 5C0AE 2CR3A 4M1DH 2DKSA 4TSBH 2W9DL 2FJFA 2JF1A 3TNMA 1FGNH 3QNXB 2AJXH 2CDGB 2BC4A 2GTZA 5DZOA 1CWVA 3PWVA 4PYGA 1PY9A 2BOCA 2V9RA 3IVKA 4IHOA 4PV9B 1MCSA 3CVIH 1JNHA 1LO2H 3T2QA 4YWGL 1U41A 2OR9L 4H8WL 5HY9B 2WUBH 3O8XA 3QJHA 3QQ3B 3QUML 4ZO6A 4JAMA 5BCAA 3PXJA 3D69B 4JY5H 3UJIL 4PRPE 1FVDA 2EXWD 2YMXH 4R0LC 3LS5L 1C08B 1OAKH 5HGDB 3F7YB 3QIBA 3ARRA 3MA7A 5DC4B 2BSRA 1HHIA 2EEAA 4Y4FC 1YZZA 1N3NB 1MFBH 1WGOA 4Y5XA 4KJYB 2VDRH 4TUJA 5JA8B 2Y7QA 3FMGL 2AV7B 4X6CE 3LKNB 1RULH 2CSPA 2IGFH 3MJ9A 5D2LA 2EE2A 3IXAB 4G6ML 5JMOC 5T3ZD 2EKSB 4PJCE 3MRJA 4JO3L 1BX2B 2AQ1A 3UAJD 1A7OL 5DJ2B 2GT9A 3IKCB 5IOPA 3STLB 3VGBA 1MHEA 1YEIH 1HEZA 3OKEA 1GIGH 1IKFL 4NO0A 3ZMRA 5JO5A 3GMNB 2B1AH 3C9NA 3QWQB 3T3ME 2FBJH 4NRYB 4PLNC 4F7TA 3ULSA 4B5EA 2MSPA 4ELMB 3ARGA 3DNKA 4X5XB 3WNPA 5E6ZA 3V5KB 2HKHH 1S7WB 1ZK9A 1FYTE 2AEQH 4G8FB 3D85A 2IH1B 3UBXB 2NY3B 4UUJA 2HLFD 8CGTA 3WNNA 1H15B 2ADJB 4KI5E 1U95B 4KROD 4MZ3A 3OXSB 4MA3B 1VFOA 2CLVA 4OLUL 4P4RA 5IP4A 1JPFB 1N64L 1HHJA 4M7JH 3ARQA 2ATPB 4JG1L 5IR1B 4M5YH 5DMGD 3OR7B 3S5LG 5JUEL 1A9BA 2DQFA 2IPKA 3MLWL 4YGAB 4HJGA 2AXFB 1HXMB 1WIOA 1NC2A 1OTTC 5CP7B 2D7NA 4YHOL 2NR6D 5DJDA 5ISZB 4P9HC 3VGEA 3KS0J 4U1IA 1MAMH 4KKAD 4Z7QE 1ADQH 1JNLH 3FTGA 2F5AH 2PYED 3L95A 4QRQA 1A1NB 3CVHB 4NQEB 5F3HA 3T3PE 4QXWA 5CBAB 1KCKA 3UC0H 3N1MC 1HCFX 1H0DA 4P46A 2ZSVB 1MCFA 4Z7WA 5KS9B 3GBNL 1HQ4B 2KKQA 4HGMA 3U36A 5I16A 2HFEA 1MCEA 3PP3H 2OZ4H 5D7IE 1HDMA 3BP4A 1TVBB 5GGVY 2E8ZA 4CDHA 5HI4D 3MLZH 5I18L 1TJGL 2DQHH 2ICES 2R1WB 3QHFH 1UJ3B 4ZOAA 3CFDA 4H0GA 4JB9H 1BVLA 2GITB 2FWOB 3PQYA 1ZE3C 3I9GH 2P42B 1J0JA 5F8RC 4DEPB 1I7ZB 5L88H 1TENA 1OAUH 4GRLB 3TIEB 5E08H 1L0XA 2E7BA 4NUGL 5E00B 3RWCA 4TOYH 4M7LL 5ACMA 1KCSL 4TUKH 3WEXA 3LIZH 2WLZA 4U1NA 5E6IB 3BEVB 5HJ3B 2W38A 2KZWA 4PB0L 1CXFA 4NNXB 4E42B 3HC3L 4ZFZA 3VXMD 4JFZH 1RU9H 4JY4B 3B4NA 3ULUL 1AGCA 2LVCA 1KEML 3LVEA 3JTTA 3MUZ1 1N5AB 3C5ZC 3V52L 3H6JA 1KFAH 2ESVA 1JK8B 3RVTC 3LPFA 3RQ3A 3G5ZA 2BNQA 1I4FB 5L9DL 1FL6A 5D1XC 2DF3A 4NO5B 1JWMA 3DO3A 1U8KA 4PRNA 4LAQH 3O6MH 3P2TA 3RZCC 2YD9A 2I27N 1F6LL 5GRJL 3W11D 3VG9B 4LARL 3VD7A 3BW9A 1WIUA 5J9PA 5E8PA 4FZEL 1FBIL 1AGFB 2V7NA 2VN7A 1K6QH 3QHZH 1E4XH 1DCLA 4HJ0D 4NGHH 2WZPD 4OZHE 4JVWA 4KI5F 4POYA 2VQUA 2X5PA 1MH5A 4CL7A 1NCWL 4XTRD 4Z7VE 3CXDH 2V9TA 1EBPA 4XRCB 1PZUB 3C2SA 1QACA 4AT6B 4G8IA 1DUZB 3U30B 3K7UA 1K8IB 4YDIL 4PGBB 5LGHL 2QSQA 5DVOA 2R2BA 4YE4L 3VU2A 2NZ9D 4Y8DC 3T8XA 5DEGA 2E3VA 2YD6A 4P5TC 3CCHB 5MEPB 5FKAB 4CU6A 4HWEL 3RHWF 4GAYA 3K4AA 2IC2A 5C0DA 1F58L 3QPXH 4Z7QF 5HHPB 3I3BA 5SV4A 3QUZA 3U4AA 2YRLA 1A5FH 3B6SA 3SGDH 2EH8H 3T3PF 2CGRL 4MMZC 4PTUB 4R26L 4F9LC 1YEFH 3MBEC 5DVLA 3EFDL 5IBTL 5TPWH 4KMLB 1KIQA 1YUHB 2Y25A 4JZOB 4EIZC 2BXZA 5D7IF 4XXCA 5I17B 1AKJD 1RIHL 1YECL 4I48A 5CSGA 4PV8A 5JORB 4LLUB 3FB5B 4O2FB 1UCBH 1PZ5A 1YMMD 3FHQA 3ALWA 9CGTA 2C1OB 4G6JL 3GJFB 3D39D 4U1JA 3OKYA 4HBQA 2IAMD 3I6KB 3K4ZA 1BFOA 1EAJA 4HGWB 4LHQB 4PJ9A 2IQ9H 4MAYD 4RGMC 3OKOA 3FB6A 3BKJH 1FFRA 2X44D 1IAKB 1G7MB 1EXUB 4JKPH 3PHQA 4MXVE 5DRZB 2E6QA 1OOAA 3BOVA 4JY6A 3B9VA 4YQXL 3TV3H 4UQ2A 1YPZA 1UH4A 3PL6C 2X4PB 4XCEA 3S37L 4NKDB 5DRWA 5LVEA 1NANH 3H2WA 4RGOH 3HR5A 5C0CD 1MJJA 2YR3A 1QBBA 5FDWB 1FDLH 1TCRB 3RKPA 4Y2DA 1QLRA 3FN9A 3VXUD 1P53A 5CGTA 4I0PA 4OFIA 4OBRA 3MV9A 4S1DD 5CJBA 5DHYA 4HKXA 5J3HC 1I9EA 2V2TB 3IB4A 3QIWC 3H9ZA 4XCNB 5C8JA 3S37X 1LEIB 2IADA 4OZHF 4YC2B 4HDIB 3SEPA 5F9JA 4D0CA 3CXHK 5GGSA 1FVEA 1XGTB 5CCKL 5DVMA 1G7JA 4ALAH 2BERA 3FQTB 4RFNB 1WAAF 5DGQA 3K74B 3L3DB 5HI3C 4UT7H 5LGKA 3SO3B 3EO1B 4HWBH 3RAJH 4FABL 1MSPA 4HX1B 1N2RA 5GSRB 4YPGA 1JTOA 25C8L 3ZYZA 4QRRA 3MCLL 1R24B 3CDYA 3RGVC 1VESA 3FN0H 2XNAB 2X1XR 3KPQB 5TGBA 3MNWB 3TJEH 3THMH 3M1BB 5BJTA 4C4KO 4F7EA 1N4XL 3MFFA 3PWPE 4U6TA 5AEAA 4D9LH 4G8EB 4XVJH 4KXZH 5FUOL 4O2EA 1DFBL 1NCCL 3TBVB 5IBLD 4HKZB 4E0RA 1NCNA 4M1DL 1UKQA 4HK0A 1DQML 1FGNL 3GNMH 5GZOD 2AJXL 5B4MC 3TO4D 2XOTA 4LNRA 2W60B 3OAZH 1KSRA 3ME0A 1HWHB 1LO2L 4HIHB 3E6FB 4RX4A 3NABH 2WUBL 4DAGL 4YHYB 3KPMB 1FFNA 3OKNB 4PJXE 5E1HB 4MNQE 4QHUB 4Y4KC 4JY5L 3ZKMD 1KPVA 1FZOB 4YGVB 2ADFL 2XZAL 5LWYH 4GLRH 4K9EC 3HCVB 3VWJA 5T1LA 4N5ED 5J7CC 4FA8A 2D7OA 1WEJH 1MFBL 2VDRL 4GRWF 4U0QB 3MRFA 3VJ6A 1RULL 2IGFL 3H9YA 4HT1H 4K8RL 1V05A 4PRIE 4B0MM 5ESAA 2DLEA 3RIAF 3P9MB 3C5SB 1X5ZA 3IETA 3AUVA 3LPGA 1XH3A 4PJ5D 2FO4A 5LCVH 4OZGE 2R69H 4RGNE 3QDMD 3CPLA 5IB3B 4I13B 4Z7UF 1GIGL 3VI4F 4Q74A 2XFXB 1WT5C 3IU3B 3MZTA 5EO0B 2Q7YB 1K85A 2A83B 5GSVB 2B1AL 3EZ8A 1R5VB 4WUUD 1UB5B 3OPZH 1TVHB 2FBJL 2R39A 1BMGA 1LE9A 3NCCB 32C2B 3QPQC 4ZAKB 3VFSA 1IEBA 2AI0H 2HKHL 3TBWA 2NTSP 4JJ5B 4MDIA 1MRDH 4P59H 3QDGE 3UYOD 2V6HA 2AEQL 2ZUTA 3HPLB 3BDXA 4MWFB 5D7KE 5E5RB 4A2LA 5I0ZA 1H8SA 3MREA 5IHZA 1SMOA 4BUGA 3FT4B 2GSIA 3BRGC 1X6LA 3RP1A 5D1QD 2L0DA 3ARBC 5DS8A 4QTIH 3X14B 4DKEH 4M7JL 4HUUB 3BWAA 1S7QA 4M5YL 5MERB 5FYKU 1ZHLB 1CICD 4XHJC 4WI3A 1C5CH 5FYKD 3GSQB 3LKRB 3ULVH 4OIIH 3ESVF 2D9QB 4JFFE 3NN8A 2W65B 4MVBC 4PG2A 1R5IB 1BFSA 1FSKC 5F1NA 1MY7A 2M26A 1DVFB 4EN3C 2FNBA 1KTLB 4WTWA 3QDHA 4FNLH 5H35B 4X7EC 3VFNA 3SGKA 3X3FH 1JNLL 1OP9A 1QHPA 3QUMA 3CZFA 3FO0H 2F5AL 2VZSA 1AO7D 3Q48A 2MQ0A 1G0DA 2Z35B 1WICA 3WUWB 1E4KC 5T1DH 3R06B 4X8XA 1JGUH 1HOCA 1W2KT 2UY6A 3ZE1F 3D2UB 3VFPA 4PJXF 4KV5E 2OZ4L 4N0UB 4X6BA 4IOFC 2NY1B 1NL0H 3V4VH 4E5XA 5CJQL 3EGSA 2VLRD 1D5MA 3MLZL 1A4JB 5CEXA 4M6MH 1F6AA