1WQWA

Crystal structure of biotin protein ligase from pyrococcus horikoshii ot3 in complex with biotinyl-5-amp
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
235
structure length
235
Chain Sequence
MLGLKTSIIGRRVIYFQEITSTNEFAKTSYLEEGTVIVADKQTMGHGRLNRKWESPEGGLWLSIVLSPKVPQKDLPKIVFLGAVGVVETLKEFSIDGRIKWPNDVLVNYKKIAGVLVEGKGDKIVLGIGLNVNNKVPNGATSMKLELGSEVPLLSVFRSLITNLDRLYLNFLKNPMDILNLVRDNMILGVRVKILGDGSFEGIAEDIDDFGRLIIRLDSGEVKKVIYGDVSLRFL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords biotin--[acetyl-CoA-carboxylase] ligase
publication title Crystal Structures of Biotin Protein Ligase from Pyrococcus horikoshii OT3 and its Complexes: Structural Basis of Biotin Activation
pubmed doi rcsb
source organism Pyrococcus horikoshii
molecule tags Ligase
total genus 66
structure length 235
sequence length 235
chains with identical sequence B
ec nomenclature ec 6.3.4.15: Biotin--[biotin carboxyl-carrier protein] ligase.
pdb deposition date 2004-10-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02237 BPL_C Biotin protein ligase C terminal domain
A PF03099 BPL_LplA_LipB Biotin/lipoate A/B protein ligase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 1wqwA02
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 1wqwA01
3QTCA 4JUVA 4UP9A 2DXTA 4M78G 1B34A 4H2WA 1LOJA 4P3PA 4H2TA 2DXUA 4HA8A 4M75A 4XU0A 3RL6A 4EMKC 4YRJA 4P75A 4KQEA 3V8JA 1PYSB 2CIMA 4DPGA 1ADYA 1I5LA 4N0AA 4RCBA 4M77G 4YRFA 5LJ3d 3R07A 1H4SA 4X5OA 5GAN7 3NETA 3JB9G 4A53A 2P5IA 4C92E 5GAN4 1Y96B 5ELNA 1NNHA 4RCCA 5GAN5 5LJ3f 1WLEA 2ZR3A 1C0AA 1E24A 2ZT5A 2RA2A 3REXA 4M75E 4G85A 2DDZA 3P8YA 2ODRD 4C8QF 3VU3C 4F7UF 4XU2A 3PCOB 3HFZA 5HGQA 1B70A 3JCMV 4YRTA 1I4K1 5GMKl 1H641 4X9DA 1NJ5A 2ZCEA 3JCMc 2DZ9A 1WQ7A 1HTTA 3JCMg 3M4GA 2ALYA 3QNEA 4TQDA 2AKWB 3TEHA 1QE0A 4HWOA 4M7DF 4XTUA 1B7YA 2RHSA 1USYC 1LNXA 3INZA 4F7UA 4RDXA 4M78D 2ZIOA 4YRPA 1KMNA 3RKWA 3RESA 3HXVA 3RUXA 4HT8A 2G4CA 3QO3A 4XTWA 1BIAA 3JCMe 3A31A 3A32A 2QTXA 4L87A 3HFOA 4XTVA 5LJ3h 2EJ9A 1EVKA 3E9IA 2DU5A 4H2XB 3CMQA 1EIYB 2RB6A 4M77D 1H4QA 4YP0A 2PMEA 3MF1A 3JCMJ 3NELA 1ASYA 3BFMA 3RGLA 2ZT7A 3RKXA 4PJOA 2QHSA 4YDQA 4TVAB 2E5AA 4BWAA 4KR2A 3JB9D 4EMGA 5GAN6 4P71A 1NYRA 2DKGA 5F5WA 1BIBA 4LNSA 3M4PA 3HFNA 3L2ZA 1NYQA 4XTXA 4F7UE 4YRKA 4TWAA 4XU3A 4PJOG 2CJAA 5GAOl 2AMCB 4WI1A 4XTYA 4QVCA 3V8KA 3JCMd 3ICAA 1U1SA 4M77F 2E41A 4WJ3M 1YCYA 2Q5HA 2Y90A 3FB9A 4P72A 1YFRA 4XEOA 3JB9F 4M78A 3JCMb 3AHUA 3M4QA 4P3OA 1Z7MA 4RMFA 2C8MA 1NJ8A 3VBBA 4C92B 3JCMP 4H2UA 2Q5IA 1MGQA 3A5YA 2DQ0A 3HY0A 4C92C 3UH0A 3P8VA 2IY5A 4M77A 3IG2A 3G1ZA 1EQRA 3SB2A 2K57A 3PGGA 4M7AG 1N9RA 1E1OA 3JB9I 4EMKB 4CH6A 2DTIA 4M75B 4NOYA 3OD1A 4H2YA 1B76A 4G84A 4M75C 4XU1A 2Q7GA 4YRGA 1M5Q1 2DZCA 4HT9A 1GGMA 4EMHA 3FJPA 4P75C 1I8FA 4H2SA 4V2SA 4MMLA 4DQ2A 4M78E 3W3SA 4K87A 3WQZA 4YRSA 4YCWA 4NL2A 5LJ5f 2E10A 2HNIA 4BW9A 4AH6A 5C52B 3HRIA 4M77E 4PJOD 4UP8A 3JCMh 3A7AA 3VQXA 11ASA 3MF2A 3HXUA 2I4NA 1U1TA 1TH7A 4OLFA 1D3BA 1SESA 2YLCA 2ZT6A 1N9WA 1N9SA 4YRCA 2ARUA 5GAOn 2E1HA 1BBUA 4J15A 3E9HA 2ALYB 4K86A 3RKYA 1X54A 3JB9J 2ZNIA 2YHTA 2ZT8A 4YREA 1HK9A 4Y91A 1NJ1A 2PMFA 5GAMf 3JB9H 4XEMA 4P74C 4C8QB 4F7UB 4PJOF 2QHVA 1G5IA 1SRYA 3PCOA 3KFUA 4P3NA 4C8QC 4M7AD 1WPYA 1NJ2A 4TQFA 4YRRA 4YRQA 2Q7HA 3FIFA 2FB7A 3BY7A 4X9CA 2DU7A 4CH4A 1USYA 4QVDA 4M7DB 2RM4A 4P73C 4M7DC 1JJCB 2P0LA 3RACA 2FYKA 4PG3A 5E3IA 2I2LA 5LJ5g 3A7RA 2ZZGA 5C53B 3IKLA 2EL9A 4YCUA 4OP0A 3PZCA 2ODRC 4M78F 2I4OA 1X01A 4HWRA 1X56A 4M7AF 4H2XA 2EAYA 1EIYA 3BW1A 2DTHA 3NENA 2J3MA 1H4TA 4CS2A 2C7IA 5ELOA 1JBMA 5LJ5e 3BJUA 4YRLA 3QSUA 5GMKm 4TVAA 2DTOA 2Q7EA 3SWNB 3HRKA 4ZTZB 1M8VA 3V8LA 3SWNC 4PJOE 1RIQA 4M78B 3HTZA 3LSSA 4M7AA 5GAMg 3JCMX 4J6XA 4M78C 4MMKA 3VQVA 1KQ2A 5LJ5j 2AMCA 4HWTA 2RD1A 4H02A 4UP7A 1ASZA 2XGTA 2ARSA 4K88A 4M77B 4ZTUB 2CJBA 3A74A 1B34B 2E65A 4M77C 5GAMe 2RHQA 1NJ6A 5GANg 3GIBA 1YB3A 1ADJA 2I4LA 3IALA 5LJ5d 2E3CA 2ZZFA 4CH3A 3QO5A 2CGHA 3V7SA 1IL2A 5K1XA 1SERA 4PNOA 1ATIA 4H2VA 5GAN2 3HXYA 2DEQA 3L4GA 4N0AC 4M7AE 1HXDA 1VQZA 5GANe 3RIRA 3ERRA 4JRIA 4J6YA 5GAMj 4EMKA 1E1TA 3LC0A 5K1PA 12ASA 1B8AA 4C8QD 4C92G 5GAOm 2EWNA 2EJGA 1PYSA 1L0WA 4RQFA 3HY1A 3HXZA 3LSQA 3QO7A 1WQWA 4M75G 3HFZB 1D3BB 1B70B 4CS4A 5GAMd 5GANj 3DSQA 1X2HA 1BBWA 3RF1A 1Y96A 3REUA 2VC8A 5KNNA 4M7DD 4YRNA 4JRKA 2DJZA 4YRMA 4EO4A 1LYLA 4CH5A 4TVWA 1KMMA 3TEHB 5GMKe 4RQEA 2QHTA 1YGBA 5C51B 4PHCA 2J3LA 5GAN3 1B7YB 1LJOA 5GANd 2RHSB 2E64A 3RERA 3UGQA 5LJ5h 3HSBA 3HXWA 2QHUA 3I7FA 3JCMQ 4YPFA 5GAOp 3VQWA 1I81A 4J6WA 2AKWA 5I21A 5GANf 2I4MA 5GMKj 2EJFA 4P74A 2ZTGA 3BDUA 1QF6A 4WF2A 1KOGA 4C8QA 3TEGA 4PJOB 1X55A 1KQ1A 3V7RA 4PJOC 4HWSA 3VQYA 3EFRA 1WYDA 4P71C 4YCVA 3P8TA 4HWPA 2ZINA 4XTZA 4C92D 1EOVA 2ARTA 2ZZEA 4CS3A 4C8QG 3JCMW 1SETA 4F7UG 5GAMh 1WU7A 4P73A 4EX5A 1HC7A 4M7DA 4UPAA 3A5ZA 4YROA 1EFWA 2ZIMA 3EFSA 2DVEA 4M75D 1JJCA 3L1AA 1YFTA 4O2DA 4Q6GA 4ZIBA 3UFGA 5DY9A 4XQ3A 3TUPA 4HVCA 3HXXA 4C8QE 5LJ3g 3V7CA 2DQ3A 2VXEA 1E22A 4M7DG 4P72C 5GANh 2XTIA 1H4VB 1JRIA 1WNLA 3QUIA 4M7AB 3HFVA 1G51A 1W66A 4M7AC 3QO8A 4KR3A 4TTVA 1EVLA 3IKMB 4C92F 3MEYA 4NCXA 5GAOr 2JN0A 5GMKi 2VXFA 3NEMA 2IY5B 5LJ3e 4NL3A 4E51A 5GAN8 3SWNA 4M7DE 2ZNJA 3A7UA 4Q15A 4YRIA 2CJ9A 4M75F 2RHQB 4TVYA 4YYEA 3UGTA 2ZGWA 1X2GA 3QHSA 2ZXFA 1FYFA 4J5YA 4WJ4A 4A54A 3JCMf 5GAOq 4C92A 1YFSA 1Z7NA 2YLBA 5CAIA 1G5HA 1J5WA 4JLIA 2ZR2A 3L4GB 5GMKh 5LJ3j
chains in the Genus database with same CATH superfamily
2DILA 2LJ0A 1Q86U 4FT2A 1KD1C 4D8DA 3RMSA 3X25B 1LOJA 4P3PA 4H2TA 3PIOA 3CCSQ 4HA8A 4M75A 4FCYA 3M0RA 4A4GA 4EMKC 3OYLA 3REBB 3M54A 4KQEA 1GRIA 3PVLA 4KH0B 2A8EA 4M77G 2MK5A 1EZZB 3CBPA 3LGFA 1SSFA 2XDBA 5GAN7 3OYCA 3PMIA 2LT1A 1MMNA 4A53A 4L59A 4C92E 2P5IA 4LVIA 1BI0A 1Y96B 2KYBA 1VQ9A 1VQ7T 4RCCA 5GAN5 2KSSA 4FYWB 1E24A 3GOXA 3LLRA 2X4YA 4EPCA 5CCAA 2ODRD 3AT1B 4XU2A 3HFZA 5KYXB 2ZCEA 3MHXA 4Q5WA 1R8OB 5KCOA 2P4RA 1WQ7A 3OYHA 3I55Q 3THKA 3CCVQ 3QNEA 2R58A 3X24B 2AKWB 4E7JA 1AZGB 1QE0A 2OJ2A 1T3SA 3L2RA 5L8RE 2HQEA 3INZA 1YIJT 4RDXA 1SKUB 4M78D 3EGXB 4J9CA 3QO3A 1KC8R 2Y4XA 1S72Q 3A32A 3GF5A 1JJ2P 2KROA 3X26B 4L5GA 4ELYC 4KULA 4JZ4A 4H2XB 1EIYB 2GGRA 2K9GA 3CC7T 2RB6A 1VQPQ 1H4QA 4YP0A 2QA4T 3NELA 3JCMJ 3CD6Q 1K73R 2J06A 4ZN3A 1B7TA 4TVAB 2E5AA 4KR2A 1NBEB 3JB9D 3M55A 4P71A 1NYRA 3MJXA 3OS2A 1NPRA 3M4PA 3L2ZA 1YNZA 3M0SA 3G6EQ 3CCEA 4YRKA 3VKIA 4TWAA 2IVWA 2QYZA 4ZNXA 2CJAA 5GAOl 1QW1A 4E7KA 5EG2A 4PLIA 2XDDA 3CPFA 4AG2C 2JM8A 2V8IA 2LCSA 2LQNA 4ZN1A 3FB9A 4P72A 2DA9A 1D1BA 3HP9A 4M78A 1D09B 2E5KA 1TUCA 2W10A 4PLLA 2J6FA 1AWJA 2NUZA 3CCLQ 1KD1U 4P3OA 1AWOA 1MGQA 2DQ0A 3PTAA 2IY5A 3UATA 1AEYA 3SB2A 2DO3A 2BZ8A 3M53A 3FDRA 1OX9A 5LL6S 1E1OA 4EMKB 4CH6A 3T9NA 5D6XA 4G84A 2RMOA 3SD4A 4FSSA 1X6OA 3A8LB 4JS4A 2ZPIB 4HT9A 2MPXC 4KGXB 1W2BA 3EHRA 1VQ8T 2HKNA 3QPHA 4K87A 2ED1A 1YHQQ 4YRSA 1BU1A 4YCWA 2CZ7B 5KE2A 1M1GA 4R55A 1H92A 5KCHA 4AH6A 4HVWA 3VUZA 1QQJA 2ZZDA 3VQXA 2AZVA 3MF2A 4E7HA 1QWEA 1U1TA 2JTFA 1X69A 4OMMA 4ATOA 3CCRA 5IHKA 3QJ6A 2OAWA 2ALYB 4K86A 3CXCS 1IHVA 4LD9K 1VQMT 2JVVA 2QG9B 4Y91A 1PNJA 1NJ1A 1TU0B 1YJNT 4F7UB 4PJOF 2QHVA 1YJWT 1G5IA 4C8QC 5KYXA 3MEUA 1NJ2A 4TQFA 4YRRA 2XMFA 2I0NA 4YRQA 1BCMA 2CP5A 2FB7A 2DU7A 2VGMA 2LNVA 2FZGB 1USYA 1ZQ1A 4PL6A 1MV3A 2RM4A 1VQ4A 1KC8C 4M7DC 1JJCB 2EYWA 2FYKA 3EHQA 2OTLQ 2ZZGA 2FRYA 5C53B 5IN1A 1MMAA 1DJ7B 2L3PA 1LCKA 1X01A 1ZSZC 1K73C 4M7AF 2KXDA 4H2XA 1EIYA 2PZ1A 2RHZA 1PSFA 2P0KA 3NENA 3OW2A 4PJNA 4YRLA 3QSUA 2RI3A 4F04B 5GMKm 3CCST 4TVAA 2DTOA 1TWBA 1VQOQ 2O2OA 1VQ6A 3SWNB 2ZPFB 4BACA 1E6GA 1ZHIA 4DOWA 4AFQC 4PJOE 5C6SA 1OOTA 3MPUB 3E1SA 2HD0A 4J6XA 4MMKA 3VQVA 4E47A 5LJ5j 2ABLA 2RH2A 2YUPA 3I56A 4K88A 1KG1A 4M77B 1WGSA 1UHFA 1WLPB 2QI2A 2WSFE 4ZTUB 3G1JA 3A74A 1JU5C 3P8BB 5DLOA 5GAMe 2M51A 3LW5E 1M2VB 5GANg 4N4IA 4B9WA 1PHTA 1HYOA 1S1NA 3C0CA 2FEIA 4CH3A 5D7UA 5FWBA 3V7SA 1XNIA 5K1XA 3OS1A 4PNOA 5GAN2 4YTLA 2K2MA 4M7AE 1WJRA 1HXDA 3I55T 3CCVT 4EMKA 1E1TA 2F69A 3LC0A 5K1PA 2YRVA 2YUQA 4J7IA 2O31A 4C92G 1O75A 1D1CA 2EWNA 1PYSA 3QDRB 2FVUA 3OYYA 2XIDA 8AT1B 1S72T 3HRSA 2YDLA 2QDLA 3DSQA 2FPDA 1FYNA 1BBWA 3RR6A 5I2SA 2C06A 3REUA 1YITA 1VQPT 1HD3A 3CD6T 4IUPA 3A8HB 3TEHB 4E7SA 3OY9A 1MHNA 4FM4B 3GBQA 2J3LA 1N6AA 2AIRB 2KQWA 5HKCA 2CDTA 2E64A 3JRZA 3G6ET 3UGQA 3ASKA 3HXWA 1FMKA 1KC8U 3TREA 2EYYA 1UDLA 1M30A 4J6WA 3CCJQ 5I21A 2I4MA 5GMKj 4BI4A 1MNDA 3BDUA 1PSEA 4J7FA 2JNGA 2HQXA 4WF2A 3GPLA 1K73U 1QKWA 2L3SA 2EGEA 3QIIA 3MP6A 1X55A 3QJYA 4JPBW 1Q81R 3CCLT 4P71C 4J9EA 4XTZA 2D0NA 2HZYA 3OYMA 3OYAA 2B8AA 4P73A 4RTWA 4D8KA 3OMGA 2KI7A 3H0IA 1AVZC 2ZIMA 3QZ5B 1JJCA 4O2DA 4Q6GA 2DFUA 3UFGA 2QEXA 4J9FA 3TUPA 2IIMA 4IUVA 3UDCA 4C8QE 3NTIA 3V7CA 3MQZA 4P72C 2F5KA 1X27A 3EGUA 5IHNA 3EFOA 1YHQT 2X3XD 4NCXA 3NTHA 2D1XA 5KYNA 4PK4A 3PT9A 5LJ3e 2JXBA 2JM9A 3SWNA 4LUEA 4M7DE 3A7UA 4FYVB 2X51A 4Q15A 4M75F 4TVYA 3MEWA 4C0DB 2ZGWA 3S3NA 3DLMA 2YRCA 3X20B 2H8HA 2EQMA 4A54A 2QQ9A 2V8KA 3QZ9B 4KT0E 2RHUA 1J5WA 1NG2A 1G3YA 3QTCA 9ATCB 4IIMA 4H2WA 1M27C 4Z02A 4XU0A 4Z89A 1UHCA 3HRTA 2K3BA 1IRXA 4YRJA 4QW2A 2K3XA 1UG1A 1RAIB 1AWWA 4B9XA 1ADYA 1VYTA 3FRNA 2CH4A 1RABB 1H4SA 4X5OA 3REAB 4LVJA 3J80E 5GAN4 2HKQB 2QDYB 4R56A 5ELNA 3LWIA 2K2VA 4MDXA 2NUPB 5AYFA 2ZR3A 1XTDA 3H8ZA 1C0AA 1RADB 1IGQA 2K7AA 6AT1B 1M1KR 3MO8A 2ZT5A 4M75E 2OTLT 4G85A 3M59A 3P8YA 2VASA 3VU3C 3G4SQ 4KRTA 3PCOB 2ATCB 1VQKQ 3JCMV 2FHDA 1I4K1 4QQGA 5GMKl 2XICA 2ED0A 1UECA 3JCMc 5D6YA 3CXCA 2BKDN 3JCMg 5KYUB 4TQDA 4LVLA 3CCUA 3TEHA 1Y71A 2RK2A 1RAGB 1NLPC 4FW2A 1VQOT 4PFZA 1USYC 2K3YA 1ARKA 2RHYA 2LJ3A 2EYZA 4OB0B 3HXVA 3RKWA 3RESA 3RUXA 4P5NA 2FZKB 2QTXA 1RAHB 2DM1A 4L87A 2JMCA 1ZUYA 1VQ5Q 4XTVA 1D1AA 4CC7A 3NTKA 3CMQA 2PMEA 3MF1A 4HT4A 2V26A 2GTJA 1ASYA 4HVVA 1Q81C 1ZA2B 5CK9A 2ZT7A 1V1CA 3TVTA 2QHSA 2FZCB 4YDQA 1IGUA 2PUOB 3NPFA 5CKHA 2VVKA 4FU6A 4OMPA 1BIBA 3VRYA 4LNSA 4R0KA 3ER0A 2A0FB 2V1QA 4XU3A 3CMEA 1QP3A 2DJQA 2C0OA 4PJOG 3G71Q 4WI1A 4XTYA 1CKBA 2CZ1B 3ICAA 2RK1A 4LE9A 1XOVA 4WJ3M 1YCYA 2Q5HA 2Y90A 3EG1A 2DF6A 1VOMA 2GQIA 3JB9F 3EGDB 3AHUA 2JOYA 3M4QA 1Z7MA 4N4HA 3CBOA 4RMFA 4C92B 1YI2A 2DL5A 3EG2A 2KDSA 1AOJA 4H2UA 2Q5IA 2IG0A 3E9GA 2F1LA 3VV0A 1IXDA 1ZBXA 3CCMA 2KRNA 4M7AG 2VWFA 4PJLA 3JB9I 3TSZA 4M4ZA 2QASA 3L2VA 2E6NA 4FIBA 3SHWA 1QCNA 1MMGA 2DZCA 2LNHB 1PC0A 3I56Q 1I8FA 1RI0A 4H2SA 1NJIC 1R0BG 4MMLA 4DQ2A 4M78E 2LVMA 4JJBA 4A4HA 3WQZA 2LCCA 1N5ZA 2DL4A 3CCJT 2E10A 4OB1B 2AT1B 2COWA 3OS0A 4BW9A 2L2PA 2JTMA 2J6KA 4BD3A 11ASA 4XK8E 2J7IA 2GCXA 3GNGA 2ENMA 2M16A 3HXUA 2MMPA 3U23A 4OMQA 2K4YA 1D3BA 1QWFA 3M57A 2ZT6A 1N9WA 2R57A 1VQLQ 5GAOn 1YN8A 2E1HA 1M1KC 1C0MA 2L8DA 3UT1A 3O8VA 2NUPA 4ZTJA 2EW3A 1Q95G 2AHJB 1HK9A 2CP0A 5GAMf 1YJ9Q 1M2OA 4L6V5 1VQ7A 4RTYA 3PCOA 3QKJA 4P3NA 2P84A 1JXOA 2CZ6B 1Q81U 1TUGB 1AZEA 4Z88A 2PNIA 1M3BA 2Q7HA 3FIFA 2DERA 5HK0A 1KJWA 1X6BA 1U3OA 4JJDA 2NUTB 2PQWA 1KFZA 1PKSA 2O4XB 4P73C 3OYGA 1G5VA 2P0LA 5CR2A 2BUDA 2I2LA 5LJ5g 3A7RA 2A37A 2HAXA 3IKLA 1Y0MA 2WSCE 4KGVB 3C95A 2QXFA 2I4OA 1YIJA 2LCLA 4HWRA 1X56A 2RJDA 5FU6B 3R6NA 4FYYB 2H3JA 4BB7A 1OV3A 3M5AA 3QWXX 3L2QA 1K0XA 1KHCA 2C7IA 5ELOA 4C5GA 3BJUA 3EH2A 3I9QA 3TU4K 1W2BP 2CREA 3LGLA 4BY6B 3CC7A 2COZA 4EDUA 2QA4A 2KXCA 3V8LA 1RAAB 2KGTA 3SWNC 1RIQA 3OBYA 3M0PA 1YCSB 2A7YA 2D0QB 2E70A 2QQAA 1Q82R 3LH0A 3SFMA 4H02A 2DMOA 4X34A 4UC4A 2L89A 2DVJA 2LTOA 2M0OA 3WVEB 4CC4B 2D6FA 2ARSA 2QQBA 2CJBA 1WHJA 1B34B 4KBMB 1NJIU 1BB9A 4M77C 2CT3A 2RHQA 1YB3A 1T0JA 2E3CA 3M56A 3G4ST 4HCZA 2KVQG 1QP2A 1IL2A 1VQKT 1SERA 1TTHB 1UE9A 1ATIA 4H2VA 3DB3A 1GCPA 3L4GA 2MI6A 1VQZA 1G3TA 5GANe 1OPKA 4J6YA 12ASA 1B8AA 4GLKA 1I0CA 1OZ2A 3OSSC 3TQ7P 1CKAA 2EJGA 4RQFA 2VKNA 1WHLA 3J81E 3HY1A 1M1KU 1K8AR 2NWMA 4LNPA 4DEYA 2KT8A 4DBHA 2HSEB 1D0YA 3LH5A 3A8GB 4M75G 3VYGA 1OQKA 5GAMd 1VQ5T 1X2HA 1Y96A 5KNNA 1VQ8A 2LT4A 4FYXB 5CO7A 3EG0A 1FX7A 2RQRA 3H0HA 2QHTA 4TVRA 3MCAB 1YGBA 2LMJA 1TXQA 5GAN3 1B7YB 2RHSB 3OW2P 1H3ZA 3CC2Q 2G3RA 2EQKA 4C5IA 4HKEA 3VS0A 3HSBA 2EQJA 3JCMQ 2QQSA 5KE3A 3OYEA 1YWPA 3A98A 3G71T 2QGFB 2AKWA 2GFUA 4P74A 4QQ6A 4BDYA 1WHKA 3ZL7C 4DBQA 3TEGA 3KFVA 2VYTA 4B6MA 4PJOB 2LP5A 2E5QA 1NPPA 3EGXA 3I5RA 2KK4A 2L3QA 3VQYA 1BI1A 1WYDA 4YCVA 4RG8A 3P8TA 1NZ9A 4OB3B 1YJNA 1EOVA 2PUKB 2ZZEA 3CMAQ 2RHXA 3H6ZA 4DOVA 1G3SA 1TS9A 5GAMh 1Y07A 2O4XA 4YROA 4RTZA 1QVGS 2OX7A 1YFTA 2FL7A 1GCQA 1SHFA 3A8OB 5IH2A 5DY9A 4XQ3A 4AT1B 4HVCA 1UJ0A 2DQ3A 2XTIA 3QDFA 3QUIA 4M7AB 3HFVA 1C6VX 3CC4A 3QO8A 1F1BB 1K76A 4X1VA 3IKMB 3MEYA 4RTUA 2JN0A 4CRIA 2JZ2A 1E6HA 3NEMA 2E12A 5GAN8 4YRIA 1Q82C 3CPWS 1VQNQ 3CCSA 4C0DC 4J5YA 5A0GA 4WJ4A 4RKUE 5GAOq 4ZTFA 1YFSA 1Z7NA 1KQSS 1FWZA 2YLBA 3EG9B 4JLIA 1VQLT 1HJDA 1SPKA 4M78G 1B34A 1PRMC 2PTKA 2EYQA 5CKFA 1WXBA 1YJ9T 2HDAA 1JQQA 4DEXA 5A0DA 1M4ZA 4PJMA 4RCBA 2HSPA 5LJ3d 4WCIA 3R07A 1PD0A 3ZBDA 3NETA 2KY9A 2DD5A 4CC3A 3JB9G 3PFSA 1UEBA 2K6DA 1NNHA 1K8AC 1QKXA 1WLEA 5KYYB 3VJPA 3I55A 4QQDA 3CCVA 2DK3A 4DBRA 3VS2A 1UGVA 4C8QF 5HGQA 5KYWB 4YRTA 1VQ9Q 2P0QA 4ELZC 2DD4A 2RI2A 2V8JA 3MP8A 2MIOA 1QMCA 4JLGA 4C5EA 3LX7A 2M0YA 1S72A 2ALYA 3M4GA 4FSXA 4HWOA 2H3EB 5CQYA 3QG1A 3PNWC 4M7DF 2XK0A 1GBQA 1B7YA 4IURA 2BE9B 1VQPA 2RHSA 1LNXA 4F7UA 4ORZA 5FRMA 1I07A 1ZX6A 4HT8A 4LUDA 1AHJB 2G4CA 2GTOA 3JCMe 1D0ZA 3OB9A 5LJ3h 1EVKA 3MEVA 2MAMA 5J26A 2Z0WA 5IXBA 3G6EA 4M77D 2EQUA 1K1ZA 3OYIA 1NLOC 3BFMA 4E7LA 4DA4A 2MOXA 3PVQA 3RGLA 4PJOA 4BWAA 1H3HA 4EMGA 5GAN6 2DKGA 4J83A 5F5WA 2X4XA 2O9VA 1NYGA 3F70A 1CSKA 5CKEA 4IKFA 3HFNA 1TG0A 2NYSA 3QYHB 4XTXA 2DIQA 2HCKA 3EAEA 1D0XA 2CSIA 3HHTB 5CIUA 1Q82U 5J39A 2OTJA 2AMCB 1WI7A 1IO6A 4FW1A 1YBYA 4QVCA 1W6XA 5DM7R 5EC7A 2RQWA 2E41A 1JO8A 1X2QA 3WVDB 1A0NB 2RJCA 3D7SB 3CCEQ 4LVMA 1JJ2S 1MMDA 1YFRA 4XEOA 3JCMb 2X35A 3C4SA 4JZ3A 4OMLA 1X6GA 2DRMA 2AK5A 3GLXA 1NJ8A 3VBBA 3JCMP 3HY0A 1QVFP 4C92C 3UH0A 3P8VA 4M77A 2QA4Q 3SDZA 1NJIR 2XD0A 1BI3A 1N9RA 1ZBJA 1YHQA 5HK3A 4NOYA 4M75B 3OD1A 1M2VA 4AMCA 2FPEA 3CQTA 5FROA 2Q7GA 1M5Q1 3CXCP 4BDZA 4EMHA 3FJPA 4P75C 3CC2T 4HCKA 1PWTA 4AFUC 1JB0E 3EG9A 3P8DA 1K8AU 2HQHA 1B3QA 2CYZB 3EG3A 2RO0A 1LPLA 3W3SA 3OQ5A 3OSVA 4LXCA 4NL2A 2B86A 2OI3A 4J9DA 1X2KA 4C0FA 5HCKA 1BBZA 1FMVA 4KH1B 4FL6A 3LWHA 3HRIA 2CP3A 2YWWA 3VRZA 4K11A 3A7AA 2I4NA 2MWPA 3X28B 1SHGA 5FU7B 2DL8A 4OMOA 3CMAT 3OBWA 1Y7XA 2PVGB 3OYBA 2ARUA 3GNFB 2F2VA 3MEAA 2RJFA 1BBUA 4OMNA 3E9HA 3RKYA 1R0CB 1X54A 4LDXA 1BKBA 2PMFA 3JB9H 5AT1B 4XEMA 1TOVA 4P74C 2KT1A 1OU8A 1RAFB 3KFUA 1SRYA 3BDLA 5D6WA 2XDPA 2VUBA 4LDYA 3CCRQ 3L2WA 3C94A 2KBTA 1AT1B 2OTLA 1K9AA 4O6JA 2L3RA 2EPDA 4X9CA 4CH4A 2HL3A 3TSWA 1SG5A 3A5ZB 2F5TX 2XHCA 3HPWA 1M90R 3CEYA 4PFOA 2X3WD 2KMTA 4PG3A 2M02A 1RACB 2X4JA 1VQNT 4C0ZA 2EL9A 1GCQC 3FLGA 1VQOA 4RUGA 2ZPGB 3UF4A 2D8JA 4M78F 2CP7A 3NGPA 2R5AA 3H0FA 4E2FB 2BZXA 3CCQA 3BW1A 2DTHA 4E7IA 1VQ4Q 4FT4A 4A4KA 1QVGA 5FU6C 5LJ5e 4JDSA 1Q7YC 4F14A 1OZ3A 1SEMA 1J3TA 1RAEB 2Q7EA 2DE0X 3TCJA 1P92A 3HRKA 4ZTZB 1M8VA 3Q1JA 4BY6C 3JAME 2BTTA 4HCBA 4J9BA 2LQ8A 4M78B 2O88A 3LSSA 3ME9A 1GFCA 1WA7A 1VYUA 1KQ2A 2AMCA 2RD1A 3HL8A 1FMWA 1VQ6Q 1ASZA 2K79A 2XGTA 2KRMA 2CUDA 3M0QA 3JV3A 4A4FA 1SRMA 3CPWA 1QCFA 1OPLA 1NJ6A 1UFFA 3GIBA 1K0SA 1V29B 4LVKA 2E3IA 1OU9A 1ADJA 3CC4Q 4BI8B 2I4LA 1GL5A 3A1PA 1MUZA 4ME7A 3PMTA 1KQSA 3QO5A 2CGHA 1ZLMA 3BE3A 4WTOB 1EX4A 1VQ9T 3OYJA 1BYMA 2DEQA 3G7ZA 3NFCA 1PD1A 1ZA1B 4J8OA 2F2WA 4QT7A 4OB2B 3RIRA 2VV5A 2CZ0B 5GAMj 4RTVA 1IREB 5A0LA 2E6ZA 4MZTA 2JT4A 4MDWA 1O9SA 2EQIA 2FPFA 4LDWA 2ESWA 2MWOA 5CQXA 3OYFA 2EGAA 2KAFA 3HXZA 3LSQA 3RMQA 3QO7A 5M9OA 2KR3A 1B70B 1ABOA 4F16A 1SSHA 4A63B 2VC8A 2DJZA 2F2XA 4YRMA 1EIFA 3E19A 1LYLA 4TVWA 7AT1B 1KMMA 5GMKe 1RL2A 2SRCA 4EIKA 3CCJA 4PHCA 2K5LA 2XKOC 1LJOA 5GANd 2PVDB 1VA7A 2KNBB 1YITQ 2CS7A 3OYKA 3I7FA 4PJJA 5GAOp 2ROLA 2FG0A 5DLQE 5KYUA 1I81A 3WXMB 3VS7A 2LX9A 2A3LA 2A08A 3VYHB 4GY5A 3HKSA 1IHWA 1QF6A 2CP2A 3CCET 2JS0A 2EIFA 1KK7A 4PJOC 1Q7YU 3EFRA 2DYIA 4HWPA 4C92D 3R6OA 4NS5A 3VS1A 5CVIA 2ARTA 3QBYA 1Z9ZA 3VS3A 4CS3A 4C8QG 1SETA 1WU7A 1M90C 1Y57A 4EX5A 3A5ZA 4II1A 1IB8A 2DVEA 3L1AA 3HRUA 4ZIBA 1RUWA 5ECAA 4OMFB 1W70A 1VYVA 2VXEA 4M7DG 5GANh 1WNLA 2RJEA 2YUOA 2GBQA 4M7AC 4KR3A 4D6WA 5GMKi 2W0ZA 2QEXQ 3SEMA 4O5VA 4E51A 1JJ2A 1OYXA 1WZOA 2ZNJA 1WYXA 2RNAA 2CJ9A 4OGCA 2HMAA 4KUDK 2GFAA 3EGDA 2OTJQ 2YRDA 1G3WA 2HL5C 1NEGA 2COYA 2P0PA 1WX6A 3JCMf 4C92A 3MP1A 1NYFA 5CAIA 2ZR2A 1G83A 3UPUA 5LJ3j 2JUFA 5C0MA 4JUVA 4UP9A 3NMZC 2DXTA 2V1RA 2DXUA 2QAZA 3RL6A 4P75A 3V8JA 3UA7A 1PYSB 3L42A 2CIMA 4DPGA 4BE2A 1I5LA 4N0AA 2DYBA 3CCRT 4YRFA 3QYGB 1R77A 1NEBA 2LRQA 4PFPA 2RN8A 2BZYA 1QVPA 1PRLC 2QTVA 3M0UA 3G4SA 2FRWA 1QLYA 2XG8D 1VQKA 4IUQA 5A2QE 2EBPA 1KIKA 1I1JA 5LJ3f 4J9IA 2RHIA 1PCXA 2P4TA 2RA2A 3REXA 1WHGA 1K9MR 2DDZA 1M3AA 1QVFS 1X75C 3LYIA 1N8RR 5HY6A 1TUDA 4F7UF 2DXBA 4ANJA 1XJWB 1B70A 1OULA 3FC3A 1K4US 3N5BB 2A28A 1H641 4X9DA 1NJ5A 3ULRB 2DZ9A 1VQ4T 1HTTA 1V76A 2LDMA 2QK0A 2XI9A 1VQ5A 4JJNK 1YWOA 1M8MA 1OI1A 4XTUA 2DNUA 2HBPA 1M90U 2ZIOA 4YRPA 1KMNA 2ZPBB 3KXTA 1VQMA 2QGGA 4XTWA 1BIAA 2LJ1A 3A31A 5CKBA 1UB4A 3CCUQ 1BCOA 2AZSA 3HFOA 3QWYA 2EJ9A 3E9IA 2DU5A 2R5MA 1YJWA 1UGRB 2LC4A 4E6RA 1VQ6T 2CSQA 5CKDA 4C0GA 1VUBA 2NUTA 1KSWA 3HTRA 3RKXA 3G71A 1BK2A 3CC4T 5IHIA 2MF2A 2L0AA 5I11A 1UUEA 1G2BA 1NYQA 4F7UE 2EKHA 1T3LA 2M9UA 3I56T 2JTEA 2RI5A 2YUNA 1AWXA 1NE8A 3EFOB 2RQTA 4DBFA 3V8KA 2DRKA 1U8RA 3JCMd 3P8HA 1U1SA 4M77F 4QKUA 2FO0A 1VIEA 3VS6A 1IZ6A 1JXMA 1HSQA 3META 1PKTA 3CMEQ 3CCQQ 2WACA 1WXUA 4AFZC 2X4WA 4Y28E 2C8MA 1B07A 3PIPA 3A5YA 1OX8A 3IG2A 1H8KA 3G1ZA 1EQRA 4CC2A 3VS5A 2K57A 3PGGA 2RF0A 2OAUA 2DTIA 4H2YA 1B76A 1MV0B 2JW4A 1OEBA 3S3OA 1SRLA 4M75C 4XU1A 4BUGA 1YI2Q 4YRGA 2PVOB 1GGMA 3RNJA 1M3CA 4ZGDB 1YITT 4IUTA 3TEEA 4V2SA 3CCMQ 1GFDA 4VUBA 4GBQA 2CKKA 1ABQA 4KGZB 3UWNA 1Q86R 3MKDA 3E9FA 1RI9A 1UJYA 5LJ5f 4A4EA 2LX7A 2EYXA 2HNIA 2O9SA 2D9TA 4OGEA 1NM7A 1VQLA 5C52B 3E2UA 4M77E 4LD6A 5GJVB 4Z8AA 2WSEE 4JRPA 2VGNA 3JCMh 4PJOD 4UP8A 1EFNA 1C1AA 5FRNA 2MCNA 3URGA 8ATCB 4ZGEB 3DB4A 4OVAA 1LVKA 1TH7A 1M9SA 4OLFA 1YJ9A 1SESA 1WJQA 2YLCA 1N9SA 1ZUUA 4YRCA 2DEUA 5FU7C 4J15A 2ZPHB 1M1FA 1BI2A 1K9MC 3DLLA 1YFNA 2C0IA 1FXXA 2LQKA 3JB9J 1N8RC 2ZNIA 2YHTA 2ZT8A 4YREA 4C8QB 3RDVA 1UGQB 3EH1A 2SEMA 3CD6A 2DPPB 4M7AD 3KUFA 5I2MA 2J05A 2DLPA 1WPYA 5GJWB 4F17A 1ZUKA 3BY7A 2QEXT 2RQUA 4QVDA 1VQ7Q 3C12A 4M7DB 5IAYA 1W1FA 2AKLA 2C0TA 1WFWA 3RACA 5E3IA 3UA6A 1Q7YR 3S6WA 2OTJT 2YSQA 3GP8A 4YCUA 4OP0A 3PZCA 1ZSZB 1PM3A 5J3BA 4RTXA 2G6FX 2ODRC 1N27A 3M4YA 2EAYA 3I5SA 2QQRA 2J3MA 1H4TA 4CS2A 4LN2A 2EKOA 1AD5A 3CCLA 1JBMA 2J6OA 2PU9B 2AKKA 4XAXB 1WHHA 2EFIA 1WHMA 2M1HA 1YIJQ 5IT9E 4GLMA 2BE7D 5IXFA 1U06A 2DX1A 3HTZA 4M7AA 4JRQA 3VUBA 5GAMg 2DXCA 1UGSB 3JCMX 4M78C 1W4SA 2XU8A 4HWTA 2Y4YA 2E4HA 4BI3A 1WIEA 4UP7A 4OF1A 3FJ5A 3QXEB 3CC7Q 4QVZA 2A36A 1Z9QA 2RPNA 3JSCA 2E65A 4IUUA 3S3MA 2KRSA 3OYDA 4MZMA 4ESRA 1KD1R 2E3HA 3IALA 3M0TA 5LJ5d 2CT4A 2ZZFA 1GBRA 5L23A 1SF9A 2GNCA 1E7OA 4AG1C 3HXYA 2D8HA 4N0AC 1W2BS 1MNEA 4JJCA 4KUIA 2KEAA 2CUBA 2EGCA 4RMOA 4HVUA 3ERRA 4JRIA 2DL7A 4BE0A 4LDVA 2YXYA 4BE1A 4C8QD 5GAOm 3H41A 2DIGA 1VIFA 2DAQA 1L0WA 1XQHA 4RG2A 3CBMA 1Q86C 2DBMA 3H9NA 1K9MU 1RLPC 3OS5A 1WQWA 1N8RU 1JEGA 3CCUT 1D3BB 3HFZB 4CS4A 5GANj 1G8XA 3RF1A 4AFSC 3CC2A 2RQVA 4ZGJB 3L2UA 4M7DD 4YRNA 4JRKA 3ZFJA 3J7AF 2KE9A 4EO4A 4CH5A 5KYYA 1QVFA 4RQEA 4J9HA 2K5IA 2JS2A 3NHNA 5C51B 1ZSGA 5I22A 4PKCC 2L5QA 1GXIE 1QVGP 2MYSA 1YP5A 2NS6A 3RERA 5KYWA 1VQ8Q 5LJ5h 2EVRA 3OYNA 1ACMB 3ZEHA 1QCOA 4J9GA 3FEOA 5FLXE 2QHUA 4YPFA 5KH6A 3VQWA 4Y92A 3RBBB 2ZCFB 5GANf 4IIOA 2EJFA 3CMAA 2ZTGA 1TSFA 1KOGA 1UGPB 4C8QA 2CH4W 1KQ1A 3CMET 3CCQT 3V7RA 4HWSA 2LQWA 3A8MB 2HEQA 2ROTA 3PE0A 2ZINA 2LZ6B 4HCCA 3O5ZA 3CPWP 2YT6A 2K5FA 2NLUA 2JMAA 3JCMW 4F7UG 2DETA 1HC7A 4M7DA 4UPAA 1WDXA 2IPOB 1EFWA 3OW2S 2ZAEA 1KQSP 3M58A 3EFSA 4M75D 1VQMQ 1UTIA 1YJNQ 1T0HA 1YI2T 1WXTA 2ZPEB 4MZPA 3HXXA 5LJ3g 1ZSZA 2ECZA 2HBWA 1YJWQ 4HXJA 2VB6A 1E22A 1PG5B 1H4VB 1JRIA 3CCMT 2GF7A 4RTTA 1G51A 3IQLA 1W66A 1VQNA 3DKMA 1X43A 4LDUA 4TTVA 1EVLA 4C5HA 4C92F 5FW9A 3KBGA 4JS5A 1WJSA 2DL3A 2O01E 5GAOr 4E7ZA 1U5SA 2GQVA 2VXFA 1I5OB 3M9QA 2KYMA 2IY5B 4NL3A 1KHIA 4CI0C 3OMCA 2RHQB 3I35A 2BIVA 4YYEA 3UGTA 1X2GA 3QHSA 2ZXFA 2DBKA 2X9HA 1FYFA 5FWCA 3VS4A 2CP6A 1RLQC 3OA6A 1G5HA 4N4GA 3L4GB 5GMKh 2JJ9A
chains in the Genus database with same CATH topology
1Q86U 1KD1C 4FT2A 3RMSA 3X25B 1LOJA 4P3PA 4H2TA 3PIOA 4HA8A 4M75A 4A4GA 4EMKC 3OYLA 4KQEA 3M54A 2A8EA 4M77G 3CBPA 3LGFA 1SSFA 2XDBA 5GAN7 3OYCA 3PMIA 2LT1A 4A53A 4L59A 4C92E 2P5IA 4LVIA 1BI0A 1Y96B 1VQ9A 1VQ7T 4RCCA 5GAN5 2KSSA 1E24A 3GOXA 3LLRA 2X4YA 4EPCA 5CCAA 2ODRD 4XU2A 3HFZA 2ZCEA 3MHXA 4Q5WA 1R8OB 5KCOA 1WQ7A 3OYHA 3QNEA 2R58A 3X24B 2AKWB 4E7JA 1QE0A 3L2RA 5L8RE 2HQEA 3INZA 1YIJT 4RDXA 4M78D 3QO3A 2Y4XA 3A32A 3GF5A 3X26B 4L5GA 4ELYC 4KULA 4H2XB 1EIYB 3CC7T 2RB6A 1H4QA 4YP0A 2QA4T 3NELA 3JCMJ 4ZN3A 4TVAB 2E5AA 4KR2A 3JB9D 3M55A 4P71A 1NYRA 3OS2A 1NPRA 3M4PA 3L2ZA 3CCEA 4YRKA 3VKIA 4TWAA 2IVWA 2CJAA 5GAOl 1QW1A 4E7KA 5EG2A 4PLIA 2XDDA 3CPFA 2V8IA 4ZN1A 3FB9A 4P72A 3HP9A 4M78A 1KD1U 4PLLA 4P3OA 1MGQA 2DQ0A 3PTAA 2IY5A 3SB2A 2DO3A 3M53A 3FDRA 5LL6S 1E1OA 4EMKB 4CH6A 3T9NA 5D6XA 4G84A 3SD4A 1X6OA 3A8LB 4JS4A 2ZPIB 4HT9A 1W2BA 1VQ8T 3QPHA 4K87A 4YRSA 4YCWA 2CZ7B 5KE2A 1M1GA 4R55A 5KCHA 4AH6A 3VUZA 2ZZDA 3VQXA 3MF2A 4E7HA 1U1TA 2JTFA 4ATOA 3CCRA 3QJ6A 2ALYB 4K86A 3CXCS 4LD9K 1VQMT 2JVVA 4Y91A 1NJ1A 1YJNT 4F7UB 4PJOF 2QHVA 1YJWT 1G5IA 4C8QC 3MEUA 1NJ2A 4TQFA 4YRRA 4YRQA 2FB7A 2DU7A 2VGMA 2LNVA 1USYA 1ZQ1A 4PL6A 2RM4A 1VQ4A 1KC8C 4M7DC 1JJCB 2FYKA 2ZZGA 5C53B 5IN1A 1DJ7B 1X01A 1K73C 4M7AF 4H2XA 1EIYA 2RHZA 1PSFA 2P0KA 3NENA 3OW2A 4YRLA 3QSUA 2RI3A 5GMKm 3CCST 4TVAA 2DTOA 1VQ6A 3SWNB 2ZPFB 4BACA 1ZHIA 4DOWA 4PJOE 5C6SA 3E1SA 2HD0A 4J6XA 4MMKA 3VQVA 4E47A 5LJ5j 2RH2A 3I56A 4K88A 1KG1A 1WGSA 2QI2A 4M77B 2WSFE 4ZTUB 3A74A 3P8BB 5DLOA 5GAMe 3LW5E 5GANg 4N4IA 4B9WA 4CH3A 3V7SA 1XNIA 5K1XA 3OS1A 4PNOA 5GAN2 4YTLA 4M7AE 1WJRA 1HXDA 3I55T 3CCVT 4EMKA 1E1TA 2F69A 3LC0A 5K1PA 2YRVA 4J7IA 4C92G 1O75A 2EWNA 1PYSA 3QDRB 2FVUA 3OYYA 2XIDA 1S72T 3HRSA 3DSQA 1BBWA 5I2SA 2C06A 3REUA 1YITA 1VQPT 3CD6T 4IUPA 3A8HB 3TEHB 3OY9A 1MHNA 4FM4B 2J3LA 1N6AA 2KQWA 5HKCA 2E64A 3JRZA 3G6ET 3UGQA 3ASKA 3HXWA 1KC8U 3TREA 4J6WA 5I21A 2I4MA 5GMKj 4BI4A 3BDUA 1PSEA 4J7FA 2JNGA 2HQXA 4WF2A 3GPLA 1K73U 3QIIA 3MP6A 1X55A 3QJYA 3CCLT 4P71C 4XTZA 3OYMA 3OYAA 2B8AA 4P73A 3OMGA 2ZIMA 3QZ5B 1JJCA 4O2DA 4Q6GA 3UFGA 2QEXA 3TUPA 4IUVA 3UDCA 4C8QE 3NTIA 3V7CA 3MQZA 4P72C 2F5KA 1YHQT 4NCXA 3NTHA 3PT9A 5LJ3e 3SWNA 4M7DE 3A7UA 4Q15A 4M75F 4TVYA 3MEWA 4C0DB 2ZGWA 3S3NA 3DLMA 3X20B 2EQMA 4A54A 2QQ9A 2V8KA 3QZ9B 4KT0E 2RHUA 1J5WA 1G3YA 3QTCA 4H2WA 4Z02A 4XU0A 3HRTA 4YRJA 4QW2A 2K3XA 4B9XA 1ADYA 3FRNA 1H4SA 4X5OA 4LVJA 3J80E 5GAN4 2QDYB 4R56A 5ELNA 3LWIA 2K2VA 4MDXA 5AYFA 2ZR3A 1XTDA 3H8ZA 1C0AA 3MO8A 2ZT5A 4M75E 2OTLT 4G85A 3M59A 3P8YA 3VU3C 3PCOB 3JCMV 2FHDA 1I4K1 4QQGA 5GMKl 2XICA 3JCMc 5D6YA 3CXCA 2BKDN 3JCMg 4TQDA 4LVLA 3CCUA 3TEHA 1Y71A 2RK2A 1VQOT 1USYC 2K3YA 2RHYA 4OB0B 3HXVA 3RKWA 3RESA 3RUXA 4P5NA 2QTXA 4L87A 4XTVA 3NTKA 3CMQA 2PMEA 3MF1A 4HT4A 1ASYA 1Q81C 2ZT7A 5CK9A 4YDQA 2QHSA 2PUOB 5CKHA 4FU6A 1BIBA 4LNSA 3ER0A 4XU3A 3CMEA 1QP3A 4PJOG 4WI1A 4XTYA 2CZ1B 3ICAA 2RK1A 1XOVA 4WJ3M 1YCYA 2Q5HA 2Y90A 3JB9F 3AHUA 2JOYA 3M4QA 1Z7MA 4N4HA 3CBOA 4RMFA 4C92B 1YI2A 2KDSA 4H2UA 2Q5IA 2IG0A 3E9GA 3VV0A 1ZBXA 3CCMA 4M7AG 3JB9I 3L2VA 2E6NA 4FIBA 2DZCA 1I8FA 1RI0A 4H2SA 1NJIC 4MMLA 4DQ2A 4M78E 2LVMA 4A4HA 3WQZA 2LCCA 3CCJT 2E10A 4OB1B 4BW9A 3OS0A 2JTMA 4BD3A 11ASA 4XK8E 2GCXA 3GNGA 2M16A 3HXUA 2MMPA 2K4YA 1D3BA 3M57A 2ZT6A 1N9WA 2R57A 5GAOn 2E1HA 1M1KC 2L8DA 3UT1A 3O8VA 4ZTJA 2AHJB 1HK9A 5GAMf 4L6V5 1VQ7A 3PCOA 3QKJA 4P3NA 2CZ6B 1Q81U 2Q7HA 3FIFA 5HK0A 2PQWA 2O4XB 4P73C 3OYGA 1G5VA 2P0LA 5CR2A 2BUDA 2I2LA 5LJ5g 3A7RA 2HAXA 3IKLA 2WSCE 3C95A 2QXFA 2I4OA 1YIJA 2LCLA 4HWRA 1X56A 2RJDA 5FU6B 2H3JA 4BB7A 3M5AA 3L2QA 2C7IA 1KHCA 5ELOA 4C5GA 3BJUA 3TU4K 3LGLA 4BY6B 3CC7A 4EDUA 2QA4A 3V8LA 3SWNC 1RIQA 3OBYA 2A7YA 2D0QB 2E70A 2QQAA 3LH0A 3SFMA 4H02A 4X34A 4UC4A 2L89A 3WVEB 2LTOA 2M0OA 2D6FA 2ARSA 2QQBA 2CJBA 1B34B 4KBMB 1NJIU 4M77C 2RHQA 1YB3A 2E3CA 3M56A 3G4ST 4HCZA 2KVQG 1QP2A 1IL2A 1VQKT 1SERA 4H2VA 1ATIA 3DB3A 3L4GA 2MI6A 1VQZA 1G3TA 5GANe 4J6YA 12ASA 1B8AA 4GLKA 1OZ2A 3OSSC 2EJGA 4RQFA 3J81E 3HY1A 1M1KU 3A8GB 4M75G 3VYGA 1VQ5T 5GAMd 1X2HA 1Y96A 5KNNA 1VQ8A 2LT4A 5CO7A 1FX7A 2QHTA 4TVRA 3MCAB 1YGBA 5GAN3 1B7YB 2RHSB 1H3ZA 2G3RA 2EQKA 4C5IA 4HKEA 3HSBA 2EQJA 3JCMQ 2QQSA 5KE3A 3OYEA 3G71T 2AKWA 2GFUA 4P74A 4QQ6A 4BDYA 3TEGA 2VYTA 4PJOB 2E5QA 1NPPA 2KK4A 3VQYA 1BI1A 1WYDA 4YCVA 4RG8A 3P8TA 1NZ9A 4OB3B 1YJNA 1EOVA 2PUKB 2ZZEA 2RHXA 3H6ZA 4DOVA 1G3SA 5GAMh 1Y07A 2O4XA 4YROA 1QVGS 1YFTA 2FL7A 3A8OB 5DY9A 4XQ3A 4HVCA 2DQ3A 2XTIA 3QUIA 4M7AB 3HFVA 3CC4A 3QO8A 3IKMB 3MEYA 2JN0A 4CRIA 2JZ2A 3NEMA 2E12A 5GAN8 4YRIA 1Q82C 3CPWS 3CCSA 4C0DC 4J5YA 5A0GA 4WJ4A 4RKUE 5GAOq 4ZTFA 1YFSA 1Z7NA 1KQSS 1FWZA 2YLBA 4JLIA 1VQLT 4M78G 1B34A 2EYQA 5CKFA 1YJ9T 5A0DA 1M4ZA 4RCBA 5LJ3d 3R07A 3ZBDA 3NETA 2KY9A 2DD5A 3JB9G 3PFSA 1UEBA 1NNHA 1K8AC 1WLEA 3VJPA 3I55A 4QQDA 3CCVA 2DK3A 4C8QF 5HGQA 4YRTA 2P0QA 4ELZC 2DD4A 2RI2A 2V8JA 3MP8A 4JLGA 4C5EA 3LX7A 1S72A 2ALYA 3M4GA 4FSXA 4HWOA 5CQYA 3QG1A 3PNWC 4M7DF 2XK0A 1B7YA 4IURA 2RHSA 1VQPA 1LNXA 4F7UA 5FRMA 4HT8A 1AHJB 2G4CA 3JCMe 3OB9A 5LJ3h 1EVKA 3MEVA 2MAMA 5J26A 3G6EA 4M77D 2EQUA 3OYIA 3BFMA 4E7LA 4DA4A 3RGLA 4PJOA 4BWAA 4EMGA 5GAN6 2DKGA 4J83A 5F5WA 2X4XA 3F70A 5CKEA 4IKFA 3HFNA 3QYHB 4XTXA 2DIQA 3EAEA 3HHTB 5CIUA 1Q82U 5J39A 2OTJA 2AMCB 1YBYA 4QVCA 5DM7R 2E41A 3WVDB 2RJCA 4LVMA 1JJ2S 1YFRA 4XEOA 3JCMb 2X35A 3C4SA 3GLXA 1NJ8A 3VBBA 3JCMP 3HY0A 4C92C 3UH0A 3P8VA 4M77A 3SDZA 2XD0A 1BI3A 1N9RA 1YHQA 5HK3A 4NOYA 4M75B 3OD1A 5FROA 2Q7GA 1M5Q1 4BDZA 4EMHA 3FJPA 4P75C 3CC2T 1JB0E 3P8DA 1K8AU 2CYZB 3W3SA 2RO0A 3OQ5A 3OSVA 4NL2A 4C0FA 3HRIA 4FL6A 3LWHA 3A7AA 2I4NA 2MWPA 3X28B 5FU7B 3CMAT 3OBWA 1Y7XA 2PVGB 3OYBA 2ARUA 3GNFB 3MEAA 2RJFA 1BBUA 3E9HA 3RKYA 1X54A 4LDXA 1BKBA 2PMFA 3JB9H 4XEMA 4P74C 3KFUA 1SRYA 3BDLA 5D6WA 2XDPA 2VUBA 4LDYA 3L2WA 3C94A 2OTLA 4O6JA 2L3RA 4X9CA 4CH4A 3A5ZB 2F5TX 2XHCA 3HPWA 3CEYA 4PG3A 2KMTA 2X4JA 1VQNT 4C0ZA 2EL9A 3FLGA 1VQOA 2ZPGB 4M78F 2R5AA 3CCQA 3BW1A 2DTHA 4E7IA 4FT4A 4A4KA 1QVGA 5FU6C 5LJ5e 4JDSA 1Q7YC 1OZ3A 2Q7EA 3TCJA 1P92A 3HRKA 4ZTZB 1M8VA 3Q1JA 4BY6C 3JAME 4HCBA 2LQ8A 4M78B 3LSSA 3ME9A 1KQ2A 2AMCA 2RD1A 3HL8A 1ASZA 2XGTA 4A4FA 3CPWA 1NJ6A 3GIBA 1V29B 4LVKA 1ADJA 2I4LA 4BI8B 4ME7A 3PMTA 1KQSA 3QO5A 2CGHA 1VQ9T 3OYJA 1BYMA 2DEQA 3G7ZA 3NFCA 4J8OA 4OB2B 3RIRA 2VV5A 2CZ0B 5GAMj 1IREB 5A0LA 2E6ZA 4MZTA 4MDWA 1O9SA 4LDWA 2MWOA 5CQXA 3OYFA 2KAFA 3HXZA 3LSQA 3RMQA 3QO7A 5M9OA 1B70B 2VC8A 2DJZA 4YRMA 1EIFA 3E19A 1LYLA 4TVWA 1KMMA 5GMKe 1RL2A 3CCJA 4PHCA 2K5LA 2XKOC 1LJOA 5GANd 2PVDB 2CS7A 3OYKA 3I7FA 5GAOp 5DLQE 1I81A 3WXMB 2LX9A 2A3LA 3VYHB 4GY5A 3HKSA 1QF6A 3CCET 2EIFA 4PJOC 1Q7YU 3EFRA 4HWPA 4C92D 3R6OA 4NS5A 5CVIA 2ARTA 3QBYA 4CS3A 4C8QG 1SETA 1WU7A 1M90C 4EX5A 3A5ZA 4II1A 2DVEA 3L1AA 3HRUA 4ZIBA 4OMFB 2VXEA 4M7DG 5GANh 1WNLA 2RJEA 4M7AC 4KR3A 4D6WA 5GMKi 4O5VA 4E51A 1JJ2A 1OYXA 2ZNJA 2CJ9A 4OGCA 4KUDK 2GFAA 1G3WA 3JCMf 2P0PA 4C92A 3MP1A 5CAIA 2ZR2A 3UPUA 5LJ3j 2JUFA 5C0MA 4JUVA 4UP9A 2DXTA 2DXUA 3RL6A 4P75A 3V8JA 1PYSB 3L42A 2CIMA 4DPGA 4BE2A 1I5LA 4N0AA 3CCRT 4YRFA 3QYGB 2LRQA 1QVPA 3G4SA 2XG8D 1VQKA 4IUQA 5A2QE 5LJ3f 2RHIA 2P4TA 2RA2A 3REXA 2DDZA 1QVFS 1X75C 3LYIA 5HY6A 4F7UF 2DXBA 1B70A 3FC3A 3N5BB 1H641 4X9DA 1NJ5A 2DZ9A 1VQ4T 1HTTA 2LDMA 2XI9A 1VQ5A 4JJNK 1OI1A 4XTUA 2HBPA 1M90U 2ZIOA 4YRPA 1KMNA 2ZPBB 3KXTA 1VQMA 4XTWA 1BIAA 3A31A 5CKBA 1UB4A 3HFOA 2EJ9A 3E9IA 2DU5A 2R5MA 1YJWA 1UGRB 2LC4A 1VQ6T 5CKDA 4C0GA 1VUBA 3RKXA 3G71A 3CC4T 2MF2A 1NYQA 4F7UE 3I56T 2M9UA 2RI5A 1NE8A 3V8KA 1U8RA 3JCMd 3P8HA 1U1SA 4M77F 1VIEA 1IZ6A 3META 2WACA 2X4WA 4Y28E 2C8MA 3PIPA 3A5YA 3IG2A 3G1ZA 1EQRA 2K57A 3PGGA 2OAUA 2DTIA 4H2YA 1B76A 3S3OA 4M75C 4XU1A 4BUGA 4YRGA 2PVOB 1GGMA 4ZGDB 1YITT 4IUTA 3TEEA 4V2SA 4VUBA 2CKKA 3UWNA 3E9FA 5LJ5f 4A4EA 2HNIA 2D9TA 4OGEA 1VQLA 5C52B 4M77E 4LD6A 2WSEE 4JRPA 2VGNA 3JCMh 4PJOD 4UP8A 5FRNA 3URGA 4ZGEB 3DB4A 4OVAA 1M9SA 1TH7A 4OLFA 1YJ9A 1SESA 1WJQA 2YLCA 1N9SA 4YRCA 5FU7C 4J15A 2ZPHB 1M1FA 1BI2A 1K9MC 3DLLA 1FXXA 2LQKA 3JB9J 1N8RC 2ZNIA 2YHTA 2ZT8A 4YREA 4C8QB 1UGQB 3CD6A 2DPPB 4M7AD 3KUFA 5I2MA 1WPYA 3BY7A 2QEXT 4QVDA 3C12A 4M7DB 5IAYA 3RACA 5E3IA 3S6WA 2OTJT 4YCUA 3GP8A 4OP0A 3PZCA 5J3BA 2ODRC 1N27A 3M4YA 2EAYA 2QQRA 2J3MA 1H4TA 4CS2A 2EKOA 3CCLA 1JBMA 2PU9B 4XAXB 2EFIA 2M1HA 5IT9E 3HTZA 4M7AA 4JRQA 3VUBA 5GAMg 2DXCA 1UGSB 3JCMX 4M78C 1W4SA 2XU8A 4HWTA 2Y4YA 4BI3A 4UP7A 4OF1A 3QXEB 4QVZA 3JSCA 2E65A 4IUUA 3S3MA 3OYDA 4MZMA 3IALA 5LJ5d 2ZZFA 3HXYA 4N0AC 1W2BS 4KUIA 4RMOA 3ERRA 4JRIA 4BE0A 4LDVA 4BE1A 4C8QD 5GAOm 2DIGA 1VIFA 2DAQA 1L0WA 1XQHA 4RG2A 3CBMA 1Q86C 1K9MU 3OS5A 1WQWA 1N8RU 3CCUT 1D3BB 3HFZB 4CS4A 5GANj 3RF1A 3CC2A 4ZGJB 3L2UA 4M7DD 4YRNA 4JRKA 3ZFJA 3J7AF 4EO4A 4CH5A 1QVFA 4RQEA 2K5IA 5C51B 4PKCC 2L5QA 1GXIE 2NS6A 3RERA 5LJ5h 3OYNA 3ZEHA 3FEOA 5FLXE 2QHUA 4YPFA 5KH6A 3VQWA 2ZCFB 5GANf 2EJFA 3CMAA 2ZTGA 1KOGA 1UGPB 4C8QA 1KQ1A 3CMET 3CCQT 3V7RA 4HWSA 3A8MB 2ZINA 4HCCA 2K5FA 2NLUA 3JCMW 4F7UG 1HC7A 4M7DA 4UPAA 1EFWA 3OW2S 3M58A 3EFSA 4M75D 1YI2T 2ZPEB 4MZPA 3HXXA 5LJ3g 1E22A 1H4VB 1JRIA 3CCMT 2GF7A 1G51A 1W66A 1VQNA 3DKMA 4LDUA 4TTVA 1EVLA 4C5HA 4C92F 3KBGA 4JS5A 1WJSA 2O01E 5GAOr 2GQVA 2VXFA 3M9QA 2IY5B 4NL3A 1KHIA 4CI0C 3OMCA 2RHQB 2BIVA 4YYEA 3UGTA 1X2GA 3QHSA 2ZXFA 1FYFA 3OA6A 1G5HA 4N4GA 3L4GB 5GMKh
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3QTC A;  4JUV A;  4UP9 A;  2DXT A;  4M78 G;  1B34 A;  4H2W A;  1LOJ A;  4P3P A;  4H2T A;  2DXU A;  4HA8 A;  4M75 A;  4XU0 A;  3RL6 A;  4EMK C;  4YRJ A;  4P75 A;  4KQE A;  3V8J A;  1PYS B;  2CIM A;  4DPG A;  1ADY A;  1I5L A;  4N0A A;  4RCB A;  4M77 G;  4YRF A;  5LJ3 d;  3R07 A;  1H4S A;  4X5O A;  5GAN 7;  3NET A;  3JB9 G;  4A53 A;  2P5I A;  4C92 E;  5GAN 4;  1Y96 B;  5ELN A;  1NNH A;  4RCC A;  5GAN 5;  5LJ3 f;  1WLE A;  2ZR3 A;  1C0A A;  1E24 A;  2ZT5 A;  2RA2 A;  3REX A;  4M75 E;  4G85 A;  2DDZ A;  3P8Y A;  2ODR D;  4C8Q F;  3VU3 C;  4F7U F;  4XU2 A;  3PCO B;  3HFZ A;  5HGQ A;  1B70 A;  3JCM V;  4YRT A;  1I4K 1;  5GMK l;  1H64 1;  4X9D A;  1NJ5 A;  2ZCE A;  3JCM c;  2DZ9 A;  1WQ7 A;  1HTT A;  3JCM g;  3M4G A;  2ALY A;  3QNE A;  4TQD A;  2AKW B;  3TEH A;  1QE0 A;  4HWO A;  4M7D F;  4XTU A;  1B7Y A;  2RHS A;  1USY C;  1LNX A;  3INZ A;  4F7U A;  4RDX A;  4M78 D;  2ZIO A;  4YRP A;  1KMN A;  3RKW A;  3RES A;  3HXV A;  3RUX A;  4HT8 A;  2G4C A;  3QO3 A;  4XTW A;  1BIA A;  3JCM e;  3A31 A;  3A32 A;  2QTX A;  4L87 A;  3HFO A;  4XTV A;  5LJ3 h;  2EJ9 A;  1EVK A;  3E9I A;  2DU5 A;  4H2X B;  3CMQ A;  1EIY B;  2RB6 A;  4M77 D;  1H4Q A;  4YP0 A;  2PME A;  3MF1 A;  3JCM J;  3NEL A;  1ASY A;  3BFM A;  3RGL A;  2ZT7 A;  3RKX A;  4PJO A;  2QHS A;  4YDQ A;  4TVA B;  2E5A A;  4BWA A;  4KR2 A;  3JB9 D;  4EMG A;  5GAN 6;  4P71 A;  1NYR A;  2DKG A;  5F5W A;  1BIB A;  4LNS A;  3M4P A;  3HFN A;  3L2Z A;  1NYQ A;  4XTX A;  4F7U E;  4YRK A;  4TWA A;  4XU3 A;  4PJO G;  2CJA A;  5GAO l;  2AMC B;  4WI1 A;  4XTY A;  4QVC A;  3V8K A;  3JCM d;  3ICA A;  1U1S A;  4M77 F;  2E41 A;  4WJ3 M;  1YCY A;  2Q5H A;  2Y90 A;  3FB9 A;  4P72 A;  1YFR A;  4XEO A;  3JB9 F;  4M78 A;  3JCM b;  3AHU A;  3M4Q A;  4P3O A;  1Z7M A;  4RMF A;  2C8M A;  1NJ8 A;  3VBB A;  4C92 B;  3JCM P;  4H2U A;  2Q5I A;  1MGQ A;  3A5Y A;  2DQ0 A;  3HY0 A;  4C92 C;  3UH0 A;  3P8V A;  2IY5 A;  4M77 A;  3IG2 A;  3G1Z A;  1EQR A;  3SB2 A;  2K57 A;  3PGG A;  4M7A G;  1N9R A;  1E1O A;  3JB9 I;  4EMK B;  4CH6 A;  2DTI A;  4M75 B;  4NOY A;  3OD1 A;  4H2Y A;  1B76 A;  4G84 A;  4M75 C;  4XU1 A;  2Q7G A;  4YRG A;  1M5Q 1;  2DZC A;  4HT9 A;  1GGM A;  4EMH A;  3FJP A;  4P75 C;  1I8F A;  4H2S A;  4V2S A;  4MML A;  4DQ2 A;  4M78 E;  3W3S A;  4K87 A;  3WQZ A;  4YRS A;  4YCW A;  4NL2 A;  5LJ5 f;  2E10 A;  2HNI A;  4BW9 A;  4AH6 A;  5C52 B;  3HRI A;  4M77 E;  4PJO D;  4UP8 A;  3JCM h;  3A7A A;  3VQX A;  11AS A;  3MF2 A;  3HXU A;  2I4N A;  1U1T A;  1TH7 A;  4OLF A;  1D3B A;  1SES A;  2YLC A;  2ZT6 A;  1N9W A;  1N9S A;  4YRC A;  2ARU A;  5GAO n;  2E1H A;  1BBU A;  4J15 A;  3E9H A;  2ALY B;  4K86 A;  3RKY A;  1X54 A;  3JB9 J;  2ZNI A;  2YHT A;  2ZT8 A;  4YRE A;  1HK9 A;  4Y91 A;  1NJ1 A;  2PMF A;  5GAM f;  3JB9 H;  4XEM A;  4P74 C;  4C8Q B;  4F7U B;  4PJO F;  2QHV A;  1G5I A;  1SRY A;  3PCO A;  3KFU A;  4P3N A;  4C8Q C;  4M7A D;  1WPY A;  1NJ2 A;  4TQF A;  4YRR A;  4YRQ A;  2Q7H A;  3FIF A;  2FB7 A;  3BY7 A;  4X9C A;  2DU7 A;  4CH4 A;  1USY A;  4QVD A;  4M7D B;  2RM4 A;  4P73 C;  4M7D C;  1JJC B;  2P0L A;  3RAC A;  2FYK A;  4PG3 A;  5E3I A;  2I2L A;  5LJ5 g;  3A7R A;  2ZZG A;  5C53 B;  3IKL A;  2EL9 A;  4YCU A;  4OP0 A;  3PZC A;  2ODR C;  4M78 F;  2I4O A;  1X01 A;  4HWR A;  1X56 A;  4M7A F;  4H2X A;  2EAY A;  1EIY A;  3BW1 A;  2DTH A;  3NEN A;  2J3M A;  1H4T A;  4CS2 A;  2C7I A;  5ELO A;  1JBM A;  5LJ5 e;  3BJU A;  4YRL A;  3QSU A;  5GMK m;  4TVA A;  2DTO A;  2Q7E A;  3SWN B;  3HRK A;  4ZTZ B;  1M8V A;  3V8L A;  3SWN C;  4PJO E;  1RIQ A;  4M78 B;  3HTZ A;  3LSS A;  4M7A A;  5GAM g;  3JCM X;  4J6X A;  4M78 C;  4MMK A;  3VQV A;  1KQ2 A;  5LJ5 j;  2AMC A;  4HWT A;  2RD1 A;  4H02 A;  4UP7 A;  1ASZ A;  2XGT A;  2ARS A;  4K88 A;  4M77 B;  4ZTU B;  2CJB A;  3A74 A;  1B34 B;  2E65 A;  4M77 C;  5GAM e;  2RHQ A;  1NJ6 A;  5GAN g;  3GIB A;  1YB3 A;  1ADJ A;  2I4L A;  3IAL A;  5LJ5 d;  2E3C A;  2ZZF A;  4CH3 A;  3QO5 A;  2CGH A;  3V7S A;  1IL2 A;  5K1X A;  1SER A;  4PNO A;  1ATI A;  4H2V A;  5GAN 2;  3HXY A;  2DEQ A;  3L4G A;  4N0A C;  4M7A E;  1HXD A;  1VQZ A;  5GAN e;  3RIR A;  3ERR A;  4JRI A;  4J6Y A;  5GAM j;  4EMK A;  1E1T A;  3LC0 A;  5K1P A;  12AS A;  1B8A A;  4C8Q D;  4C92 G;  5GAO m;  2EWN A;  2EJG A;  1PYS A;  1L0W A;  4RQF A;  3HY1 A;  3HXZ A;  3LSQ A;  3QO7 A;  1WQW A;  4M75 G;  3HFZ B;  1D3B B;  1B70 B;  4CS4 A;  5GAM d;  5GAN j;  3DSQ A;  1X2H A;  1BBW A;  3RF1 A;  1Y96 A;  3REU A;  2VC8 A;  5KNN A;  4M7D D;  4YRN A;  4JRK A;  2DJZ A;  4YRM A;  4EO4 A;  1LYL A;  4CH5 A;  4TVW A;  1KMM A;  3TEH B;  5GMK e;  4RQE A;  2QHT A;  1YGB A;  5C51 B;  4PHC A;  2J3L A;  5GAN 3;  1B7Y B;  1LJO A;  5GAN d;  2RHS B;  2E64 A;  3RER A;  3UGQ A;  5LJ5 h;  3HSB A;  3HXW A;  2QHU A;  3I7F A;  3JCM Q;  4YPF A;  5GAO p;  3VQW A;  1I81 A;  4J6W A;  2AKW A;  5I21 A;  5GAN f;  2I4M A;  5GMK j;  2EJF A;  4P74 A;  2ZTG A;  3BDU A;  1QF6 A;  4WF2 A;  1KOG A;  4C8Q A;  3TEG A;  4PJO B;  1X55 A;  1KQ1 A;  3V7R A;  4PJO C;  4HWS A;  3VQY A;  3EFR A;  1WYD A;  4P71 C;  4YCV A;  3P8T A;  4HWP A;  2ZIN A;  4XTZ A;  4C92 D;  1EOV A;  2ART A;  2ZZE A;  4CS3 A;  4C8Q G;  3JCM W;  1SET A;  4F7U G;  5GAM h;  1WU7 A;  4P73 A;  4EX5 A;  1HC7 A;  4M7D A;  4UPA A;  3A5Z A;  4YRO A;  1EFW A;  2ZIM A;  3EFS A;  2DVE A;  4M75 D;  1JJC A;  3L1A A;  1YFT A;  4O2D A;  4Q6G A;  4ZIB A;  3UFG A;  5DY9 A;  4XQ3 A;  3TUP A;  4HVC A;  3HXX A;  4C8Q E;  5LJ3 g;  3V7C A;  2DQ3 A;  2VXE A;  1E22 A;  4M7D G;  4P72 C;  5GAN h;  2XTI A;  1H4V B;  1JRI A;  1WNL A;  3QUI A;  4M7A B;  3HFV A;  1G51 A;  1W66 A;  4M7A C;  3QO8 A;  4KR3 A;  4TTV A;  1EVL A;  3IKM B;  4C92 F;  3MEY A;  4NCX A;  5GAO r;  2JN0 A;  5GMK i;  2VXF A;  3NEM A;  2IY5 B;  5LJ3 e;  4NL3 A;  4E51 A;  5GAN 8;  3SWN A;  4M7D E;  2ZNJ A;  3A7U A;  4Q15 A;  4YRI A;  2CJ9 A;  4M75 F;  2RHQ B;  4TVY A;  4YYE A;  3UGT A;  2ZGW A;  1X2G A;  3QHS A;  2ZXF A;  1FYF A;  4J5Y A;  4WJ4 A;  4A54 A;  3JCM f;  5GAO q;  4C92 A;  1YFS A;  1Z7N A;  2YLB A;  5CAI A;  1G5H A;  1J5W A;  4JLI A;  2ZR2 A;  3L4G B;  5GMK h;  5LJ3 j; 
#chains in the Genus database with same CATH topology
 2DIL A;  2LJ0 A;  1Q86 U;  4FT2 A;  1KD1 C;  4D8D A;  3RMS A;  3X25 B;  1LOJ A;  4P3P A;  4H2T A;  3PIO A;  3CCS Q;  4HA8 A;  4M75 A;  4FCY A;  3M0R A;  4A4G A;  4EMK C;  3OYL A;  3REB B;  3M54 A;  4KQE A;  1GRI A;  3PVL A;  4KH0 B;  2A8E A;  4M77 G;  2MK5 A;  1EZZ B;  3CBP A;  3LGF A;  1SSF A;  2XDB A;  5GAN 7;  3OYC A;  3PMI A;  2LT1 A;  1MMN A;  4A53 A;  4L59 A;  4C92 E;  2P5I A;  4LVI A;  1BI0 A;  1Y96 B;  2KYB A;  1VQ9 A;  1VQ7 T;  4RCC A;  5GAN 5;  2KSS A;  4FYW B;  1E24 A;  3GOX A;  3LLR A;  2X4Y A;  4EPC A;  5CCA A;  2ODR D;  3AT1 B;  4XU2 A;  3HFZ A;  5KYX B;  2ZCE A;  3MHX A;  4Q5W A;  1R8O B;  5KCO A;  2P4R A;  1WQ7 A;  3OYH A;  3I55 Q;  3THK A;  3CCV Q;  3QNE A;  2R58 A;  3X24 B;  2AKW B;  4E7J A;  1AZG B;  1QE0 A;  2OJ2 A;  1T3S A;  3L2R A;  5L8R E;  2HQE A;  3INZ A;  1YIJ T;  4RDX A;  1SKU B;  4M78 D;  3EGX B;  4J9C A;  3QO3 A;  1KC8 R;  2Y4X A;  1S72 Q;  3A32 A;  3GF5 A;  1JJ2 P;  2KRO A;  3X26 B;  4L5G A;  4ELY C;  4KUL A;  4JZ4 A;  4H2X B;  1EIY B;  2GGR A;  2K9G A;  3CC7 T;  2RB6 A;  1VQP Q;  1H4Q A;  4YP0 A;  2QA4 T;  3NEL A;  3JCM J;  3CD6 Q;  1K73 R;  2J06 A;  4ZN3 A;  1B7T A;  4TVA B;  2E5A A;  4KR2 A;  1NBE B;  3JB9 D;  3M55 A;  4P71 A;  1NYR A;  3MJX A;  3OS2 A;  1NPR A;  3M4P A;  3L2Z A;  1YNZ A;  3M0S A;  3G6E Q;  3CCE A;  4YRK A;  3VKI A;  4TWA A;  2IVW A;  2QYZ A;  4ZNX A;  2CJA A;  5GAO l;  1QW1 A;  4E7K A;  5EG2 A;  4PLI A;  2XDD A;  3CPF A;  4AG2 C;  2JM8 A;  2V8I A;  2LCS A;  2LQN A;  4ZN1 A;  3FB9 A;  4P72 A;  2DA9 A;  1D1B A;  3HP9 A;  4M78 A;  1D09 B;  2E5K A;  1TUC A;  2W10 A;  4PLL A;  2J6F A;  1AWJ A;  2NUZ A;  3CCL Q;  1KD1 U;  4P3O A;  1AWO A;  1MGQ A;  2DQ0 A;  3PTA A;  2IY5 A;  3UAT A;  1AEY A;  3SB2 A;  2DO3 A;  2BZ8 A;  3M53 A;  3FDR A;  1OX9 A;  5LL6 S;  1E1O A;  4EMK B;  4CH6 A;  3T9N A;  5D6X A;  4G84 A;  2RMO A;  3SD4 A;  4FSS A;  1X6O A;  3A8L B;  4JS4 A;  2ZPI B;  4HT9 A;  2MPX C;  4KGX B;  1W2B A;  3EHR A;  1VQ8 T;  2HKN A;  3QPH A;  4K87 A;  2ED1 A;  1YHQ Q;  4YRS A;  1BU1 A;  4YCW A;  2CZ7 B;  5KE2 A;  1M1G A;  4R55 A;  1H92 A;  5KCH A;  4AH6 A;  4HVW A;  3VUZ A;  1QQJ A;  2ZZD A;  3VQX A;  2AZV A;  3MF2 A;  4E7H A;  1QWE A;  1U1T A;  2JTF A;  1X69 A;  4OMM A;  4ATO A;  3CCR A;  5IHK A;  3QJ6 A;  2OAW A;  2ALY B;  4K86 A;  3CXC S;  1IHV A;  4LD9 K;  1VQM T;  2JVV A;  2QG9 B;  4Y91 A;  1PNJ A;  1NJ1 A;  1TU0 B;  1YJN T;  4F7U B;  4PJO F;  2QHV A;  1YJW T;  1G5I A;  4C8Q C;  5KYX A;  3MEU A;  1NJ2 A;  4TQF A;  4YRR A;  2XMF A;  2I0N A;  4YRQ A;  1BCM A;  2CP5 A;  2FB7 A;  2DU7 A;  2VGM A;  2LNV A;  2FZG B;  1USY A;  1ZQ1 A;  4PL6 A;  1MV3 A;  2RM4 A;  1VQ4 A;  1KC8 C;  4M7D C;  1JJC B;  2EYW A;  2FYK A;  3EHQ A;  2OTL Q;  2ZZG A;  2FRY A;  5C53 B;  5IN1 A;  1MMA A;  1DJ7 B;  2L3P A;  1LCK A;  1X01 A;  1ZSZ C;  1K73 C;  4M7A F;  2KXD A;  4H2X A;  1EIY A;  2PZ1 A;  2RHZ A;  1PSF A;  2P0K A;  3NEN A;  3OW2 A;  4PJN A;  4YRL A;  3QSU A;  2RI3 A;  4F04 B;  5GMK m;  3CCS T;  4TVA A;  2DTO A;  1TWB A;  1VQO Q;  2O2O A;  1VQ6 A;  3SWN B;  2ZPF B;  4BAC A;  1E6G A;  1ZHI A;  4DOW A;  4AFQ C;  4PJO E;  5C6S A;  1OOT A;  3MPU B;  3E1S A;  2HD0 A;  4J6X A;  4MMK A;  3VQV A;  4E47 A;  5LJ5 j;  2ABL A;  2RH2 A;  2YUP A;  3I56 A;  4K88 A;  1KG1 A;  4M77 B;  1WGS A;  1UHF A;  1WLP B;  2QI2 A;  2WSF E;  4ZTU B;  3G1J A;  3A74 A;  1JU5 C;  3P8B B;  5DLO A;  5GAM e;  2M51 A;  3LW5 E;  1M2V B;  5GAN g;  4N4I A;  4B9W A;  1PHT A;  1HYO A;  1S1N A;  3C0C A;  2FEI A;  4CH3 A;  5D7U A;  5FWB A;  3V7S A;  1XNI A;  5K1X A;  3OS1 A;  4PNO A;  5GAN 2;  4YTL A;  2K2M A;  4M7A E;  1WJR A;  1HXD A;  3I55 T;  3CCV T;  4EMK A;  1E1T A;  2F69 A;  3LC0 A;  5K1P A;  2YRV A;  2YUQ A;  4J7I A;  2O31 A;  4C92 G;  1O75 A;  1D1C A;  2EWN A;  1PYS A;  3QDR B;  2FVU A;  3OYY A;  2XID A;  8AT1 B;  1S72 T;  3HRS A;  2YDL A;  2QDL A;  3DSQ A;  2FPD A;  1FYN A;  1BBW A;  3RR6 A;  5I2S A;  2C06 A;  3REU A;  1YIT A;  1VQP T;  1HD3 A;  3CD6 T;  4IUP A;  3A8H B;  3TEH B;  4E7S A;  3OY9 A;  1MHN A;  4FM4 B;  3GBQ A;  2J3L A;  1N6A A;  2AIR B;  2KQW A;  5HKC A;  2CDT A;  2E64 A;  3JRZ A;  3G6E T;  3UGQ A;  3ASK A;  3HXW A;  1FMK A;  1KC8 U;  3TRE A;  2EYY A;  1UDL A;  1M30 A;  4J6W A;  3CCJ Q;  5I21 A;  2I4M A;  5GMK j;  4BI4 A;  1MND A;  3BDU A;  1PSE A;  4J7F A;  2JNG A;  2HQX A;  4WF2 A;  3GPL A;  1K73 U;  1QKW A;  2L3S A;  2EGE A;  3QII A;  3MP6 A;  1X55 A;  3QJY A;  4JPB W;  1Q81 R;  3CCL T;  4P71 C;  4J9E A;  4XTZ A;  2D0N A;  2HZY A;  3OYM A;  3OYA A;  2B8A A;  4P73 A;  4RTW A;  4D8K A;  3OMG A;  2KI7 A;  3H0I A;  1AVZ C;  2ZIM A;  3QZ5 B;  1JJC A;  4O2D A;  4Q6G A;  2DFU A;  3UFG A;  2QEX A;  4J9F A;  3TUP A;  2IIM A;  4IUV A;  3UDC A;  4C8Q E;  3NTI A;  3V7C A;  3MQZ A;  4P72 C;  2F5K A;  1X27 A;  3EGU A;  5IHN A;  3EFO A;  1YHQ T;  2X3X D;  4NCX A;  3NTH A;  2D1X A;  5KYN A;  4PK4 A;  3PT9 A;  5LJ3 e;  2JXB A;  2JM9 A;  3SWN A;  4LUE A;  4M7D E;  3A7U A;  4FYV B;  2X51 A;  4Q15 A;  4M75 F;  4TVY A;  3MEW A;  4C0D B;  2ZGW A;  3S3N A;  3DLM A;  2YRC A;  3X20 B;  2H8H A;  2EQM A;  4A54 A;  2QQ9 A;  2V8K A;  3QZ9 B;  4KT0 E;  2RHU A;  1J5W A;  1NG2 A;  1G3Y A;  3QTC A;  9ATC B;  4IIM A;  4H2W A;  1M27 C;  4Z02 A;  4XU0 A;  4Z89 A;  1UHC A;  3HRT A;  2K3B A;  1IRX A;  4YRJ A;  4QW2 A;  2K3X A;  1UG1 A;  1RAI B;  1AWW A;  4B9X A;  1ADY A;  1VYT A;  3FRN A;  2CH4 A;  1RAB B;  1H4S A;  4X5O A;  3REA B;  4LVJ A;  3J80 E;  5GAN 4;  2HKQ B;  2QDY B;  4R56 A;  5ELN A;  3LWI A;  2K2V A;  4MDX A;  2NUP B;  5AYF A;  2ZR3 A;  1XTD A;  3H8Z A;  1C0A A;  1RAD B;  1IGQ A;  2K7A A;  6AT1 B;  1M1K R;  3MO8 A;  2ZT5 A;  4M75 E;  2OTL T;  4G85 A;  3M59 A;  3P8Y A;  2VAS A;  3VU3 C;  3G4S Q;  4KRT A;  3PCO B;  2ATC B;  1VQK Q;  3JCM V;  2FHD A;  1I4K 1;  4QQG A;  5GMK l;  2XIC A;  2ED0 A;  1UEC A;  3JCM c;  5D6Y A;  3CXC A;  2BKD N;  3JCM g;  5KYU B;  4TQD A;  4LVL A;  3CCU A;  3TEH A;  1Y71 A;  2RK2 A;  1RAG B;  1NLP C;  4FW2 A;  1VQO T;  4PFZ A;  1USY C;  2K3Y A;  1ARK A;  2RHY A;  2LJ3 A;  2EYZ A;  4OB0 B;  3HXV A;  3RKW A;  3RES A;  3RUX A;  4P5N A;  2FZK B;  2QTX A;  1RAH B;  2DM1 A;  4L87 A;  2JMC A;  1ZUY A;  1VQ5 Q;  4XTV A;  1D1A A;  4CC7 A;  3NTK A;  3CMQ A;  2PME A;  3MF1 A;  4HT4 A;  2V26 A;  2GTJ A;  1ASY A;  4HVV A;  1Q81 C;  1ZA2 B;  5CK9 A;  2ZT7 A;  1V1C A;  3TVT A;  2QHS A;  2FZC B;  4YDQ A;  1IGU A;  2PUO B;  3NPF A;  5CKH A;  2VVK A;  4FU6 A;  4OMP A;  1BIB A;  3VRY A;  4LNS A;  4R0K A;  3ER0 A;  2A0F B;  2V1Q A;  4XU3 A;  3CME A;  1QP3 A;  2DJQ A;  2C0O A;  4PJO G;  3G71 Q;  4WI1 A;  4XTY A;  1CKB A;  2CZ1 B;  3ICA A;  2RK1 A;  4LE9 A;  1XOV A;  4WJ3 M;  1YCY A;  2Q5H A;  2Y90 A;  3EG1 A;  2DF6 A;  1VOM A;  2GQI A;  3JB9 F;  3EGD B;  3AHU A;  2JOY A;  3M4Q A;  1Z7M A;  4N4H A;  3CBO A;  4RMF A;  4C92 B;  1YI2 A;  2DL5 A;  3EG2 A;  2KDS A;  1AOJ A;  4H2U A;  2Q5I A;  2IG0 A;  3E9G A;  2F1L A;  3VV0 A;  1IXD A;  1ZBX A;  3CCM A;  2KRN A;  4M7A G;  2VWF A;  4PJL A;  3JB9 I;  3TSZ A;  4M4Z A;  2QAS A;  3L2V A;  2E6N A;  4FIB A;  3SHW A;  1QCN A;  1MMG A;  2DZC A;  2LNH B;  1PC0 A;  3I56 Q;  1I8F A;  1RI0 A;  4H2S A;  1NJI C;  1R0B G;  4MML A;  4DQ2 A;  4M78 E;  2LVM A;  4JJB A;  4A4H A;  3WQZ A;  2LCC A;  1N5Z A;  2DL4 A;  3CCJ T;  2E10 A;  4OB1 B;  2AT1 B;  2COW A;  3OS0 A;  4BW9 A;  2L2P A;  2JTM A;  2J6K A;  4BD3 A;  11AS A;  4XK8 E;  2J7I A;  2GCX A;  3GNG A;  2ENM A;  2M16 A;  3HXU A;  2MMP A;  3U23 A;  4OMQ A;  2K4Y A;  1D3B A;  1QWF A;  3M57 A;  2ZT6 A;  1N9W A;  2R57 A;  1VQL Q;  5GAO n;  1YN8 A;  2E1H A;  1M1K C;  1C0M A;  2L8D A;  3UT1 A;  3O8V A;  2NUP A;  4ZTJ A;  2EW3 A;  1Q95 G;  2AHJ B;  1HK9 A;  2CP0 A;  5GAM f;  1YJ9 Q;  1M2O A;  4L6V 5;  1VQ7 A;  4RTY A;  3PCO A;  3QKJ A;  4P3N A;  2P84 A;  1JXO A;  2CZ6 B;  1Q81 U;  1TUG B;  1AZE A;  4Z88 A;  2PNI A;  1M3B A;  2Q7H A;  3FIF A;  2DER A;  5HK0 A;  1KJW A;  1X6B A;  1U3O A;  4JJD A;  2NUT B;  2PQW A;  1KFZ A;  1PKS A;  2O4X B;  4P73 C;  3OYG A;  1G5V A;  2P0L A;  5CR2 A;  2BUD A;  2I2L A;  5LJ5 g;  3A7R A;  2A37 A;  2HAX A;  3IKL A;  1Y0M A;  2WSC E;  4KGV B;  3C95 A;  2QXF A;  2I4O A;  1YIJ A;  2LCL A;  4HWR A;  1X56 A;  2RJD A;  5FU6 B;  3R6N A;  4FYY B;  2H3J A;  4BB7 A;  1OV3 A;  3M5A A;  3QWX X;  3L2Q A;  1K0X A;  1KHC A;  2C7I A;  5ELO A;  4C5G A;  3BJU A;  3EH2 A;  3I9Q A;  3TU4 K;  1W2B P;  2CRE A;  3LGL A;  4BY6 B;  3CC7 A;  2COZ A;  4EDU A;  2QA4 A;  2KXC A;  3V8L A;  1RAA B;  2KGT A;  3SWN C;  1RIQ A;  3OBY A;  3M0P A;  1YCS B;  2A7Y A;  2D0Q B;  2E70 A;  2QQA A;  1Q82 R;  3LH0 A;  3SFM A;  4H02 A;  2DMO A;  4X34 A;  4UC4 A;  2L89 A;  2DVJ A;  2LTO A;  2M0O A;  3WVE B;  4CC4 B;  2D6F A;  2ARS A;  2QQB A;  2CJB A;  1WHJ A;  1B34 B;  4KBM B;  1NJI U;  1BB9 A;  4M77 C;  2CT3 A;  2RHQ A;  1YB3 A;  1T0J A;  2E3C A;  3M56 A;  3G4S T;  4HCZ A;  2KVQ G;  1QP2 A;  1IL2 A;  1VQK T;  1SER A;  1TTH B;  1UE9 A;  1ATI A;  4H2V A;  3DB3 A;  1GCP A;  3L4G A;  2MI6 A;  1VQZ A;  1G3T A;  5GAN e;  1OPK A;  4J6Y A;  12AS A;  1B8A A;  4GLK A;  1I0C A;  1OZ2 A;  3OSS C;  3TQ7 P;  1CKA A;  2EJG A;  4RQF A;  2VKN A;  1WHL A;  3J81 E;  3HY1 A;  1M1K U;  1K8A R;  2NWM A;  4LNP A;  4DEY A;  2KT8 A;  4DBH A;  2HSE B;  1D0Y A;  3LH5 A;  3A8G B;  4M75 G;  3VYG A;  1OQK A;  5GAM d;  1VQ5 T;  1X2H A;  1Y96 A;  5KNN A;  1VQ8 A;  2LT4 A;  4FYX B;  5CO7 A;  3EG0 A;  1FX7 A;  2RQR A;  3H0H A;  2QHT A;  4TVR A;  3MCA B;  1YGB A;  2LMJ A;  1TXQ A;  5GAN 3;  1B7Y B;  2RHS B;  3OW2 P;  1H3Z A;  3CC2 Q;  2G3R A;  2EQK A;  4C5I A;  4HKE A;  3VS0 A;  3HSB A;  2EQJ A;  3JCM Q;  2QQS A;  5KE3 A;  3OYE A;  1YWP A;  3A98 A;  3G71 T;  2QGF B;  2AKW A;  2GFU A;  4P74 A;  4QQ6 A;  4BDY A;  1WHK A;  3ZL7 C;  4DBQ A;  3TEG A;  3KFV A;  2VYT A;  4B6M A;  4PJO B;  2LP5 A;  2E5Q A;  1NPP A;  3EGX A;  3I5R A;  2KK4 A;  2L3Q A;  3VQY A;  1BI1 A;  1WYD A;  4YCV A;  4RG8 A;  3P8T A;  1NZ9 A;  4OB3 B;  1YJN A;  1EOV A;  2PUK B;  2ZZE A;  3CMA Q;  2RHX A;  3H6Z A;  4DOV A;  1G3S A;  1TS9 A;  5GAM h;  1Y07 A;  2O4X A;  4YRO A;  4RTZ A;  1QVG S;  2OX7 A;  1YFT A;  2FL7 A;  1GCQ A;  1SHF A;  3A8O B;  5IH2 A;  5DY9 A;  4XQ3 A;  4AT1 B;  4HVC A;  1UJ0 A;  2DQ3 A;  2XTI A;  3QDF A;  3QUI A;  4M7A B;  3HFV A;  1C6V X;  3CC4 A;  3QO8 A;  1F1B B;  1K76 A;  4X1V A;  3IKM B;  3MEY A;  4RTU A;  2JN0 A;  4CRI A;  2JZ2 A;  1E6H A;  3NEM A;  2E12 A;  5GAN 8;  4YRI A;  1Q82 C;  3CPW S;  1VQN Q;  3CCS A;  4C0D C;  4J5Y A;  5A0G A;  4WJ4 A;  4RKU E;  5GAO q;  4ZTF A;  1YFS A;  1Z7N A;  1KQS S;  1FWZ A;  2YLB A;  3EG9 B;  4JLI A;  1VQL T;  1HJD A;  1SPK A;  4M78 G;  1B34 A;  1PRM C;  2PTK A;  2EYQ A;  5CKF A;  1WXB A;  1YJ9 T;  2HDA A;  1JQQ A;  4DEX A;  5A0D A;  1M4Z A;  4PJM A;  4RCB A;  2HSP A;  5LJ3 d;  4WCI A;  3R07 A;  1PD0 A;  3ZBD A;  3NET A;  2KY9 A;  2DD5 A;  4CC3 A;  3JB9 G;  3PFS A;  1UEB A;  2K6D A;  1NNH A;  1K8A C;  1QKX A;  1WLE A;  5KYY B;  3VJP A;  3I55 A;  4QQD A;  3CCV A;  2DK3 A;  4DBR A;  3VS2 A;  1UGV A;  4C8Q F;  5HGQ A;  5KYW B;  4YRT A;  1VQ9 Q;  2P0Q A;  4ELZ C;  2DD4 A;  2RI2 A;  2V8J A;  3MP8 A;  2MIO A;  1QMC A;  4JLG A;  4C5E A;  3LX7 A;  2M0Y A;  1S72 A;  2ALY A;  3M4G A;  4FSX A;  4HWO A;  2H3E B;  5CQY A;  3QG1 A;  3PNW C;  4M7D F;  2XK0 A;  1GBQ A;  1B7Y A;  4IUR A;  2BE9 B;  1VQP A;  2RHS A;  1LNX A;  4F7U A;  4ORZ A;  5FRM A;  1I07 A;  1ZX6 A;  4HT8 A;  4LUD A;  1AHJ B;  2G4C A;  2GTO A;  3JCM e;  1D0Z A;  3OB9 A;  5LJ3 h;  1EVK A;  3MEV A;  2MAM A;  5J26 A;  2Z0W A;  5IXB A;  3G6E A;  4M77 D;  2EQU A;  1K1Z A;  3OYI A;  1NLO C;  3BFM A;  4E7L A;  4DA4 A;  2MOX A;  3PVQ A;  3RGL A;  4PJO A;  4BWA A;  1H3H A;  4EMG A;  5GAN 6;  2DKG A;  4J83 A;  5F5W A;  2X4X A;  2O9V A;  1NYG A;  3F70 A;  1CSK A;  5CKE A;  4IKF A;  3HFN A;  1TG0 A;  2NYS A;  3QYH B;  4XTX A;  2DIQ A;  2HCK A;  3EAE A;  1D0X A;  2CSI A;  3HHT B;  5CIU A;  1Q82 U;  5J39 A;  2OTJ A;  2AMC B;  1WI7 A;  1IO6 A;  4FW1 A;  1YBY A;  4QVC A;  1W6X A;  5DM7 R;  5EC7 A;  2RQW A;  2E41 A;  1JO8 A;  1X2Q A;  3WVD B;  1A0N B;  2RJC A;  3D7S B;  3CCE Q;  4LVM A;  1JJ2 S;  1MMD A;  1YFR A;  4XEO A;  3JCM b;  2X35 A;  3C4S A;  4JZ3 A;  4OML A;  1X6G A;  2DRM A;  2AK5 A;  3GLX A;  1NJ8 A;  3VBB A;  3JCM P;  3HY0 A;  1QVF P;  4C92 C;  3UH0 A;  3P8V A;  4M77 A;  2QA4 Q;  3SDZ A;  1NJI R;  2XD0 A;  1BI3 A;  1N9R A;  1ZBJ A;  1YHQ A;  5HK3 A;  4NOY A;  4M75 B;  3OD1 A;  1M2V A;  4AMC A;  2FPE A;  3CQT A;  5FRO A;  2Q7G A;  1M5Q 1;  3CXC P;  4BDZ A;  4EMH A;  3FJP A;  4P75 C;  3CC2 T;  4HCK A;  1PWT A;  4AFU C;  1JB0 E;  3EG9 A;  3P8D A;  1K8A U;  2HQH A;  1B3Q A;  2CYZ B;  3EG3 A;  2RO0 A;  1LPL A;  3W3S A;  3OQ5 A;  3OSV A;  4LXC A;  4NL2 A;  2B86 A;  2OI3 A;  4J9D A;  1X2K A;  4C0F A;  5HCK A;  1BBZ A;  1FMV A;  4KH1 B;  4FL6 A;  3LWH A;  3HRI A;  2CP3 A;  2YWW A;  3VRZ A;  4K11 A;  3A7A A;  2I4N A;  2MWP A;  3X28 B;  1SHG A;  5FU7 B;  2DL8 A;  4OMO A;  3CMA T;  3OBW A;  1Y7X A;  2PVG B;  3OYB A;  2ARU A;  3GNF B;  2F2V A;  3MEA A;  2RJF A;  1BBU A;  4OMN A;  3E9H A;  3RKY A;  1R0C B;  1X54 A;  4LDX A;  1BKB A;  2PMF A;  3JB9 H;  5AT1 B;  4XEM A;  1TOV A;  4P74 C;  2KT1 A;  1OU8 A;  1RAF B;  3KFU A;  1SRY A;  3BDL A;  5D6W A;  2XDP A;  2VUB A;  4LDY A;  3CCR Q;  3L2W A;  3C94 A;  2KBT A;  1AT1 B;  2OTL A;  1K9A A;  4O6J A;  2L3R A;  2EPD A;  4X9C A;  4CH4 A;  2HL3 A;  3TSW A;  1SG5 A;  3A5Z B;  2F5T X;  2XHC A;  3HPW A;  1M90 R;  3CEY A;  4PFO A;  2X3W D;  2KMT A;  4PG3 A;  2M02 A;  1RAC B;  2X4J A;  1VQN T;  4C0Z A;  2EL9 A;  1GCQ C;  3FLG A;  1VQO A;  4RUG A;  2ZPG B;  3UF4 A;  2D8J A;  4M78 F;  2CP7 A;  3NGP A;  2R5A A;  3H0F A;  4E2F B;  2BZX A;  3CCQ A;  3BW1 A;  2DTH A;  4E7I A;  1VQ4 Q;  4FT4 A;  4A4K A;  1QVG A;  5FU6 C;  5LJ5 e;  4JDS A;  1Q7Y C;  4F14 A;  1OZ3 A;  1SEM A;  1J3T A;  1RAE B;  2Q7E A;  2DE0 X;  3TCJ A;  1P92 A;  3HRK A;  4ZTZ B;  1M8V A;  3Q1J A;  4BY6 C;  3JAM E;  2BTT A;  4HCB A;  4J9B A;  2LQ8 A;  4M78 B;  2O88 A;  3LSS A;  3ME9 A;  1GFC A;  1WA7 A;  1VYU A;  1KQ2 A;  2AMC A;  2RD1 A;  3HL8 A;  1FMW A;  1VQ6 Q;  1ASZ A;  2K79 A;  2XGT A;  2KRM A;  2CUD A;  3M0Q A;  3JV3 A;  4A4F A;  1SRM A;  3CPW A;  1QCF A;  1OPL A;  1NJ6 A;  1UFF A;  3GIB A;  1K0S A;  1V29 B;  4LVK A;  2E3I A;  1OU9 A;  1ADJ A;  3CC4 Q;  4BI8 B;  2I4L A;  1GL5 A;  3A1P A;  1MUZ A;  4ME7 A;  3PMT A;  1KQS A;  3QO5 A;  2CGH A;  1ZLM A;  3BE3 A;  4WTO B;  1EX4 A;  1VQ9 T;  3OYJ A;  1BYM A;  2DEQ A;  3G7Z A;  3NFC A;  1PD1 A;  1ZA1 B;  4J8O A;  2F2W A;  4QT7 A;  4OB2 B;  3RIR A;  2VV5 A;  2CZ0 B;  5GAM j;  4RTV A;  1IRE B;  5A0L A;  2E6Z A;  4MZT A;  2JT4 A;  4MDW A;  1O9S A;  2EQI A;  2FPF A;  4LDW A;  2ESW A;  2MWO A;  5CQX A;  3OYF A;  2EGA A;  2KAF A;  3HXZ A;  3LSQ A;  3RMQ A;  3QO7 A;  5M9O A;  2KR3 A;  1B70 B;  1ABO A;  4F16 A;  1SSH A;  4A63 B;  2VC8 A;  2DJZ A;  2F2X A;  4YRM A;  1EIF A;  3E19 A;  1LYL A;  4TVW A;  7AT1 B;  1KMM A;  5GMK e;  1RL2 A;  2SRC A;  4EIK A;  3CCJ A;  4PHC A;  2K5L A;  2XKO C;  1LJO A;  5GAN d;  2PVD B;  1VA7 A;  2KNB B;  1YIT Q;  2CS7 A;  3OYK A;  3I7F A;  4PJJ A;  5GAO p;  2ROL A;  2FG0 A;  5DLQ E;  5KYU A;  1I81 A;  3WXM B;  3VS7 A;  2LX9 A;  2A3L A;  2A08 A;  3VYH B;  4GY5 A;  3HKS A;  1IHW A;  1QF6 A;  2CP2 A;  3CCE T;  2JS0 A;  2EIF A;  1KK7 A;  4PJO C;  1Q7Y U;  3EFR A;  2DYI A;  4HWP A;  4C92 D;  3R6O A;  4NS5 A;  3VS1 A;  5CVI A;  2ART A;  3QBY A;  1Z9Z A;  3VS3 A;  4CS3 A;  4C8Q G;  1SET A;  1WU7 A;  1M90 C;  1Y57 A;  4EX5 A;  3A5Z A;  4II1 A;  1IB8 A;  2DVE A;  3L1A A;  3HRU A;  4ZIB A;  1RUW A;  5ECA A;  4OMF B;  1W70 A;  1VYV A;  2VXE A;  4M7D G;  5GAN h;  1WNL A;  2RJE A;  2YUO A;  2GBQ A;  4M7A C;  4KR3 A;  4D6W A;  5GMK i;  2W0Z A;  2QEX Q;  3SEM A;  4O5V A;  4E51 A;  1JJ2 A;  1OYX A;  1WZO A;  2ZNJ A;  1WYX A;  2RNA A;  2CJ9 A;  4OGC A;  2HMA A;  4KUD K;  2GFA A;  3EGD A;  2OTJ Q;  2YRD A;  1G3W A;  2HL5 C;  1NEG A;  2COY A;  2P0P A;  1WX6 A;  3JCM f;  4C92 A;  3MP1 A;  1NYF A;  5CAI A;  2ZR2 A;  1G83 A;  3UPU A;  5LJ3 j;  2JUF A;  5C0M A;  4JUV A;  4UP9 A;  3NMZ C;  2DXT A;  2V1R A;  2DXU A;  2QAZ A;  3RL6 A;  4P75 A;  3V8J A;  3UA7 A;  1PYS B;  3L42 A;  2CIM A;  4DPG A;  4BE2 A;  1I5L A;  4N0A A;  2DYB A;  3CCR T;  4YRF A;  3QYG B;  1R77 A;  1NEB A;  2LRQ A;  4PFP A;  2RN8 A;  2BZY A;  1QVP A;  1PRL C;  2QTV A;  3M0U A;  3G4S A;  2FRW A;  1QLY A;  2XG8 D;  1VQK A;  4IUQ A;  5A2Q E;  2EBP A;  1KIK A;  1I1J A;  5LJ3 f;  4J9I A;  2RHI A;  1PCX A;  2P4T A;  2RA2 A;  3REX A;  1WHG A;  1K9M R;  2DDZ A;  1M3A A;  1QVF S;  1X75 C;  3LYI A;  1N8R R;  5HY6 A;  1TUD A;  4F7U F;  2DXB A;  4ANJ A;  1XJW B;  1B70 A;  1OUL A;  3FC3 A;  1K4U S;  3N5B B;  2A28 A;  1H64 1;  4X9D A;  1NJ5 A;  3ULR B;  2DZ9 A;  1VQ4 T;  1HTT A;  1V76 A;  2LDM A;  2QK0 A;  2XI9 A;  1VQ5 A;  4JJN K;  1YWO A;  1M8M A;  1OI1 A;  4XTU A;  2DNU A;  2HBP A;  1M90 U;  2ZIO A;  4YRP A;  1KMN A;  2ZPB B;  3KXT A;  1VQM A;  2QGG A;  4XTW A;  1BIA A;  2LJ1 A;  3A31 A;  5CKB A;  1UB4 A;  3CCU Q;  1BCO A;  2AZS A;  3HFO A;  3QWY A;  2EJ9 A;  3E9I A;  2DU5 A;  2R5M A;  1YJW A;  1UGR B;  2LC4 A;  4E6R A;  1VQ6 T;  2CSQ A;  5CKD A;  4C0G A;  1VUB A;  2NUT A;  1KSW A;  3HTR A;  3RKX A;  3G71 A;  1BK2 A;  3CC4 T;  5IHI A;  2MF2 A;  2L0A A;  5I11 A;  1UUE A;  1G2B A;  1NYQ A;  4F7U E;  2EKH A;  1T3L A;  2M9U A;  3I56 T;  2JTE A;  2RI5 A;  2YUN A;  1AWX A;  1NE8 A;  3EFO B;  2RQT A;  4DBF A;  3V8K A;  2DRK A;  1U8R A;  3JCM d;  3P8H A;  1U1S A;  4M77 F;  4QKU A;  2FO0 A;  1VIE A;  3VS6 A;  1IZ6 A;  1JXM A;  1HSQ A;  3MET A;  1PKT A;  3CME Q;  3CCQ Q;  2WAC A;  1WXU A;  4AFZ C;  2X4W A;  4Y28 E;  2C8M A;  1B07 A;  3PIP A;  3A5Y A;  1OX8 A;  3IG2 A;  1H8K A;  3G1Z A;  1EQR A;  4CC2 A;  3VS5 A;  2K57 A;  3PGG A;  2RF0 A;  2OAU A;  2DTI A;  4H2Y A;  1B76 A;  1MV0 B;  2JW4 A;  1OEB A;  3S3O A;  1SRL A;  4M75 C;  4XU1 A;  4BUG A;  1YI2 Q;  4YRG A;  2PVO B;  1GGM A;  3RNJ A;  1M3C A;  4ZGD B;  1YIT T;  4IUT A;  3TEE A;  4V2S A;  3CCM Q;  1GFD A;  4VUB A;  4GBQ A;  2CKK A;  1ABQ A;  4KGZ B;  3UWN A;  1Q86 R;  3MKD A;  3E9F A;  1RI9 A;  1UJY A;  5LJ5 f;  4A4E A;  2LX7 A;  2EYX A;  2HNI A;  2O9S A;  2D9T A;  4OGE A;  1NM7 A;  1VQL A;  5C52 B;  3E2U A;  4M77 E;  4LD6 A;  5GJV B;  4Z8A A;  2WSE E;  4JRP A;  2VGN A;  3JCM h;  4PJO D;  4UP8 A;  1EFN A;  1C1A A;  5FRN A;  2MCN A;  3URG A;  8ATC B;  4ZGE B;  3DB4 A;  4OVA A;  1LVK A;  1TH7 A;  1M9S A;  4OLF A;  1YJ9 A;  1SES A;  1WJQ A;  2YLC A;  1N9S A;  1ZUU A;  4YRC A;  2DEU A;  5FU7 C;  4J15 A;  2ZPH B;  1M1F A;  1BI2 A;  1K9M C;  3DLL A;  1YFN A;  2C0I A;  1FXX A;  2LQK A;  3JB9 J;  1N8R C;  2ZNI A;  2YHT A;  2ZT8 A;  4YRE A;  4C8Q B;  3RDV A;  1UGQ B;  3EH1 A;  2SEM A;  3CD6 A;  2DPP B;  4M7A D;  3KUF A;  5I2M A;  2J05 A;  2DLP A;  1WPY A;  5GJW B;  4F17 A;  1ZUK A;  3BY7 A;  2QEX T;  2RQU A;  4QVD A;  1VQ7 Q;  3C12 A;  4M7D B;  5IAY A;  1W1F A;  2AKL A;  2C0T A;  1WFW A;  3RAC A;  5E3I A;  3UA6 A;  1Q7Y R;  3S6W A;  2OTJ T;  2YSQ A;  3GP8 A;  4YCU A;  4OP0 A;  3PZC A;  1ZSZ B;  1PM3 A;  5J3B A;  4RTX A;  2G6F X;  2ODR C;  1N27 A;  3M4Y A;  2EAY A;  3I5S A;  2QQR A;  2J3M A;  1H4T A;  4CS2 A;  4LN2 A;  2EKO A;  1AD5 A;  3CCL A;  1JBM A;  2J6O A;  2PU9 B;  2AKK A;  4XAX B;  1WHH A;  2EFI A;  1WHM A;  2M1H A;  1YIJ Q;  5IT9 E;  4GLM A;  2BE7 D;  5IXF A;  1U06 A;  2DX1 A;  3HTZ A;  4M7A A;  4JRQ A;  3VUB A;  5GAM g;  2DXC A;  1UGS B;  3JCM X;  4M78 C;  1W4S A;  2XU8 A;  4HWT A;  2Y4Y A;  2E4H A;  4BI3 A;  1WIE A;  4UP7 A;  4OF1 A;  3FJ5 A;  3QXE B;  3CC7 Q;  4QVZ A;  2A36 A;  1Z9Q A;  2RPN A;  3JSC A;  2E65 A;  4IUU A;  3S3M A;  2KRS A;  3OYD A;  4MZM A;  4ESR A;  1KD1 R;  2E3H A;  3IAL A;  3M0T A;  5LJ5 d;  2CT4 A;  2ZZF A;  1GBR A;  5L23 A;  1SF9 A;  2GNC A;  1E7O A;  4AG1 C;  3HXY A;  2D8H A;  4N0A C;  1W2B S;  1MNE A;  4JJC A;  4KUI A;  2KEA A;  2CUB A;  2EGC A;  4RMO A;  4HVU A;  3ERR A;  4JRI A;  2DL7 A;  4BE0 A;  4LDV A;  2YXY A;  4BE1 A;  4C8Q D;  5GAO m;  3H41 A;  2DIG A;  1VIF A;  2DAQ A;  1L0W A;  1XQH A;  4RG2 A;  3CBM A;  1Q86 C;  2DBM A;  3H9N A;  1K9M U;  1RLP C;  3OS5 A;  1WQW A;  1N8R U;  1JEG A;  3CCU T;  1D3B B;  3HFZ B;  4CS4 A;  5GAN j;  1G8X A;  3RF1 A;  4AFS C;  3CC2 A;  2RQV A;  4ZGJ B;  3L2U A;  4M7D D;  4YRN A;  4JRK A;  3ZFJ A;  3J7A F;  2KE9 A;  4EO4 A;  4CH5 A;  5KYY A;  1QVF A;  4RQE A;  4J9H A;  2K5I A;  2JS2 A;  3NHN A;  5C51 B;  1ZSG A;  5I22 A;  4PKC C;  2L5Q A;  1GXI E;  1QVG P;  2MYS A;  1YP5 A;  2NS6 A;  3RER A;  5KYW A;  1VQ8 Q;  5LJ5 h;  2EVR A;  3OYN A;  1ACM B;  3ZEH A;  1QCO A;  4J9G A;  3FEO A;  5FLX E;  2QHU A;  4YPF A;  5KH6 A;  3VQW A;  4Y92 A;  3RBB B;  2ZCF B;  5GAN f;  4IIO A;  2EJF A;  3CMA A;  2ZTG A;  1TSF A;  1KOG A;  1UGP B;  4C8Q A;  2CH4 W;  1KQ1 A;  3CME T;  3CCQ T;  3V7R A;  4HWS A;  2LQW A;  3A8M B;  2HEQ A;  2ROT A;  3PE0 A;  2ZIN A;  2LZ6 B;  4HCC A;  3O5Z A;  3CPW P;  2YT6 A;  2K5F A;  2NLU A;  2JMA A;  3JCM W;  4F7U G;  2DET A;  1HC7 A;  4M7D A;  4UPA A;  1WDX A;  2IPO B;  1EFW A;  3OW2 S;  2ZAE A;  1KQS P;  3M58 A;  3EFS A;  4M75 D;  1VQM Q;  1UTI A;  1YJN Q;  1T0H A;  1YI2 T;  1WXT A;  2ZPE B;  4MZP A;  3HXX A;  5LJ3 g;  1ZSZ A;  2ECZ A;  2HBW A;  1YJW Q;  4HXJ A;  2VB6 A;  1E22 A;  1PG5 B;  1H4V B;  1JRI A;  3CCM T;  2GF7 A;  4RTT A;  1G51 A;  3IQL A;  1W66 A;  1VQN A;  3DKM A;  1X43 A;  4LDU A;  4TTV A;  1EVL A;  4C5H A;  4C92 F;  5FW9 A;  3KBG A;  4JS5 A;  1WJS A;  2DL3 A;  2O01 E;  5GAO r;  4E7Z A;  1U5S A;  2GQV A;  2VXF A;  1I5O B;  3M9Q A;  2KYM A;  2IY5 B;  4NL3 A;  1KHI A;  4CI0 C;  3OMC A;  2RHQ B;  3I35 A;  2BIV A;  4YYE A;  3UGT A;  1X2G A;  3QHS A;  2ZXF A;  2DBK A;  2X9H A;  1FYF A;  5FWC A;  3VS4 A;  2CP6 A;  1RLQ C;  3OA6 A;  1G5H A;  4N4G A;  3L4G B;  5GMK h;  2JJ9 A; 
#chains in the Genus database with same CATH homology
 1Q86 U;  1KD1 C;  4FT2 A;  3RMS A;  3X25 B;  1LOJ A;  4P3P A;  4H2T A;  3PIO A;  4HA8 A;  4M75 A;  4A4G A;  4EMK C;  3OYL A;  4KQE A;  3M54 A;  2A8E A;  4M77 G;  3CBP A;  3LGF A;  1SSF A;  2XDB A;  5GAN 7;  3OYC A;  3PMI A;  2LT1 A;  4A53 A;  4L59 A;  4C92 E;  2P5I A;  4LVI A;  1BI0 A;  1Y96 B;  1VQ9 A;  1VQ7 T;  4RCC A;  5GAN 5;  2KSS A;  1E24 A;  3GOX A;  3LLR A;  2X4Y A;  4EPC A;  5CCA A;  2ODR D;  4XU2 A;  3HFZ A;  2ZCE A;  3MHX A;  4Q5W A;  1R8O B;  5KCO A;  1WQ7 A;  3OYH A;  3QNE A;  2R58 A;  3X24 B;  2AKW B;  4E7J A;  1QE0 A;  3L2R A;  5L8R E;  2HQE A;  3INZ A;  1YIJ T;  4RDX A;  4M78 D;  3QO3 A;  2Y4X A;  3A32 A;  3GF5 A;  3X26 B;  4L5G A;  4ELY C;  4KUL A;  4H2X B;  1EIY B;  3CC7 T;  2RB6 A;  1H4Q A;  4YP0 A;  2QA4 T;  3NEL A;  3JCM J;  4ZN3 A;  4TVA B;  2E5A A;  4KR2 A;  3JB9 D;  3M55 A;  4P71 A;  1NYR A;  3OS2 A;  1NPR A;  3M4P A;  3L2Z A;  3CCE A;  4YRK A;  3VKI A;  4TWA A;  2IVW A;  2CJA A;  5GAO l;  1QW1 A;  4E7K A;  5EG2 A;  4PLI A;  2XDD A;  3CPF A;  2V8I A;  4ZN1 A;  3FB9 A;  4P72 A;  3HP9 A;  4M78 A;  1KD1 U;  4PLL A;  4P3O A;  1MGQ A;  2DQ0 A;  3PTA A;  2IY5 A;  3SB2 A;  2DO3 A;  3M53 A;  3FDR A;  5LL6 S;  1E1O A;  4EMK B;  4CH6 A;  3T9N A;  5D6X A;  4G84 A;  3SD4 A;  1X6O A;  3A8L B;  4JS4 A;  2ZPI B;  4HT9 A;  1W2B A;  1VQ8 T;  3QPH A;  4K87 A;  4YRS A;  4YCW A;  2CZ7 B;  5KE2 A;  1M1G A;  4R55 A;  5KCH A;  4AH6 A;  3VUZ A;  2ZZD A;  3VQX A;  3MF2 A;  4E7H A;  1U1T A;  2JTF A;  4ATO A;  3CCR A;  3QJ6 A;  2ALY B;  4K86 A;  3CXC S;  4LD9 K;  1VQM T;  2JVV A;  4Y91 A;  1NJ1 A;  1YJN T;  4F7U B;  4PJO F;  2QHV A;  1YJW T;  1G5I A;  4C8Q C;  3MEU A;  1NJ2 A;  4TQF A;  4YRR A;  4YRQ A;  2FB7 A;  2DU7 A;  2VGM A;  2LNV A;  1USY A;  1ZQ1 A;  4PL6 A;  2RM4 A;  1VQ4 A;  1KC8 C;  4M7D C;  1JJC B;  2FYK A;  2ZZG A;  5C53 B;  5IN1 A;  1DJ7 B;  1X01 A;  1K73 C;  4M7A F;  4H2X A;  1EIY A;  2RHZ A;  1PSF A;  2P0K A;  3NEN A;  3OW2 A;  4YRL A;  3QSU A;  2RI3 A;  5GMK m;  3CCS T;  4TVA A;  2DTO A;  1VQ6 A;  3SWN B;  2ZPF B;  4BAC A;  1ZHI A;  4DOW A;  4PJO E;  5C6S A;  3E1S A;  2HD0 A;  4J6X A;  4MMK A;  3VQV A;  4E47 A;  5LJ5 j;  2RH2 A;  3I56 A;  4K88 A;  1KG1 A;  1WGS A;  2QI2 A;  4M77 B;  2WSF E;  4ZTU B;  3A74 A;  3P8B B;  5DLO A;  5GAM e;  3LW5 E;  5GAN g;  4N4I A;  4B9W A;  4CH3 A;  3V7S A;  1XNI A;  5K1X A;  3OS1 A;  4PNO A;  5GAN 2;  4YTL A;  4M7A E;  1WJR A;  1HXD A;  3I55 T;  3CCV T;  4EMK A;  1E1T A;  2F69 A;  3LC0 A;  5K1P A;  2YRV A;  4J7I A;  4C92 G;  1O75 A;  2EWN A;  1PYS A;  3QDR B;  2FVU A;  3OYY A;  2XID A;  1S72 T;  3HRS A;  3DSQ A;  1BBW A;  5I2S A;  2C06 A;  3REU A;  1YIT A;  1VQP T;  3CD6 T;  4IUP A;  3A8H B;  3TEH B;  3OY9 A;  1MHN A;  4FM4 B;  2J3L A;  1N6A A;  2KQW A;  5HKC A;  2E64 A;  3JRZ A;  3G6E T;  3UGQ A;  3ASK A;  3HXW A;  1KC8 U;  3TRE A;  4J6W A;  5I21 A;  2I4M A;  5GMK j;  4BI4 A;  3BDU A;  1PSE A;  4J7F A;  2JNG A;  2HQX A;  4WF2 A;  3GPL A;  1K73 U;  3QII A;  3MP6 A;  1X55 A;  3QJY A;  3CCL T;  4P71 C;  4XTZ A;  3OYM A;  3OYA A;  2B8A A;  4P73 A;  3OMG A;  2ZIM A;  3QZ5 B;  1JJC A;  4O2D A;  4Q6G A;  3UFG A;  2QEX A;  3TUP A;  4IUV A;  3UDC A;  4C8Q E;  3NTI A;  3V7C A;  3MQZ A;  4P72 C;  2F5K A;  1YHQ T;  4NCX A;  3NTH A;  3PT9 A;  5LJ3 e;  3SWN A;  4M7D E;  3A7U A;  4Q15 A;  4M75 F;  4TVY A;  3MEW A;  4C0D B;  2ZGW A;  3S3N A;  3DLM A;  3X20 B;  2EQM A;  4A54 A;  2QQ9 A;  2V8K A;  3QZ9 B;  4KT0 E;  2RHU A;  1J5W A;  1G3Y A;  3QTC A;  4H2W A;  4Z02 A;  4XU0 A;  3HRT A;  4YRJ A;  4QW2 A;  2K3X A;  4B9X A;  1ADY A;  3FRN A;  1H4S A;  4X5O A;  4LVJ A;  3J80 E;  5GAN 4;  2QDY B;  4R56 A;  5ELN A;  3LWI A;  2K2V A;  4MDX A;  5AYF A;  2ZR3 A;  1XTD A;  3H8Z A;  1C0A A;  3MO8 A;  2ZT5 A;  4M75 E;  2OTL T;  4G85 A;  3M59 A;  3P8Y A;  3VU3 C;  3PCO B;  3JCM V;  2FHD A;  1I4K 1;  4QQG A;  5GMK l;  2XIC A;  3JCM c;  5D6Y A;  3CXC A;  2BKD N;  3JCM g;  4TQD A;  4LVL A;  3CCU A;  3TEH A;  1Y71 A;  2RK2 A;  1VQO T;  1USY C;  2K3Y A;  2RHY A;  4OB0 B;  3HXV A;  3RKW A;  3RES A;  3RUX A;  4P5N A;  2QTX A;  4L87 A;  4XTV A;  3NTK A;  3CMQ A;  2PME A;  3MF1 A;  4HT4 A;  1ASY A;  1Q81 C;  2ZT7 A;  5CK9 A;  4YDQ A;  2QHS A;  2PUO B;  5CKH A;  4FU6 A;  1BIB A;  4LNS A;  3ER0 A;  4XU3 A;  3CME A;  1QP3 A;  4PJO G;  4WI1 A;  4XTY A;  2CZ1 B;  3ICA A;  2RK1 A;  1XOV A;  4WJ3 M;  1YCY A;  2Q5H A;  2Y90 A;  3JB9 F;  3AHU A;  2JOY A;  3M4Q A;  1Z7M A;  4N4H A;  3CBO A;  4RMF A;  4C92 B;  1YI2 A;  2KDS A;  4H2U A;  2Q5I A;  2IG0 A;  3E9G A;  3VV0 A;  1ZBX A;  3CCM A;  4M7A G;  3JB9 I;  3L2V A;  2E6N A;  4FIB A;  2DZC A;  1I8F A;  1RI0 A;  4H2S A;  1NJI C;  4MML A;  4DQ2 A;  4M78 E;  2LVM A;  4A4H A;  3WQZ A;  2LCC A;  3CCJ T;  2E10 A;  4OB1 B;  4BW9 A;  3OS0 A;  2JTM A;  4BD3 A;  11AS A;  4XK8 E;  2GCX A;  3GNG A;  2M16 A;  3HXU A;  2MMP A;  2K4Y A;  1D3B A;  3M57 A;  2ZT6 A;  1N9W A;  2R57 A;  5GAO n;  2E1H A;  1M1K C;  2L8D A;  3UT1 A;  3O8V A;  4ZTJ A;  2AHJ B;  1HK9 A;  5GAM f;  4L6V 5;  1VQ7 A;  3PCO A;  3QKJ A;  4P3N A;  2CZ6 B;  1Q81 U;  2Q7H A;  3FIF A;  5HK0 A;  2PQW A;  2O4X B;  4P73 C;  3OYG A;  1G5V A;  2P0L A;  5CR2 A;  2BUD A;  2I2L A;  5LJ5 g;  3A7R A;  2HAX A;  3IKL A;  2WSC E;  3C95 A;  2QXF A;  2I4O A;  1YIJ A;  2LCL A;  4HWR A;  1X56 A;  2RJD A;  5FU6 B;  2H3J A;  4BB7 A;  3M5A A;  3L2Q A;  2C7I A;  1KHC A;  5ELO A;  4C5G A;  3BJU A;  3TU4 K;  3LGL A;  4BY6 B;  3CC7 A;  4EDU A;  2QA4 A;  3V8L A;  3SWN C;  1RIQ A;  3OBY A;  2A7Y A;  2D0Q B;  2E70 A;  2QQA A;  3LH0 A;  3SFM A;  4H02 A;  4X34 A;  4UC4 A;  2L89 A;  3WVE B;  2LTO A;  2M0O A;  2D6F A;  2ARS A;  2QQB A;  2CJB A;  1B34 B;  4KBM B;  1NJI U;  4M77 C;  2RHQ A;  1YB3 A;  2E3C A;  3M56 A;  3G4S T;  4HCZ A;  2KVQ G;  1QP2 A;  1IL2 A;  1VQK T;  1SER A;  4H2V A;  1ATI A;  3DB3 A;  3L4G A;  2MI6 A;  1VQZ A;  1G3T A;  5GAN e;  4J6Y A;  12AS A;  1B8A A;  4GLK A;  1OZ2 A;  3OSS C;  2EJG A;  4RQF A;  3J81 E;  3HY1 A;  1M1K U;  3A8G B;  4M75 G;  3VYG A;  1VQ5 T;  5GAM d;  1X2H A;  1Y96 A;  5KNN A;  1VQ8 A;  2LT4 A;  5CO7 A;  1FX7 A;  2QHT A;  4TVR A;  3MCA B;  1YGB A;  5GAN 3;  1B7Y B;  2RHS B;  1H3Z A;  2G3R A;  2EQK A;  4C5I A;  4HKE A;  3HSB A;  2EQJ A;  3JCM Q;  2QQS A;  5KE3 A;  3OYE A;  3G71 T;  2AKW A;  2GFU A;  4P74 A;  4QQ6 A;  4BDY A;  3TEG A;  2VYT A;  4PJO B;  2E5Q A;  1NPP A;  2KK4 A;  3VQY A;  1BI1 A;  1WYD A;  4YCV A;  4RG8 A;  3P8T A;  1NZ9 A;  4OB3 B;  1YJN A;  1EOV A;  2PUK B;  2ZZE A;  2RHX A;  3H6Z A;  4DOV A;  1G3S A;  5GAM h;  1Y07 A;  2O4X A;  4YRO A;  1QVG S;  1YFT A;  2FL7 A;  3A8O B;  5DY9 A;  4XQ3 A;  4HVC A;  2DQ3 A;  2XTI A;  3QUI A;  4M7A B;  3HFV A;  3CC4 A;  3QO8 A;  3IKM B;  3MEY A;  2JN0 A;  4CRI A;  2JZ2 A;  3NEM A;  2E12 A;  5GAN 8;  4YRI A;  1Q82 C;  3CPW S;  3CCS A;  4C0D C;  4J5Y A;  5A0G A;  4WJ4 A;  4RKU E;  5GAO q;  4ZTF A;  1YFS A;  1Z7N A;  1KQS S;  1FWZ A;  2YLB A;  4JLI A;  1VQL T;  4M78 G;  1B34 A;  2EYQ A;  5CKF A;  1YJ9 T;  5A0D A;  1M4Z A;  4RCB A;  5LJ3 d;  3R07 A;  3ZBD A;  3NET A;  2KY9 A;  2DD5 A;  3JB9 G;  3PFS A;  1UEB A;  1NNH A;  1K8A C;  1WLE A;  3VJP A;  3I55 A;  4QQD A;  3CCV A;  2DK3 A;  4C8Q F;  5HGQ A;  4YRT A;  2P0Q A;  4ELZ C;  2DD4 A;  2RI2 A;  2V8J A;  3MP8 A;  4JLG A;  4C5E A;  3LX7 A;  1S72 A;  2ALY A;  3M4G A;  4FSX A;  4HWO A;  5CQY A;  3QG1 A;  3PNW C;  4M7D F;  2XK0 A;  1B7Y A;  4IUR A;  2RHS A;  1VQP A;  1LNX A;  4F7U A;  5FRM A;  4HT8 A;  1AHJ B;  2G4C A;  3JCM e;  3OB9 A;  5LJ3 h;  1EVK A;  3MEV A;  2MAM A;  5J26 A;  3G6E A;  4M77 D;  2EQU A;  3OYI A;  3BFM A;  4E7L A;  4DA4 A;  3RGL A;  4PJO A;  4BWA A;  4EMG A;  5GAN 6;  2DKG A;  4J83 A;  5F5W A;  2X4X A;  3F70 A;  5CKE A;  4IKF A;  3HFN A;  3QYH B;  4XTX A;  2DIQ A;  3EAE A;  3HHT B;  5CIU A;  1Q82 U;  5J39 A;  2OTJ A;  2AMC B;  1YBY A;  4QVC A;  5DM7 R;  2E41 A;  3WVD B;  2RJC A;  4LVM A;  1JJ2 S;  1YFR A;  4XEO A;  3JCM b;  2X35 A;  3C4S A;  3GLX A;  1NJ8 A;  3VBB A;  3JCM P;  3HY0 A;  4C92 C;  3UH0 A;  3P8V A;  4M77 A;  3SDZ A;  2XD0 A;  1BI3 A;  1N9R A;  1YHQ A;  5HK3 A;  4NOY A;  4M75 B;  3OD1 A;  5FRO A;  2Q7G A;  1M5Q 1;  4BDZ A;  4EMH A;  3FJP A;  4P75 C;  3CC2 T;  1JB0 E;  3P8D A;  1K8A U;  2CYZ B;  3W3S A;  2RO0 A;  3OQ5 A;  3OSV A;  4NL2 A;  4C0F A;  3HRI A;  4FL6 A;  3LWH A;  3A7A A;  2I4N A;  2MWP A;  3X28 B;  5FU7 B;  3CMA T;  3OBW A;  1Y7X A;  2PVG B;  3OYB A;  2ARU A;  3GNF B;  3MEA A;  2RJF A;  1BBU A;  3E9H A;  3RKY A;  1X54 A;  4LDX A;  1BKB A;  2PMF A;  3JB9 H;  4XEM A;  4P74 C;  3KFU A;  1SRY A;  3BDL A;  5D6W A;  2XDP A;  2VUB A;  4LDY A;  3L2W A;  3C94 A;  2OTL A;  4O6J A;  2L3R A;  4X9C A;  4CH4 A;  3A5Z B;  2F5T X;  2XHC A;  3HPW A;  3CEY A;  4PG3 A;  2KMT A;  2X4J A;  1VQN T;  4C0Z A;  2EL9 A;  3FLG A;  1VQO A;  2ZPG B;  4M78 F;  2R5A A;  3CCQ A;  3BW1 A;  2DTH A;  4E7I A;  4FT4 A;  4A4K A;  1QVG A;  5FU6 C;  5LJ5 e;  4JDS A;  1Q7Y C;  1OZ3 A;  2Q7E A;  3TCJ A;  1P92 A;  3HRK A;  4ZTZ B;  1M8V A;  3Q1J A;  4BY6 C;  3JAM E;  4HCB A;  2LQ8 A;  4M78 B;  3LSS A;  3ME9 A;  1KQ2 A;  2AMC A;  2RD1 A;  3HL8 A;  1ASZ A;  2XGT A;  4A4F A;  3CPW A;  1NJ6 A;  3GIB A;  1V29 B;  4LVK A;  1ADJ A;  2I4L A;  4BI8 B;  4ME7 A;  3PMT A;  1KQS A;  3QO5 A;  2CGH A;  1VQ9 T;  3OYJ A;  1BYM A;  2DEQ A;  3G7Z A;  3NFC A;  4J8O A;  4OB2 B;  3RIR A;  2VV5 A;  2CZ0 B;  5GAM j;  1IRE B;  5A0L A;  2E6Z A;  4MZT A;  4MDW A;  1O9S A;  4LDW A;  2MWO A;  5CQX A;  3OYF A;  2KAF A;  3HXZ A;  3LSQ A;  3RMQ A;  3QO7 A;  5M9O A;  1B70 B;  2VC8 A;  2DJZ A;  4YRM A;  1EIF A;  3E19 A;  1LYL A;  4TVW A;  1KMM A;  5GMK e;  1RL2 A;  3CCJ A;  4PHC A;  2K5L A;  2XKO C;  1LJO A;  5GAN d;  2PVD B;  2CS7 A;  3OYK A;  3I7F A;  5GAO p;  5DLQ E;  1I81 A;  3WXM B;  2LX9 A;  2A3L A;  3VYH B;  4GY5 A;  3HKS A;  1QF6 A;  3CCE T;  2EIF A;  4PJO C;  1Q7Y U;  3EFR A;  4HWP A;  4C92 D;  3R6O A;  4NS5 A;  5CVI A;  2ART A;  3QBY A;  4CS3 A;  4C8Q G;  1SET A;  1WU7 A;  1M90 C;  4EX5 A;  3A5Z A;  4II1 A;  2DVE A;  3L1A A;  3HRU A;  4ZIB A;  4OMF B;  2VXE A;  4M7D G;  5GAN h;  1WNL A;  2RJE A;  4M7A C;  4KR3 A;  4D6W A;  5GMK i;  4O5V A;  4E51 A;  1JJ2 A;  1OYX A;  2ZNJ A;  2CJ9 A;  4OGC A;  4KUD K;  2GFA A;  1G3W A;  3JCM f;  2P0P A;  4C92 A;  3MP1 A;  5CAI A;  2ZR2 A;  3UPU A;  5LJ3 j;  2JUF A;  5C0M A;  4JUV A;  4UP9 A;  2DXT A;  2DXU A;  3RL6 A;  4P75 A;  3V8J A;  1PYS B;  3L42 A;  2CIM A;  4DPG A;  4BE2 A;  1I5L A;  4N0A A;  3CCR T;  4YRF A;  3QYG B;  2LRQ A;  1QVP A;  3G4S A;  2XG8 D;  1VQK A;  4IUQ A;  5A2Q E;  5LJ3 f;  2RHI A;  2P4T A;  2RA2 A;  3REX A;  2DDZ A;  1QVF S;  1X75 C;  3LYI A;  5HY6 A;  4F7U F;  2DXB A;  1B70 A;  3FC3 A;  3N5B B;  1H64 1;  4X9D A;  1NJ5 A;  2DZ9 A;  1VQ4 T;  1HTT A;  2LDM A;  2XI9 A;  1VQ5 A;  4JJN K;  1OI1 A;  4XTU A;  2HBP A;  1M90 U;  2ZIO A;  4YRP A;  1KMN A;  2ZPB B;  3KXT A;  1VQM A;  4XTW A;  1BIA A;  3A31 A;  5CKB A;  1UB4 A;  3HFO A;  2EJ9 A;  3E9I A;  2DU5 A;  2R5M A;  1YJW A;  1UGR B;  2LC4 A;  1VQ6 T;  5CKD A;  4C0G A;  1VUB A;  3RKX A;  3G71 A;  3CC4 T;  2MF2 A;  1NYQ A;  4F7U E;  3I56 T;  2M9U A;  2RI5 A;  1NE8 A;  3V8K A;  1U8R A;  3JCM d;  3P8H A;  1U1S A;  4M77 F;  1VIE A;  1IZ6 A;  3MET A;  2WAC A;  2X4W A;  4Y28 E;  2C8M A;  3PIP A;  3A5Y A;  3IG2 A;  3G1Z A;  1EQR A;  2K57 A;  3PGG A;  2OAU A;  2DTI A;  4H2Y A;  1B76 A;  3S3O A;  4M75 C;  4XU1 A;  4BUG A;  4YRG A;  2PVO B;  1GGM A;  4ZGD B;  1YIT T;  4IUT A;  3TEE A;  4V2S A;  4VUB A;  2CKK A;  3UWN A;  3E9F A;  5LJ5 f;  4A4E A;  2HNI A;  2D9T A;  4OGE A;  1VQL A;  5C52 B;  4M77 E;  4LD6 A;  2WSE E;  4JRP A;  2VGN A;  3JCM h;  4PJO D;  4UP8 A;  5FRN A;  3URG A;  4ZGE B;  3DB4 A;  4OVA A;  1M9S A;  1TH7 A;  4OLF A;  1YJ9 A;  1SES A;  1WJQ A;  2YLC A;  1N9S A;  4YRC A;  5FU7 C;  4J15 A;  2ZPH B;  1M1F A;  1BI2 A;  1K9M C;  3DLL A;  1FXX A;  2LQK A;  3JB9 J;  1N8R C;  2ZNI A;  2YHT A;  2ZT8 A;  4YRE A;  4C8Q B;  1UGQ B;  3CD6 A;  2DPP B;  4M7A D;  3KUF A;  5I2M A;  1WPY A;  3BY7 A;  2QEX T;  4QVD A;  3C12 A;  4M7D B;  5IAY A;  3RAC A;  5E3I A;  3S6W A;  2OTJ T;  4YCU A;  3GP8 A;  4OP0 A;  3PZC A;  5J3B A;  2ODR C;  1N27 A;  3M4Y A;  2EAY A;  2QQR A;  2J3M A;  1H4T A;  4CS2 A;  2EKO A;  3CCL A;  1JBM A;  2PU9 B;  4XAX B;  2EFI A;  2M1H A;  5IT9 E;  3HTZ A;  4M7A A;  4JRQ A;  3VUB A;  5GAM g;  2DXC A;  1UGS B;  3JCM X;  4M78 C;  1W4S A;  2XU8 A;  4HWT A;  2Y4Y A;  4BI3 A;  4UP7 A;  4OF1 A;  3QXE B;  4QVZ A;  3JSC A;  2E65 A;  4IUU A;  3S3M A;  3OYD A;  4MZM A;  3IAL A;  5LJ5 d;  2ZZF A;  3HXY A;  4N0A C;  1W2B S;  4KUI A;  4RMO A;  3ERR A;  4JRI A;  4BE0 A;  4LDV A;  4BE1 A;  4C8Q D;  5GAO m;  2DIG A;  1VIF A;  2DAQ A;  1L0W A;  1XQH A;  4RG2 A;  3CBM A;  1Q86 C;  1K9M U;  3OS5 A;  1WQW A;  1N8R U;  3CCU T;  1D3B B;  3HFZ B;  4CS4 A;  5GAN j;  3RF1 A;  3CC2 A;  4ZGJ B;  3L2U A;  4M7D D;  4YRN A;  4JRK A;  3ZFJ A;  3J7A F;  4EO4 A;  4CH5 A;  1QVF A;  4RQE A;  2K5I A;  5C51 B;  4PKC C;  2L5Q A;  1GXI E;  2NS6 A;  3RER A;  5LJ5 h;  3OYN A;  3ZEH A;  3FEO A;  5FLX E;  2QHU A;  4YPF A;  5KH6 A;  3VQW A;  2ZCF B;  5GAN f;  2EJF A;  3CMA A;  2ZTG A;  1KOG A;  1UGP B;  4C8Q A;  1KQ1 A;  3CME T;  3CCQ T;  3V7R A;  4HWS A;  3A8M B;  2ZIN A;  4HCC A;  2K5F A;  2NLU A;  3JCM W;  4F7U G;  1HC7 A;  4M7D A;  4UPA A;  1EFW A;  3OW2 S;  3M58 A;  3EFS A;  4M75 D;  1YI2 T;  2ZPE B;  4MZP A;  3HXX A;  5LJ3 g;  1E22 A;  1H4V B;  1JRI A;  3CCM T;  2GF7 A;  1G51 A;  1W66 A;  1VQN A;  3DKM A;  4LDU A;  4TTV A;  1EVL A;  4C5H A;  4C92 F;  3KBG A;  4JS5 A;  1WJS A;  2O01 E;  5GAO r;  2GQV A;  2VXF A;  3M9Q A;  2IY5 B;  4NL3 A;  1KHI A;  4CI0 C;  3OMC A;  2RHQ B;  2BIV A;  4YYE A;  3UGT A;  1X2G A;  3QHS A;  2ZXF A;  1FYF A;  3OA6 A;  1G5H A;  4N4G A;  3L4G B;  5GMK h; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...