1WQWA

Crystal structure of biotin protein ligase from pyrococcus horikoshii ot3 in complex with biotinyl-5-amp
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
235
structure length
235
Chain Sequence
b'MLGLKTSIIGRRVIYFQEITSTNEFAKTSYLEEGTVIVADKQTMGHGRLNRKWESPEGGLWLSIVLSPKVPQKDLPKIVFLGAVGVVETLKEFSIDGRIKWPNDVLVNYKKIAGVLVEGKGDKIVLGIGLNVNNKVPNGATSMKLELGSEVPLLSVFRSLITNLDRLYLNFLKNPMDILNLVRDNMILGVRVKILGDGSFEGIAEDIDDFGRLIIRLDSGEVKKVIYGDVSLRFL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords biotin--[acetyl-CoA-carboxylase] ligase
publication title Crystal Structures of Biotin Protein Ligase from Pyrococcus horikoshii OT3 and its Complexes: Structural Basis of Biotin Activation
pubmed doi rcsb
source organism Pyrococcus horikoshii
molecule tags Ligase
total genus 66
structure length 235
sequence length 235
chains with identical sequence B
ec nomenclature ec 6.3.4.15: Biotin--[biotin carboxyl-carrier protein] ligase.
pdb deposition date 2004-10-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02237 BPL_C Biotin protein ligase C terminal domain
A PF03099 BPL_LplA_LipB Biotin/lipoate A/B protein ligase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 1wqwA02
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 1wqwA01
1EVKA 3HFZB 3A7UA 3JCMJ 4M7DE 1SERA 4M7DA 3HFOA 4KR2A 5GAN3 2EL9A 4F7UB 2IY5B 4PJOE 1E1OA 1W66A 4C92B 3CMQA 2DEQA 4PJOA 1KMNA 3QO3A 1B70B 4C92C 2ZGWA 4H2TA 2E5AA 5GAMd 4H02A 3VU3C 4EMKA 5GAOn 2ALYA 5KNNA 4M7AE 3SWNA 3AHUA 4M7AA 4YRKA 3V7CA 4P72C 1Y96B 4M77G 3PCOB 2EJFA 3NEMA 4F7UF 3JCMd 3HY1A 3QTCA 4CH5A 4C92F 5LJ3e 2XTIA 3M4QA 1Z7MA 4H2YA 4YYEA 1YGBA 5GMKe 3V8JA 5GAMe 5GANj 3JB9H 2ZT6A 4XEMA 3JCMP 4XTXA 4CH4A 1LNXA 4RDXA 1MGQA 4PJOG 1HC7A 2DU7A 4H2WA 2ARTA 5F5WA 1USYA 4RQFA 1GGMA 3LSQA 5GMKi 3EFRA 4M75B 5GAMf 3MF2A 4TQDA 4H2XA 3UGQA 1RIQA 4C92D 4EMHA 2P0LA 4PG3A 1EVLA 4M75C 4J5YA 4M7AG 4YRIA 4CH3A 1HK9A 4XQ3A 1ADYA 4TVYA 2AKWA 4P74C 4QVDA 1WQWA 3JCMf 3PGGA 4Q6GA 2J3MA 1WU7A 3P8YA 1NYQA 3JCMV 4Y91A 4NL3A 2Q7GA 1H4QA 4M75F 3TEHB 4XEOA 4P71A 5E3IA 4EX5A 4DPGA 1I81A 5DY9A 1M5Q1 2QHVA 3RERA 2Q7HA 1X56A 5K1XA 4Q15A 5GANh 3HFVA 3NELA 2QTXA 5GMKj 3BDUA 4M78B 5GAMj 3M4GA 4K88A 1L0WA 1D3BB 1KQ1A 3HXYA 4NCXA 4BWAA 4TVAB 4F7UG 3IKLA 4KR3A 2RA2A 4M78C 4C92G 2PMEA 4M75D 3JB9I 5GANd 4C8QB 3IG2A 4CS2A 2JN0A 3RKWA 4XTWA 2DZCA 3P8TA 4V2SA 4C8QC 2ARUA 4HWOA 2Q5IA 3BW1A 5LJ5g 4E51A 2DKGA 2ZIOA 4XTVA 3VQWA 4M78F 4HWTA 1ADJA 4P3OA 4TTVA 2DXTA 1NJ2A 2RB6A 3VQVA 4N0AC 4OP0A 4C8QF 2DQ3A 2E3CA 4HWPA 1N9WA 4M77A 2J3LA 4M7DF 2EJGA 3L4GB 5GMKl 4J6YA 3HRIA 4XTUA 5GANf 2ZT5A 3HFNA 2DQ0A 4M78D 4YCWA 1JJCA 5GMKh 5GAMh 1BBWA 4ZIBA 1ASZA 4YRFA 4HT9A 3IKMB 2FB7A 1B7YB 1C0AA 1NJ6A 5GAN8 1B34B 3IALA 2DZ9A 4XU0A 5LJ3d 4C8QD 3HXWA 3RESA 3NETA 3TEGA 5CAIA 4M7DD 2E64A 4JLIA 2QHUA 4YRQA 3WQZA 3JCMh 2FYKA 1M8VA 4HWSA 4J15A 1USYC 1X55A 2RHQB 3SB2A 5I21A 4JRIA 1BIBA 1N9SA 2CJ9A 2QHTA 4YRRA 2HNIA 3FJPA 2ZNJA 1YFSA 2AMCB 3BJUA 1U1SA 2YHTA 4YRCA 1NNHA 4YCUA 4XTYA 3V7SA 1KOGA 4UP8A 2E10A 1X2GA 3JCMW 3JB9G 2ZTGA 3RACA 1U1TA 5LJ5d 4KQEA 3V8KA 4YDQA 3JCMX 2RHSB 4YREA 2DXUA 5LJ3f 4XTZA 2E65A 1NJ8A 5GAOq 3HXXA 3FIFA 1ATIA 2DTIA 3HFZA 4EO4A 5C53B 3QO7A 3VBBA 1VQZA 4UP9A 1N9RA 4X9CA 4TQFA 4BW9A 2I4OA 1IL2A 4F7UE 4WI1A 5GAOm 3MEYA 4C92E 4F7UA 3I7FA 5GAN2 2IY5A 4C92A 4HT8A 2DVEA 5LJ5e 2DU5A 1B70A 2QHSA 4P75A 4HVCA 4RMFA 2ZXFA 3RKXA 2Y90A 4P72A 2ZNIA 2CGHA 4YCVA 2DJZA 5LJ5f 1X54A 1Y96A 4HWRA 3PCOA 4YPFA 1EOVA 1YFTA 3RGLA 2ARSA 4YRJA 5LJ3j 4OLFA 3A5ZA 4CS3A 1KQ2A 11ASA 4DQ2A 1YB3A 3HXUA 3UGTA 2RM4A 3VQYA 3BY7A 4M77B 4UP7A 1HTTA 3M4PA 3QSUA 3ICAA 3L1AA 12ASA 4M77C 5GAN4 2E41A 4M75E 2I4MA 4M7DB 4K86A 4M75A 1JBMA 4P74A 4XU2A 4M7DC 4PJOB 4G85A 3E9IA 4K87A 5ELOA 4PHCA 2ODRC 5LJ5j 1E22A 4MMKA 4PJOC 1X01A 4M77F 4J6XA 4EMKB 4XU3A 3JCMg 1H4VB 1QE0A 2ALYB 1QF6A 1WLEA 3SWNB 1I4K1 4M7AB 4H2SA 4O2DA 4EMKC 4XU1A 3R07A 3SWNC 3TEHA 3REXA 4RCCA 4M7AC 5ELNA 1E24A 5LJ3h 2I4LA 1BIAA 1B76A 4PJOF 1EQRA 3HXVA 2P5IA 1G51A 4M75G 1E1TA 4P73A 4M77D 2I4NA 4M78E 4A53A 1H4TA 4M78A 1EIYA 5GAN5 2RD1A 2Q5HA 5HGQA 2ZT8A 2PMFA 4M7AF 2YLBA 4QVCA 2ZZEA 4G84A 3INZA 4C8QE 1NYRA 1JRIA 4C8QA 2ODRD 4H2XB 4RCBA 4PJOD 2CJAA 3A7RA 3RL6A 1WPYA 1H4SA 3MF1A 5GAOr 5LJ5h 4NL2A 2AKWB 4H2VA 5GAOp 1I5LA 2EJ9A 2CIMA 4TVWA 5C52B 4N0AA 3JCMc 1Z7NA 4L87A 3L2ZA 1SRYA 4M7AD 3BFMA 3HXZA 2DDZA 1WNLA 2ZT7A 4P75C 4YRSA 1NJ1A 3E9HA 3ERRA 4LNSA 2ZZFA 4NOYA 1ASYA 4M78G 4MMLA 2ZZGA 1PYSA 3JCMQ 1X2HA 1SESA 2ZIMA 4YRPA 2I2LA 2C7IA 1FYFA 1YFRA 3L4GA 3JCMb 3A7AA 4JRKA 4P71C 3QHSA 4P3NA 4C8QG 5GANg 4YP0A 3UH0A 4M7DG 2CJBA 4YRTA 2K57A 1B7YA 1B34A 1WQ7A 4AH6A 3QNEA 3UFGA 1YCYA 3A31A 2E1HA 1J5WA 4CH6A 3QO8A 3QUIA 2G4CA 3JCMe 3P8VA 2Q7EA 2VC8A 5GAN7 4UPAA 2RHQA 3NENA 3JB9J 2XGTA 2ZR3A 3RIRA 1LOJA 2VXFA 5K1PA 2EWNA 2AMCA 1G5HA 3GIBA 1B8AA 3G1ZA 4ZTUB 4PNOA 1LJOA 3RF1A 3V7RA 4H2UA 4YRMA 1BBUA 3QO5A 4JUVA 3A74A 4HA8A 2DTHA 1WYDA 2RHSA 5LJ3g 1LYLA 3DSQA 5GAOl 1HXDA 1JJCB 5GAMg 2ZR2A 1KMMA 2VXEA 4TWAA 1SETA 3HRKA 5GMKm 3KFUA 3HSBA 1EIYB 4P73C 1H641 2DTOA 3OD1A 5GAN6 4EMGA 1NJ5A 4YRNA 4YROA 4X5OA 4YRGA 1G5IA 1TH7A 4P3PA 4RQEA 1EFWA 3W3SA 3FB9A 2ZINA 4YRLA 3TUPA 3JB9F 2ZCEA 2C8MA 3HY0A 3REUA 3PZCA 4WJ3M 4ZTZB 4X9DA 4WJ4A 3LC0A 4J6WA 3RUXA 5GANe 3LSSA 3V8LA 4CS4A 3HTZA 4A54A 3A32A 5C51B 1D3BA 4WF2A 1PYSB 2EAYA 3EFSA 4M77E 4TVAA 3VQXA 1I8FA 3A5YA 3RKYA 2YLCA 3JB9D
chains in the Genus database with same CATH superfamily
3EFOB 2BUDA 4IURA 1IGQA 4PJMA 2HEQA 4KR2A 2KBTA 5GAN3 2L0AA 3I5RA 4JJNK 1VQ8A 4DBFA 3VUZA 2AHJB 4M4ZA 4C92B 3CMQA 1KMNA 1K8AU 3QO3A 2J6OA 2P0KA 1B70B 4CI0C 2E5AA 5GAMd 4H02A 2E5QA 5I2SA 4EMKA 2FVUA 1EIFA 4M7AA 3G6EQ 3TEEA 2H3JA 2DXCA 4OB3B 2QEXT 1QWEA 4P72C 2EJFA 3JCMd 5CKHA 3M59A 4CH5A 2RJCA 1SSFA 3CMAT 5GMKe 4KH0B 3JB9H 4XEMA 2EGAA 1KHCA 4CH4A 2DVJA 2AIRB 1MGQA 1WI7A 1D1AA 4YTLA 2D0NA 2EW3A 5F5WA 2LT1A 1BI0A 4E6RA 4GY5A 3EFRA 5GAMf 3MF2A 2A08A 2Z0WA 4C92D 1YHQT 4J7FA 3C12A 4PG3A 4M7AG 4JJBA 4OMNA 3VS2A 4YRIA 1HK9A 1M27C 4FT2A 4QT7A 1IHWA 3G6EA 1AD5A 4OB2B 4Y92A 1K8AR 2YXYA 3JCMf 3PGGA 4Q6GA 2J3MA 1WU7A 2SRCA 3OYFA 3JCMV 1TUDA 3MQZA 1H4QA 1SKUB 1M3AA 5E3IA 4LDYA 1Q86C 2XK0A 1I81A 4QQ6A 4ZGDB 2X9HA 2RQWA 3QDRB 1X56A 4BI3A 2A0FB 1WFWA 4RMOA 1WHLA 2V1QA 5GMKj 2LJ1A 4L6V5 4F16A 1D3BB 1TS9A 3HXYA 1SPKA 3CCEQ 3IKLA 2JOYA 1XQHA 2PMEA 1HD3A 1ZA1B 1ZBXA 3OSVA 5GANd 1IRXA 4CS2A 3RKWA 3LYIA 1AZGB 3J80E 4A4GA 4TVRA 2HBWA 3SFMA 2PNIA 1WHHA 2CUBA 2P4TA 1EX4A 2LDMA 4E51A 4FCYA 2M51A 3ZFJA 1OPKA 1ADJA 4P3OA 2LZ6B 3VRZA 3TVTA 2EGEA 1KC8C 5CIUA 4DOWA 3R6NA 2DQ3A 3O8VA 2HQHA 2J6KA 3L4GB 3CCEA 3HRIA 3MCAB 5GANf 3G71Q 3HFNA 2DQ0A 4YCWA 1JJCA 1BBWA 4YRFA 2FB7A 4FT4A 1B7YB 1NG2A 1B34B 2DZ9A 4XU0A 3HXWA 3RESA 2MF2A 3CCVT 2DL5A 3OYBA 4J9DA 4XK8E 3X26B 2FYKA 1FMWA 2RHQB 5I21A 3CBMA 2CP3A 2YUOA 3A8LB 1VQPT 2CJ9A 2QHTA 1TG0A 2VGNA 5M9OA 1WJQA 3FJPA 1VQ4A 2ZNJA 4OMMA 4Z8AA 1U1SA 4YRCA 3M5AA 3S6WA 3V7SA 2QTVA 3MEVA 3OBYA 4DBHA 2CH4W 1PD0A 3QKJA 5FRMA 4KQEA 2EFIA 4O6JA 3E19A 2XDDA 4YDQA 2HSEB 3OYKA 1Q82C 4YREA 1PM3A 3OYIA 4JRPA 4JZ3A 3I56Q 1SRLA 3PVQA 3EFOA 1SG5A 1VQNQ 2K3XA 5C53B 4JS4A 4LD9K 2A7YA 2O88A 2FEIA 4EDUA 4X9CA 2X3WD 4BW9A 1IL2A 1ACMB 4WI1A 3MEYA 3I7FA 5GAN2 3EH2A 4C92A 5LJ5e 2DU5A 2DETA 1B70A 4P75A 4DEXA 4PK4A 3VV0A 3RKXA 1ARKA 2I0NA 4II1A 2YUQA 3OMCA 2QQAA 2P4RA 1LPLA 1X54A 4FYXB 3UDCA 2ZCFB 2P84A 1WHMA 3EG9A 1N5ZA 2HKNA 3LWIA 3L2WA 1EOVA 3PNWC 3CC2Q 2XHCA 5LJ3j 3I56A 3CC4Q 2GFAA 1VQNA 3PE0A 2F2XA 1YB3A 3BY7A 4M77B 1H8KA 2NUTB 1HTTA 4CRIA 3URGA 3QSUA 2OTLQ 2F1LA 2CZ1B 3L1AA 4OMLA 12ASA 3KUFA 5GAN4 2LX7A 1UE9A 5C6SA 4J9CA 2QA4Q 3VS7A 3EGUA 2L8DA 4J9EA 1Q7YC 4XU2A 4M7DC 3E9IA 1X75C 2KR3A 5ELOA 2X4WA 5KYYB 3CCUT 2ODRC 5LJ5j 3BE3A 2RJFA 1BI2A 1G83A 1X01A 2EGCA 4QW2A 4PJOC 1O9SA 3CC2A 4XU3A 4BDZA 2DL4A 3TSWA 3CMEQ 1WLEA 3SWNB 3CC4A 4H2SA 2L3PA 3GBQA 4RTTA 3FEOA 4LDWA 2G3RA 2FL7A 3REXA 1BKBA 2K2VA 2G6FX 3ZBDA 1BIAA 1B76A 4PJOF 3O5ZA 2RHXA 2OX7A 1G51A 1RAAB 2CYZB 4PL6A 4M77D 1G8XA 4PFOA 1ZSZB 1G3YA 1Q86U 1IB8A 1EIYA 1OX8A 2HDAA 2YLBA 3I55Q 3INZA 2AZVA 1JRIA 4RCBA 2XDPA 4E7IA 1RLQC 3A7RA 3RMQA 3RL6A 4AMCA 2MPXC 1I5LA 3CCLT 1BI1A 1RAFB 2EYYA 4C5HA 2DM1A 3CCQA 3BFMA 3L2QA 4FIBA 4P75C 4YRSA 4LNSA 8AT1B 4MMLA 3EHRA 4O5VA 2A28A 3NTKA 2ZIMA 1MV3A 2ZZDA 1FYFA 1D1BA 2ZPGB 2MIOA 1ZLMA 1KC8U 3L4GA 2PUKB 1YFNA 3QHSA 3I55A 3WVEB 4YP0A 2XIDA 2RK1A 4ZN1A 2D6FA 1B7YA 1VQ9T 3CCJQ 1B34A 1Q86R 2NYSA 2L3RA 1OOTA 3VKIA 4AH6A 3ZL7C 2FPEA 2WSEE 3EG2A 1WXUA 4FSXA 3X24B 3WVDB 3QO8A 4HVUA 5AYFA 3CCRT 4XAXB 3JCMe 1QLYA 4FU6A 2RHQA 1VQOT 5I22A 3QYHB 1U3OA 7AT1B 4IIMA 1LOJA 5HCKA 1PD1A 4OGEA 1G5HA 3GIBA 5HKCA 3CCSQ 1QKWA 2LCSA 3QYGB 2DYBA 2K7AA 4PNOA 2V1RA 1NZ9A 3BDLA 1VQ6T 1IO6A 1KSWA 1GCQA 2LQNA 2HQEA 4JUVA 4HA8A 1UG1A 4QKUA 5LJ3g 2DBMA 2IIMA 3OBWA 1NEBA 1KQSP 2JMCA 2ZR2A 3CC7Q 1FXXA 3UPUA 1Q82U 1RACB 4DEYA 1H641 4RTUA 1SF9A 4EMGA 2CT3A 2JS2A 1G5IA 2JTMA 3CCSA 3OYJA 1YI2Q 4BY6C 2RH2A 3J81E 4R55A 2JW4A 3JB9F 2C8MA 3PZCA 3VYHB 2DYIA 5A0DA 3QPHA 9ATCB 1WJSA 4X9DA 3OYAA 3LC0A 4BUGA 3RUXA 3LSSA 5GANe 3EG0A 3HTZA 4A54A 5KE2A 2C0IA 1ZQ1A 1X6OA 4WF2A 2EAYA 3VQXA 4TVAA 1I8FA 3HRSA 2OTJA 3QBYA 2EYXA 2NUTA 1RADB 3RKYA 1K73C 2XDBA 1H3HA 2CDTA 1EVKA 3HFZB 1QVFP 1VQ7Q 3JCMJ 4BDYA 4M7DE 1RLPC 3HFOA 2BKDN 5FU7C 1NYFA 2K5LA 1BCOA 4PJOE 1HYOA 1BI3A 1YI2A 1Q82R 2COWA 4C0FA 2GF7A 5KYYA 1UGRB 4MZMA 2DFUA 2YWWA 1S1NA 3KBGA 2F2VA 1G3TA 1Q7YU 3VU3C 5KH6A 1A0NB 5FWBA 3LH0A 3SWNA 5DLOA 3AHUA 2K6DA 1DJ7B 4YRKA 3V7CA 1Y96B 4M77G 2A37A 2HMAA 1B07A 3TSZA 2VUBA 2LQKA 3NFCA 4F7UF 1MMAA 2XTIA 3THKA 3M4QA 2K5IA 5GANj 2Y4YA 2H3EB 5KYUB 2GGRA 2KXDA 5EG2A 1G3SA 2W10A 1USYA 4RQFA 1GGMA 2E6NA 5I11A 4C0GA 1UFFA 4M75B 1UHCA 1Z9QA 2QQ9A 3UGQA 1UGVA 3IQLA 2EYQA 4EMHA 2H8HA 1K1ZA 5FLXE 4J5YA 1E6GA 1W70A 4CH3A 1J3TA 1IZ6A 2VVKA 1YJNT 1AVZC 3PIOA 1VIFA 2L3QA 3VJPA 2KNBB 4Y28E 2FHDA 1JO8A 2FG0A 5KYXB 2LT4A 1QCOA 4J7IA 1NYQA 1Q7YR 2Q7GA 3TEHB 1VQ5Q 4XEOA 4P71A 1V1CA 1M5Q1 1V76A 1ZHIA 4JJCA 3L2VA 2QQSA 4L59A 2F69A 4Q15A 1YITQ 3UA6A 5A0LA 3ULRB 3BDUA 4M78B 3DB3A 1KQ1A 4BWAA 5IHIA 2QDYB 4RUGA 4M75D 1FYNA 2L5QA 4MDXA 2DEUA 4XTWA 1SHGA 2DZCA 1VQ8Q 2RK2A 1PRLC 2PUOB 4V2SA 1S72T 4C8QC 1YJWQ 2ARUA 4Z89A 4HWOA 2Q5IA 4BE0A 1PG5B 3I9QA 2RHIA 1VQLT 1KK7A 4XTVA 4LNPA 1VQ5A 4TTVA 2RB6A 4N0AC 2R58A 1AT1B 4C8QF 2J3LA 3G4ST 4MZTA 3PTAA 3QZ9B 1MMGA 1D0YA 1JXMA 1C0MA 2ZT5A 5KE3A 4M78D 2VKNA 4IUTA 1OQKA 5GMKh 4J9HA 4ZIBA 4HT9A 1WX6A 4N4HA 1EZZB 3LGFA 1V29B 3JRZA 3SD4A 4A4EA 3NPFA 2AKKA 1JXOA 2JZ2A 5GAN8 1YJWA 4RG2A 1X43A 2O9VA 5L23A 1W2BP 5CAIA 4M7DD 4JLIA 1PKSA 4P5NA 1M8VA 1USYC 1X55A 3OS0A 4JRIA 4C5EA 3HHTB 1W6XA 2HNIA 2BTTA 4D8DA 3G71T 1VQMQ 1FX7A 2BIVA 3PVLA 2DERA 1X2GA 3JCMW 2C06A 4E7LA 3CCMA 3V8KA 1QVFA 2M9UA 2XI9A 3H0HA 3OYHA 3ER0A 3JCMX 1FWZA 2E65A 5CQYA 5GAOq 1SSHA 3H6ZA 3HFZA 3J7AF 4EO4A 3QO7A 1VQZA 3NGPA 2I4OA 1K73U 4F7UE 3SDZA 5FW9A 1VQKT 2QHSA 2KSSA 4RMFA 3AT1B 3M0UA 1VQMA 1YJ9Q 4EIKA 1UHFA 4UC4A 2CGHA 3C4SA 2DJZA 2VASA 1E6HA 3X28B 3UA7A 1Y96A 4ELYC 4HWRA 2HCKA 4YPFA 2CH4A 2JVVA 4CC2A 2ARSA 2E3HA 1W1FA 4BE1A 1M8MA 1OPLA 1KQ2A 3QJYA 1I0CA 3EHQA 4KGXB 4UP7A 2EPDA 2QGGA 4ESRA 3CXCA 1PCXA 3M57A 3ICAA 4E47A 1QVFS 3DKMA 3OSSC 2KEAA 4K86A 4M75A 2DL8A 3QG1A 4X1VA 1JBMA 1YJ9A 4P74A 1K73R 2B86A 4PHCA 2LC4A 2A36A 2R5AA 3CBOA 3C95A 2RQTA 5FU6B 1AWJA 3CD6T 4AT1B 1YIJA 1Q95G 5KYXA 4HCBA 2JM9A 3JAME 1I4K1 1VQ4Q 3C94A 4EMKC 2CREA 4XU1A 1QVGP 2OTLT 4ZGEB 2D0QB 3TEHA 5DLQE 4M7AC 1KFZA 2P0PA 1F1BB 2DIQA 1E24A 5LJ3h 4Z88A 2QA4T 3HXVA 2ED0A 1N8RC 4M75G 1E1TA 1K9MC 4OVAA 3VS6A 4LVKA 2FZKB 1H4TA 2AK5A 4M78A 1OULA 1UTIA 2MWOA 4EPCA 1MNDA 4CC4B 2RD1A 3EH1A 5HGQA 4M7AF 2E4HA 2QEXQ 2ZZEA 2YT6A 3CXCS 1I07A 4C8QE 1NYRA 3CMET 2JS0A 1TUCA 2DE0X 2YUNA 2CJAA 2KGTA 3OYMA 1WPYA 1H4SA 4HCZA 3MF1A 5GAOr 3OYLA 2CT4A 2V8IA 4ME7A 4NL2A 2F2WA 5LJ5h 1U5SA 2AKWB 2EJ9A 3HRUA 2O31A 2CIMA 4TVWA 5C52B 2BZYA 5CKDA 2EKOA 1GRIA 4IIOA 2DDZA 2ZT7A 1AWXA 2DJQA 1X69A 4C5GA 3ERRA 2GNCA 1ASYA 2LNHB 4NOYA 4M78G 2KT8A 3LGLA 2DX1A 3GNGA 1PYSA 4JPBW 1X2HA 1YHQQ 1SESA 4YRPA 2DRKA 1YFRA 3M0QA 1R77A 2RHZA 2QEXA 3GOXA 1T0JA 4QVZA 3CPFA 3UH0A 4FYVB 1UGPB 4LUEA 1NYGA 4M7DG 2CJBA 3META 4R0KA 4PJLA 1WHKA 3CMAA 3UFGA 2RI5A 1PSFA 3OYCA 3VS0A 2QI2A 1CKBA 2ROTA 2G4CA 2Q7EA 1UECA 4LUDA 5GAN7 1JJ2P 4UPAA 3NENA 1N6AA 3JB9J 2J06A 1AEYA 2K4YA 5CK9A 2ZR3A 2KMTA 1VA7A 2YUPA 2VXFA 1YHQA 2EWNA 1B8AA 4IUVA 2QXFA 2PQWA 2EQMA 4LVLA 3RF1A 1NPPA 4H2UA 4KGVB 3CCJT 1BBUA 3N5BB 3QO5A 2E70A 4E7JA 3A74A 4J9IA 2P0QA 2DTHA 3EAEA 1WYDA 2RHUA 3DSQA 1HXDA 1NEGA 2EQIA 2KRSA 2CZ6B 2VXEA 4FW2A 5GMKm 2YDLA 3M4YA 3FRNA 3HSBA 3Q1JA 2DTOA 2SEMA 5ECAA 5GAN6 1NJ5A 4YRNA 3HL8A 3RNJA 2MWPA 1EFWA 4C0DC 3W3SA 4E7SA 2ZINA 4DBQA 5EC7A 3A98A 3FLGA 1K9AA 2ZCEA 1NJIC 3MP6A 1YWPA 5FROA 3CCQQ 1BK2A 2DMOA 1WYXA 3REUA 1IXDA 1Y71A 2MMPA 1ZUUA 4A63B 3CCVQ 3CC7T 1MUZA 4J9FA 2RNAA 1KD1C 3RR6A 2O01E 3V8LA 2E3IA 2X51A 1OU9A 1D3BA 3EFSA 4JRQA 1M4ZA 1VQPQ 3HTRA 3UT1A 2YLCA 2CP0A 5IHNA 3A7UA 2EQKA 3REBB 1IREB 3VUBA 2LRQA 1T0HA 4Q5WA 1X2KA 1E1OA 2DEQA 2MAMA 1X6GA 2RQVA 2QDLA 2A8EA 3OS5A 1M3BA 2ZGWA 4C92C 1K0SA 1QVGA 2LJ0A 4PJNA 4A4HA 2YRCA 3CCVA 5KNNA 1WXTA 4M7AE 4LDXA 1VUBA 3E2UA 2HL5C 4FSSA 4LE9A 3NEMA 4GBQA 1VQPA 1VQ7T 3HY1A 1D0XA 3M53A 4C92F 2ZPHB 2QK0A 2DL3A 1YGBA 3V8JA 5GAMe 2VB6A 2ZT6A 3PMTA 3JCMP 3CPWP 4RDXA 4IUQA 1HC7A 2DU7A 1N8RU 2ARTA 1K9MU 3LSQA 1MHNA 2DPPB 4HVWA 1Z9ZA 4FYWB 2QQRA 2KDSA 4TQDA 1RIQA 2DK3A 3EGXB 3QDFA 3CQTA 4RTWA 4TVYA 5KYWB 2AKWA 2DBKA 3VS1A 2NLUA 3GLXA 2M0YA 1WQWA 1ZUYA 3OS1A 5CKEA 3P8YA 2AZSA 1RAHB 3M56A 1BBZA 3OYGA 1QVGS 4Y91A 1ZUKA 2QG9B 2V26A 2KRMA 2PZ1A 2K2MA 5DY9A 2ATCB 2QYZA 3CCUQ 2FRWA 2CP2A 5K1XA 1QCFA 5GANh 4OGCA 3NELA 2OTJQ 2JXBA 4OF1A 5GAMj 4K88A 3M4GA 1O75A 4NCXA 1Y0MA 4ATOA 3LW5E 4F7UG 2RA2A 2C0TA 1JJ2A 3JB9I 3NTHA 1N8RR 5IN1A 3FDRA 1TXQA 4BI4A 3L2RA 1K9MR 5D7UA 1VOMA 2BE7D 3QIIA 4J83A 5LJ5g 1AWWA 1M3CA 2DKGA 3FC3A 2ZIOA 1MMDA 1VYUA 3VQWA 2R57A 3SHWA 1YITT 1MMNA 2V8JA 3VQVA 3CCUA 1UB4A 3OYEA 1M30A 2KYBA 1UGSB 2C0OA 3PIPA 3KFVA 4HWPA 4M77A 1RI0A 5GJVB 1YCSB 1X6BA 2D8HA 5GMKl 2K3BA 1AZEA 3HKSA 4J6YA 1VQ8T 4XTUA 3CCLQ 2CSQA 1UJYA 2M16A 3HPWA 3TQ7P 3IKMB 3LWHA 1NJ6A 4D6WA 4RTYA 4ZTJA 3IALA 5LJ3d 3A8HB 3TEGA 4HKEA 2GQIA 2QHUA 1PWTA 1YN8A 1U8RA 1UJ0A 4ZN3A 1JJ2S 4HWSA 2WSCE 3SB2A 1N9SA 3EGDB 1T3LA 5D6XA 3ZEHA 1YFSA 3BJUA 3I5SA 2YHTA 1VQ9Q 1NNHA 3MHXA 4XTYA 4LDUA 3OYNA 1UUEA 3CEYA 1KOGA 4UP8A 2E10A 3CCLA 4BE2A 2ZTGA 3RACA 4JLGA 2ESWA 1NJIU 1ZSZA 1OX9A 5LJ5d 2GFUA 1PHTA 2DD5A 3CCRQ 3MKDA 2JTFA 2WACA 4JZ4A 1RAGB 1GCQC 4AG2C 1VQOQ 1GFDA 5LJ3f 5HY6A 2RQUA 1NJ8A 2M0OA 1KD1U 1BU1A 1ATIA 4E7HA 3VBBA 1Y57A 4F04B 4UP9A 2HQXA 3G6ET 1N9RA 4A4FA 3G7ZA 4C92E 1VQ6Q 1RAIB 4HT8A 2DVEA 1M2OA 1PNJA 4PJJA 1QQJA 3WXMB 2RJEA 3UWNA 1VQ9A 2YSQA 3RMSA 1GBRA 4E7KA 3GF5A 4P72A 2ZNIA 1FMKA 4AFZC 4OB1B 2RO0A 2COYA 5LJ5f 1MV0B 3CCRA 3VRYA 4KUDK 3RGLA 1VQOA 3CPWA 4YRJA 2K3YA 4OLFA 2CP6A 4KRTA 2CZ7B 2ZPIB 5IT9E 4RG8A 4IUPA 3HXUA 3UGTA 4KT0E 1NJIR 2RM4A 3VQYA 4C5IA 4DBRA 3QZ5B 1VQ6A 1M1GA 1VYVA 4M77C 4CC7A 1KD1R 2LTOA 2VWFA 4M7DB 2F5KA 4OMPA 2JNGA 3MO8A 5CCAA 2FPFA 2GTJA 3EGXA 4PJOB 1EFNA 1E22A 2HD0A 3M54A 4M77F 3S3OA 1E7OA 1H4VB 3JCMg 1QE0A 2ALYB 2OJ2A 1QF6A 1PC0A 3CCET 1X2QA 3RBBB 1KQSA 3JSCA 2WSFE 3SWNC 1WIEA 5ELNA 1GL5A 1IHVA 1EQRA 3CCMQ 1G3WA 1WGSA 3HP9A 5CR2A 3QWXX 3CPWS 2I4NA 1CKAA 1RI9A 4IUUA 2J6FA 2ROLA 2JT4A 4GLKA 1BB9A 5GAN5 2Q5HA 4NS5A 1ZSZC 2ZT8A 1T3SA 1GFCA 1B3QA 1GBQA 4X34A 2B8AA 2ODRD 4H2XB 2EYZA 1VQ4T 4PJOD 3VYGA 2J7IA 2M1HA 4PFPA 5D6YA 2BE9B 5I2MA 3JCMc 1Z7NA 4L87A 2YRVA 3L2ZA 1LVKA 1WNLA 4BACA 1TSFA 3X20B 1M1KC 2J05A 3E9HA 1KJWA 2ZZFA 2QASA 2I2LA 3EG9B 5CQXA 2CS7A 4A4KA 1KQSS 1OYXA 3JCMb 4JRKA 5L8RE 3A7AA 5DM7R 4P71C 1YJNQ 4P3NA 1WHJA 5GANg 1WZOA 4BB7A 2LCLA 2K57A 3OA6A 1QVPA 1RAEB 3MP8A 3A31A 2DO3A 5IXFA 1J5WA 4FM4B 4FL6A 4CH6A 3LLRA 2NUPB 3OQ5A 3P8BB 1OI1A 3P8VA 4F17A 2VC8A 2VGMA 1UEBA 3I56T 2HBPA 3EGDA 1VQNT 4E2FB 5K1PA 1Q81C 3H41A 1YIJQ 2OAWA 2LCCA 1BCMA 2V8KA 4AFQC 2MI6A 1YJNA 3V7RA 2EQJA 2KYMA 1NLPC 2LQ8A 2RN8A 5KYUA 1S72Q 2KQWA 1ABQA 1VQLQ 2IVWA 1G5VA 2HL3A 4FW1A 3S3MA 3HRKA 3LX7A 4PLIA 4LD6A 3KFUA 2X3XD 1EIYB 1K0XA 4RTZA 3CC2T 3MPUB 3OD1A 2ENMA 4HCKA 2DNUA 4YROA 3CC4T 4LDVA 3SEMA 2DL7A 1XJWB 3G4SQ 4YRGA 4QQDA 1TH7A 4BY6B 1M9SA 4P3PA 4RQEA 3FB9A 4JJDA 2CUDA 2X4YA 4OMOA 2HZYA 4KUIA 3L2UA 2A3LA 2BZXA 4PLLA 3HY0A 1S72A 2LMJA 4ZTZB 2LP5A 2LJ3A 1VQLA 1TOVA 2D9TA 2EVRA 3P8HA 3A32A 2MCNA 4M77E 4MDWA 3MJXA 3LH5A 3A5YA 2XG8D 1M90C 3A1PA 2AKLA 2R5MA 3JB9D 5FU7B 3G4SA 5IAYA 1SERA 2DXBA 2CSIA 8ATCB 4M7DA 2KRNA 3ME9A 2EL9A 3CMAQ 4F7UB 2IY5B 1W66A 2AT1B 3CCQT 4PJOA 2NUZA 3S3NA 4JS5A 1VIEA 4LN2A 4H2TA 2NS6A 1I5OB 4RKUE 3NMZC 4ZNXA 1W4SA 5KCHA 5GAOn 2ALYA 3TU4K 3X25B 3I55T 4C0ZA 2K5FA 3UF4A 3PCOB 2JJ9A 5J3BA 1WHGA 4LVMA 2RQRA 4KGZB 1NBEB 1VQKQ 3QTCA 4ZGJB 3A5ZB 4AFSC 5LJ3e 1Z7MA 4H2YA 2LX9A 4ORZA 4YYEA 1W2BA 3OY9A 3G71A 3DLLA 4J8OA 3P8DA 4XTXA 1XNIA 1LNXA 2D8JA 4PJOG 1RL2A 4H2WA 4HVVA 3M0TA 5CVIA 2K79A 3UATA 2XMFA 5FWCA 5GMKi 1Y07A 3EG1A 2DILA 4H2XA 1OZ3A 2JTEA 2P0LA 3NHNA 1EVLA 4M75C 3KXTA 2BZ8A 1ADYA 4XQ3A 1P92A 4P74C 1UDLA 4QVDA 5J26A 4DOVA 1WLPB 3M58A 1VQKA 2RF0A 3CBPA 3JV3A 4NL3A 3OB9A 4HCCA 3M55A 4M75F 1QKXA 1GXIE 2OAUA 2O4XB 3ASKA 4EX5A 4DPGA 4KBMB 5KYNA 1MNEA 2QHVA 3RERA 4MZPA 1M1KU 2Q7HA 1QW1A 2KAFA 3HFVA 2QTXA 3CD6Q 1L0WA 2L89A 4TVAB 1W2BS 4KR3A 3CCST 4M78C 4C92G 2KROA 2CZ0B 5IH2A 4C8QB 2PVDB 1H3ZA 3IG2A 2JN0A 3MP1A 3P8TA 2EBPA 3OW2P 1OU8A 1U06A 2NUPA 5AT1B 2F5TX 1QCNA 3BW1A 2HKQB 1YWOA 4HXJA 4M78F 4HWTA 2M02A 2PVOB 2MOXA 2DXTA 2GBQA 1NJ2A 5CO7A 2OTJT 1KIKA 4OP0A 1M2VB 2E3CA 2IPOB 1Q81U 1N9WA 3CD6A 3MEAA 4M7DF 2EJGA 3GP8A 2KXCA 3NTIA 2DIGA 2OTLA 1KHIA 1YI2T 2DLPA 1M1KR 5GAMh 1ASZA 3H9NA 3QJ6A 3A8OB 1C0AA 2QA4A 4HT4A 2KE9A 1OV3A 1KG1A 4C8QD 2KI7A 1YNZA 3NETA 1XTDA 3VS3A 1LCKA 2E64A 4YRQA 1X27A 3WQZA 3JCMh 4J15A 1D1CA 3E9FA 3TCJA 2X35A 1BIBA 3CMEA 2LNVA 1D0ZA 1C6VX 2VV5A 4OB0B 1JB0E 4YRRA 1ABOA 1WA7A 2AMCB 2FO0A 4RTXA 4ZTFA 2ECZA 4YCUA 3QWYA 5CKFA 3JB9G 1U1TA 4R56A 1SEMA 1Q81R 2RHSB 1PSEA 2DXUA 4XTZA 4ELZC 1C1AA 1R0CB 3HXXA 3FIFA 2RJDA 4GLMA 2DTIA 3MEUA 2ZPFB 2CP5A 5CKBA 3PMIA 1WJRA 3A8MB 2LQWA 4TQFA 3H0IA 5IXBA 2DF6A 1G2BA 1M90U 5GAOm 4F7UA 1QMCA 3OS2A 2IY5A 1JU5C 2E5KA 1QWFA 1ZA2B 5HK3A 3REAB 1OEBA 4HVCA 3DB4A 3TREA 1H92A 2JMAA 2ZXFA 4Z02A 3M0SA 2KVQG 2Y90A 1PRMC 4YCVA 3C0CA 3PCOA 3E9GA 3I35A 1YFTA 3RDVA 3OYDA 3GNFB 3VS5A 4WTOB 3HRTA 1M1FA 4KULA 2KT1A 4B6MA 4ANJA 3A5ZA 2QAZA 3M0RA 3D7SB 5HK0A 4CS3A 1AOJA 11ASA 1AWOA 2XICA 4DQ2A 1RABB 4N4IA 2FZGB 2X4XA 1HJDA 2CKKA 2COZA 1TWBA 3M4PA 2LVMA 4B9XA 1N27A 1CSKA 3CCJA 1K8AC 2E41A 3GPLA 2EKHA 4J9BA 4M75E 1KC8R 2I4MA 3PFSA 1VQ5T 2QGFB 4G85A 4K87A 1M90R 1TUGB 4J9GA 4D8KA 5A2QE 4MMKA 2W0ZA 2GQVA 2ED1A 1BYMA 4J6XA 1AHJB 4EMKB 4FYYB 5FU6C 4M7AB 4O2DA 2DA9A 2FPDA 4F14A 2RPNA 3R07A 5KCOA 3F70A 1FMVA 2XU8A 4RCCA 2XKOC 2O4XA 1RUWA 2I4LA 1YJWT 1HSQA 1SRMA 4PKCC 2P5IA 1QP2A 1NE8A 2RHYA 4DA4A 1R8OB 2RI3A 5GJWB 4P73A 2ZPBB 4M78E 5D6WA 1UGQB 4A53A 2YRDA 3R6OA 2DD4A 3CC7A 1YBYA 2D1XA 3L42A 2L3SA 3OW2A 3PT9A 4N4GA 2PMFA 4QVCA 5A0GA 4G84A 2VYTA 4C8QA 1WDXA 1NM7A 2RI2A 3A8GB 2XD0A 3OMGA 2MK5A 1IGUA 2L2PA 4H2VA 5GAOp 3FJ5A 4WCIA 2IG0A 1B7TA 4N0AA 3CCMT 4LVJA 1SRYA 4M7AD 3HXZA 4E7ZA 2EIFA 1NJ1A 2ZZGA 1M2VA 3M9QA 3JCMQ 1TTHB 1OZ2A 2GCXA 1JQQA 4KH1B 5C0MA 2C7IA 4LVIA 3H8ZA 1R0BG 2ZAEA 3T9NA 4C8QG 5IHKA 2GTOA 2DAQA 1K76A 1VQ7A 3VS4A 4L5GA 1PKTA 4YRTA 2FRYA 2HAXA 1SHFA 4BD3A 1VQMT 1WQ7A 2O2OA 2CP7A 4JDSA 1ZX6A 3QNEA 4IKFA 5FRNA 2JUFA 1YCYA 3QXEB 4AG1C 4PFZA 1TU0B 2E1HA 4AFUC 3OW2S 2Y4XA 2EQUA 3QUIA 2QQBA 3CXCP 4OMFB 5LL6S 2ABLA 2X4JA 1I1JA 2E12A 2E6ZA 1GCPA 2XGTA 3RIRA 2PTKA 3U23A 2AMCA 3G1ZA 4K11A 4ZTUB 1LJOA 2RMOA 1NLOC 4YRMA 2JM8A 1JEGA 5J39A 4VUBA 3M0PA 2RHSA 2DRMA 4RTVA 1LYLA 1YP5A 4OMQA 5GAOl 1YJ9T 2MYSA 2PU9B 1JJCB 5GAMg 1ZBJA 2KK4A 1KMMA 1QP3A 1XOVA 4TWAA 1SETA 1NPRA 4P73C 5KYWA 1YIJT 2HSPA 2OI3A 1D09B 4X5OA 4C0DB 2NWMA 2K9GA 3EG3A 1WXBA 2O9SA 3OYYA 1ZSGA 4QQGA 4YRLA 3TUPA 3H0FA 2FZCB 2KY9A 2PVGB 2ZPEB 3E1SA 4WJ3M 1K4US 1VYTA 4LXCA 2EYWA 4BI8B 4WJ4A 4J6WA 4CS4A 4CC3A 5C51B 3MEWA 1YITA 1PYSB 4B9WA 3G1JA 6AT1B 3DLMA 1Y7XA
chains in the Genus database with same CATH topology
4IURA 2BUDA 4KR2A 5GAN3 4JJNK 1VQ8A 3VUZA 2AHJB 4C92B 3CMQA 1KMNA 1K8AU 3QO3A 2P0KA 1B70B 4CI0C 2E5AA 5GAMd 4H02A 2E5QA 5I2SA 4EMKA 2FVUA 1EIFA 4M7AA 3TEEA 2H3JA 2DXCA 4OB3B 2QEXT 4P72C 2EJFA 3JCMd 5CKHA 3M59A 4CH5A 2RJCA 1SSFA 3CMAT 5GMKe 3JB9H 4XEMA 1KHCA 4CH4A 1MGQA 4YTLA 5F5WA 2LT1A 1BI0A 4GY5A 3EFRA 5GAMf 3MF2A 4C92D 1YHQT 4J7FA 3C12A 4PG3A 4M7AG 4YRIA 1HK9A 4FT2A 3G6EA 4OB2B 3JCMf 3PGGA 4Q6GA 2J3MA 1WU7A 3OYFA 3JCMV 3MQZA 1H4QA 5E3IA 4LDYA 1Q86C 2XK0A 1I81A 4QQ6A 4ZGDB 3QDRB 1X56A 4BI3A 4RMOA 5GMKj 4L6V5 1D3BB 3HXYA 3IKLA 2JOYA 1XQHA 2PMEA 1ZBXA 3OSVA 5GANd 4CS2A 3RKWA 3LYIA 3J80E 4A4GA 4TVRA 3SFMA 2P4TA 2LDMA 4E51A 3ZFJA 1ADJA 4P3OA 1KC8C 5CIUA 4DOWA 2DQ3A 3O8VA 3L4GB 3CCEA 3HRIA 3MCAB 5GANf 3HFNA 2DQ0A 4YCWA 1JJCA 1BBWA 4YRFA 2FB7A 4FT4A 1B7YB 1B34B 2DZ9A 4XU0A 3HXWA 3RESA 2MF2A 3CCVT 3OYBA 4XK8E 3X26B 2FYKA 2RHQB 5I21A 3CBMA 3A8LB 1VQPT 2CJ9A 2QHTA 2VGNA 5M9OA 1WJQA 3FJPA 1VQ4A 2ZNJA 1U1SA 4YRCA 3M5AA 3S6WA 3V7SA 3MEVA 3OBYA 3QKJA 5FRMA 4KQEA 2EFIA 4O6JA 3E19A 2XDDA 4YDQA 3OYKA 1Q82C 4YREA 3OYIA 4JRPA 2K3XA 5C53B 4JS4A 4LD9K 2A7YA 4EDUA 4X9CA 4BW9A 1IL2A 4WI1A 3MEYA 3I7FA 5GAN2 4C92A 5LJ5e 2DU5A 1B70A 4P75A 3VV0A 3RKXA 4II1A 3OMCA 2QQAA 1X54A 3UDCA 2ZCFB 3LWIA 3L2WA 1EOVA 3PNWC 2XHCA 5LJ3j 3I56A 2GFAA 1VQNA 1YB3A 3BY7A 4M77B 1HTTA 4CRIA 3URGA 3QSUA 2CZ1B 3L1AA 12ASA 3KUFA 5GAN4 5C6SA 2L8DA 1Q7YC 4XU2A 4M7DC 3E9IA 1X75C 5ELOA 2X4WA 3CCUT 2ODRC 5LJ5j 2RJFA 1BI2A 1X01A 4QW2A 4PJOC 1O9SA 3CC2A 4XU3A 4BDZA 1WLEA 3SWNB 3CC4A 4H2SA 3FEOA 4LDWA 2G3RA 2FL7A 3REXA 1BKBA 2K2VA 3ZBDA 1BIAA 1B76A 4PJOF 2RHXA 1G51A 4PL6A 2CYZB 4M77D 1G3YA 1Q86U 1EIYA 2YLBA 3INZA 1JRIA 4RCBA 2XDPA 4E7IA 3A7RA 3RMQA 3RL6A 1I5LA 3CCLT 1BI1A 4C5HA 3CCQA 3BFMA 3L2QA 4FIBA 4P75C 4YRSA 4LNSA 4MMLA 4O5VA 3NTKA 2ZIMA 2ZZDA 1FYFA 2ZPGB 1KC8U 3L4GA 2PUKB 3QHSA 3I55A 3WVEB 4YP0A 2XIDA 2RK1A 4ZN1A 2D6FA 1B7YA 1VQ9T 1B34A 2L3RA 3VKIA 4AH6A 2WSEE 4FSXA 3X24B 3WVDB 3QO8A 5AYFA 3CCRT 4XAXB 3JCMe 4FU6A 2RHQA 1VQOT 3QYHB 1LOJA 4OGEA 1G5HA 3GIBA 5HKCA 3QYGB 4PNOA 1NZ9A 3BDLA 1VQ6T 1Y7XA 2HQEA 4JUVA 4HA8A 5LJ3g 3OBWA 2ZR2A 1FXXA 3UPUA 1Q82U 1H641 4EMGA 1G5IA 2JTMA 3CCSA 3OYJA 4BY6C 2RH2A 3J81E 4R55A 3JB9F 2C8MA 3PZCA 3VYHB 5A0DA 3QPHA 1WJSA 4X9DA 3OYAA 3LC0A 4BUGA 3RUXA 3LSSA 5GANe 3HTZA 4A54A 5KE2A 1ZQ1A 1X6OA 4WF2A 2EAYA 3VQXA 4TVAA 1I8FA 3HRSA 2OTJA 3QBYA 1K73C 3RKYA 2XDBA 1EVKA 3HFZB 3JCMJ 4BDYA 4M7DE 3HFOA 2BKDN 5FU7C 2K5LA 4PJOE 1BI3A 1YI2A 4C0FA 2GF7A 1UGRB 4MZMA 3KBGA 1G3TA 1Q7YU 3VU3C 5KH6A 3LH0A 3SWNA 5DLOA 3AHUA 1DJ7B 4YRKA 3V7CA 1Y96B 4M77G 2VUBA 2LQKA 3NFCA 4F7UF 2XTIA 3M4QA 2K5IA 5GANj 2Y4YA 5EG2A 1G3SA 1USYA 4RQFA 1GGMA 2E6NA 4C0GA 4M75B 2QQ9A 3UGQA 2EYQA 4EMHA 5FLXE 4J5YA 4CH3A 1IZ6A 1YJNT 3PIOA 1VIFA 3VJPA 4Y28E 2FHDA 2LT4A 4J7IA 1NYQA 2Q7GA 3TEHB 4XEOA 4P71A 1M5Q1 1ZHIA 3L2VA 2QQSA 4L59A 2F69A 4Q15A 5A0LA 3BDUA 4M78B 3DB3A 1KQ1A 4BWAA 2QDYB 4M75D 2L5QA 4MDXA 4XTWA 2DZCA 2RK2A 2PUOB 4V2SA 1S72T 4C8QC 2ARUA 4HWOA 2Q5IA 4BE0A 2RHIA 1VQLT 4XTVA 1VQ5A 4TTVA 2RB6A 4N0AC 2R58A 4C8QF 2J3LA 3G4ST 4MZTA 3PTAA 3QZ9B 2ZT5A 5KE3A 4M78D 4IUTA 5GMKh 4ZIBA 4HT9A 4N4HA 3LGFA 1V29B 3JRZA 3SD4A 4A4EA 5GAN8 2JZ2A 1YJWA 4RG2A 5CAIA 4M7DD 4JLIA 4P5NA 1M8VA 1USYC 1X55A 3OS0A 4JRIA 4C5EA 3HHTB 2HNIA 3G71T 1FX7A 2BIVA 1X2GA 3JCMW 2C06A 4E7LA 3CCMA 3V8KA 1QVFA 2M9UA 2XI9A 3OYHA 3ER0A 3JCMX 1FWZA 2E65A 5CQYA 5GAOq 3H6ZA 3HFZA 3J7AF 4EO4A 3QO7A 1VQZA 2I4OA 1K73U 4F7UE 3SDZA 1VQKT 2QHSA 2KSSA 4RMFA 1VQMA 4UC4A 2CGHA 3C4SA 2DJZA 3X28B 1Y96A 4ELYC 4HWRA 4YPFA 2JVVA 2ARSA 4BE1A 1KQ2A 3QJYA 4UP7A 3CXCA 3M57A 3ICAA 4E47A 1QVFS 3DKMA 3OSSC 4K86A 4M75A 3QG1A 1JBMA 1YJ9A 4P74A 4PHCA 2LC4A 2R5AA 3CBOA 3C95A 5FU6B 3CD6T 1YIJA 4HCBA 3JAME 1I4K1 3C94A 4EMKC 4XU1A 2OTLT 4ZGEB 2D0QB 3TEHA 5DLQE 4M7AC 2P0PA 2DIQA 1E24A 5LJ3h 2QA4T 3HXVA 1N8RC 4M75G 1E1TA 1K9MC 4OVAA 4LVKA 1H4TA 4M78A 2MWOA 4EPCA 2RD1A 5HGQA 4M7AF 2ZZEA 3CXCS 4C8QE 1NYRA 3CMET 2CJAA 3OYMA 1WPYA 1H4SA 4HCZA 3MF1A 5GAOr 3OYLA 2V8IA 4ME7A 4NL2A 5LJ5h 2AKWB 2EJ9A 3HRUA 2CIMA 4TVWA 5C52B 5CKDA 2EKOA 2DDZA 2ZT7A 4C5GA 3ERRA 1ASYA 4NOYA 4M78G 3LGLA 3GNGA 1PYSA 1X2HA 1SESA 4YRPA 1YFRA 2RHZA 2QEXA 3GOXA 4QVZA 3CPFA 3UH0A 1UGPB 4M7DG 2CJBA 3META 3CMAA 3UFGA 2RI5A 1PSFA 3OYCA 2QI2A 2G4CA 2Q7EA 5GAN7 4UPAA 3NENA 1N6AA 3JB9J 2K4YA 5CK9A 2ZR3A 2KMTA 2VXFA 1YHQA 2EWNA 1B8AA 4IUVA 2QXFA 2PQWA 2EQMA 4LVLA 3RF1A 1NPPA 4H2UA 3CCJT 1BBUA 3N5BB 3QO5A 2E70A 4E7JA 3A74A 2P0QA 2DTHA 3EAEA 1WYDA 2RHUA 3DSQA 1HXDA 2CZ6B 2VXEA 5GMKm 3M4YA 3FRNA 3HSBA 3Q1JA 2DTOA 5GAN6 1NJ5A 4YRNA 3HL8A 2MWPA 1EFWA 4C0DC 3W3SA 2ZINA 3FLGA 2ZCEA 1NJIC 3MP6A 5FROA 3REUA 1Y71A 2MMPA 3CC7T 1KD1C 2O01E 3V8LA 1D3BA 3EFSA 4JRQA 1M4ZA 3UT1A 2YLCA 3A7UA 2EQKA 1IREB 3VUBA 2LRQA 4Q5WA 1E1OA 2DEQA 2MAMA 2A8EA 3OS5A 4C92C 2ZGWA 1QVGA 4A4HA 3CCVA 5KNNA 4M7AE 4LDXA 1VUBA 3NEMA 1VQPA 1VQ7T 3HY1A 3M53A 4C92F 2ZPHB 1YGBA 3V8JA 5GAMe 2ZT6A 3PMTA 3JCMP 4RDXA 4IUQA 1HC7A 2DU7A 1N8RU 2ARTA 1K9MU 3LSQA 1MHNA 2DPPB 2QQRA 2KDSA 4TQDA 1RIQA 2DK3A 4TVYA 2AKWA 2NLUA 3GLXA 1WQWA 3OS1A 5CKEA 3P8YA 3M56A 3OYGA 1QVGS 4Y91A 5DY9A 5K1XA 5GANh 4OGCA 3NELA 4OF1A 5GAMj 4K88A 3M4GA 1O75A 4NCXA 4ATOA 3LW5E 4F7UG 2RA2A 1JJ2A 3JB9I 3NTHA 5IN1A 3FDRA 4BI4A 3L2RA 3QIIA 4J83A 5LJ5g 2DKGA 3FC3A 2ZIOA 3VQWA 2R57A 1YITT 2V8JA 3VQVA 3CCUA 1UB4A 3OYEA 1UGSB 3PIPA 4HWPA 4M77A 1RI0A 5GMKl 3HKSA 4J6YA 1VQ8T 4XTUA 2M16A 3HPWA 3IKMB 3LWHA 1NJ6A 4D6WA 4ZTJA 3IALA 5LJ3d 3A8HB 3TEGA 4HKEA 2QHUA 1U8RA 1JJ2S 4HWSA 2WSCE 3SB2A 1N9SA 5D6XA 3ZEHA 1YFSA 3BJUA 2YHTA 1NNHA 3MHXA 4XTYA 4LDUA 3OYNA 3CEYA 1KOGA 4UP8A 2E10A 3CCLA 4BE2A 2ZTGA 3RACA 4JLGA 1NJIU 5LJ5d 2GFUA 2DD5A 2JTFA 2WACA 5LJ3f 5HY6A 1NJ8A 2M0OA 1KD1U 1ATIA 4E7HA 3VBBA 4UP9A 2HQXA 3G6ET 1N9RA 4A4FA 3G7ZA 4C92E 4HT8A 2DVEA 3WXMB 2RJEA 3UWNA 1VQ9A 3RMSA 4E7KA 3GF5A 4P72A 2ZNIA 4OB1B 2RO0A 5LJ5f 3CCRA 4KUDK 3RGLA 1VQOA 3CPWA 4YRJA 2K3YA 4OLFA 2CZ7B 2ZPIB 5IT9E 4RG8A 4IUPA 3HXUA 3UGTA 4KT0E 2RM4A 3VQYA 4C5IA 3QZ5B 1VQ6A 1M1GA 4M77C 2LTOA 4M7DB 2F5KA 2JNGA 3MO8A 5CCAA 4PJOB 1E22A 2HD0A 3M54A 4M77F 3S3OA 1H4VB 3JCMg 1QE0A 2ALYB 1QF6A 3CCET 1KQSA 3JSCA 2WSFE 3SWNC 5ELNA 1EQRA 1G3WA 1WGSA 3HP9A 5CR2A 3CPWS 2I4NA 4IUUA 4GLKA 5GAN5 2Q5HA 4NS5A 2ZT8A 4X34A 2B8AA 2ODRD 4H2XB 1VQ4T 4PJOD 3VYGA 2M1HA 5D6YA 5I2MA 3JCMc 1Z7NA 4L87A 2YRVA 3L2ZA 1WNLA 4BACA 3X20B 1M1KC 3E9HA 2ZZFA 2I2LA 5CQXA 2CS7A 4A4KA 1KQSS 1OYXA 3JCMb 4JRKA 5L8RE 3A7AA 5DM7R 4P71C 4P3NA 5GANg 4BB7A 2LCLA 2K57A 3OA6A 1QVPA 3MP8A 3A31A 2DO3A 1J5WA 4FM4B 4FL6A 4CH6A 3LLRA 3OQ5A 3P8BB 1OI1A 3P8VA 2VC8A 2VGMA 1UEBA 3I56T 2HBPA 1VQNT 5K1PA 1Q81C 2LCCA 2V8KA 2MI6A 1YJNA 3V7RA 2EQJA 2LQ8A 2KQWA 2IVWA 1G5VA 3S3MA 3HRKA 3LX7A 4PLIA 4LD6A 3KFUA 1EIYB 3CC2T 3OD1A 4YROA 3CC4T 4LDVA 4YRGA 4QQDA 1TH7A 4BY6B 1M9SA 4P3PA 4RQEA 3FB9A 2X4YA 3L2UA 4KUIA 2A3LA 4PLLA 3HY0A 1S72A 4ZTZB 1VQLA 2D9TA 3P8HA 3A32A 4M77E 4MDWA 3A5YA 2XG8D 1M90C 3JB9D 2R5MA 5FU7B 3G4SA 5IAYA 1SERA 2DXBA 4M7DA 3ME9A 2EL9A 4F7UB 2IY5B 1W66A 3CCQT 4PJOA 3S3NA 4JS5A 1VIEA 4H2TA 2NS6A 4RKUE 1W4SA 5KCHA 5GAOn 2ALYA 3TU4K 3X25B 3I55T 4C0ZA 2K5FA 3PCOB 5J3BA 4LVMA 3QTCA 4ZGJB 3A5ZB 5LJ3e 1Z7MA 4H2YA 2LX9A 4YYEA 1W2BA 3OY9A 3G71A 3DLLA 4J8OA 3P8DA 4XTXA 1XNIA 1LNXA 4PJOG 1RL2A 4H2WA 5CVIA 5GMKi 1Y07A 4H2XA 1OZ3A 2P0LA 1EVLA 4M75C 3KXTA 1ADYA 4XQ3A 1P92A 4P74C 4QVDA 5J26A 4DOVA 3M58A 1VQKA 3CBPA 4NL3A 3OB9A 4HCCA 3M55A 4M75F 1GXIE 2OAUA 2O4XB 3ASKA 4EX5A 4DPGA 4KBMB 2QHVA 3RERA 4MZPA 1M1KU 2Q7HA 1QW1A 2KAFA 3HFVA 2QTXA 1L0WA 2L89A 4TVAB 1W2BS 4KR3A 3CCST 4M78C 4C92G 2CZ0B 4C8QB 2PVDB 1H3ZA 3IG2A 2JN0A 3MP1A 3P8TA 2F5TX 3BW1A 4M78F 4HWTA 2PVOB 2DXTA 1NJ2A 5CO7A 2OTJT 4OP0A 2E3CA 1Q81U 1N9WA 3CD6A 3MEAA 4M7DF 2EJGA 3GP8A 3NTIA 2DIGA 2OTLA 1KHIA 1YI2T 5GAMh 1ASZA 3QJ6A 3A8OB 1C0AA 2QA4A 4HT4A 1KG1A 4C8QD 3NETA 1XTDA 2E64A 4YRQA 3WQZA 3JCMh 4J15A 3E9FA 3TCJA 2X35A 1BIBA 3CMEA 2LNVA 4YRRA 2VV5A 4OB0B 1JB0E 2AMCB 4ZTFA 4YCUA 5CKFA 3JB9G 1U1TA 4R56A 2RHSB 1PSEA 2DXUA 4XTZA 4ELZC 3HXXA 3FIFA 2RJDA 2DTIA 3MEUA 2ZPFB 5CKBA 3PMIA 1WJRA 3A8MB 4TQFA 1M90U 5GAOm 4F7UA 3OS2A 2IY5A 5HK3A 4HVCA 3DB4A 3TREA 2ZXFA 4Z02A 2KVQG 2Y90A 4YCVA 3PCOA 3E9GA 1YFTA 3OYDA 3GNFB 3HRTA 1M1FA 4KULA 3A5ZA 5HK0A 4CS3A 11ASA 2XICA 4DQ2A 4N4IA 2X4XA 2CKKA 3M4PA 2LVMA 4B9XA 1N27A 3CCJA 1K8AC 2E41A 3GPLA 4M75E 2I4MA 3PFSA 1VQ5T 4G85A 4K87A 5A2QE 4MMKA 2GQVA 1BYMA 4J6XA 1AHJB 4EMKB 5FU6C 4M7AB 4O2DA 3R07A 5KCOA 3F70A 2XU8A 4RCCA 2XKOC 2O4XA 2I4LA 1YJWT 4PKCC 2P5IA 1QP2A 1NE8A 2RHYA 4DA4A 1R8OB 2RI3A 4P73A 2ZPBB 4M78E 5D6WA 1UGQB 4A53A 2DD4A 3R6OA 3CC7A 1YBYA 3L42A 3OW2A 3PT9A 4N4GA 2PMFA 4QVCA 5A0GA 4G84A 2VYTA 4C8QA 2RI2A 3A8GB 2XD0A 3OMGA 4H2VA 5GAOp 2IG0A 4N0AA 3CCMT 4LVJA 1SRYA 4M7AD 3HXZA 2EIFA 1NJ1A 2ZZGA 3M9QA 3JCMQ 1OZ2A 2GCXA 4LVIA 5C0MA 2C7IA 3H8ZA 3T9NA 4C8QG 2DAQA 1VQ7A 4L5GA 4YRTA 2HAXA 4BD3A 1VQMT 1WQ7A 4JDSA 3QNEA 4IKFA 5FRNA 2JUFA 1YCYA 3QXEB 2E1HA 3OW2S 2Y4XA 2EQUA 3QUIA 2QQBA 4OMFB 5LL6S 2X4JA 2E12A 2E6ZA 2XGTA 3RIRA 2AMCA 3G1ZA 4ZTUB 1LJOA 4YRMA 5J39A 4VUBA 2RHSA 1LYLA 5GAOl 1YJ9T 2PU9B 1JJCB 5GAMg 2KK4A 1KMMA 1QP3A 1XOVA 4TWAA 1SETA 1NPRA 4P73C 1YIJT 4X5OA 4C0DB 3OYYA 4QQGA 4YRLA 3TUPA 2KY9A 2PVGB 2ZPEB 3E1SA 4WJ3M 4BI8B 4WJ4A 4J6WA 4CS4A 5C51B 3MEWA 1PYSB 1YITA 4B9WA 3DLMA 4ZN3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1EVK A;  3HFZ B;  3A7U A;  3JCM J;  4M7D E;  1SER A;  4M7D A;  3HFO A;  4KR2 A;  5GAN 3;  2EL9 A;  4F7U B;  2IY5 B;  4PJO E;  1E1O A;  1W66 A;  4C92 B;  3CMQ A;  2DEQ A;  4PJO A;  1KMN A;  3QO3 A;  1B70 B;  4C92 C;  2ZGW A;  4H2T A;  2E5A A;  5GAM d;  4H02 A;  3VU3 C;  4EMK A;  5GAO n;  2ALY A;  5KNN A;  4M7A E;  3SWN A;  3AHU A;  4M7A A;  4YRK A;  3V7C A;  4P72 C;  1Y96 B;  4M77 G;  3PCO B;  2EJF A;  3NEM A;  4F7U F;  3JCM d;  3HY1 A;  3QTC A;  4CH5 A;  4C92 F;  5LJ3 e;  2XTI A;  3M4Q A;  1Z7M A;  4H2Y A;  4YYE A;  1YGB A;  5GMK e;  3V8J A;  5GAM e;  5GAN j;  3JB9 H;  2ZT6 A;  4XEM A;  3JCM P;  4XTX A;  4CH4 A;  1LNX A;  4RDX A;  1MGQ A;  4PJO G;  1HC7 A;  2DU7 A;  4H2W A;  2ART A;  5F5W A;  1USY A;  4RQF A;  1GGM A;  3LSQ A;  5GMK i;  3EFR A;  4M75 B;  5GAM f;  3MF2 A;  4TQD A;  4H2X A;  3UGQ A;  1RIQ A;  4C92 D;  4EMH A;  2P0L A;  4PG3 A;  1EVL A;  4M75 C;  4J5Y A;  4M7A G;  4YRI A;  4CH3 A;  1HK9 A;  4XQ3 A;  1ADY A;  4TVY A;  2AKW A;  4P74 C;  4QVD A;  1WQW A;  3JCM f;  3PGG A;  4Q6G A;  2J3M A;  1WU7 A;  3P8Y A;  1NYQ A;  3JCM V;  4Y91 A;  4NL3 A;  2Q7G A;  1H4Q A;  4M75 F;  3TEH B;  4XEO A;  4P71 A;  5E3I A;  4EX5 A;  4DPG A;  1I81 A;  5DY9 A;  1M5Q 1;  2QHV A;  3RER A;  2Q7H A;  1X56 A;  5K1X A;  4Q15 A;  5GAN h;  3HFV A;  3NEL A;  2QTX A;  5GMK j;  3BDU A;  4M78 B;  5GAM j;  3M4G A;  4K88 A;  1L0W A;  1D3B B;  1KQ1 A;  3HXY A;  4NCX A;  4BWA A;  4TVA B;  4F7U G;  3IKL A;  4KR3 A;  2RA2 A;  4M78 C;  4C92 G;  2PME A;  4M75 D;  3JB9 I;  5GAN d;  4C8Q B;  3IG2 A;  4CS2 A;  2JN0 A;  3RKW A;  4XTW A;  2DZC A;  3P8T A;  4V2S A;  4C8Q C;  2ARU A;  4HWO A;  2Q5I A;  3BW1 A;  5LJ5 g;  4E51 A;  2DKG A;  2ZIO A;  4XTV A;  3VQW A;  4M78 F;  4HWT A;  1ADJ A;  4P3O A;  4TTV A;  2DXT A;  1NJ2 A;  2RB6 A;  3VQV A;  4N0A C;  4OP0 A;  4C8Q F;  2DQ3 A;  2E3C A;  4HWP A;  1N9W A;  4M77 A;  2J3L A;  4M7D F;  2EJG A;  3L4G B;  5GMK l;  4J6Y A;  3HRI A;  4XTU A;  5GAN f;  2ZT5 A;  3HFN A;  2DQ0 A;  4M78 D;  4YCW A;  1JJC A;  5GMK h;  5GAM h;  1BBW A;  4ZIB A;  1ASZ A;  4YRF A;  4HT9 A;  3IKM B;  2FB7 A;  1B7Y B;  1C0A A;  1NJ6 A;  5GAN 8;  1B34 B;  3IAL A;  2DZ9 A;  4XU0 A;  5LJ3 d;  4C8Q D;  3HXW A;  3RES A;  3NET A;  3TEG A;  5CAI A;  4M7D D;  2E64 A;  4JLI A;  2QHU A;  4YRQ A;  3WQZ A;  3JCM h;  2FYK A;  1M8V A;  4HWS A;  4J15 A;  1USY C;  1X55 A;  2RHQ B;  3SB2 A;  5I21 A;  4JRI A;  1BIB A;  1N9S A;  2CJ9 A;  2QHT A;  4YRR A;  2HNI A;  3FJP A;  2ZNJ A;  1YFS A;  2AMC B;  3BJU A;  1U1S A;  2YHT A;  4YRC A;  1NNH A;  4YCU A;  4XTY A;  3V7S A;  1KOG A;  4UP8 A;  2E10 A;  1X2G A;  3JCM W;  3JB9 G;  2ZTG A;  3RAC A;  1U1T A;  5LJ5 d;  4KQE A;  3V8K A;  4YDQ A;  3JCM X;  2RHS B;  4YRE A;  2DXU A;  5LJ3 f;  4XTZ A;  2E65 A;  1NJ8 A;  5GAO q;  3HXX A;  3FIF A;  1ATI A;  2DTI A;  3HFZ A;  4EO4 A;  5C53 B;  3QO7 A;  3VBB A;  1VQZ A;  4UP9 A;  1N9R A;  4X9C A;  4TQF A;  4BW9 A;  2I4O A;  1IL2 A;  4F7U E;  4WI1 A;  5GAO m;  3MEY A;  4C92 E;  4F7U A;  3I7F A;  5GAN 2;  2IY5 A;  4C92 A;  4HT8 A;  2DVE A;  5LJ5 e;  2DU5 A;  1B70 A;  2QHS A;  4P75 A;  4HVC A;  4RMF A;  2ZXF A;  3RKX A;  2Y90 A;  4P72 A;  2ZNI A;  2CGH A;  4YCV A;  2DJZ A;  5LJ5 f;  1X54 A;  1Y96 A;  4HWR A;  3PCO A;  4YPF A;  1EOV A;  1YFT A;  3RGL A;  2ARS A;  4YRJ A;  5LJ3 j;  4OLF A;  3A5Z A;  4CS3 A;  1KQ2 A;  11AS A;  4DQ2 A;  1YB3 A;  3HXU A;  3UGT A;  2RM4 A;  3VQY A;  3BY7 A;  4M77 B;  4UP7 A;  1HTT A;  3M4P A;  3QSU A;  3ICA A;  3L1A A;  12AS A;  4M77 C;  5GAN 4;  2E41 A;  4M75 E;  2I4M A;  4M7D B;  4K86 A;  4M75 A;  1JBM A;  4P74 A;  4XU2 A;  4M7D C;  4PJO B;  4G85 A;  3E9I A;  4K87 A;  5ELO A;  4PHC A;  2ODR C;  5LJ5 j;  1E22 A;  4MMK A;  4PJO C;  1X01 A;  4M77 F;  4J6X A;  4EMK B;  4XU3 A;  3JCM g;  1H4V B;  1QE0 A;  2ALY B;  1QF6 A;  1WLE A;  3SWN B;  1I4K 1;  4M7A B;  4H2S A;  4O2D A;  4EMK C;  4XU1 A;  3R07 A;  3SWN C;  3TEH A;  3REX A;  4RCC A;  4M7A C;  5ELN A;  1E24 A;  5LJ3 h;  2I4L A;  1BIA A;  1B76 A;  4PJO F;  1EQR A;  3HXV A;  2P5I A;  1G51 A;  4M75 G;  1E1T A;  4P73 A;  4M77 D;  2I4N A;  4M78 E;  4A53 A;  1H4T A;  4M78 A;  1EIY A;  5GAN 5;  2RD1 A;  2Q5H A;  5HGQ A;  2ZT8 A;  2PMF A;  4M7A F;  2YLB A;  4QVC A;  2ZZE A;  4G84 A;  3INZ A;  4C8Q E;  1NYR A;  1JRI A;  4C8Q A;  2ODR D;  4H2X B;  4RCB A;  4PJO D;  2CJA A;  3A7R A;  3RL6 A;  1WPY A;  1H4S A;  3MF1 A;  5GAO r;  5LJ5 h;  4NL2 A;  2AKW B;  4H2V A;  5GAO p;  1I5L A;  2EJ9 A;  2CIM A;  4TVW A;  5C52 B;  4N0A A;  3JCM c;  1Z7N A;  4L87 A;  3L2Z A;  1SRY A;  4M7A D;  3BFM A;  3HXZ A;  2DDZ A;  1WNL A;  2ZT7 A;  4P75 C;  4YRS A;  1NJ1 A;  3E9H A;  3ERR A;  4LNS A;  2ZZF A;  4NOY A;  1ASY A;  4M78 G;  4MML A;  2ZZG A;  1PYS A;  3JCM Q;  1X2H A;  1SES A;  2ZIM A;  4YRP A;  2I2L A;  2C7I A;  1FYF A;  1YFR A;  3L4G A;  3JCM b;  3A7A A;  4JRK A;  4P71 C;  3QHS A;  4P3N A;  4C8Q G;  5GAN g;  4YP0 A;  3UH0 A;  4M7D G;  2CJB A;  4YRT A;  2K57 A;  1B7Y A;  1B34 A;  1WQ7 A;  4AH6 A;  3QNE A;  3UFG A;  1YCY A;  3A31 A;  2E1H A;  1J5W A;  4CH6 A;  3QO8 A;  3QUI A;  2G4C A;  3JCM e;  3P8V A;  2Q7E A;  2VC8 A;  5GAN 7;  4UPA A;  2RHQ A;  3NEN A;  3JB9 J;  2XGT A;  2ZR3 A;  3RIR A;  1LOJ A;  2VXF A;  5K1P A;  2EWN A;  2AMC A;  1G5H A;  3GIB A;  1B8A A;  3G1Z A;  4ZTU B;  4PNO A;  1LJO A;  3RF1 A;  3V7R A;  4H2U A;  4YRM A;  1BBU A;  3QO5 A;  4JUV A;  3A74 A;  4HA8 A;  2DTH A;  1WYD A;  2RHS A;  5LJ3 g;  1LYL A;  3DSQ A;  5GAO l;  1HXD A;  1JJC B;  5GAM g;  2ZR2 A;  1KMM A;  2VXE A;  4TWA A;  1SET A;  3HRK A;  5GMK m;  3KFU A;  3HSB A;  1EIY B;  4P73 C;  1H64 1;  2DTO A;  3OD1 A;  5GAN 6;  4EMG A;  1NJ5 A;  4YRN A;  4YRO A;  4X5O A;  4YRG A;  1G5I A;  1TH7 A;  4P3P A;  4RQE A;  1EFW A;  3W3S A;  3FB9 A;  2ZIN A;  4YRL A;  3TUP A;  3JB9 F;  2ZCE A;  2C8M A;  3HY0 A;  3REU A;  3PZC A;  4WJ3 M;  4ZTZ B;  4X9D A;  4WJ4 A;  3LC0 A;  4J6W A;  3RUX A;  5GAN e;  3LSS A;  3V8L A;  4CS4 A;  3HTZ A;  4A54 A;  3A32 A;  5C51 B;  1D3B A;  4WF2 A;  1PYS B;  2EAY A;  3EFS A;  4M77 E;  4TVA A;  3VQX A;  1I8F A;  3A5Y A;  3RKY A;  2YLC A;  3JB9 D; 
#chains in the Genus database with same CATH topology
 3EFO B;  2BUD A;  4IUR A;  1IGQ A;  4PJM A;  2HEQ A;  4KR2 A;  2KBT A;  5GAN 3;  2L0A A;  3I5R A;  4JJN K;  1VQ8 A;  4DBF A;  3VUZ A;  2AHJ B;  4M4Z A;  4C92 B;  3CMQ A;  1KMN A;  1K8A U;  3QO3 A;  2J6O A;  2P0K A;  1B70 B;  4CI0 C;  2E5A A;  5GAM d;  4H02 A;  2E5Q A;  5I2S A;  4EMK A;  2FVU A;  1EIF A;  4M7A A;  3G6E Q;  3TEE A;  2H3J A;  2DXC A;  4OB3 B;  2QEX T;  1QWE A;  4P72 C;  2EJF A;  3JCM d;  5CKH A;  3M59 A;  4CH5 A;  2RJC A;  1SSF A;  3CMA T;  5GMK e;  4KH0 B;  3JB9 H;  4XEM A;  2EGA A;  1KHC A;  4CH4 A;  2DVJ A;  2AIR B;  1MGQ A;  1WI7 A;  1D1A A;  4YTL A;  2D0N A;  2EW3 A;  5F5W A;  2LT1 A;  1BI0 A;  4E6R A;  4GY5 A;  3EFR A;  5GAM f;  3MF2 A;  2A08 A;  2Z0W A;  4C92 D;  1YHQ T;  4J7F A;  3C12 A;  4PG3 A;  4M7A G;  4JJB A;  4OMN A;  3VS2 A;  4YRI A;  1HK9 A;  1M27 C;  4FT2 A;  4QT7 A;  1IHW A;  3G6E A;  1AD5 A;  4OB2 B;  4Y92 A;  1K8A R;  2YXY A;  3JCM f;  3PGG A;  4Q6G A;  2J3M A;  1WU7 A;  2SRC A;  3OYF A;  3JCM V;  1TUD A;  3MQZ A;  1H4Q A;  1SKU B;  1M3A A;  5E3I A;  4LDY A;  1Q86 C;  2XK0 A;  1I81 A;  4QQ6 A;  4ZGD B;  2X9H A;  2RQW A;  3QDR B;  1X56 A;  4BI3 A;  2A0F B;  1WFW A;  4RMO A;  1WHL A;  2V1Q A;  5GMK j;  2LJ1 A;  4L6V 5;  4F16 A;  1D3B B;  1TS9 A;  3HXY A;  1SPK A;  3CCE Q;  3IKL A;  2JOY A;  1XQH A;  2PME A;  1HD3 A;  1ZA1 B;  1ZBX A;  3OSV A;  5GAN d;  1IRX A;  4CS2 A;  3RKW A;  3LYI A;  1AZG B;  3J80 E;  4A4G A;  4TVR A;  2HBW A;  3SFM A;  2PNI A;  1WHH A;  2CUB A;  2P4T A;  1EX4 A;  2LDM A;  4E51 A;  4FCY A;  2M51 A;  3ZFJ A;  1OPK A;  1ADJ A;  4P3O A;  2LZ6 B;  3VRZ A;  3TVT A;  2EGE A;  1KC8 C;  5CIU A;  4DOW A;  3R6N A;  2DQ3 A;  3O8V A;  2HQH A;  2J6K A;  3L4G B;  3CCE A;  3HRI A;  3MCA B;  5GAN f;  3G71 Q;  3HFN A;  2DQ0 A;  4YCW A;  1JJC A;  1BBW A;  4YRF A;  2FB7 A;  4FT4 A;  1B7Y B;  1NG2 A;  1B34 B;  2DZ9 A;  4XU0 A;  3HXW A;  3RES A;  2MF2 A;  3CCV T;  2DL5 A;  3OYB A;  4J9D A;  4XK8 E;  3X26 B;  2FYK A;  1FMW A;  2RHQ B;  5I21 A;  3CBM A;  2CP3 A;  2YUO A;  3A8L B;  1VQP T;  2CJ9 A;  2QHT A;  1TG0 A;  2VGN A;  5M9O A;  1WJQ A;  3FJP A;  1VQ4 A;  2ZNJ A;  4OMM A;  4Z8A A;  1U1S A;  4YRC A;  3M5A A;  3S6W A;  3V7S A;  2QTV A;  3MEV A;  3OBY A;  4DBH A;  2CH4 W;  1PD0 A;  3QKJ A;  5FRM A;  4KQE A;  2EFI A;  4O6J A;  3E19 A;  2XDD A;  4YDQ A;  2HSE B;  3OYK A;  1Q82 C;  4YRE A;  1PM3 A;  3OYI A;  4JRP A;  4JZ3 A;  3I56 Q;  1SRL A;  3PVQ A;  3EFO A;  1SG5 A;  1VQN Q;  2K3X A;  5C53 B;  4JS4 A;  4LD9 K;  2A7Y A;  2O88 A;  2FEI A;  4EDU A;  4X9C A;  2X3W D;  4BW9 A;  1IL2 A;  1ACM B;  4WI1 A;  3MEY A;  3I7F A;  5GAN 2;  3EH2 A;  4C92 A;  5LJ5 e;  2DU5 A;  2DET A;  1B70 A;  4P75 A;  4DEX A;  4PK4 A;  3VV0 A;  3RKX A;  1ARK A;  2I0N A;  4II1 A;  2YUQ A;  3OMC A;  2QQA A;  2P4R A;  1LPL A;  1X54 A;  4FYX B;  3UDC A;  2ZCF B;  2P84 A;  1WHM A;  3EG9 A;  1N5Z A;  2HKN A;  3LWI A;  3L2W A;  1EOV A;  3PNW C;  3CC2 Q;  2XHC A;  5LJ3 j;  3I56 A;  3CC4 Q;  2GFA A;  1VQN A;  3PE0 A;  2F2X A;  1YB3 A;  3BY7 A;  4M77 B;  1H8K A;  2NUT B;  1HTT A;  4CRI A;  3URG A;  3QSU A;  2OTL Q;  2F1L A;  2CZ1 B;  3L1A A;  4OML A;  12AS A;  3KUF A;  5GAN 4;  2LX7 A;  1UE9 A;  5C6S A;  4J9C A;  2QA4 Q;  3VS7 A;  3EGU A;  2L8D A;  4J9E A;  1Q7Y C;  4XU2 A;  4M7D C;  3E9I A;  1X75 C;  2KR3 A;  5ELO A;  2X4W A;  5KYY B;  3CCU T;  2ODR C;  5LJ5 j;  3BE3 A;  2RJF A;  1BI2 A;  1G83 A;  1X01 A;  2EGC A;  4QW2 A;  4PJO C;  1O9S A;  3CC2 A;  4XU3 A;  4BDZ A;  2DL4 A;  3TSW A;  3CME Q;  1WLE A;  3SWN B;  3CC4 A;  4H2S A;  2L3P A;  3GBQ A;  4RTT A;  3FEO A;  4LDW A;  2G3R A;  2FL7 A;  3REX A;  1BKB A;  2K2V A;  2G6F X;  3ZBD A;  1BIA A;  1B76 A;  4PJO F;  3O5Z A;  2RHX A;  2OX7 A;  1G51 A;  1RAA B;  2CYZ B;  4PL6 A;  4M77 D;  1G8X A;  4PFO A;  1ZSZ B;  1G3Y A;  1Q86 U;  1IB8 A;  1EIY A;  1OX8 A;  2HDA A;  2YLB A;  3I55 Q;  3INZ A;  2AZV A;  1JRI A;  4RCB A;  2XDP A;  4E7I A;  1RLQ C;  3A7R A;  3RMQ A;  3RL6 A;  4AMC A;  2MPX C;  1I5L A;  3CCL T;  1BI1 A;  1RAF B;  2EYY A;  4C5H A;  2DM1 A;  3CCQ A;  3BFM A;  3L2Q A;  4FIB A;  4P75 C;  4YRS A;  4LNS A;  8AT1 B;  4MML A;  3EHR A;  4O5V A;  2A28 A;  3NTK A;  2ZIM A;  1MV3 A;  2ZZD A;  1FYF A;  1D1B A;  2ZPG B;  2MIO A;  1ZLM A;  1KC8 U;  3L4G A;  2PUK B;  1YFN A;  3QHS A;  3I55 A;  3WVE B;  4YP0 A;  2XID A;  2RK1 A;  4ZN1 A;  2D6F A;  1B7Y A;  1VQ9 T;  3CCJ Q;  1B34 A;  1Q86 R;  2NYS A;  2L3R A;  1OOT A;  3VKI A;  4AH6 A;  3ZL7 C;  2FPE A;  2WSE E;  3EG2 A;  1WXU A;  4FSX A;  3X24 B;  3WVD B;  3QO8 A;  4HVU A;  5AYF A;  3CCR T;  4XAX B;  3JCM e;  1QLY A;  4FU6 A;  2RHQ A;  1VQO T;  5I22 A;  3QYH B;  1U3O A;  7AT1 B;  4IIM A;  1LOJ A;  5HCK A;  1PD1 A;  4OGE A;  1G5H A;  3GIB A;  5HKC A;  3CCS Q;  1QKW A;  2LCS A;  3QYG B;  2DYB A;  2K7A A;  4PNO A;  2V1R A;  1NZ9 A;  3BDL A;  1VQ6 T;  1IO6 A;  1KSW A;  1GCQ A;  2LQN A;  2HQE A;  4JUV A;  4HA8 A;  1UG1 A;  4QKU A;  5LJ3 g;  2DBM A;  2IIM A;  3OBW A;  1NEB A;  1KQS P;  2JMC A;  2ZR2 A;  3CC7 Q;  1FXX A;  3UPU A;  1Q82 U;  1RAC B;  4DEY A;  1H64 1;  4RTU A;  1SF9 A;  4EMG A;  2CT3 A;  2JS2 A;  1G5I A;  2JTM A;  3CCS A;  3OYJ A;  1YI2 Q;  4BY6 C;  2RH2 A;  3J81 E;  4R55 A;  2JW4 A;  3JB9 F;  2C8M A;  3PZC A;  3VYH B;  2DYI A;  5A0D A;  3QPH A;  9ATC B;  1WJS A;  4X9D A;  3OYA A;  3LC0 A;  4BUG A;  3RUX A;  3LSS A;  5GAN e;  3EG0 A;  3HTZ A;  4A54 A;  5KE2 A;  2C0I A;  1ZQ1 A;  1X6O A;  4WF2 A;  2EAY A;  3VQX A;  4TVA A;  1I8F A;  3HRS A;  2OTJ A;  3QBY A;  2EYX A;  2NUT A;  1RAD B;  3RKY A;  1K73 C;  2XDB A;  1H3H A;  2CDT A;  1EVK A;  3HFZ B;  1QVF P;  1VQ7 Q;  3JCM J;  4BDY A;  4M7D E;  1RLP C;  3HFO A;  2BKD N;  5FU7 C;  1NYF A;  2K5L A;  1BCO A;  4PJO E;  1HYO A;  1BI3 A;  1YI2 A;  1Q82 R;  2COW A;  4C0F A;  2GF7 A;  5KYY A;  1UGR B;  4MZM A;  2DFU A;  2YWW A;  1S1N A;  3KBG A;  2F2V A;  1G3T A;  1Q7Y U;  3VU3 C;  5KH6 A;  1A0N B;  5FWB A;  3LH0 A;  3SWN A;  5DLO A;  3AHU A;  2K6D A;  1DJ7 B;  4YRK A;  3V7C A;  1Y96 B;  4M77 G;  2A37 A;  2HMA A;  1B07 A;  3TSZ A;  2VUB A;  2LQK A;  3NFC A;  4F7U F;  1MMA A;  2XTI A;  3THK A;  3M4Q A;  2K5I A;  5GAN j;  2Y4Y A;  2H3E B;  5KYU B;  2GGR A;  2KXD A;  5EG2 A;  1G3S A;  2W10 A;  1USY A;  4RQF A;  1GGM A;  2E6N A;  5I11 A;  4C0G A;  1UFF A;  4M75 B;  1UHC A;  1Z9Q A;  2QQ9 A;  3UGQ A;  1UGV A;  3IQL A;  2EYQ A;  4EMH A;  2H8H A;  1K1Z A;  5FLX E;  4J5Y A;  1E6G A;  1W70 A;  4CH3 A;  1J3T A;  1IZ6 A;  2VVK A;  1YJN T;  1AVZ C;  3PIO A;  1VIF A;  2L3Q A;  3VJP A;  2KNB B;  4Y28 E;  2FHD A;  1JO8 A;  2FG0 A;  5KYX B;  2LT4 A;  1QCO A;  4J7I A;  1NYQ A;  1Q7Y R;  2Q7G A;  3TEH B;  1VQ5 Q;  4XEO A;  4P71 A;  1V1C A;  1M5Q 1;  1V76 A;  1ZHI A;  4JJC A;  3L2V A;  2QQS A;  4L59 A;  2F69 A;  4Q15 A;  1YIT Q;  3UA6 A;  5A0L A;  3ULR B;  3BDU A;  4M78 B;  3DB3 A;  1KQ1 A;  4BWA A;  5IHI A;  2QDY B;  4RUG A;  4M75 D;  1FYN A;  2L5Q A;  4MDX A;  2DEU A;  4XTW A;  1SHG A;  2DZC A;  1VQ8 Q;  2RK2 A;  1PRL C;  2PUO B;  4V2S A;  1S72 T;  4C8Q C;  1YJW Q;  2ARU A;  4Z89 A;  4HWO A;  2Q5I A;  4BE0 A;  1PG5 B;  3I9Q A;  2RHI A;  1VQL T;  1KK7 A;  4XTV A;  4LNP A;  1VQ5 A;  4TTV A;  2RB6 A;  4N0A C;  2R58 A;  1AT1 B;  4C8Q F;  2J3L A;  3G4S T;  4MZT A;  3PTA A;  3QZ9 B;  1MMG A;  1D0Y A;  1JXM A;  1C0M A;  2ZT5 A;  5KE3 A;  4M78 D;  2VKN A;  4IUT A;  1OQK A;  5GMK h;  4J9H A;  4ZIB A;  4HT9 A;  1WX6 A;  4N4H A;  1EZZ B;  3LGF A;  1V29 B;  3JRZ A;  3SD4 A;  4A4E A;  3NPF A;  2AKK A;  1JXO A;  2JZ2 A;  5GAN 8;  1YJW A;  4RG2 A;  1X43 A;  2O9V A;  5L23 A;  1W2B P;  5CAI A;  4M7D D;  4JLI A;  1PKS A;  4P5N A;  1M8V A;  1USY C;  1X55 A;  3OS0 A;  4JRI A;  4C5E A;  3HHT B;  1W6X A;  2HNI A;  2BTT A;  4D8D A;  3G71 T;  1VQM Q;  1FX7 A;  2BIV A;  3PVL A;  2DER A;  1X2G A;  3JCM W;  2C06 A;  4E7L A;  3CCM A;  3V8K A;  1QVF A;  2M9U A;  2XI9 A;  3H0H A;  3OYH A;  3ER0 A;  3JCM X;  1FWZ A;  2E65 A;  5CQY A;  5GAO q;  1SSH A;  3H6Z A;  3HFZ A;  3J7A F;  4EO4 A;  3QO7 A;  1VQZ A;  3NGP A;  2I4O A;  1K73 U;  4F7U E;  3SDZ A;  5FW9 A;  1VQK T;  2QHS A;  2KSS A;  4RMF A;  3AT1 B;  3M0U A;  1VQM A;  1YJ9 Q;  4EIK A;  1UHF A;  4UC4 A;  2CGH A;  3C4S A;  2DJZ A;  2VAS A;  1E6H A;  3X28 B;  3UA7 A;  1Y96 A;  4ELY C;  4HWR A;  2HCK A;  4YPF A;  2CH4 A;  2JVV A;  4CC2 A;  2ARS A;  2E3H A;  1W1F A;  4BE1 A;  1M8M A;  1OPL A;  1KQ2 A;  3QJY A;  1I0C A;  3EHQ A;  4KGX B;  4UP7 A;  2EPD A;  2QGG A;  4ESR A;  3CXC A;  1PCX A;  3M57 A;  3ICA A;  4E47 A;  1QVF S;  3DKM A;  3OSS C;  2KEA A;  4K86 A;  4M75 A;  2DL8 A;  3QG1 A;  4X1V A;  1JBM A;  1YJ9 A;  4P74 A;  1K73 R;  2B86 A;  4PHC A;  2LC4 A;  2A36 A;  2R5A A;  3CBO A;  3C95 A;  2RQT A;  5FU6 B;  1AWJ A;  3CD6 T;  4AT1 B;  1YIJ A;  1Q95 G;  5KYX A;  4HCB A;  2JM9 A;  3JAM E;  1I4K 1;  1VQ4 Q;  3C94 A;  4EMK C;  2CRE A;  4XU1 A;  1QVG P;  2OTL T;  4ZGE B;  2D0Q B;  3TEH A;  5DLQ E;  4M7A C;  1KFZ A;  2P0P A;  1F1B B;  2DIQ A;  1E24 A;  5LJ3 h;  4Z88 A;  2QA4 T;  3HXV A;  2ED0 A;  1N8R C;  4M75 G;  1E1T A;  1K9M C;  4OVA A;  3VS6 A;  4LVK A;  2FZK B;  1H4T A;  2AK5 A;  4M78 A;  1OUL A;  1UTI A;  2MWO A;  4EPC A;  1MND A;  4CC4 B;  2RD1 A;  3EH1 A;  5HGQ A;  4M7A F;  2E4H A;  2QEX Q;  2ZZE A;  2YT6 A;  3CXC S;  1I07 A;  4C8Q E;  1NYR A;  3CME T;  2JS0 A;  1TUC A;  2DE0 X;  2YUN A;  2CJA A;  2KGT A;  3OYM A;  1WPY A;  1H4S A;  4HCZ A;  3MF1 A;  5GAO r;  3OYL A;  2CT4 A;  2V8I A;  4ME7 A;  4NL2 A;  2F2W A;  5LJ5 h;  1U5S A;  2AKW B;  2EJ9 A;  3HRU A;  2O31 A;  2CIM A;  4TVW A;  5C52 B;  2BZY A;  5CKD A;  2EKO A;  1GRI A;  4IIO A;  2DDZ A;  2ZT7 A;  1AWX A;  2DJQ A;  1X69 A;  4C5G A;  3ERR A;  2GNC A;  1ASY A;  2LNH B;  4NOY A;  4M78 G;  2KT8 A;  3LGL A;  2DX1 A;  3GNG A;  1PYS A;  4JPB W;  1X2H A;  1YHQ Q;  1SES A;  4YRP A;  2DRK A;  1YFR A;  3M0Q A;  1R77 A;  2RHZ A;  2QEX A;  3GOX A;  1T0J A;  4QVZ A;  3CPF A;  3UH0 A;  4FYV B;  1UGP B;  4LUE A;  1NYG A;  4M7D G;  2CJB A;  3MET A;  4R0K A;  4PJL A;  1WHK A;  3CMA A;  3UFG A;  2RI5 A;  1PSF A;  3OYC A;  3VS0 A;  2QI2 A;  1CKB A;  2ROT A;  2G4C A;  2Q7E A;  1UEC A;  4LUD A;  5GAN 7;  1JJ2 P;  4UPA A;  3NEN A;  1N6A A;  3JB9 J;  2J06 A;  1AEY A;  2K4Y A;  5CK9 A;  2ZR3 A;  2KMT A;  1VA7 A;  2YUP A;  2VXF A;  1YHQ A;  2EWN A;  1B8A A;  4IUV A;  2QXF A;  2PQW A;  2EQM A;  4LVL A;  3RF1 A;  1NPP A;  4H2U A;  4KGV B;  3CCJ T;  1BBU A;  3N5B B;  3QO5 A;  2E70 A;  4E7J A;  3A74 A;  4J9I A;  2P0Q A;  2DTH A;  3EAE A;  1WYD A;  2RHU A;  3DSQ A;  1HXD A;  1NEG A;  2EQI A;  2KRS A;  2CZ6 B;  2VXE A;  4FW2 A;  5GMK m;  2YDL A;  3M4Y A;  3FRN A;  3HSB A;  3Q1J A;  2DTO A;  2SEM A;  5ECA A;  5GAN 6;  1NJ5 A;  4YRN A;  3HL8 A;  3RNJ A;  2MWP A;  1EFW A;  4C0D C;  3W3S A;  4E7S A;  2ZIN A;  4DBQ A;  5EC7 A;  3A98 A;  3FLG A;  1K9A A;  2ZCE A;  1NJI C;  3MP6 A;  1YWP A;  5FRO A;  3CCQ Q;  1BK2 A;  2DMO A;  1WYX A;  3REU A;  1IXD A;  1Y71 A;  2MMP A;  1ZUU A;  4A63 B;  3CCV Q;  3CC7 T;  1MUZ A;  4J9F A;  2RNA A;  1KD1 C;  3RR6 A;  2O01 E;  3V8L A;  2E3I A;  2X51 A;  1OU9 A;  1D3B A;  3EFS A;  4JRQ A;  1M4Z A;  1VQP Q;  3HTR A;  3UT1 A;  2YLC A;  2CP0 A;  5IHN A;  3A7U A;  2EQK A;  3REB B;  1IRE B;  3VUB A;  2LRQ A;  1T0H A;  4Q5W A;  1X2K A;  1E1O A;  2DEQ A;  2MAM A;  1X6G A;  2RQV A;  2QDL A;  2A8E A;  3OS5 A;  1M3B A;  2ZGW A;  4C92 C;  1K0S A;  1QVG A;  2LJ0 A;  4PJN A;  4A4H A;  2YRC A;  3CCV A;  5KNN A;  1WXT A;  4M7A E;  4LDX A;  1VUB A;  3E2U A;  2HL5 C;  4FSS A;  4LE9 A;  3NEM A;  4GBQ A;  1VQP A;  1VQ7 T;  3HY1 A;  1D0X A;  3M53 A;  4C92 F;  2ZPH B;  2QK0 A;  2DL3 A;  1YGB A;  3V8J A;  5GAM e;  2VB6 A;  2ZT6 A;  3PMT A;  3JCM P;  3CPW P;  4RDX A;  4IUQ A;  1HC7 A;  2DU7 A;  1N8R U;  2ART A;  1K9M U;  3LSQ A;  1MHN A;  2DPP B;  4HVW A;  1Z9Z A;  4FYW B;  2QQR A;  2KDS A;  4TQD A;  1RIQ A;  2DK3 A;  3EGX B;  3QDF A;  3CQT A;  4RTW A;  4TVY A;  5KYW B;  2AKW A;  2DBK A;  3VS1 A;  2NLU A;  3GLX A;  2M0Y A;  1WQW A;  1ZUY A;  3OS1 A;  5CKE A;  3P8Y A;  2AZS A;  1RAH B;  3M56 A;  1BBZ A;  3OYG A;  1QVG S;  4Y91 A;  1ZUK A;  2QG9 B;  2V26 A;  2KRM A;  2PZ1 A;  2K2M A;  5DY9 A;  2ATC B;  2QYZ A;  3CCU Q;  2FRW A;  2CP2 A;  5K1X A;  1QCF A;  5GAN h;  4OGC A;  3NEL A;  2OTJ Q;  2JXB A;  4OF1 A;  5GAM j;  4K88 A;  3M4G A;  1O75 A;  4NCX A;  1Y0M A;  4ATO A;  3LW5 E;  4F7U G;  2RA2 A;  2C0T A;  1JJ2 A;  3JB9 I;  3NTH A;  1N8R R;  5IN1 A;  3FDR A;  1TXQ A;  4BI4 A;  3L2R A;  1K9M R;  5D7U A;  1VOM A;  2BE7 D;  3QII A;  4J83 A;  5LJ5 g;  1AWW A;  1M3C A;  2DKG A;  3FC3 A;  2ZIO A;  1MMD A;  1VYU A;  3VQW A;  2R57 A;  3SHW A;  1YIT T;  1MMN A;  2V8J A;  3VQV A;  3CCU A;  1UB4 A;  3OYE A;  1M30 A;  2KYB A;  1UGS B;  2C0O A;  3PIP A;  3KFV A;  4HWP A;  4M77 A;  1RI0 A;  5GJV B;  1YCS B;  1X6B A;  2D8H A;  5GMK l;  2K3B A;  1AZE A;  3HKS A;  4J6Y A;  1VQ8 T;  4XTU A;  3CCL Q;  2CSQ A;  1UJY A;  2M16 A;  3HPW A;  3TQ7 P;  3IKM B;  3LWH A;  1NJ6 A;  4D6W A;  4RTY A;  4ZTJ A;  3IAL A;  5LJ3 d;  3A8H B;  3TEG A;  4HKE A;  2GQI A;  2QHU A;  1PWT A;  1YN8 A;  1U8R A;  1UJ0 A;  4ZN3 A;  1JJ2 S;  4HWS A;  2WSC E;  3SB2 A;  1N9S A;  3EGD B;  1T3L A;  5D6X A;  3ZEH A;  1YFS A;  3BJU A;  3I5S A;  2YHT A;  1VQ9 Q;  1NNH A;  3MHX A;  4XTY A;  4LDU A;  3OYN A;  1UUE A;  3CEY A;  1KOG A;  4UP8 A;  2E10 A;  3CCL A;  4BE2 A;  2ZTG A;  3RAC A;  4JLG A;  2ESW A;  1NJI U;  1ZSZ A;  1OX9 A;  5LJ5 d;  2GFU A;  1PHT A;  2DD5 A;  3CCR Q;  3MKD A;  2JTF A;  2WAC A;  4JZ4 A;  1RAG B;  1GCQ C;  4AG2 C;  1VQO Q;  1GFD A;  5LJ3 f;  5HY6 A;  2RQU A;  1NJ8 A;  2M0O A;  1KD1 U;  1BU1 A;  1ATI A;  4E7H A;  3VBB A;  1Y57 A;  4F04 B;  4UP9 A;  2HQX A;  3G6E T;  1N9R A;  4A4F A;  3G7Z A;  4C92 E;  1VQ6 Q;  1RAI B;  4HT8 A;  2DVE A;  1M2O A;  1PNJ A;  4PJJ A;  1QQJ A;  3WXM B;  2RJE A;  3UWN A;  1VQ9 A;  2YSQ A;  3RMS A;  1GBR A;  4E7K A;  3GF5 A;  4P72 A;  2ZNI A;  1FMK A;  4AFZ C;  4OB1 B;  2RO0 A;  2COY A;  5LJ5 f;  1MV0 B;  3CCR A;  3VRY A;  4KUD K;  3RGL A;  1VQO A;  3CPW A;  4YRJ A;  2K3Y A;  4OLF A;  2CP6 A;  4KRT A;  2CZ7 B;  2ZPI B;  5IT9 E;  4RG8 A;  4IUP A;  3HXU A;  3UGT A;  4KT0 E;  1NJI R;  2RM4 A;  3VQY A;  4C5I A;  4DBR A;  3QZ5 B;  1VQ6 A;  1M1G A;  1VYV A;  4M77 C;  4CC7 A;  1KD1 R;  2LTO A;  2VWF A;  4M7D B;  2F5K A;  4OMP A;  2JNG A;  3MO8 A;  5CCA A;  2FPF A;  2GTJ A;  3EGX A;  4PJO B;  1EFN A;  1E22 A;  2HD0 A;  3M54 A;  4M77 F;  3S3O A;  1E7O A;  1H4V B;  3JCM g;  1QE0 A;  2ALY B;  2OJ2 A;  1QF6 A;  1PC0 A;  3CCE T;  1X2Q A;  3RBB B;  1KQS A;  3JSC A;  2WSF E;  3SWN C;  1WIE A;  5ELN A;  1GL5 A;  1IHV A;  1EQR A;  3CCM Q;  1G3W A;  1WGS A;  3HP9 A;  5CR2 A;  3QWX X;  3CPW S;  2I4N A;  1CKA A;  1RI9 A;  4IUU A;  2J6F A;  2ROL A;  2JT4 A;  4GLK A;  1BB9 A;  5GAN 5;  2Q5H A;  4NS5 A;  1ZSZ C;  2ZT8 A;  1T3S A;  1GFC A;  1B3Q A;  1GBQ A;  4X34 A;  2B8A A;  2ODR D;  4H2X B;  2EYZ A;  1VQ4 T;  4PJO D;  3VYG A;  2J7I A;  2M1H A;  4PFP A;  5D6Y A;  2BE9 B;  5I2M A;  3JCM c;  1Z7N A;  4L87 A;  2YRV A;  3L2Z A;  1LVK A;  1WNL A;  4BAC A;  1TSF A;  3X20 B;  1M1K C;  2J05 A;  3E9H A;  1KJW A;  2ZZF A;  2QAS A;  2I2L A;  3EG9 B;  5CQX A;  2CS7 A;  4A4K A;  1KQS S;  1OYX A;  3JCM b;  4JRK A;  5L8R E;  3A7A A;  5DM7 R;  4P71 C;  1YJN Q;  4P3N A;  1WHJ A;  5GAN g;  1WZO A;  4BB7 A;  2LCL A;  2K57 A;  3OA6 A;  1QVP A;  1RAE B;  3MP8 A;  3A31 A;  2DO3 A;  5IXF A;  1J5W A;  4FM4 B;  4FL6 A;  4CH6 A;  3LLR A;  2NUP B;  3OQ5 A;  3P8B B;  1OI1 A;  3P8V A;  4F17 A;  2VC8 A;  2VGM A;  1UEB A;  3I56 T;  2HBP A;  3EGD A;  1VQN T;  4E2F B;  5K1P A;  1Q81 C;  3H41 A;  1YIJ Q;  2OAW A;  2LCC A;  1BCM A;  2V8K A;  4AFQ C;  2MI6 A;  1YJN A;  3V7R A;  2EQJ A;  2KYM A;  1NLP C;  2LQ8 A;  2RN8 A;  5KYU A;  1S72 Q;  2KQW A;  1ABQ A;  1VQL Q;  2IVW A;  1G5V A;  2HL3 A;  4FW1 A;  3S3M A;  3HRK A;  3LX7 A;  4PLI A;  4LD6 A;  3KFU A;  2X3X D;  1EIY B;  1K0X A;  4RTZ A;  3CC2 T;  3MPU B;  3OD1 A;  2ENM A;  4HCK A;  2DNU A;  4YRO A;  3CC4 T;  4LDV A;  3SEM A;  2DL7 A;  1XJW B;  3G4S Q;  4YRG A;  4QQD A;  1TH7 A;  4BY6 B;  1M9S A;  4P3P A;  4RQE A;  3FB9 A;  4JJD A;  2CUD A;  2X4Y A;  4OMO A;  2HZY A;  4KUI A;  3L2U A;  2A3L A;  2BZX A;  4PLL A;  3HY0 A;  1S72 A;  2LMJ A;  4ZTZ B;  2LP5 A;  2LJ3 A;  1VQL A;  1TOV A;  2D9T A;  2EVR A;  3P8H A;  3A32 A;  2MCN A;  4M77 E;  4MDW A;  3MJX A;  3LH5 A;  3A5Y A;  2XG8 D;  1M90 C;  3A1P A;  2AKL A;  2R5M A;  3JB9 D;  5FU7 B;  3G4S A;  5IAY A;  1SER A;  2DXB A;  2CSI A;  8ATC B;  4M7D A;  2KRN A;  3ME9 A;  2EL9 A;  3CMA Q;  4F7U B;  2IY5 B;  1W66 A;  2AT1 B;  3CCQ T;  4PJO A;  2NUZ A;  3S3N A;  4JS5 A;  1VIE A;  4LN2 A;  4H2T A;  2NS6 A;  1I5O B;  4RKU E;  3NMZ C;  4ZNX A;  1W4S A;  5KCH A;  5GAO n;  2ALY A;  3TU4 K;  3X25 B;  3I55 T;  4C0Z A;  2K5F A;  3UF4 A;  3PCO B;  2JJ9 A;  5J3B A;  1WHG A;  4LVM A;  2RQR A;  4KGZ B;  1NBE B;  1VQK Q;  3QTC A;  4ZGJ B;  3A5Z B;  4AFS C;  5LJ3 e;  1Z7M A;  4H2Y A;  2LX9 A;  4ORZ A;  4YYE A;  1W2B A;  3OY9 A;  3G71 A;  3DLL A;  4J8O A;  3P8D A;  4XTX A;  1XNI A;  1LNX A;  2D8J A;  4PJO G;  1RL2 A;  4H2W A;  4HVV A;  3M0T A;  5CVI A;  2K79 A;  3UAT A;  2XMF A;  5FWC A;  5GMK i;  1Y07 A;  3EG1 A;  2DIL A;  4H2X A;  1OZ3 A;  2JTE A;  2P0L A;  3NHN A;  1EVL A;  4M75 C;  3KXT A;  2BZ8 A;  1ADY A;  4XQ3 A;  1P92 A;  4P74 C;  1UDL A;  4QVD A;  5J26 A;  4DOV A;  1WLP B;  3M58 A;  1VQK A;  2RF0 A;  3CBP A;  3JV3 A;  4NL3 A;  3OB9 A;  4HCC A;  3M55 A;  4M75 F;  1QKX A;  1GXI E;  2OAU A;  2O4X B;  3ASK A;  4EX5 A;  4DPG A;  4KBM B;  5KYN A;  1MNE A;  2QHV A;  3RER A;  4MZP A;  1M1K U;  2Q7H A;  1QW1 A;  2KAF A;  3HFV A;  2QTX A;  3CD6 Q;  1L0W A;  2L89 A;  4TVA B;  1W2B S;  4KR3 A;  3CCS T;  4M78 C;  4C92 G;  2KRO A;  2CZ0 B;  5IH2 A;  4C8Q B;  2PVD B;  1H3Z A;  3IG2 A;  2JN0 A;  3MP1 A;  3P8T A;  2EBP A;  3OW2 P;  1OU8 A;  1U06 A;  2NUP A;  5AT1 B;  2F5T X;  1QCN A;  3BW1 A;  2HKQ B;  1YWO A;  4HXJ A;  4M78 F;  4HWT A;  2M02 A;  2PVO B;  2MOX A;  2DXT A;  2GBQ A;  1NJ2 A;  5CO7 A;  2OTJ T;  1KIK A;  4OP0 A;  1M2V B;  2E3C A;  2IPO B;  1Q81 U;  1N9W A;  3CD6 A;  3MEA A;  4M7D F;  2EJG A;  3GP8 A;  2KXC A;  3NTI A;  2DIG A;  2OTL A;  1KHI A;  1YI2 T;  2DLP A;  1M1K R;  5GAM h;  1ASZ A;  3H9N A;  3QJ6 A;  3A8O B;  1C0A A;  2QA4 A;  4HT4 A;  2KE9 A;  1OV3 A;  1KG1 A;  4C8Q D;  2KI7 A;  1YNZ A;  3NET A;  1XTD A;  3VS3 A;  1LCK A;  2E64 A;  4YRQ A;  1X27 A;  3WQZ A;  3JCM h;  4J15 A;  1D1C A;  3E9F A;  3TCJ A;  2X35 A;  1BIB A;  3CME A;  2LNV A;  1D0Z A;  1C6V X;  2VV5 A;  4OB0 B;  1JB0 E;  4YRR A;  1ABO A;  1WA7 A;  2AMC B;  2FO0 A;  4RTX A;  4ZTF A;  2ECZ A;  4YCU A;  3QWY A;  5CKF A;  3JB9 G;  1U1T A;  4R56 A;  1SEM A;  1Q81 R;  2RHS B;  1PSE A;  2DXU A;  4XTZ A;  4ELZ C;  1C1A A;  1R0C B;  3HXX A;  3FIF A;  2RJD A;  4GLM A;  2DTI A;  3MEU A;  2ZPF B;  2CP5 A;  5CKB A;  3PMI A;  1WJR A;  3A8M B;  2LQW A;  4TQF A;  3H0I A;  5IXB A;  2DF6 A;  1G2B A;  1M90 U;  5GAO m;  4F7U A;  1QMC A;  3OS2 A;  2IY5 A;  1JU5 C;  2E5K A;  1QWF A;  1ZA2 B;  5HK3 A;  3REA B;  1OEB A;  4HVC A;  3DB4 A;  3TRE A;  1H92 A;  2JMA A;  2ZXF A;  4Z02 A;  3M0S A;  2KVQ G;  2Y90 A;  1PRM C;  4YCV A;  3C0C A;  3PCO A;  3E9G A;  3I35 A;  1YFT A;  3RDV A;  3OYD A;  3GNF B;  3VS5 A;  4WTO B;  3HRT A;  1M1F A;  4KUL A;  2KT1 A;  4B6M A;  4ANJ A;  3A5Z A;  2QAZ A;  3M0R A;  3D7S B;  5HK0 A;  4CS3 A;  1AOJ A;  11AS A;  1AWO A;  2XIC A;  4DQ2 A;  1RAB B;  4N4I A;  2FZG B;  2X4X A;  1HJD A;  2CKK A;  2COZ A;  1TWB A;  3M4P A;  2LVM A;  4B9X A;  1N27 A;  1CSK A;  3CCJ A;  1K8A C;  2E41 A;  3GPL A;  2EKH A;  4J9B A;  4M75 E;  1KC8 R;  2I4M A;  3PFS A;  1VQ5 T;  2QGF B;  4G85 A;  4K87 A;  1M90 R;  1TUG B;  4J9G A;  4D8K A;  5A2Q E;  4MMK A;  2W0Z A;  2GQV A;  2ED1 A;  1BYM A;  4J6X A;  1AHJ B;  4EMK B;  4FYY B;  5FU6 C;  4M7A B;  4O2D A;  2DA9 A;  2FPD A;  4F14 A;  2RPN A;  3R07 A;  5KCO A;  3F70 A;  1FMV A;  2XU8 A;  4RCC A;  2XKO C;  2O4X A;  1RUW A;  2I4L A;  1YJW T;  1HSQ A;  1SRM A;  4PKC C;  2P5I A;  1QP2 A;  1NE8 A;  2RHY A;  4DA4 A;  1R8O B;  2RI3 A;  5GJW B;  4P73 A;  2ZPB B;  4M78 E;  5D6W A;  1UGQ B;  4A53 A;  2YRD A;  3R6O A;  2DD4 A;  3CC7 A;  1YBY A;  2D1X A;  3L42 A;  2L3S A;  3OW2 A;  3PT9 A;  4N4G A;  2PMF A;  4QVC A;  5A0G A;  4G84 A;  2VYT A;  4C8Q A;  1WDX A;  1NM7 A;  2RI2 A;  3A8G B;  2XD0 A;  3OMG A;  2MK5 A;  1IGU A;  2L2P A;  4H2V A;  5GAO p;  3FJ5 A;  4WCI A;  2IG0 A;  1B7T A;  4N0A A;  3CCM T;  4LVJ A;  1SRY A;  4M7A D;  3HXZ A;  4E7Z A;  2EIF A;  1NJ1 A;  2ZZG A;  1M2V A;  3M9Q A;  3JCM Q;  1TTH B;  1OZ2 A;  2GCX A;  1JQQ A;  4KH1 B;  5C0M A;  2C7I A;  4LVI A;  3H8Z A;  1R0B G;  2ZAE A;  3T9N A;  4C8Q G;  5IHK A;  2GTO A;  2DAQ A;  1K76 A;  1VQ7 A;  3VS4 A;  4L5G A;  1PKT A;  4YRT A;  2FRY A;  2HAX A;  1SHF A;  4BD3 A;  1VQM T;  1WQ7 A;  2O2O A;  2CP7 A;  4JDS A;  1ZX6 A;  3QNE A;  4IKF A;  5FRN A;  2JUF A;  1YCY A;  3QXE B;  4AG1 C;  4PFZ A;  1TU0 B;  2E1H A;  4AFU C;  3OW2 S;  2Y4X A;  2EQU A;  3QUI A;  2QQB A;  3CXC P;  4OMF B;  5LL6 S;  2ABL A;  2X4J A;  1I1J A;  2E12 A;  2E6Z A;  1GCP A;  2XGT A;  3RIR A;  2PTK A;  3U23 A;  2AMC A;  3G1Z A;  4K11 A;  4ZTU B;  1LJO A;  2RMO A;  1NLO C;  4YRM A;  2JM8 A;  1JEG A;  5J39 A;  4VUB A;  3M0P A;  2RHS A;  2DRM A;  4RTV A;  1LYL A;  1YP5 A;  4OMQ A;  5GAO l;  1YJ9 T;  2MYS A;  2PU9 B;  1JJC B;  5GAM g;  1ZBJ A;  2KK4 A;  1KMM A;  1QP3 A;  1XOV A;  4TWA A;  1SET A;  1NPR A;  4P73 C;  5KYW A;  1YIJ T;  2HSP A;  2OI3 A;  1D09 B;  4X5O A;  4C0D B;  2NWM A;  2K9G A;  3EG3 A;  1WXB A;  2O9S A;  3OYY A;  1ZSG A;  4QQG A;  4YRL A;  3TUP A;  3H0F A;  2FZC B;  2KY9 A;  2PVG B;  2ZPE B;  3E1S A;  4WJ3 M;  1K4U S;  1VYT A;  4LXC A;  2EYW A;  4BI8 B;  4WJ4 A;  4J6W A;  4CS4 A;  4CC3 A;  5C51 B;  3MEW A;  1YIT A;  1PYS B;  4B9W A;  3G1J A;  6AT1 B;  3DLM A;  1Y7X A; 
#chains in the Genus database with same CATH homology
 4IUR A;  2BUD A;  4KR2 A;  5GAN 3;  4JJN K;  1VQ8 A;  3VUZ A;  2AHJ B;  4C92 B;  3CMQ A;  1KMN A;  1K8A U;  3QO3 A;  2P0K A;  1B70 B;  4CI0 C;  2E5A A;  5GAM d;  4H02 A;  2E5Q A;  5I2S A;  4EMK A;  2FVU A;  1EIF A;  4M7A A;  3TEE A;  2H3J A;  2DXC A;  4OB3 B;  2QEX T;  4P72 C;  2EJF A;  3JCM d;  5CKH A;  3M59 A;  4CH5 A;  2RJC A;  1SSF A;  3CMA T;  5GMK e;  3JB9 H;  4XEM A;  1KHC A;  4CH4 A;  1MGQ A;  4YTL A;  5F5W A;  2LT1 A;  1BI0 A;  4GY5 A;  3EFR A;  5GAM f;  3MF2 A;  4C92 D;  1YHQ T;  4J7F A;  3C12 A;  4PG3 A;  4M7A G;  4YRI A;  1HK9 A;  4FT2 A;  3G6E A;  4OB2 B;  3JCM f;  3PGG A;  4Q6G A;  2J3M A;  1WU7 A;  3OYF A;  3JCM V;  3MQZ A;  1H4Q A;  5E3I A;  4LDY A;  1Q86 C;  2XK0 A;  1I81 A;  4QQ6 A;  4ZGD B;  3QDR B;  1X56 A;  4BI3 A;  4RMO A;  5GMK j;  4L6V 5;  1D3B B;  3HXY A;  3IKL A;  2JOY A;  1XQH A;  2PME A;  1ZBX A;  3OSV A;  5GAN d;  4CS2 A;  3RKW A;  3LYI A;  3J80 E;  4A4G A;  4TVR A;  3SFM A;  2P4T A;  2LDM A;  4E51 A;  3ZFJ A;  1ADJ A;  4P3O A;  1KC8 C;  5CIU A;  4DOW A;  2DQ3 A;  3O8V A;  3L4G B;  3CCE A;  3HRI A;  3MCA B;  5GAN f;  3HFN A;  2DQ0 A;  4YCW A;  1JJC A;  1BBW A;  4YRF A;  2FB7 A;  4FT4 A;  1B7Y B;  1B34 B;  2DZ9 A;  4XU0 A;  3HXW A;  3RES A;  2MF2 A;  3CCV T;  3OYB A;  4XK8 E;  3X26 B;  2FYK A;  2RHQ B;  5I21 A;  3CBM A;  3A8L B;  1VQP T;  2CJ9 A;  2QHT A;  2VGN A;  5M9O A;  1WJQ A;  3FJP A;  1VQ4 A;  2ZNJ A;  1U1S A;  4YRC A;  3M5A A;  3S6W A;  3V7S A;  3MEV A;  3OBY A;  3QKJ A;  5FRM A;  4KQE A;  2EFI A;  4O6J A;  3E19 A;  2XDD A;  4YDQ A;  3OYK A;  1Q82 C;  4YRE A;  3OYI A;  4JRP A;  2K3X A;  5C53 B;  4JS4 A;  4LD9 K;  2A7Y A;  4EDU A;  4X9C A;  4BW9 A;  1IL2 A;  4WI1 A;  3MEY A;  3I7F A;  5GAN 2;  4C92 A;  5LJ5 e;  2DU5 A;  1B70 A;  4P75 A;  3VV0 A;  3RKX A;  4II1 A;  3OMC A;  2QQA A;  1X54 A;  3UDC A;  2ZCF B;  3LWI A;  3L2W A;  1EOV A;  3PNW C;  2XHC A;  5LJ3 j;  3I56 A;  2GFA A;  1VQN A;  1YB3 A;  3BY7 A;  4M77 B;  1HTT A;  4CRI A;  3URG A;  3QSU A;  2CZ1 B;  3L1A A;  12AS A;  3KUF A;  5GAN 4;  5C6S A;  2L8D A;  1Q7Y C;  4XU2 A;  4M7D C;  3E9I A;  1X75 C;  5ELO A;  2X4W A;  3CCU T;  2ODR C;  5LJ5 j;  2RJF A;  1BI2 A;  1X01 A;  4QW2 A;  4PJO C;  1O9S A;  3CC2 A;  4XU3 A;  4BDZ A;  1WLE A;  3SWN B;  3CC4 A;  4H2S A;  3FEO A;  4LDW A;  2G3R A;  2FL7 A;  3REX A;  1BKB A;  2K2V A;  3ZBD A;  1BIA A;  1B76 A;  4PJO F;  2RHX A;  1G51 A;  4PL6 A;  2CYZ B;  4M77 D;  1G3Y A;  1Q86 U;  1EIY A;  2YLB A;  3INZ A;  1JRI A;  4RCB A;  2XDP A;  4E7I A;  3A7R A;  3RMQ A;  3RL6 A;  1I5L A;  3CCL T;  1BI1 A;  4C5H A;  3CCQ A;  3BFM A;  3L2Q A;  4FIB A;  4P75 C;  4YRS A;  4LNS A;  4MML A;  4O5V A;  3NTK A;  2ZIM A;  2ZZD A;  1FYF A;  2ZPG B;  1KC8 U;  3L4G A;  2PUK B;  3QHS A;  3I55 A;  3WVE B;  4YP0 A;  2XID A;  2RK1 A;  4ZN1 A;  2D6F A;  1B7Y A;  1VQ9 T;  1B34 A;  2L3R A;  3VKI A;  4AH6 A;  2WSE E;  4FSX A;  3X24 B;  3WVD B;  3QO8 A;  5AYF A;  3CCR T;  4XAX B;  3JCM e;  4FU6 A;  2RHQ A;  1VQO T;  3QYH B;  1LOJ A;  4OGE A;  1G5H A;  3GIB A;  5HKC A;  3QYG B;  4PNO A;  1NZ9 A;  3BDL A;  1VQ6 T;  1Y7X A;  2HQE A;  4JUV A;  4HA8 A;  5LJ3 g;  3OBW A;  2ZR2 A;  1FXX A;  3UPU A;  1Q82 U;  1H64 1;  4EMG A;  1G5I A;  2JTM A;  3CCS A;  3OYJ A;  4BY6 C;  2RH2 A;  3J81 E;  4R55 A;  3JB9 F;  2C8M A;  3PZC A;  3VYH B;  5A0D A;  3QPH A;  1WJS A;  4X9D A;  3OYA A;  3LC0 A;  4BUG A;  3RUX A;  3LSS A;  5GAN e;  3HTZ A;  4A54 A;  5KE2 A;  1ZQ1 A;  1X6O A;  4WF2 A;  2EAY A;  3VQX A;  4TVA A;  1I8F A;  3HRS A;  2OTJ A;  3QBY A;  1K73 C;  3RKY A;  2XDB A;  1EVK A;  3HFZ B;  3JCM J;  4BDY A;  4M7D E;  3HFO A;  2BKD N;  5FU7 C;  2K5L A;  4PJO E;  1BI3 A;  1YI2 A;  4C0F A;  2GF7 A;  1UGR B;  4MZM A;  3KBG A;  1G3T A;  1Q7Y U;  3VU3 C;  5KH6 A;  3LH0 A;  3SWN A;  5DLO A;  3AHU A;  1DJ7 B;  4YRK A;  3V7C A;  1Y96 B;  4M77 G;  2VUB A;  2LQK A;  3NFC A;  4F7U F;  2XTI A;  3M4Q A;  2K5I A;  5GAN j;  2Y4Y A;  5EG2 A;  1G3S A;  1USY A;  4RQF A;  1GGM A;  2E6N A;  4C0G A;  4M75 B;  2QQ9 A;  3UGQ A;  2EYQ A;  4EMH A;  5FLX E;  4J5Y A;  4CH3 A;  1IZ6 A;  1YJN T;  3PIO A;  1VIF A;  3VJP A;  4Y28 E;  2FHD A;  2LT4 A;  4J7I A;  1NYQ A;  2Q7G A;  3TEH B;  4XEO A;  4P71 A;  1M5Q 1;  1ZHI A;  3L2V A;  2QQS A;  4L59 A;  2F69 A;  4Q15 A;  5A0L A;  3BDU A;  4M78 B;  3DB3 A;  1KQ1 A;  4BWA A;  2QDY B;  4M75 D;  2L5Q A;  4MDX A;  4XTW A;  2DZC A;  2RK2 A;  2PUO B;  4V2S A;  1S72 T;  4C8Q C;  2ARU A;  4HWO A;  2Q5I A;  4BE0 A;  2RHI A;  1VQL T;  4XTV A;  1VQ5 A;  4TTV A;  2RB6 A;  4N0A C;  2R58 A;  4C8Q F;  2J3L A;  3G4S T;  4MZT A;  3PTA A;  3QZ9 B;  2ZT5 A;  5KE3 A;  4M78 D;  4IUT A;  5GMK h;  4ZIB A;  4HT9 A;  4N4H A;  3LGF A;  1V29 B;  3JRZ A;  3SD4 A;  4A4E A;  5GAN 8;  2JZ2 A;  1YJW A;  4RG2 A;  5CAI A;  4M7D D;  4JLI A;  4P5N A;  1M8V A;  1USY C;  1X55 A;  3OS0 A;  4JRI A;  4C5E A;  3HHT B;  2HNI A;  3G71 T;  1FX7 A;  2BIV A;  1X2G A;  3JCM W;  2C06 A;  4E7L A;  3CCM A;  3V8K A;  1QVF A;  2M9U A;  2XI9 A;  3OYH A;  3ER0 A;  3JCM X;  1FWZ A;  2E65 A;  5CQY A;  5GAO q;  3H6Z A;  3HFZ A;  3J7A F;  4EO4 A;  3QO7 A;  1VQZ A;  2I4O A;  1K73 U;  4F7U E;  3SDZ A;  1VQK T;  2QHS A;  2KSS A;  4RMF A;  1VQM A;  4UC4 A;  2CGH A;  3C4S A;  2DJZ A;  3X28 B;  1Y96 A;  4ELY C;  4HWR A;  4YPF A;  2JVV A;  2ARS A;  4BE1 A;  1KQ2 A;  3QJY A;  4UP7 A;  3CXC A;  3M57 A;  3ICA A;  4E47 A;  1QVF S;  3DKM A;  3OSS C;  4K86 A;  4M75 A;  3QG1 A;  1JBM A;  1YJ9 A;  4P74 A;  4PHC A;  2LC4 A;  2R5A A;  3CBO A;  3C95 A;  5FU6 B;  3CD6 T;  1YIJ A;  4HCB A;  3JAM E;  1I4K 1;  3C94 A;  4EMK C;  4XU1 A;  2OTL T;  4ZGE B;  2D0Q B;  3TEH A;  5DLQ E;  4M7A C;  2P0P A;  2DIQ A;  1E24 A;  5LJ3 h;  2QA4 T;  3HXV A;  1N8R C;  4M75 G;  1E1T A;  1K9M C;  4OVA A;  4LVK A;  1H4T A;  4M78 A;  2MWO A;  4EPC A;  2RD1 A;  5HGQ A;  4M7A F;  2ZZE A;  3CXC S;  4C8Q E;  1NYR A;  3CME T;  2CJA A;  3OYM A;  1WPY A;  1H4S A;  4HCZ A;  3MF1 A;  5GAO r;  3OYL A;  2V8I A;  4ME7 A;  4NL2 A;  5LJ5 h;  2AKW B;  2EJ9 A;  3HRU A;  2CIM A;  4TVW A;  5C52 B;  5CKD A;  2EKO A;  2DDZ A;  2ZT7 A;  4C5G A;  3ERR A;  1ASY A;  4NOY A;  4M78 G;  3LGL A;  3GNG A;  1PYS A;  1X2H A;  1SES A;  4YRP A;  1YFR A;  2RHZ A;  2QEX A;  3GOX A;  4QVZ A;  3CPF A;  3UH0 A;  1UGP B;  4M7D G;  2CJB A;  3MET A;  3CMA A;  3UFG A;  2RI5 A;  1PSF A;  3OYC A;  2QI2 A;  2G4C A;  2Q7E A;  5GAN 7;  4UPA A;  3NEN A;  1N6A A;  3JB9 J;  2K4Y A;  5CK9 A;  2ZR3 A;  2KMT A;  2VXF A;  1YHQ A;  2EWN A;  1B8A A;  4IUV A;  2QXF A;  2PQW A;  2EQM A;  4LVL A;  3RF1 A;  1NPP A;  4H2U A;  3CCJ T;  1BBU A;  3N5B B;  3QO5 A;  2E70 A;  4E7J A;  3A74 A;  2P0Q A;  2DTH A;  3EAE A;  1WYD A;  2RHU A;  3DSQ A;  1HXD A;  2CZ6 B;  2VXE A;  5GMK m;  3M4Y A;  3FRN A;  3HSB A;  3Q1J A;  2DTO A;  5GAN 6;  1NJ5 A;  4YRN A;  3HL8 A;  2MWP A;  1EFW A;  4C0D C;  3W3S A;  2ZIN A;  3FLG A;  2ZCE A;  1NJI C;  3MP6 A;  5FRO A;  3REU A;  1Y71 A;  2MMP A;  3CC7 T;  1KD1 C;  2O01 E;  3V8L A;  1D3B A;  3EFS A;  4JRQ A;  1M4Z A;  3UT1 A;  2YLC A;  3A7U A;  2EQK A;  1IRE B;  3VUB A;  2LRQ A;  4Q5W A;  1E1O A;  2DEQ A;  2MAM A;  2A8E A;  3OS5 A;  4C92 C;  2ZGW A;  1QVG A;  4A4H A;  3CCV A;  5KNN A;  4M7A E;  4LDX A;  1VUB A;  3NEM A;  1VQP A;  1VQ7 T;  3HY1 A;  3M53 A;  4C92 F;  2ZPH B;  1YGB A;  3V8J A;  5GAM e;  2ZT6 A;  3PMT A;  3JCM P;  4RDX A;  4IUQ A;  1HC7 A;  2DU7 A;  1N8R U;  2ART A;  1K9M U;  3LSQ A;  1MHN A;  2DPP B;  2QQR A;  2KDS A;  4TQD A;  1RIQ A;  2DK3 A;  4TVY A;  2AKW A;  2NLU A;  3GLX A;  1WQW A;  3OS1 A;  5CKE A;  3P8Y A;  3M56 A;  3OYG A;  1QVG S;  4Y91 A;  5DY9 A;  5K1X A;  5GAN h;  4OGC A;  3NEL A;  4OF1 A;  5GAM j;  4K88 A;  3M4G A;  1O75 A;  4NCX A;  4ATO A;  3LW5 E;  4F7U G;  2RA2 A;  1JJ2 A;  3JB9 I;  3NTH A;  5IN1 A;  3FDR A;  4BI4 A;  3L2R A;  3QII A;  4J83 A;  5LJ5 g;  2DKG A;  3FC3 A;  2ZIO A;  3VQW A;  2R57 A;  1YIT T;  2V8J A;  3VQV A;  3CCU A;  1UB4 A;  3OYE A;  1UGS B;  3PIP A;  4HWP A;  4M77 A;  1RI0 A;  5GMK l;  3HKS A;  4J6Y A;  1VQ8 T;  4XTU A;  2M16 A;  3HPW A;  3IKM B;  3LWH A;  1NJ6 A;  4D6W A;  4ZTJ A;  3IAL A;  5LJ3 d;  3A8H B;  3TEG A;  4HKE A;  2QHU A;  1U8R A;  1JJ2 S;  4HWS A;  2WSC E;  3SB2 A;  1N9S A;  5D6X A;  3ZEH A;  1YFS A;  3BJU A;  2YHT A;  1NNH A;  3MHX A;  4XTY A;  4LDU A;  3OYN A;  3CEY A;  1KOG A;  4UP8 A;  2E10 A;  3CCL A;  4BE2 A;  2ZTG A;  3RAC A;  4JLG A;  1NJI U;  5LJ5 d;  2GFU A;  2DD5 A;  2JTF A;  2WAC A;  5LJ3 f;  5HY6 A;  1NJ8 A;  2M0O A;  1KD1 U;  1ATI A;  4E7H A;  3VBB A;  4UP9 A;  2HQX A;  3G6E T;  1N9R A;  4A4F A;  3G7Z A;  4C92 E;  4HT8 A;  2DVE A;  3WXM B;  2RJE A;  3UWN A;  1VQ9 A;  3RMS A;  4E7K A;  3GF5 A;  4P72 A;  2ZNI A;  4OB1 B;  2RO0 A;  5LJ5 f;  3CCR A;  4KUD K;  3RGL A;  1VQO A;  3CPW A;  4YRJ A;  2K3Y A;  4OLF A;  2CZ7 B;  2ZPI B;  5IT9 E;  4RG8 A;  4IUP A;  3HXU A;  3UGT A;  4KT0 E;  2RM4 A;  3VQY A;  4C5I A;  3QZ5 B;  1VQ6 A;  1M1G A;  4M77 C;  2LTO A;  4M7D B;  2F5K A;  2JNG A;  3MO8 A;  5CCA A;  4PJO B;  1E22 A;  2HD0 A;  3M54 A;  4M77 F;  3S3O A;  1H4V B;  3JCM g;  1QE0 A;  2ALY B;  1QF6 A;  3CCE T;  1KQS A;  3JSC A;  2WSF E;  3SWN C;  5ELN A;  1EQR A;  1G3W A;  1WGS A;  3HP9 A;  5CR2 A;  3CPW S;  2I4N A;  4IUU A;  4GLK A;  5GAN 5;  2Q5H A;  4NS5 A;  2ZT8 A;  4X34 A;  2B8A A;  2ODR D;  4H2X B;  1VQ4 T;  4PJO D;  3VYG A;  2M1H A;  5D6Y A;  5I2M A;  3JCM c;  1Z7N A;  4L87 A;  2YRV A;  3L2Z A;  1WNL A;  4BAC A;  3X20 B;  1M1K C;  3E9H A;  2ZZF A;  2I2L A;  5CQX A;  2CS7 A;  4A4K A;  1KQS S;  1OYX A;  3JCM b;  4JRK A;  5L8R E;  3A7A A;  5DM7 R;  4P71 C;  4P3N A;  5GAN g;  4BB7 A;  2LCL A;  2K57 A;  3OA6 A;  1QVP A;  3MP8 A;  3A31 A;  2DO3 A;  1J5W A;  4FM4 B;  4FL6 A;  4CH6 A;  3LLR A;  3OQ5 A;  3P8B B;  1OI1 A;  3P8V A;  2VC8 A;  2VGM A;  1UEB A;  3I56 T;  2HBP A;  1VQN T;  5K1P A;  1Q81 C;  2LCC A;  2V8K A;  2MI6 A;  1YJN A;  3V7R A;  2EQJ A;  2LQ8 A;  2KQW A;  2IVW A;  1G5V A;  3S3M A;  3HRK A;  3LX7 A;  4PLI A;  4LD6 A;  3KFU A;  1EIY B;  3CC2 T;  3OD1 A;  4YRO A;  3CC4 T;  4LDV A;  4YRG A;  4QQD A;  1TH7 A;  4BY6 B;  1M9S A;  4P3P A;  4RQE A;  3FB9 A;  2X4Y A;  3L2U A;  4KUI A;  2A3L A;  4PLL A;  3HY0 A;  1S72 A;  4ZTZ B;  1VQL A;  2D9T A;  3P8H A;  3A32 A;  4M77 E;  4MDW A;  3A5Y A;  2XG8 D;  1M90 C;  3JB9 D;  2R5M A;  5FU7 B;  3G4S A;  5IAY A;  1SER A;  2DXB A;  4M7D A;  3ME9 A;  2EL9 A;  4F7U B;  2IY5 B;  1W66 A;  3CCQ T;  4PJO A;  3S3N A;  4JS5 A;  1VIE A;  4H2T A;  2NS6 A;  4RKU E;  1W4S A;  5KCH A;  5GAO n;  2ALY A;  3TU4 K;  3X25 B;  3I55 T;  4C0Z A;  2K5F A;  3PCO B;  5J3B A;  4LVM A;  3QTC A;  4ZGJ B;  3A5Z B;  5LJ3 e;  1Z7M A;  4H2Y A;  2LX9 A;  4YYE A;  1W2B A;  3OY9 A;  3G71 A;  3DLL A;  4J8O A;  3P8D A;  4XTX A;  1XNI A;  1LNX A;  4PJO G;  1RL2 A;  4H2W A;  5CVI A;  5GMK i;  1Y07 A;  4H2X A;  1OZ3 A;  2P0L A;  1EVL A;  4M75 C;  3KXT A;  1ADY A;  4XQ3 A;  1P92 A;  4P74 C;  4QVD A;  5J26 A;  4DOV A;  3M58 A;  1VQK A;  3CBP A;  4NL3 A;  3OB9 A;  4HCC A;  3M55 A;  4M75 F;  1GXI E;  2OAU A;  2O4X B;  3ASK A;  4EX5 A;  4DPG A;  4KBM B;  2QHV A;  3RER A;  4MZP A;  1M1K U;  2Q7H A;  1QW1 A;  2KAF A;  3HFV A;  2QTX A;  1L0W A;  2L89 A;  4TVA B;  1W2B S;  4KR3 A;  3CCS T;  4M78 C;  4C92 G;  2CZ0 B;  4C8Q B;  2PVD B;  1H3Z A;  3IG2 A;  2JN0 A;  3MP1 A;  3P8T A;  2F5T X;  3BW1 A;  4M78 F;  4HWT A;  2PVO B;  2DXT A;  1NJ2 A;  5CO7 A;  2OTJ T;  4OP0 A;  2E3C A;  1Q81 U;  1N9W A;  3CD6 A;  3MEA A;  4M7D F;  2EJG A;  3GP8 A;  3NTI A;  2DIG A;  2OTL A;  1KHI A;  1YI2 T;  5GAM h;  1ASZ A;  3QJ6 A;  3A8O B;  1C0A A;  2QA4 A;  4HT4 A;  1KG1 A;  4C8Q D;  3NET A;  1XTD A;  2E64 A;  4YRQ A;  3WQZ A;  3JCM h;  4J15 A;  3E9F A;  3TCJ A;  2X35 A;  1BIB A;  3CME A;  2LNV A;  4YRR A;  2VV5 A;  4OB0 B;  1JB0 E;  2AMC B;  4ZTF A;  4YCU A;  5CKF A;  3JB9 G;  1U1T A;  4R56 A;  2RHS B;  1PSE A;  2DXU A;  4XTZ A;  4ELZ C;  3HXX A;  3FIF A;  2RJD A;  2DTI A;  3MEU A;  2ZPF B;  5CKB A;  3PMI A;  1WJR A;  3A8M B;  4TQF A;  1M90 U;  5GAO m;  4F7U A;  3OS2 A;  2IY5 A;  5HK3 A;  4HVC A;  3DB4 A;  3TRE A;  2ZXF A;  4Z02 A;  2KVQ G;  2Y90 A;  4YCV A;  3PCO A;  3E9G A;  1YFT A;  3OYD A;  3GNF B;  3HRT A;  1M1F A;  4KUL A;  3A5Z A;  5HK0 A;  4CS3 A;  11AS A;  2XIC A;  4DQ2 A;  4N4I A;  2X4X A;  2CKK A;  3M4P A;  2LVM A;  4B9X A;  1N27 A;  3CCJ A;  1K8A C;  2E41 A;  3GPL A;  4M75 E;  2I4M A;  3PFS A;  1VQ5 T;  4G85 A;  4K87 A;  5A2Q E;  4MMK A;  2GQV A;  1BYM A;  4J6X A;  1AHJ B;  4EMK B;  5FU6 C;  4M7A B;  4O2D A;  3R07 A;  5KCO A;  3F70 A;  2XU8 A;  4RCC A;  2XKO C;  2O4X A;  2I4L A;  1YJW T;  4PKC C;  2P5I A;  1QP2 A;  1NE8 A;  2RHY A;  4DA4 A;  1R8O B;  2RI3 A;  4P73 A;  2ZPB B;  4M78 E;  5D6W A;  1UGQ B;  4A53 A;  2DD4 A;  3R6O A;  3CC7 A;  1YBY A;  3L42 A;  3OW2 A;  3PT9 A;  4N4G A;  2PMF A;  4QVC A;  5A0G A;  4G84 A;  2VYT A;  4C8Q A;  2RI2 A;  3A8G B;  2XD0 A;  3OMG A;  4H2V A;  5GAO p;  2IG0 A;  4N0A A;  3CCM T;  4LVJ A;  1SRY A;  4M7A D;  3HXZ A;  2EIF A;  1NJ1 A;  2ZZG A;  3M9Q A;  3JCM Q;  1OZ2 A;  2GCX A;  4LVI A;  5C0M A;  2C7I A;  3H8Z A;  3T9N A;  4C8Q G;  2DAQ A;  1VQ7 A;  4L5G A;  4YRT A;  2HAX A;  4BD3 A;  1VQM T;  1WQ7 A;  4JDS A;  3QNE A;  4IKF A;  5FRN A;  2JUF A;  1YCY A;  3QXE B;  2E1H A;  3OW2 S;  2Y4X A;  2EQU A;  3QUI A;  2QQB A;  4OMF B;  5LL6 S;  2X4J A;  2E12 A;  2E6Z A;  2XGT A;  3RIR A;  2AMC A;  3G1Z A;  4ZTU B;  1LJO A;  4YRM A;  5J39 A;  4VUB A;  2RHS A;  1LYL A;  5GAO l;  1YJ9 T;  2PU9 B;  1JJC B;  5GAM g;  2KK4 A;  1KMM A;  1QP3 A;  1XOV A;  4TWA A;  1SET A;  1NPR A;  4P73 C;  1YIJ T;  4X5O A;  4C0D B;  3OYY A;  4QQG A;  4YRL A;  3TUP A;  2KY9 A;  2PVG B;  2ZPE B;  3E1S A;  4WJ3 M;  4BI8 B;  4WJ4 A;  4J6W A;  4CS4 A;  5C51 B;  3MEW A;  1PYS B;  1YIT A;  4B9W A;  3DLM A;  4ZN3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...