1WQWA

Crystal structure of biotin protein ligase from pyrococcus horikoshii ot3 in complex with biotinyl-5-amp
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
235
structure length
235
Chain Sequence
MLGLKTSIIGRRVIYFQEITSTNEFAKTSYLEEGTVIVADKQTMGHGRLNRKWESPEGGLWLSIVLSPKVPQKDLPKIVFLGAVGVVETLKEFSIDGRIKWPNDVLVNYKKIAGVLVEGKGDKIVLGIGLNVNNKVPNGATSMKLELGSEVPLLSVFRSLITNLDRLYLNFLKNPMDILNLVRDNMILGVRVKILGDGSFEGIAEDIDDFGRLIIRLDSGEVKKVIYGDVSLRFL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structures of Biotin Protein Ligase from Pyrococcus horikoshii OT3 and its Complexes: Structural Basis of Biotin Activation
pubmed doi rcsb
source organism Pyrococcus horikoshii
molecule tags Ligase
molecule keywords biotin--[acetyl-CoA-carboxylase] ligase
total genus 66
structure length 235
sequence length 235
chains with identical sequence B
ec nomenclature ec 6.3.4.15: Biotin--[biotin carboxyl-carrier protein] ligase.
pdb deposition date 2004-10-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02237 BPL_C Biotin protein ligase C terminal domain
A PF03099 BPL_LplA_LipB Biotin/lipoate A/B protein ligase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 1wqwA02
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 1wqwA01
4RCBA 4M77B 1YB3A 3WQZA 4J15A 3HY0A 3BW1A 4C8QE 4PJOF 3JB9F 3HFOA 3A74A 4P3NA 2E41A 5LJ3d 2ARSA 1H4VB 3P8YA 1BBWA 5GANh 2DZCA 4M7AA 3M4GA 3L4GA 3RGLA 2E5AA 4H2XB 3TEHA 3JB9D 3UH0A 5F5WA 4YCWA 4M75A 3LSSA 1KQ1A 4P73A 4RDXA 1YGBA 4YRSA 3BDUA 4N0AC 4PNOA 4CH3A 1NNHA 1YFRA 1GGMA 1QE0A 4DQ2A 5GANf 4YRFA 2Q7EA 1WPYA 4XEMA 4CS3A 4TVAB 5CAIA 1G51A 1X55A 5GAOq 4CH5A 4N0AA 4PJOB 3V7SA 4OP0A 4M77F 2C8MA 3L4GB 3P8TA 2EAYA 1NJ1A 1Z7NA 5GAN2 4TVYA 4JRKA 4TQFA 1E1OA 1B7YB 2ALYA 1WLEA 3NELA 1G5HA 3V7CA 4KR2A 2DTHA 4BWAA 3HXWA 4XTXA 4K87A 4CS4A 2DJZA 4C92G 2DTOA 5GAOn 1WQ7A 1USYC 4M75G 4TVAA 3QSUA 4UP7A 4K86A 1YFSA 1B76A 4Y91A 4P75C 3RKYA 3JB9J 4M7AG 3RESA 3JCMJ 3MF2A 4KQEA 2RHSA 3QO7A 4M77E 4G85A 1B70A 2Q5HA 4ZTZB 4JRIA 4P75A 2DXUA 5GMKm 1EFWA 3PZCA 4OLFA 2YHTA 5GANd 2G4CA 4P3PA 4PG3A 3BFMA 4C8QG 3QTCA 2C7IA 5C51B 4HWSA 4C92B 4H2YA 4Q6GA 4XU0A 4YRNA 5GAMj 3SB2A 1N9RA 5GAMf 3HXXA 1H4QA 4L87A 1HC7A 1FYFA 4M78A 5LJ3g 1L0WA 1WQWA 1LYLA 3GIBA 3FB9A 1B34A 3V8JA 3A7RA 4QVDA 2FYKA 2DQ0A 2ZINA 3FIFA 3JCMh 4H2TA 1B34B 3VU3C 4PHCA 4P3OA 3HXUA 4BW9A 2ZZEA 2RHQB 3PCOA 1SERA 1ATIA 4C92A 2E3CA 4A54A 2DZ9A 2RHSB 3IKLA 4YYEA 4TTVA 4K88A 5C53B 4M7DC 5GAOr 4P74A 4NL3A 5GAN4 4XTYA 3MF1A 5GMKh 2CJ9A 4H2SA 3FJPA 3RF1A 4ZIBA 3JB9G 3NENA 5DY9A 4XU2A 1BBUA 5GANj 4XTUA 2CJBA 5GMKi 3JB9H 4F7UB 1H4TA 1YFTA 1EIYB 3JCMX 2RB6A 4TVWA 4HVCA 1WU7A 2QHTA 1E24A 2ODRD 4M75D 4EO4A 4NCXA 1X2GA 2J3MA 5LJ5j 3SWNA 4C92D 4M7DF 2EJGA 4C8QC 2ZT5A 3QO3A 3VQWA 3RL6A 1PYSB 3AHUA 3HY1A 3EFSA 1X01A 2RHQA 3PCOB 4QVCA 1NJ8A 1JJCB 1I4K1 4YRGA 1RIQA 3RACA 2I4OA 4UPAA 4XTWA 1HK9A 3QNEA 4HT9A 1EOVA 3JCMV 1KOGA 3JCMe 4PJOA 5LJ5f 4HWPA 3G1ZA 2DXTA 1KMNA 1Y96B 4P71A 4E51A 1JRIA 2CIMA 2EL9A 3R07A 4HWOA 4P72A 4EMKC 4M7DD 3A31A 4M75E 4C92C 2I2LA 4M75F 4CH4A 4P71C 4YRRA 1U1SA 1H4SA 4PJOE 3HRKA 1MGQA 2QHVA 4M7AE 1Y96A 4M75B 4MMKA 4PJOG 2DKGA 5I21A 1SRYA 1C0AA 4EMKB 1PYSA 4F7UG 4X9DA 2ZIMA 3SWNB 2AKWA 5K1PA 3V8KA 2XGTA 2ZNIA 2RD1A 4EMGA 2Y90A 1EVLA 1X54A 2K57A 5GAMe 4M78G 3PGGA 4YRMA 4M7AC 4CS2A 2I4MA 1EQRA 1EIYA 2YLCA 5C52B 3JCMg 4M7DE 4YPFA 3HXZA 1NJ6A 1E1TA 3A5ZA 3UFGA 4P73C 2QTXA 4PJOD 1ADJA 4ZTUB 4F7UE 1B7YA 2ALYB 4P72C 4H2VA 3RKWA 3REUA 5LJ5d 3HRIA 3OD1A 1N9WA 3HFZB 4RMFA 4HWTA 1I8FA 4NOYA 2Q7HA 4YRKA 3M4QA 2I4NA 2VXFA 4HT8A 5LJ3j 5E3IA 4C92E 5GAMg 4YCVA 1X56A 4HWRA 4CH6A 5GAN7 2P0LA 5GAOm 2ZCEA 3RUXA 3UGQA 3JCMc 1VQZA 1NJ2A 2CGHA 4WJ3M 4EX5A 2ZZFA 2XTIA 1SETA 3JCMP 4M7AF 1WNLA 2QHSA 3A7UA 4XTZA 4M78E 2RM4A 4YRJA 1E22A 3MEYA 5GAOp 4M7AB 3QO5A 3RERA 5GAN6 2DDZA 4WJ4A 2AKWB 5ELNA 5ELOA 1U1TA 2ODRC 3HXYA 4EMKA 2ZGWA 3RKXA 4H2XA 3TEHB 4XQ3A 2EJ9A 3VQVA 2JN0A 2ZT7A 2DVEA 3CMQA 2ZXFA 3IKMB 1LOJA 3IALA 5GMKe 4V2SA 3IG2A 2ZNJA 1G5IA 4M7AD 4M77A 2I4LA 1QF6A 3EFRA 3JCMQ 4YDQA 3JCMf 4C92F 3L2ZA 2P5IA 2AMCA 3HTZA 5LJ3f 4M7DB 1B70B 1ASZA 4WF2A 5LJ3h 12ASA 2ARTA 4M77D 4YCUA 4UP9A 3V7RA 3ERRA 2E10A 3NETA 1NYQA 1TH7A 4YROA 2ZTGA 3TEGA 1JJCA 4YRTA 2Q5IA 4XU1A 4LNSA 2ZR3A 5GAN5 2FB7A 1YCYA 2VC8A 1I5LA 4UP8A 4YREA 2PMEA 4J6YA 4A53A 3A7AA 2J3LA 1D3BB 1WYDA 4YRIA 2DEQA 3UGTA 2ZT6A 4C8QF 4DPGA 11ASA 4XTVA 2AMCB 4RQEA 5LJ5g 3TUPA 4X9CA 3V8LA 4XU3A 3INZA 2ZR2A 4YRCA 3NEMA 3VQYA 4C8QD 1NYRA 4G84A 2EWNA 4M77G 3L1AA 5GANe 2YLBA 4M78B 2E65A 3BY7A 3A5YA 5LJ3e 4RQFA 3JB9I 2ZT8A 3RIRA 1SESA 2ARUA 5HGQA 4NL2A 1ASYA 4PJOC 5GANg 1EVKA 1HXDA 4KR3A 3JCMd 4H2WA 3ICAA 4YRPA 1KMMA 1X2HA 2IY5A 4TWAA 2DTIA 4M75C 3HFNA 4C8QB 5LJ5e 4TQDA 2IY5B 1HTTA 1W66A 3VQXA 1H641 4M78D 3VBBA 4JLIA 3A32A 3E9HA 4C8QA 2ZIOA 1IL2A 3E9IA 1I81A 3LC0A 5GAN3 1Z7MA 3BJUA 4YP0A 3QUIA 3JCMb 2RA2A 5GAMh 5GAOl 2DQ3A 3JCMW 4X5OA 3SWNC 2HNIA 4JUVA 2ZZGA 1JBMA 2E64A 4M78C 3I7FA 4MMLA 3KFUA 3HXVA 4P74C 1J5WA 2QHUA 1D3BA 2EJFA 3HFZA 4M77C 5GAN8 4YRQA 2Q7GA 5GAMd 4M7DG 1BIAA 5GMKl 5KNNA 1LJOA 4J5YA 3W3SA 4F7UF 1M5Q1 3M4PA 3REXA 2E1HA 4XEOA 3HFVA 3DSQA 4O2DA 2CJAA 4Q15A 1N9SA 4J6XA 5GMKj 4F7UA 3P8VA 4J6WA 1NJ5A 2DU5A 4M78F 3LSQA 1B8AA 4RCCA 3QO8A 4WI1A 4M7DA 2PMFA 4YRLA 4H02A 5K1XA 1ADYA 4EMHA 1USYA 2DU7A 3QHSA 5LJ5h 1LNXA 3HSBA 1M8VA 1KQ2A 1BIBA 2VXEA 4H2UA 4HA8A 4AH6A
chains in the Genus database with same CATH superfamily
2JW4A 3WQZA 3VS6A 4J15A 2LQ8A 3HY0A 2JZ2A 3JB9F 5LJ3d 4LUEA 2XG8D 2KR3A 3OYGA 5KCHA 1BBWA 1N27A 5GANh 1F1BB 1Z9QA 3CMAA 2E5AA 3TEHA 1WHKA 1OPLA 3CMAQ 5D7UA 1QVGS 4DOVA 1VQPT 3R6OA 1JJ2A 4KRTA 1EZZB 4RDXA 1BI1A 1FMVA 4CH3A 1GBRA 2DX1A 1WHLA 3EFOA 3CC4T 1X55A 1IREB 1W2BS 4TVAB 1HSQA 5KE2A 5GAOq 3MPUB 2EYYA 3P8BB 2ZPEB 1OQKA 4FCYA 1Q81C 2C8MA 3P8TA 3I9QA 2EAYA 1Z7NA 1K8AC 5CKFA 2RK2A 3NTIA 2YXYA 2LJ1A 2ZZDA 2H8HA 4TQFA 1M90R 1WXBA 1B7YB 1NEBA 3LWHA 3FC3A 1OPKA 3NELA 1Q82U 2YUNA 4KR2A 3NTKA 1VQPQ 2L3QA 1QQJA 4BWAA 2F1LA 1HYOA 3TSWA 4XTXA 4FM4B 5IXBA 2RHIA 1QCOA 2DTOA 1WIEA 2JTEA 1WQ7A 1ABQA 1SF9A 1VQLT 3CMEQ 2A8EA 1NJIU 1UGVA 1BI0A 4E47A 2XMFA 4P75C 3ME9A 3JB9J 1NZ9A 4HXJA 3WVEB 2HSEB 5KYXB 1PKTA 2BZ8A 1QVPA 3CBMA 1B70A 4ZTZB 2V26A 3S3NA 3EGUA 4JRIA 4P75A 2DXUA 4C0GA 5GMKm 2EKHA 4QW2A 2OTLQ 5AT1B 2YHTA 2G4CA 2ZPGB 3BFMA 4DBRA 3QTCA 2C7IA 4QQDA 1T0JA 2PTKA 1EFNA 2I0NA 3X24B 3CMET 3MO8A 1VQKT 4UC4A 3HXXA 1N9RA 5GAMf 3I5SA 3A1PA 4CC4B 3N5BB 4BUGA 2VKNA 3OSVA 1VQ6A 1PCXA 4M78A 2J6KA 3UA7A 3GIBA 1V29B 1MMNA 1PNJA 2ZINA 2JS2A 2KRNA 3FIFA 2ZPHB 3VU3C 4PHCA 1ZX6A 5DM7R 3EG2A 1X2KA 1ATIA 3QZ9B 1E7OA 1ZQ1A 2QQBA 4JZ3A 2RHSB 1HD3A 4AT1B 4B9XA 5KCOA 1PSFA 5C53B 4NL3A 2ZCFB 3X26B 5GAN4 4OB3B 3VS4A 5GMKh 2CJ9A 3FJPA 2E70A 2WSEE 2EGAA 1BBUA 1TS9A 3LYIA 4E7IA 2X4JA 1YIJA 2M02A 3M57A 1VA7A 1ZA1B 1Z9ZA 1RL2A 1RLPC 3GP8A 4TVWA 1M3BA 4KGXB 1VQ7T 2F2VA 3A8LB 4HVCA 1UJYA 1M90U 2ODRD 3VV0A 4EO4A 3NGPA 1X2GA 2J3MA 5LJ5j 4M7DF 1UB4A 2GBQA 5AYFA 2EJGA 1TUGB 3VQWA 1PYSB 3NTHA 1GFDA 1OX8A 2E12A 1M8MA 2KAFA 4J9GA 1EX4A 2NYSA 1KD1R 3DB4A 3A8OB 1YHQQ 2EPDA 1JJCB 4YRGA 2V1QA 2KE9A 3E1SA 2EBPA 4UPAA 1IHWA 4DEXA 3QDFA 4XTWA 1WXTA 4PFPA 1G8XA 3OYEA 2JM8A 4OMQA 1XQHA 2ESWA 3G4SA 1VQ7Q 1UG1A 2F2XA 1SRMA 2ZPBB 4FT2A 3CCUQ 1SG5A 1AWJA 3J80E 3L2UA 3OYDA 1U5SA 2DERA 4YRRA 5FU7C 2JMAA 3OSSC 4M7AE 2LDMA 4M75B 1BCOA 3EGXB 3KBGA 2DBMA 1PYSA 4F7UG 2OJ2A 3G71A 1UUEA 1R0BG 2XGTA 4FYXB 3GNGA 1MUZA 4EPCA 2RD1A 3CCST 2XDPA 3CCQT 2FEIA 3I56Q 1MV3A 2A0FB 1WLPB 1EVLA 2K57A 2P4RA 4HCBA 5KYXA 3EG9B 3QZ5B 1H3HA 2BUDA 1AWWA 2YLCA 1NJIR 3JCMg 3EH2A 1D1CA 3H6ZA 2LRQA 1K73U 1AWXA 2B86A 3A5ZA 4Y92A 1SHGA 4P73C 1ADJA 4LDWA 2K9GA 3RKWA 4CRIA 5FWCA 3HRIA 2M0OA 3MKDA 4HWTA 5IHNA 1JQQA 4A4HA 1MHNA 2Q7HA 4YRKA 2E5QA 3NMZC 3OYJA 2KROA 2A37A 2M1HA 5GAMg 1IRXA 1K0XA 3QYHB 1Y0MA 3RUXA 2EQJA 2E3HA 3JCMc 4Z8AA 1SSHA 1NJ2A 4WJ3M 3G1JA 1C1AA 1SETA 3QPHA 2ABLA 2FPFA 2QHSA 3A7UA 5I22A 3CCEQ 1TTHB 2COWA 1CSKA 3QO5A 2DO3A 2YRDA 5GAN6 2NUTA 1NM7A 4IKFA 2X4YA 3OMGA 3O5ZA 2ODRC 1RAGB 3HXYA 4OMOA 2FRYA 2SRCA 2PVOB 2R57A 2ZGWA 3TEHB 4OF1A 2GCXA 4JRQA 3HRSA 1KHIA 3PFSA 2OX7A 4JS5A 2DVEA 5HK0A 3IKMB 3CCJT 2ROTA 2CS7A 4V2SA 3IG2A 3OA6A 1G5VA 1G5IA 2ZNJA 1FXXA 3EFRA 3JCMQ 1OI1A 4YDQA 3JCMf 2ZPIB 4C92F 2HSPA 1TSFA 4M7DB 3CCET 3E9GA 1BBZA 4A4FA 12ASA 1Y71A 4PLLA 4YCUA 3ERRA 4Y28E 3NETA 2FL7A 3TEGA 3M0TA 2DIGA 1KJWA 4LNSA 2O4XB 2FB7A 2JS0A 2VC8A 1NLPC 1I5LA 4GLMA 4A53A 3OB9A 2J3LA 4WCIA 2CP3A 4RTXA 1VQ9A 4E7ZA 2WACA 1M1FA 1VQ5Q 2AMCB 2YRVA 3I55A 4PKCC 4XU3A 4ANJA 2F5KA 5A2QE 4C8QD 2LNVA 5GANe 2LX9A 2YLBA 4M78B 3TQ7P 4E7LA 3RIRA 2JUFA 4PJOC 4FU6A 1EVKA 3KXTA 4BDYA 3JCMd 3EHRA 1X2HA 1SSFA 3JV3A 1AT1B 4FYVB 1ZSZC 3HFNA 4C8QB 4TQDA 2IY5B 1HTTA 2LQNA 4J9EA 2RQWA 3CD6Q 4N4IA 1W66A 4M78D 2GF7A 1QWEA 3QBYA 3OS2A 1YJNQ 1G3SA 2KMTA 2A36A 1IL2A 4C0FA 2CZ7B 1BYMA 3QUIA 3JCMb 2CH4W 1NYFA 1YJ9Q 2JOYA 3OYMA 2HCKA 1HJDA 2HNIA 4JUVA 1JBMA 2E64A 5ECAA 2R5MA 5KYUB 4N4GA 3I7FA 3I35A 4MMLA 3M4YA 4JJNK 4L6V5 3OS1A 4LDVA 4M77C 5GAN8 2E3IA 4M7DG 4FW1A 1BIAA 3C94A 3GLXA 2M51A 2XK0A 1ZLMA 2LCCA 5CKEA 4DBFA 2XD0A 4A4GA 1TU0B 3DSQA 3VS5A 2K7AA 1VYVA 4HVVA 5IHIA 3VJPA 1I5OB 4JDSA 2D0QB 3P8VA 2DMOA 4J6WA 4F17A 8AT1B 3LSQA 5FU6B 4E6RA 1Q86R 2AHJB 3CCQA 1AEYA 2L2PA 2F69A 4IUUA 2PMFA 2YUPA 1LPLA 3SFMA 5K1XA 1ADYA 1Q7YC 1USYA 3CBPA 1R77A 3HSBA 3RMSA 3QJ6A 2Y4YA 4QQGA 3OQ5A 4PJNA 5CIUA 2C0TA 5DLQE 3QWYA 4RCBA 4R0KA 4PJOF 4PLIA 3HFOA 2FPDA 3A74A 3URGA 1VQOA 2FZKB 1H4VB 2DZCA 1C6VX 2R5AA 3G4ST 1K9MU 3L4GA 3RGLA 1UDLA 3Q1JA 4BB7A 2YWWA 3LSSA 3EG3A 4IURA 1Q81U 3WXMB 2DXCA 3QJYA 2X4XA 4PNOA 4BY6B 1UGPB 2QA4A 1GGMA 1QE0A 4YRFA 3F70A 4CS3A 4XEMA 5FLXE 4BACA 1M90C 2XKOC 3V7SA 4OP0A 4M77F 3L4GB 2X3XD 4IIMA 1NJ1A 3QDRB 2GTOA 2PVGB 2OTJQ 3G4SQ 1VQ7A 4TVYA 4LXCA 2KXDA 2K2VA 3FJ5A 2QQ9A 1E1OA 3JAME 4L59A 4F16A 1WLEA 1G5HA 3V7CA 1U06A 3C12A 2DTHA 2KRSA 4K87A 4CS4A 2LP5A 3HPWA 3VYGA 3CD6T 1E6HA 4C5GA 4AFUC 3SEMA 2FO0A 2O4XA 2CSQA 2K3YA 4K86A 1YFSA 4CC3A 2MK5A 2ROLA 4JZ4A 1YI2T 1WDXA 3RESA 2JVVA 3MF2A 3PMIA 3C4SA 2O01E 2RHSA 3QO7A 4M77E 1VQOT 1OV3A 1YWOA 2D8JA 2Q5HA 2G3RA 1W6XA 1PD1A 1QVGA 2PUOB 3MCAB 3PZCA 4R55A 5J39A 1SRLA 4P3PA 2DNUA 3VKIA 2EKOA 4C8QG 3MEWA 1YJWA 3M0RA 4HWSA 4C92B 1RAAB 4JJBA 2K2MA 4XU0A 4HVWA 2HBWA 5GAMj 3SB2A 1H4QA 1XTDA 4L87A 5KYUA 1HC7A 1OOTA 1QP2A 1L0WA 1X43A 1PHTA 3REBB 1U8RA 3A7RA 2DL3A 1AD5A 2FYKA 1M4ZA 2O9SA 3JCMh 4EDUA 1B34B 4HCCA 4X34A 3CQTA 4BW9A 2QDLA 2RHQB 3PCOA 1SERA 4C92A 4A4KA 4BI4A 3OYFA 4OMFB 1X6OA 1M9SA 1WJRA 5A0DA 4K88A 4M7DC 4AFQC 4P74A 1WXUA 3CCVA 3CCRQ 4ZIBA 2EYZA 1ZUKA 4CC2A 3JB9G 3EHQA 4MDXA 5L8RE 4AFSC 5IHKA 5GMKi 3DB3A 4KULA 2AT1B 3SDZA 1N5ZA 3ZFJA 3MP8A 2L3RA 2GQVA 1N6AA 1V76A 4ZTFA 2E5KA 2FVUA 1YJ9A 1WU7A 2JM9A 3G7ZA 4NCXA 1JU5C 3HKSA 4J9CA 2CZ0B 4HCZA 2C0OA 3QO3A 1D09B 3CBOA 2CP0A 3RBBB 3HY1A 2F2WA 3EFSA 1TUDA 4J9BA 2P0KA 1VQNA 4QVCA 1NJ8A 1QCNA 2I4OA 3QNEA 3OW2A 4HT9A 1EOVA 1KOGA 4PJOA 2BE9B 4TVRA 3GBQA 3L2WA 3CCSQ 3VS0A 3M56A 1YP5A 5LJ5f 2HZYA 3G1ZA 2HBPA 1Y96B 4E51A 1KQSP 3M55A 3H0IA 2CIMA 2DL5A 3R07A 4NS5A 5IN1A 2K3XA 4EMKC 1GRIA 2I2LA 4QKUA 1MNDA 3M53A 1H4SA 1U1SA 1YWPA 4PJOE 1MGQA 2H3JA 2QHVA 1R0CB 1WYXA 1AZGB 4JS4A 2C0IA 3SWNB 4LDYA 1WJQA 3T9NA 4EMGA 1N8RU 3CPFA 1T3SA 2QI2A 3PGGA 1I0CA 2I4MA 1QCFA 2SEMA 1IXDA 1EQRA 3OYCA 1A0NB 4FW2A 5KYWA 4OMMA 1TOVA 4AG1C 1VQMT 2KEAA 4YPFA 1NJ6A 1QVFA 3UFGA 2WSFE 4JLGA 2V1RA 2JMCA 1PD0A 5LJ5d 3REUA 3TVTA 3OD1A 4E2FB 5HKCA 3CCMQ 4NOYA 3G6EA 3M4QA 2D8HA 4F04B 2VXFA 3G6ET 3ZEHA 2EQMA 5LJ3j 3S6WA 4C92E 4XK8E 4YCVA 5GAN7 4WTOB 5GAOm 3UGQA 4FIBA 2DK3A 3RMQA 2CGHA 2IIMA 5HY6A 2DRMA 1H8KA 2ZZFA 1GL5A 3VS1A 2IVWA 1WNLA 1VQLQ 4XTZA 1K4US 1PG5B 3MEYA 5CKBA 3QIIA 3I5RA 5HK3A 3RERA 5I11A 3CCQQ 5ELOA 1U1TA 1W70A 1GXIE 1VQ8T 4O5VA 1WHGA 3A8GB 4XQ3A 2EJ9A 3EGDA 4PJMA 3VQVA 2JN0A 3HP9A 4D8KA 2KQWA 3A8MB 3LGFA 4D6WA 4M77A 2I4LA 2HL3A 2VWFA 3OS0A 1WGSA 2O9VA 1W2BA 3MJXA 2RJFA 2M16A 2P5IA 3AT1B 5LJ3f 1B70B 2P0PA 4WF2A 4GLKA 1FMKA 1ZSZB 5LJ3h 2P84A 4UP9A 5IH2A 4BDZA 1X69A 2DBKA 1NYQA 4YROA 2QASA 2RJEA 1PSEA 3G71T 4J9HA 3PIOA 2YDLA 5FWBA 4YRTA 1DJ7B 2EQKA 1IZ6A 3X25B 4C0DB 1UJ0A 3OYKA 2BZXA 3TEEA 1D3BB 4YRIA 2BIVA 4ZGJB 4LUDA 1VQKQ 2LCLA 2D1XA 4HCKA 2RQTA 2DEQA 2GGRA 4C8QF 11ASA 1VQNT 2VGMA 3MP1A 4RTWA 1U3OA 2MAMA 1BI3A 2CYZB 3TUPA 1QP3A 4X9CA 3X28B 2FPEA 3INZA 4YRCA 3QYGB 2COZA 3NEMA 2A7YA 2LC4A 1CKBA 1M2VA 2A08A 3EG9A 1YJ9T 1QW1A 2E65A 1SESA 2ARUA 5HGQA 1ASYA 4GY5A 4A63B 2ED1A 2DJQA 3GNFB 4YRPA 4K11A 3GOXA 2IY5A 2QEXA 1VQ4A 2DTIA 4J9DA 5LJ5e 1V1CA 2HKNA 4ME7A 3C0CA 2X51A 2QDYB 1JO8A 1H641 4JLIA 2O88A 1M2VB 1I81A 2AZVA 3LC0A 3R6NA 3VYHB 1FX7A 5GAN3 1N8RR 1ZA2B 4LVKA 1GCQC 2RA2A 2GTJA 3FRNA 3OY9A 4OB1B 3JCMW 1YIJT 4B6MA 5KYYB 5IAYA 3PNWC 5FW9A 1RACB 2JJ9A 3KFUA 3HXVA 2RO0A 4P74C 1J5WA 1I07A 4FSXA 3WVDB 2QA4Q 2DF6A 2RI2A 4AG2C 4YRQA 3GF5A 5GAMd 3PT9A 1Y7XA 5GMKl 3CPWP 1OZ3A 1YHQT 4J5YA 3W3SA 1SPKA 1RABB 1RAEB 3REXA 2E1HA 3HFVA 2RNAA 4IUPA 2ATCB 1XOVA 1Q7YU 3CCUA 2CJAA 1N9SA 3MEUA 2DFUA 6AT1B 2X3WD 1WFWA 4M78F 2P0QA 3KFVA 4DOWA 2HEQA 2PU9B 4RCCA 5EG2A 1YNZA 3TSZA 4WI1A 1RAIB 3KUFA 3HHTB 4H02A 1RI0A 2PQWA 1YHQA 1VQKA 1YI2A 2DVJA 2FZGB 3QHSA 4FL6A 1M8VA 1KQ2A 1OULA 1OX9A 2VXEA 4HA8A 3CD6A 2XU8A 1YB3A 1K8AR 4OB0B 1ZHIA 3BW1A 4C0DC 3DLMA 5FRMA 2BE7D 2E41A 1WJSA 4PL6A 2ARSA 3EAEA 2K5LA 3P8YA 4M7AA 3M4GA 3EGXA 3JB9D 2RQRA 4P73A 3RNJA 1VQ4T 1YFRA 1LCKA 3LH0A 2DEUA 4ZNXA 1G3WA 2Q7EA 1KG1A 1G51A 3RDVA 1W1FA 4CH5A 4KGZB 1BCMA 2RF0A 1NPRA 1UE9A 4LVLA 1KC8U 1NYGA 4JRKA 3IQLA 1VQOQ 4QQ6A 2K4YA 2CREA 1B7TA 2J06A 4JRPA 5CVIA 5LL6S 4KH1B 3FLGA 3CC4A 3FDRA 4KUDK 2X9HA 2DJZA 1K8AU 2DM1A 1KD1U 1USYC 4M75G 1ARKA 1K73R 4Q5WA 4ZTJA 2HQHA 4C5EA 2RQUA 4Y91A 2CSIA 4MZMA 1NBEB 2JXBA 4KQEA 2GNCA 1I1JA 5KYWB 3ASKA 1O9SA 2KSSA 1PRLC 2VV5A 2JT4A 3LH5A 2K5FA 4OGEA 3CC7Q 4OLFA 1SKUB 4LD9K 2O2OA 4OMLA 1M1GA 3CXCP 2YT6A 4CI0C 2M0YA 5GJWB 2BKDN 1LVKA 4H2YA 4YRNA 3LWIA 4IUQA 4E7SA 3CCRT 3TREA 1FYFA 4C5HA 1WZOA 1YITQ 2D9TA 3FB9A 1B34A 1AHJB 3V8JA 4E7JA 2DPPB 2RHZA 4QVDA 2DQ0A 4FSSA 3E19A 4N4HA 9ATCB 4A54A 4ORZA 2HQEA 2DZ9A 3IKLA 3SHWA 4TTVA 1XNIA 5IT9E 4DA4A 4RMOA 2EGCA 4XTYA 3H9NA 3MF1A 4A4EA 3RF1A 1NE8A 2RH2A 2DYIA 3OMCA 5DY9A 1VUBA 4XU2A 1VQ9Q 1M3AA 2QEXQ 2HDAA 3JB9H 3UT1A 5D6YA 8ATCB 1WI7A 4HVUA 4E7HA 1EIYB 3JCMX 3I56T 2EW3A 1QKWA 3MP6A 3X20B 1ZUYA 4C0ZA 2QHTA 3U23A 3SWNA 4RG8A 3THKA 4J7IA 2L8DA 1ZSZA 1ZSGA 1KC8C 3L2VA 4C8QC 1M1KU 1VQMA 3QXEB 2KBTA 4C5IA 1YJNT 3AHUA 2D0NA 5D6WA 2E6NA 2XDBA 1X01A 2P4TA 4GBQA 3UA6A 1VQ9T 2KGTA 1IGUA 3ZBDA 4YTLA 4HKEA 1HK9A 1QWFA 3JCMV 2E6ZA 2NWMA 4HWPA 1VYUA 2DXTA 2BTTA 4P71A 1JRIA 4RG2A 2VGNA 2EL9A 1KSWA 2Z0WA 4M7DD 2HQXA 2Y4XA 3CCEA 1Q86C 4RTTA 4CH4A 3M5AA 1N8RC 4J83A 2FRWA 4ATOA 2OAWA 2V8IA 1Y96A 4J9FA 3EGDB 2RPNA 3CC2A 3CCJA 1X75C 3OYBA 2AKWA 1CKAA 3V8KA 5M9OA 3E2UA 3ZL7C 2QQAA 2ZNIA 1Q82R 3HRTA 2Y90A 4M4ZA 1B07A 2LCSA 5FRNA 1ZBXA 4M78G 4L5GA 2LJ3A 4CS2A 2QQRA 1MMDA 1EIYA 1QKXA 1NEGA 1QLYA 4MZTA 5KH6A 4M7DE 5CCAA 2ZPFB 5C0MA 4LD6A 1T0HA 4ZTUB 4F7UE 2ALYB 4P72C 4J9IA 5FU7B 4H2VA 3S3OA 4CC7A 3LW5E 3HFZB 4RMFA 3GPLA 5CK9A 4FT4A 2KY9A 2H3EB 2MWOA 1D0YA 4KGVB 1QMCA 2I4NA 2OTJT 4HT8A 5E3IA 5CQYA 2DE0X 1X56A 1TWBA 4CH6A 1M27C 1VQ5A 3CCVT 3CCMA 2P0LA 2ZCEA 1VQZA 2RMOA 1D0XA 3S3MA 1UGRB 4EX5A 2J7IA 2OAUA 4IUVA 5L23A 1M1KR 3JCMP 4M7AF 5CO7A 4M78E 4YRJA 2CP6A 1E22A 4M7AB 2BZYA 1WA7A 1VOMA 2DDZA 1SHFA 5CR2A 2EQUA 5ELNA 2AK5A 4EMKA 3RKXA 1W4SA 2DRKA 4ESRA 1KHCA 1YITA 2PZ1A 2LTOA 1UHCA 2CP7A 3CMQA 1WHHA 4Z88A 2DL4A 2X35A 1JEGA 1LOJA 3IALA 2J05A 3MEVA 4XAXB 4M7AD 1YJWT 3H0HA 1H3ZA 1QF6A 5J26A 2NS6A 3L2ZA 2COYA 4BE1A 2AMCA 3HTZA 2X4WA 1ASZA 3L2RA 2ARTA 2RHXA 2DD5A 2E4HA 1Q86U 3V7RA 2E10A 2ZTGA 2OTLT 1PC0A 3G6EQ 1T3LA 1YCYA 2MYSA 1R8OB 2G6FX 1AOJA 2K6DA 3A7AA 4QT7A 1WYDA 4O6JA 4PFZA 3M0QA 2NUPA 5GJVB 4B9WA 1GCQA 4BE0A 4IUTA 4JPBW 1PRMC 4RKUE 5LJ5g 3ER0A 3EG1A 2KDSA 1XJWB 1K9MR 1QVGP 3VQYA 1NYRA 3P8DA 4M77G 2VVKA 3L1AA 3CPWS 1C0MA 1FYNA 1SEMA 1PKSA 4J7FA 1YIJQ 3BY7A 5LJ3e 3VS7A 4RQFA 3UDCA 3JB9I 4AMCA 5GANg 4PJJA 1HXDA 3J7AF 4H2WA 3ICAA 1OU8A 3VS3A 1NG2A 2MIOA 2KK4A 3BE3A 2QA4T 4TWAA 1K1ZA 4BY6C 3VQXA 3UPUA 2CUDA 3VBBA 3E9HA 2ZIOA 3CC7A 3E9IA 2EVRA 2RI5A 4YP0A 3CCMT 2LMJA 1RADB 5GAMh 2DETA 5GAOl 2DQ3A 3BDLA 2OTJA 4OMPA 4RTZA 3SWNC 2YSQA 3VRYA 3HL8A 2ECZA 2QAZA 4M78C 2PVDB 2L3SA 3PMTA 2EJFA 5FROA 3HFZA 3CC2Q 2Q7GA 1VQ6T 3D7SB 2MPXC 5KNNA 2DD4A 1LJOA 3META 2C06A 2HMAA 3MQZA 3ULRB 3VUZA 2DIQA 2B8AA 4O2DA 4Q15A 1KK7A 4JJDA 1NJ5A 4ELZC 4IIOA 2K3BA 1B8AA 4AFZC 2EQIA 3QO8A 1UGSB 4YRLA 2GFAA 1Y57A 3A8HB 1JXMA 3H8ZA 3CC2T 4EMHA 2MI6A 1IB8A 2DILA 1LNXA 1VQ4Q 4Z02A 1VQLA 4M77B 2W10A 2NUTB 4C8QE 1RAFB 1Y07A 4OGCA 4P3NA 2FHDA 2LJ0A 2DXBA 4H2XB 3UH0A 2LQWA 1WHJA 5F5WA 4YCWA 4M75A 1VQMQ 1KQ1A 1OZ2A 2KNBB 2KT1A 1MMAA 1YGBA 4YRSA 4ZN1A 2VYTA 1JB0E 3BDUA 2DAQA 1G2BA 3P8HA 4N0AC 1YBYA 2DLPA 2PNIA 1NNHA 3CCLT 4DQ2A 1K9MC 5GANf 1JXOA 1M2OA 1ZUUA 1WPYA 5CAIA 3MHXA 2J6FA 1Q95G 4RUGA 4N0AA 4PJOB 5I2SA 5GAN2 1VQPA 1OEBA 1BKBA 1KD1C 1VIEA 1GFCA 2ALYA 4BD3A 3I56A 7AT1B 3CMAT 3OYAA 4ZGDB 1VQ8Q 4HT4A 3CEYA 3M0UA 3I55T 2PUKB 3HXWA 1G3YA 3CCLA 3H0FA 1D1AA 2RHYA 3QG1A 4BI8B 4C92G 2CH4A 2HL5C 3HRUA 5GAOn 3CCLQ 4LDXA 2XDDA 3JSCA 2CZ6B 3EFOB 3QSUA 4TVAA 2GFUA 2HD0A 3FEOA 3CC4Q 4UP7A 2MCNA 1B76A 3CXCA 2KYMA 4KBMB 3RKYA 1AWOA 4M7AG 3PVLA 2EFIA 3JCMJ 4G85A 2YUOA 2FZCB 2L3PA 1YCSB 1EFWA 4RTVA 3G71Q 3I55Q 5GANd 1X6GA 4PG3A 4DBHA 1VQ6Q 1P92A 3OBWA 5C51B 2L89A 4Q6GA 5A0LA 3UF4A 3QKJA 3H41A 1M3CA 3OYNA 3C95A 5LJ3g 4OVAA 1WQWA 1LYLA 2KXCA 2MF2A 1M30A 4H2TA 2NLUA 4P3OA 3HXUA 2QGGA 4BE2A 4LNPA 1KFZA 5KE3A 1GBQA 2ZZEA 2AKKA 2E3CA 4KH0B 2CZ1B 1H92A 4YYEA 2XIDA 3M9QA 2A3LA 2AKLA 2O31A 3OYHA 5GAOr 4ELYC 1YFNA 2QTVA 1D0ZA 4LVIA 4H2SA 1TXQA 2LQKA 4JJCA 1MV0B 3M59A 3NENA 1PM3A 5GANj 4XTUA 1IO6A 2CJBA 3MEAA 4F7UB 2RJDA 5HCKA 1M1KC 1H4TA 1YFTA 2J6OA 2CT3A 1X6BA 1MNEA 1RI9A 2K79A 3TCJA 2RB6A 5CKHA 3JRZA 3CC7T 2DA9A 1E24A 4M75D 4C92D 4PK4A 2LZ6B 5DLOA 2L0AA 1UGQB 3OYYA 4F14A 2ZT5A 2NUPB 4QVZA 3M0SA 3RL6A 4E7KA 1FMWA 2RHQA 3PCOB 2RJCA 1I4K1 2RQVA 1RIQA 3RACA 1X27A 3NPFA 3O8VA 3CCSA 1BK2A 3JCMe 1X2QA 4PFOA 1BB9A 2KVQG 1KMNA 4P5NA 2D6FA 1EIFA 2KT8A 2CKKA 1J3TA 5J3BA 2A28A 3OYLA 4HWOA 4P72A 3A31A 4M75E 4C92C 2CT4A 4M75F 1BU1A 4P71C 2ED0A 4RTUA 1NLOC 3CPWA 3HRKA 2QYZA 3EG0A 3CXCS 4MMKA 4PJOG 2DKGA 2DL8A 4FYYB 5I21A 2KI7A 3UWNA 1SRYA 2QK0A 1C0AA 3DKMA 4EMKB 2JTMA 2DL7A 2OTLA 2CUBA 2NUZA 4X9DA 2ZIMA 5K1PA 2LNHB 2FG0A 3NFCA 5CKDA 4LN2A 3SD4A 1QVFS 1X54A 2RN8A 4ZGEB 2K5IA 5GAMe 2JTFA 4YRMA 1WHMA 4M7AC 3CCUT 2IPOB 5C52B 1VIFA 3M54A 4MDWA 3HXZA 2EYQA 3E9FA 3LLRA 4R56A 3OBYA 4LDUA 1E1TA 2QTXA 4OB2B 4PJOD 1S72T 1O75A 2RHUA 1B7YA 1YITT 2LT4A 1G83A 1B3QA 2EGEA 2VASA 2LT1A 3OW2S 1N9WA 2ZAEA 1UTIA 3J81E 1I8FA 4LVJA 2QQSA 2F5TX 3M58A 3EH1A 1Q7YR 1UHFA 2YRCA 1RLQC 5EC7A 4HWRA 2QG9B 2IG0A 1RUWA 1TUCA 5D6XA 1S72A 1VQNQ 4II1A 2XTIA 1S72Q 1K9AA 1VQ5T 3NHNA 1TG0A 1IGQA 2DYBA 1K76A 2QEXT 1K0SA 2RM4A 2QXFA 2HAXA 3OYIA 5GAOp 2VB6A 2RI3A 4WJ4A 2AKWB 4ZN3A 2CP2A 2HKQB 2MWPA 4H2XA 4LE9A 4FYWB 2W0ZA 2LVMA 2ZT7A 2ZXFA 5GMKe 3CMEA 1W2BP 4LVMA 2JNGA 5I2MA 3UATA 2V8JA 4BI3A 5CQXA 1ACMB 3OS5A 4M77D 1IHVA 3TU4K 1TH7A 3L2QA 1AVZC 3PVQA 1JJCA 2Q5IA 4XU1A 1KC8R 2ZR3A 5GAN5 4UP8A 4YREA 2L5QA 2PMEA 1G3TA 4J6YA 3CCVQ 3VS2A 3CCJQ 1UECA 3REAB 4RTYA 1OYXA 3UGTA 2ZT6A 4DPGA 2XHCA 3RR6A 2OI3A 4OMNA 4XTVA 4RQEA 5KYYA 4DBQA 1NPPA 3V8LA 2LX7A 3PE0A 2ZR2A 1K73C 4G84A 3DLLA 2EWNA 1Q81R 1KQSS 1E6GA 2CDTA 2WSCE 2RK1A 3A5YA 1MMGA 1VQ8A 2ZT8A 1D1BA 1FWZA 4NL2A 3PTAA 2EYWA 1OU9A 2ENMA 4KR3A 1RAHB 2KRMA 3HTRA 1YJNA 1KMMA 1UEBA 2M9UA 2V8KA 4M75C 1YJWQ 4MZPA 1QVFP 2YUQA 2MMPA 1YN8A 3A32A 4C8QA 1Q82C 1GCPA 1KIKA 1Z7MA 1YI2Q 3BJUA 1ABOA 3LX7A 3A98A 3LGLA 5KYNA 4X5OA 2AZSA 3L42A 1UFFA 1NJIC 1WX6A 5IXFA 2ZZGA 1BI2A 1ZBJA 2KYBA 2MOXA 2XICA 4Z89A 2QHUA 1D3BA 1JJ2S 2EIFA 2CP5A 1VYTA 5A0GA 2EYXA 4VUBA 3VUBA 1AZEA 4F7UF 2QGFB 1M5Q1 3M4PA 1JJ2P 4XEOA 4DEYA 5C6SA 2XI9A 4KT0E 1KQSA 4X1VA 4J6XA 4KUIA 5GMKj 4F7UA 3QWXX 3PIPA 5FU6C 3M0PA 2DU5A 3OW2P 4M7DA 4EIKA 3A5ZB 3CCRA 3VRZA 2GQIA 4PJLA 2R58A 1S1NA 2AIRB 1PWTA 2DU7A 2VUBA 5LJ5h 4J8OA 1BIBA 4H2UA 4AH6A 4D8DA
chains in the Genus database with same CATH topology
3WQZA 4J15A 2LQ8A 3HY0A 2JZ2A 3JB9F 5LJ3d 2XG8D 3OYGA 5KCHA 1BBWA 1N27A 5GANh 3CMAA 2E5AA 3TEHA 1QVGS 4DOVA 1VQPT 3R6OA 1JJ2A 4RDXA 1BI1A 4CH3A 4TVAB 3CC4T 1X55A 1IREB 1W2BS 5KE2A 5GAOq 3P8BB 2ZPEB 1Q81C 2C8MA 3P8TA 2EAYA 1Z7NA 1K8AC 5CKFA 2RK2A 3NTIA 2ZZDA 4TQFA 1B7YB 3LWHA 3FC3A 3NELA 1Q82U 4KR2A 3NTKA 4BWAA 4XTXA 4FM4B 2RHIA 2DTOA 1WQ7A 1VQLT 2A8EA 1NJIU 1BI0A 4E47A 4P75C 3ME9A 3JB9J 1NZ9A 3WVEB 1QVPA 3CBMA 1B70A 4ZTZB 3S3NA 4JRIA 4P75A 2DXUA 4C0GA 5GMKm 4QW2A 2YHTA 2G4CA 2ZPGB 3BFMA 3QTCA 2C7IA 4QQDA 3X24B 3CMET 3MO8A 1VQKT 4UC4A 3HXXA 1N9RA 5GAMf 3N5BB 4BUGA 3OSVA 1VQ6A 4M78A 3GIBA 1V29B 2ZINA 3FIFA 2ZPHB 3VU3C 4PHCA 5DM7R 1ATIA 3QZ9B 1ZQ1A 2QQBA 2RHSB 4B9XA 5KCOA 1PSFA 5C53B 4NL3A 2ZCFB 3X26B 5GAN4 4OB3B 5GMKh 2CJ9A 3FJPA 2E70A 2WSEE 1BBUA 3LYIA 4E7IA 2X4JA 1YIJA 3M57A 1RL2A 3GP8A 4TVWA 1VQ7T 4HVCA 3A8LB 2ODRD 1M90U 3VV0A 4EO4A 1X2GA 2J3MA 5LJ5j 4M7DF 1UB4A 5AYFA 2EJGA 3VQWA 1PYSB 3NTHA 2E12A 2KAFA 3DB4A 3A8OB 1JJCB 4YRGA 3E1SA 4UPAA 4XTWA 3OYEA 1XQHA 3G4SA 2ZPBB 4FT2A 3J80E 3L2UA 3OYDA 4YRRA 5FU7C 3OSSC 4M7AE 2LDMA 4M75B 3KBGA 1PYSA 4F7UG 3G71A 2XGTA 3GNGA 4EPCA 2RD1A 3CCST 2XDPA 3CCQT 1EVLA 2K57A 4HCBA 3QZ5B 2BUDA 2YLCA 3JCMg 1K73U 3H6ZA 2LRQA 3A5ZA 4P73C 1ADJA 4LDWA 3RKWA 4CRIA 3HRIA 2M0OA 4HWTA 4A4HA 1MHNA 2Q7HA 4YRKA 2E5QA 3OYJA 2M1HA 5GAMg 3QYHB 3RUXA 2EQJA 3JCMc 1NJ2A 4WJ3M 1SETA 3QPHA 2QHSA 3A7UA 3QO5A 2DO3A 5GAN6 4IKFA 2X4YA 3OMGA 2ODRC 3HXYA 2ZGWA 3TEHB 2PVOB 2R57A 4OF1A 2GCXA 4JRQA 3HRSA 1KHIA 3PFSA 4JS5A 2DVEA 5HK0A 3IKMB 3CCJT 2CS7A 4V2SA 3IG2A 3OA6A 1G5IA 1G5VA 2ZNJA 1FXXA 3EFRA 3JCMQ 1OI1A 4YDQA 3JCMf 2ZPIB 4C92F 4M7DB 3CCET 3E9GA 4A4FA 12ASA 1Y71A 4YCUA 4PLLA 3ERRA 4Y28E 3NETA 2FL7A 3TEGA 2DIGA 4LNSA 2O4XB 2FB7A 2VC8A 1I5LA 4A53A 3OB9A 2J3LA 1VQ9A 2WACA 1M1FA 2AMCB 2YRVA 3I55A 4PKCC 4XU3A 2F5KA 5A2QE 4C8QD 2LNVA 5GANe 2LX9A 2YLBA 4M78B 4E7LA 3RIRA 2JUFA 4PJOC 4FU6A 1EVKA 3KXTA 4BDYA 3JCMd 1X2HA 1SSFA 3HFNA 4C8QB 4TQDA 2IY5B 1HTTA 1W66A 4N4IA 4M78D 2GF7A 3QBYA 3OS2A 1G3SA 2KMTA 1IL2A 4C0FA 2CZ7B 1BYMA 3QUIA 3JCMb 2JOYA 3OYMA 2HNIA 4JUVA 1JBMA 2E64A 2R5MA 3I7FA 4N4GA 4MMLA 3M4YA 4JJNK 4L6V5 3OS1A 4LDVA 4M77C 5GAN8 4M7DG 1BIAA 3C94A 3GLXA 2XK0A 2LCCA 5CKEA 2XD0A 4A4GA 3DSQA 3VJPA 4JDSA 2D0QB 3P8VA 4J6WA 3LSQA 5FU6B 2AHJB 3CCQA 2F69A 4IUUA 2PMFA 3SFMA 5K1XA 1ADYA 1Q7YC 1USYA 3CBPA 3HSBA 3RMSA 3QJ6A 2Y4YA 4QQGA 3OQ5A 5CIUA 5DLQE 4RCBA 4PJOF 4PLIA 3HFOA 3A74A 3URGA 1VQOA 1H4VB 2DZCA 2R5AA 3G4ST 1K9MU 3L4GA 3RGLA 3Q1JA 4BB7A 3LSSA 4IURA 1Q81U 3WXMB 2DXCA 3QJYA 2X4XA 4PNOA 4BY6B 1UGPB 2QA4A 1GGMA 1QE0A 4YRFA 3F70A 4CS3A 4XEMA 5FLXE 4BACA 1M90C 2XKOC 3V7SA 4OP0A 4M77F 3L4GB 1NJ1A 3QDRB 2PVGB 1VQ7A 4TVYA 2K2VA 1E1OA 2QQ9A 3JAME 4L59A 1WLEA 1G5HA 3V7CA 3C12A 2DTHA 4K87A 4CS4A 3HPWA 3VYGA 3CD6T 4C5GA 2O4XA 2K3YA 4K86A 1YFSA 1YI2T 3RESA 2JVVA 3MF2A 3PMIA 3C4SA 2O01E 2RHSA 3QO7A 4M77E 1VQOT 2Q5HA 2G3RA 1QVGA 2PUOB 3MCAB 3PZCA 4R55A 5J39A 4P3PA 3VKIA 2EKOA 4C8QG 3MEWA 1YJWA 4HWSA 4C92B 4XU0A 5GAMj 3SB2A 1H4QA 1XTDA 4L87A 1HC7A 1QP2A 1L0WA 1U8RA 3A7RA 2FYKA 1M4ZA 3JCMh 4EDUA 1B34B 4HCCA 4X34A 4BW9A 2RHQB 3PCOA 1SERA 4C92A 4A4KA 4BI4A 3OYFA 4OMFB 1X6OA 1M9SA 1WJRA 5A0DA 4K88A 4M7DC 4P74A 3CCVA 4ZIBA 3JB9G 4MDXA 5L8RE 5GMKi 3DB3A 4KULA 3SDZA 3ZFJA 3MP8A 2L3RA 2GQVA 1N6AA 4ZTFA 1YJ9A 2FVUA 1WU7A 3G7ZA 4NCXA 3HKSA 2CZ0B 4HCZA 3QO3A 3CBOA 3HY1A 3EFSA 1VQNA 2P0KA 4QVCA 1NJ8A 2I4OA 3QNEA 3OW2A 4HT9A 1EOVA 1KOGA 4PJOA 4TVRA 3L2WA 3M56A 5LJ5f 3G1ZA 2HBPA 1Y96B 4E51A 3M55A 2CIMA 3R07A 4NS5A 5IN1A 2K3XA 4EMKC 2I2LA 3M53A 1H4SA 1U1SA 4PJOE 1MGQA 2H3JA 2QHVA 4JS4A 3SWNB 4LDYA 1WJQA 3T9NA 4EMGA 1N8RU 3CPFA 2QI2A 3PGGA 2I4MA 1EQRA 3OYCA 1VQMT 4YPFA 1NJ6A 1QVFA 3UFGA 2WSFE 4JLGA 3REUA 5LJ5d 3OD1A 5HKCA 4NOYA 3G6EA 3M4QA 2VXFA 3G6ET 3ZEHA 2EQMA 5LJ3j 3S6WA 4C92E 4XK8E 4YCVA 5GAN7 5GAOm 3UGQA 4FIBA 2DK3A 3RMQA 2CGHA 5HY6A 2ZZFA 2IVWA 1WNLA 4XTZA 3MEYA 5CKBA 3QIIA 5HK3A 3RERA 5ELOA 1U1TA 1GXIE 1VQ8T 4O5VA 3A8GB 4XQ3A 2EJ9A 3VQVA 2JN0A 3HP9A 2KQWA 3A8MB 3LGFA 4D6WA 4M77A 2I4LA 3OS0A 1WGSA 1W2BA 2RJFA 2M16A 2P5IA 5LJ3f 1B70B 2P0PA 4WF2A 4GLKA 5LJ3h 4UP9A 4BDZA 1NYQA 4YROA 2RJEA 1PSEA 3G71T 3PIOA 4YRTA 1DJ7B 2EQKA 1IZ6A 3X25B 4C0DB 3OYKA 3TEEA 1D3BB 4YRIA 2BIVA 4ZGJB 2LCLA 2DEQA 4C8QF 11ASA 1VQNT 2VGMA 3MP1A 2MAMA 1BI3A 2CYZB 3TUPA 1QP3A 4X9CA 3X28B 3INZA 4YRCA 3QYGB 3NEMA 2A7YA 2LC4A 1YJ9T 1QW1A 2E65A 1SESA 2ARUA 5HGQA 1ASYA 4GY5A 3GNFB 4YRPA 3GOXA 2IY5A 2QEXA 1VQ4A 2DTIA 5LJ5e 4ME7A 2QDYB 1H641 4JLIA 1I81A 3LC0A 3VYHB 1FX7A 5GAN3 4LVKA 2RA2A 3FRNA 3OY9A 4OB1B 3JCMW 1YIJT 5IAYA 3PNWC 3KFUA 3HXVA 2RO0A 4P74C 1J5WA 4FSXA 3WVDB 2RI2A 4YRQA 3GF5A 5GAMd 3PT9A 1Y7XA 5GMKl 1OZ3A 1YHQT 4J5YA 3W3SA 3REXA 2E1HA 3HFVA 4IUPA 1XOVA 2CJAA 1Q7YU 3CCUA 1N9SA 3MEUA 4M78F 2P0QA 4DOWA 4RCCA 2PU9B 5EG2A 4WI1A 3KUFA 3HHTB 4H02A 1RI0A 2PQWA 1YHQA 1VQKA 1YI2A 3QHSA 4FL6A 1M8VA 1KQ2A 2VXEA 4HA8A 3CD6A 2XU8A 1YB3A 4OB0B 1ZHIA 3BW1A 4C0DC 3DLMA 5FRMA 2E41A 1WJSA 4PL6A 2ARSA 3EAEA 2K5LA 3P8YA 4M7AA 3M4GA 3JB9D 4P73A 1VQ4T 1YFRA 3LH0A 1G3WA 2Q7EA 1KG1A 1G51A 4CH5A 1NPRA 4LVLA 1KC8U 4JRKA 4QQ6A 2K4YA 4JRPA 5CVIA 5LL6S 3FLGA 3CC4A 3FDRA 4KUDK 1K8AU 2DJZA 1USYC 1KD1U 4M75G 4Q5WA 4ZTJA 4C5EA 4Y91A 4MZMA 4KQEA 3ASKA 1O9SA 2KSSA 2VV5A 2K5FA 4OGEA 4OLFA 4LD9K 1M1GA 4CI0C 2BKDN 4H2YA 4YRNA 3LWIA 4IUQA 3CCRT 3TREA 1FYFA 4C5HA 2D9TA 3FB9A 1B34A 1AHJB 3V8JA 4E7JA 2RHZA 2DPPB 4QVDA 2DQ0A 3E19A 4N4HA 4A54A 2HQEA 2DZ9A 3IKLA 4TTVA 1XNIA 5IT9E 4DA4A 4RMOA 4XTYA 3MF1A 4A4EA 3RF1A 1NE8A 2RH2A 3OMCA 5DY9A 1VUBA 4XU2A 3JB9H 3UT1A 5D6YA 4E7HA 1EIYB 3JCMX 3I56T 3MP6A 3X20B 4C0ZA 2QHTA 3SWNA 4RG8A 4J7IA 2L8DA 1KC8C 3L2VA 4C8QC 1M1KU 1VQMA 3QXEB 4C5IA 1YJNT 3AHUA 5D6WA 2E6NA 2XDBA 1X01A 2P4TA 1VQ9T 3ZBDA 4YTLA 4HKEA 1HK9A 3JCMV 2E6ZA 4HWPA 2DXTA 4P71A 1JRIA 4RG2A 2VGNA 2EL9A 4M7DD 2HQXA 2Y4XA 3CCEA 1Q86C 4CH4A 3M5AA 1N8RC 4J83A 4ATOA 2V8IA 1Y96A 3CC2A 3CCJA 1X75C 3OYBA 2AKWA 3V8KA 5M9OA 2QQAA 2ZNIA 3HRTA 2Y90A 5FRNA 1ZBXA 4M78G 4L5GA 4CS2A 2QQRA 1EIYA 4MZTA 5KH6A 4M7DE 5CCAA 2ZPFB 5C0MA 4LD6A 4ZTUB 4F7UE 2ALYB 4P72C 5FU7B 4H2VA 3S3OA 3LW5E 3HFZB 4RMFA 3GPLA 5CK9A 4FT4A 2KY9A 2MWOA 2I4NA 2OTJT 4HT8A 5E3IA 5CQYA 1X56A 4CH6A 1VQ5A 3CCVT 3CCMA 2P0LA 2ZCEA 1VQZA 3S3MA 1UGRB 4EX5A 2OAUA 4IUVA 3JCMP 4M7AF 5CO7A 4M78E 4YRJA 1E22A 4M7AB 2DDZA 5CR2A 2EQUA 5ELNA 4EMKA 3RKXA 1W4SA 1KHCA 1YITA 2LTOA 3CMQA 2X35A 1LOJA 3IALA 3MEVA 4XAXB 4M7AD 1YJWT 1QF6A 1H3ZA 5J26A 2NS6A 3L2ZA 4BE1A 2AMCA 3HTZA 2X4WA 1ASZA 3L2RA 2ARTA 2RHXA 2DD5A 1Q86U 3V7RA 2E10A 2ZTGA 2OTLT 1YCYA 1R8OB 3A7AA 1WYDA 4O6JA 4B9WA 4BE0A 4IUTA 4RKUE 5LJ5g 3ER0A 2KDSA 3VQYA 1NYRA 3P8DA 4M77G 3CPWS 3L1AA 4J7FA 3BY7A 5LJ3e 4RQFA 3UDCA 3JB9I 5GANg 1HXDA 3J7AF 4H2WA 3ICAA 2KK4A 4TWAA 2QA4T 4BY6C 3VQXA 3UPUA 3VBBA 3E9HA 2ZIOA 3CC7A 3E9IA 2RI5A 4YP0A 3CCMT 5GAMh 5GAOl 2DQ3A 3BDLA 2OTJA 3SWNC 3HL8A 4M78C 2PVDB 3PMTA 2EJFA 3HFZA 5FROA 2Q7GA 1VQ6T 5KNNA 2DD4A 1LJOA 3META 2C06A 3MQZA 3VUZA 2DIQA 2B8AA 4O2DA 4Q15A 1NJ5A 4ELZC 1B8AA 3QO8A 1UGSB 4YRLA 2GFAA 3A8HB 3H8ZA 3CC2T 4EMHA 2MI6A 1LNXA 4Z02A 1VQLA 4M77B 4C8QE 1Y07A 4OGCA 4P3NA 2FHDA 2DXBA 4H2XB 3UH0A 5F5WA 4YCWA 4M75A 1KQ1A 1OZ2A 1YGBA 4YRSA 4ZN1A 2VYTA 1JB0E 3BDUA 2DAQA 3P8HA 4N0AC 1YBYA 1NNHA 3CCLT 4DQ2A 1K9MC 5GANf 1WPYA 5CAIA 3MHXA 4N0AA 4PJOB 5I2SA 5GAN2 1VQPA 1BKBA 1KD1C 1VIEA 2ALYA 4BD3A 3I56A 3CMAT 3OYAA 4ZGDB 4HT4A 3CEYA 3I55T 2PUKB 3HXWA 1G3YA 3CCLA 2RHYA 3QG1A 4BI8B 4C92G 3HRUA 5GAOn 4LDXA 2XDDA 3JSCA 2CZ6B 3QSUA 4TVAA 2GFUA 2HD0A 3FEOA 4UP7A 1B76A 3CXCA 4KBMB 3RKYA 4M7AG 3JCMJ 2EFIA 4G85A 1EFWA 5GANd 4PG3A 1P92A 3OBWA 5C51B 2L89A 4Q6GA 5A0LA 3QKJA 3OYNA 3C95A 5LJ3g 4OVAA 1WQWA 1LYLA 2MF2A 4H2TA 2NLUA 4P3OA 3HXUA 4BE2A 5KE3A 2ZZEA 2E3CA 2CZ1B 4YYEA 2XIDA 3M9QA 2A3LA 3OYHA 5GAOr 4ELYC 4LVIA 4H2SA 2LQKA 3M59A 3NENA 5GANj 4XTUA 2CJBA 3MEAA 4F7UB 2RJDA 1M1KC 1H4TA 1YFTA 3TCJA 2RB6A 5CKHA 3JRZA 3CC7T 1E24A 4M75D 4C92D 5DLOA 1UGQB 3OYYA 2ZT5A 4QVZA 3RL6A 4E7KA 2RHQA 3PCOB 2RJCA 1I4K1 1RIQA 3RACA 3O8VA 3CCSA 3JCMe 2KVQG 1KMNA 4P5NA 2D6FA 1EIFA 2CKKA 5J3BA 3OYLA 4HWOA 4P72A 3A31A 4M75E 4C92C 4M75F 4P71C 3CPWA 3HRKA 3CXCS 4MMKA 4PJOG 2DKGA 5I21A 1SRYA 3UWNA 1C0AA 3DKMA 4EMKB 2JTMA 2OTLA 4X9DA 2ZIMA 5K1PA 3NFCA 5CKDA 3SD4A 1QVFS 1X54A 4ZGEB 2K5IA 5GAMe 2JTFA 4YRMA 4M7AC 3CCUT 5C52B 1VIFA 3M54A 4MDWA 3HXZA 2EYQA 3E9FA 3LLRA 4R56A 3OBYA 4LDUA 1E1TA 2QTXA 4OB2B 4PJOD 1S72T 1O75A 2RHUA 1B7YA 1YITT 2LT4A 2LT1A 3OW2S 1N9WA 3J81E 1I8FA 4LVJA 2QQSA 2F5TX 3M58A 4HWRA 2IG0A 5D6XA 1S72A 4II1A 2XTIA 1VQ5T 2QEXT 2RM4A 2QXFA 2HAXA 3OYIA 5GAOp 2RI3A 4WJ4A 2AKWB 4ZN3A 2MWPA 4H2XA 2LVMA 2ZT7A 2ZXFA 5GMKe 3CMEA 4LVMA 2JNGA 5I2MA 2V8JA 4BI3A 5CQXA 3OS5A 4M77D 3TU4K 1TH7A 3L2QA 1JJCA 2Q5IA 4XU1A 2ZR3A 5GAN5 4UP8A 4YREA 2L5QA 2PMEA 1G3TA 4J6YA 1OYXA 3UGTA 2ZT6A 4DPGA 2XHCA 4XTVA 4RQEA 1NPPA 3V8LA 2ZR2A 1K73C 4G84A 3DLLA 2EWNA 1KQSS 2WSCE 2RK1A 3A5YA 1VQ8A 2ZT8A 1FWZA 4NL2A 3PTAA 4KR3A 1YJNA 1KMMA 1UEBA 2M9UA 2V8KA 4M75C 4MZPA 2MMPA 3A32A 4C8QA 1Q82C 1Z7MA 3BJUA 3LX7A 3LGLA 4X5OA 3L42A 1NJIC 2ZZGA 1BI2A 2XICA 2QHUA 1JJ2S 1D3BA 2EIFA 5A0GA 4VUBA 3VUBA 4F7UF 1M5Q1 3M4PA 4XEOA 5C6SA 2XI9A 4KT0E 1KQSA 4J6XA 4KUIA 5GMKj 4F7UA 3PIPA 5FU6C 2DU5A 4M7DA 3A5ZB 3CCRA 2R58A 2DU7A 2VUBA 5LJ5h 4J8OA 1BIBA 4H2UA 4AH6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4RCB A;  4M77 B;  1YB3 A;  3WQZ A;  4J15 A;  3HY0 A;  3BW1 A;  4C8Q E;  4PJO F;  3JB9 F;  3HFO A;  3A74 A;  4P3N A;  2E41 A;  5LJ3 d;  2ARS A;  1H4V B;  3P8Y A;  1BBW A;  5GAN h;  2DZC A;  4M7A A;  3M4G A;  3L4G A;  3RGL A;  2E5A A;  4H2X B;  3TEH A;  3JB9 D;  3UH0 A;  5F5W A;  4YCW A;  4M75 A;  3LSS A;  1KQ1 A;  4P73 A;  4RDX A;  1YGB A;  4YRS A;  3BDU A;  4N0A C;  4PNO A;  4CH3 A;  1NNH A;  1YFR A;  1GGM A;  1QE0 A;  4DQ2 A;  5GAN f;  4YRF A;  2Q7E A;  1WPY A;  4XEM A;  4CS3 A;  4TVA B;  5CAI A;  1G51 A;  1X55 A;  5GAO q;  4CH5 A;  4N0A A;  4PJO B;  3V7S A;  4OP0 A;  4M77 F;  2C8M A;  3L4G B;  3P8T A;  2EAY A;  1NJ1 A;  1Z7N A;  5GAN 2;  4TVY A;  4JRK A;  4TQF A;  1E1O A;  1B7Y B;  2ALY A;  1WLE A;  3NEL A;  1G5H A;  3V7C A;  4KR2 A;  2DTH A;  4BWA A;  3HXW A;  4XTX A;  4K87 A;  4CS4 A;  2DJZ A;  4C92 G;  2DTO A;  5GAO n;  1WQ7 A;  1USY C;  4M75 G;  4TVA A;  3QSU A;  4UP7 A;  4K86 A;  1YFS A;  1B76 A;  4Y91 A;  4P75 C;  3RKY A;  3JB9 J;  4M7A G;  3RES A;  3JCM J;  3MF2 A;  4KQE A;  2RHS A;  3QO7 A;  4M77 E;  4G85 A;  1B70 A;  2Q5H A;  4ZTZ B;  4JRI A;  4P75 A;  2DXU A;  5GMK m;  1EFW A;  3PZC A;  4OLF A;  2YHT A;  5GAN d;  2G4C A;  4P3P A;  4PG3 A;  3BFM A;  4C8Q G;  3QTC A;  2C7I A;  5C51 B;  4HWS A;  4C92 B;  4H2Y A;  4Q6G A;  4XU0 A;  4YRN A;  5GAM j;  3SB2 A;  1N9R A;  5GAM f;  3HXX A;  1H4Q A;  4L87 A;  1HC7 A;  1FYF A;  4M78 A;  5LJ3 g;  1L0W A;  1WQW A;  1LYL A;  3GIB A;  3FB9 A;  1B34 A;  3V8J A;  3A7R A;  4QVD A;  2FYK A;  2DQ0 A;  2ZIN A;  3FIF A;  3JCM h;  4H2T A;  1B34 B;  3VU3 C;  4PHC A;  4P3O A;  3HXU A;  4BW9 A;  2ZZE A;  2RHQ B;  3PCO A;  1SER A;  1ATI A;  4C92 A;  2E3C A;  4A54 A;  2DZ9 A;  2RHS B;  3IKL A;  4YYE A;  4TTV A;  4K88 A;  5C53 B;  4M7D C;  5GAO r;  4P74 A;  4NL3 A;  5GAN 4;  4XTY A;  3MF1 A;  5GMK h;  2CJ9 A;  4H2S A;  3FJP A;  3RF1 A;  4ZIB A;  3JB9 G;  3NEN A;  5DY9 A;  4XU2 A;  1BBU A;  5GAN j;  4XTU A;  2CJB A;  5GMK i;  3JB9 H;  4F7U B;  1H4T A;  1YFT A;  1EIY B;  3JCM X;  2RB6 A;  4TVW A;  4HVC A;  1WU7 A;  2QHT A;  1E24 A;  2ODR D;  4M75 D;  4EO4 A;  4NCX A;  1X2G A;  2J3M A;  5LJ5 j;  3SWN A;  4C92 D;  4M7D F;  2EJG A;  4C8Q C;  2ZT5 A;  3QO3 A;  3VQW A;  3RL6 A;  1PYS B;  3AHU A;  3HY1 A;  3EFS A;  1X01 A;  2RHQ A;  3PCO B;  4QVC A;  1NJ8 A;  1JJC B;  1I4K 1;  4YRG A;  1RIQ A;  3RAC A;  2I4O A;  4UPA A;  4XTW A;  1HK9 A;  3QNE A;  4HT9 A;  1EOV A;  3JCM V;  1KOG A;  3JCM e;  4PJO A;  5LJ5 f;  4HWP A;  3G1Z A;  2DXT A;  1KMN A;  1Y96 B;  4P71 A;  4E51 A;  1JRI A;  2CIM A;  2EL9 A;  3R07 A;  4HWO A;  4P72 A;  4EMK C;  4M7D D;  3A31 A;  4M75 E;  4C92 C;  2I2L A;  4M75 F;  4CH4 A;  4P71 C;  4YRR A;  1U1S A;  1H4S A;  4PJO E;  3HRK A;  1MGQ A;  2QHV A;  4M7A E;  1Y96 A;  4M75 B;  4MMK A;  4PJO G;  2DKG A;  5I21 A;  1SRY A;  1C0A A;  4EMK B;  1PYS A;  4F7U G;  4X9D A;  2ZIM A;  3SWN B;  2AKW A;  5K1P A;  3V8K A;  2XGT A;  2ZNI A;  2RD1 A;  4EMG A;  2Y90 A;  1EVL A;  1X54 A;  2K57 A;  5GAM e;  4M78 G;  3PGG A;  4YRM A;  4M7A C;  4CS2 A;  2I4M A;  1EQR A;  1EIY A;  2YLC A;  5C52 B;  3JCM g;  4M7D E;  4YPF A;  3HXZ A;  1NJ6 A;  1E1T A;  3A5Z A;  3UFG A;  4P73 C;  2QTX A;  4PJO D;  1ADJ A;  4ZTU B;  4F7U E;  1B7Y A;  2ALY B;  4P72 C;  4H2V A;  3RKW A;  3REU A;  5LJ5 d;  3HRI A;  3OD1 A;  1N9W A;  3HFZ B;  4RMF A;  4HWT A;  1I8F A;  4NOY A;  2Q7H A;  4YRK A;  3M4Q A;  2I4N A;  2VXF A;  4HT8 A;  5LJ3 j;  5E3I A;  4C92 E;  5GAM g;  4YCV A;  1X56 A;  4HWR A;  4CH6 A;  5GAN 7;  2P0L A;  5GAO m;  2ZCE A;  3RUX A;  3UGQ A;  3JCM c;  1VQZ A;  1NJ2 A;  2CGH A;  4WJ3 M;  4EX5 A;  2ZZF A;  2XTI A;  1SET A;  3JCM P;  4M7A F;  1WNL A;  2QHS A;  3A7U A;  4XTZ A;  4M78 E;  2RM4 A;  4YRJ A;  1E22 A;  3MEY A;  5GAO p;  4M7A B;  3QO5 A;  3RER A;  5GAN 6;  2DDZ A;  4WJ4 A;  2AKW B;  5ELN A;  5ELO A;  1U1T A;  2ODR C;  3HXY A;  4EMK A;  2ZGW A;  3RKX A;  4H2X A;  3TEH B;  4XQ3 A;  2EJ9 A;  3VQV A;  2JN0 A;  2ZT7 A;  2DVE A;  3CMQ A;  2ZXF A;  3IKM B;  1LOJ A;  3IAL A;  5GMK e;  4V2S A;  3IG2 A;  2ZNJ A;  1G5I A;  4M7A D;  4M77 A;  2I4L A;  1QF6 A;  3EFR A;  3JCM Q;  4YDQ A;  3JCM f;  4C92 F;  3L2Z A;  2P5I A;  2AMC A;  3HTZ A;  5LJ3 f;  4M7D B;  1B70 B;  1ASZ A;  4WF2 A;  5LJ3 h;  12AS A;  2ART A;  4M77 D;  4YCU A;  4UP9 A;  3V7R A;  3ERR A;  2E10 A;  3NET A;  1NYQ A;  1TH7 A;  4YRO A;  2ZTG A;  3TEG A;  1JJC A;  4YRT A;  2Q5I A;  4XU1 A;  4LNS A;  2ZR3 A;  5GAN 5;  2FB7 A;  1YCY A;  2VC8 A;  1I5L A;  4UP8 A;  4YRE A;  2PME A;  4J6Y A;  4A53 A;  3A7A A;  2J3L A;  1D3B B;  1WYD A;  4YRI A;  2DEQ A;  3UGT A;  2ZT6 A;  4C8Q F;  4DPG A;  11AS A;  4XTV A;  2AMC B;  4RQE A;  5LJ5 g;  3TUP A;  4X9C A;  3V8L A;  4XU3 A;  3INZ A;  2ZR2 A;  4YRC A;  3NEM A;  3VQY A;  4C8Q D;  1NYR A;  4G84 A;  2EWN A;  4M77 G;  3L1A A;  5GAN e;  2YLB A;  4M78 B;  2E65 A;  3BY7 A;  3A5Y A;  5LJ3 e;  4RQF A;  3JB9 I;  2ZT8 A;  3RIR A;  1SES A;  2ARU A;  5HGQ A;  4NL2 A;  1ASY A;  4PJO C;  5GAN g;  1EVK A;  1HXD A;  4KR3 A;  3JCM d;  4H2W A;  3ICA A;  4YRP A;  1KMM A;  1X2H A;  2IY5 A;  4TWA A;  2DTI A;  4M75 C;  3HFN A;  4C8Q B;  5LJ5 e;  4TQD A;  2IY5 B;  1HTT A;  1W66 A;  3VQX A;  1H64 1;  4M78 D;  3VBB A;  4JLI A;  3A32 A;  3E9H A;  4C8Q A;  2ZIO A;  1IL2 A;  3E9I A;  1I81 A;  3LC0 A;  5GAN 3;  1Z7M A;  3BJU A;  4YP0 A;  3QUI A;  3JCM b;  2RA2 A;  5GAM h;  5GAO l;  2DQ3 A;  3JCM W;  4X5O A;  3SWN C;  2HNI A;  4JUV A;  2ZZG A;  1JBM A;  2E64 A;  4M78 C;  3I7F A;  4MML A;  3KFU A;  3HXV A;  4P74 C;  1J5W A;  2QHU A;  1D3B A;  2EJF A;  3HFZ A;  4M77 C;  5GAN 8;  4YRQ A;  2Q7G A;  5GAM d;  4M7D G;  1BIA A;  5GMK l;  5KNN A;  1LJO A;  4J5Y A;  3W3S A;  4F7U F;  1M5Q 1;  3M4P A;  3REX A;  2E1H A;  4XEO A;  3HFV A;  3DSQ A;  4O2D A;  2CJA A;  4Q15 A;  1N9S A;  4J6X A;  5GMK j;  4F7U A;  3P8V A;  4J6W A;  1NJ5 A;  2DU5 A;  4M78 F;  3LSQ A;  1B8A A;  4RCC A;  3QO8 A;  4WI1 A;  4M7D A;  2PMF A;  4YRL A;  4H02 A;  5K1X A;  1ADY A;  4EMH A;  1USY A;  2DU7 A;  3QHS A;  5LJ5 h;  1LNX A;  3HSB A;  1M8V A;  1KQ2 A;  1BIB A;  2VXE A;  4H2U A;  4HA8 A;  4AH6 A; 
#chains in the Genus database with same CATH topology
 2JW4 A;  3WQZ A;  3VS6 A;  4J15 A;  2LQ8 A;  3HY0 A;  2JZ2 A;  3JB9 F;  5LJ3 d;  4LUE A;  2XG8 D;  2KR3 A;  3OYG A;  5KCH A;  1BBW A;  1N27 A;  5GAN h;  1F1B B;  1Z9Q A;  3CMA A;  2E5A A;  3TEH A;  1WHK A;  1OPL A;  3CMA Q;  5D7U A;  1QVG S;  4DOV A;  1VQP T;  3R6O A;  1JJ2 A;  4KRT A;  1EZZ B;  4RDX A;  1BI1 A;  1FMV A;  4CH3 A;  1GBR A;  2DX1 A;  1WHL A;  3EFO A;  3CC4 T;  1X55 A;  1IRE B;  1W2B S;  4TVA B;  1HSQ A;  5KE2 A;  5GAO q;  3MPU B;  2EYY A;  3P8B B;  2ZPE B;  1OQK A;  4FCY A;  1Q81 C;  2C8M A;  3P8T A;  3I9Q A;  2EAY A;  1Z7N A;  1K8A C;  5CKF A;  2RK2 A;  3NTI A;  2YXY A;  2LJ1 A;  2ZZD A;  2H8H A;  4TQF A;  1M90 R;  1WXB A;  1B7Y B;  1NEB A;  3LWH A;  3FC3 A;  1OPK A;  3NEL A;  1Q82 U;  2YUN A;  4KR2 A;  3NTK A;  1VQP Q;  2L3Q A;  1QQJ A;  4BWA A;  2F1L A;  1HYO A;  3TSW A;  4XTX A;  4FM4 B;  5IXB A;  2RHI A;  1QCO A;  2DTO A;  1WIE A;  2JTE A;  1WQ7 A;  1ABQ A;  1SF9 A;  1VQL T;  3CME Q;  2A8E A;  1NJI U;  1UGV A;  1BI0 A;  4E47 A;  2XMF A;  4P75 C;  3ME9 A;  3JB9 J;  1NZ9 A;  4HXJ A;  3WVE B;  2HSE B;  5KYX B;  1PKT A;  2BZ8 A;  1QVP A;  3CBM A;  1B70 A;  4ZTZ B;  2V26 A;  3S3N A;  3EGU A;  4JRI A;  4P75 A;  2DXU A;  4C0G A;  5GMK m;  2EKH A;  4QW2 A;  2OTL Q;  5AT1 B;  2YHT A;  2G4C A;  2ZPG B;  3BFM A;  4DBR A;  3QTC A;  2C7I A;  4QQD A;  1T0J A;  2PTK A;  1EFN A;  2I0N A;  3X24 B;  3CME T;  3MO8 A;  1VQK T;  4UC4 A;  3HXX A;  1N9R A;  5GAM f;  3I5S A;  3A1P A;  4CC4 B;  3N5B B;  4BUG A;  2VKN A;  3OSV A;  1VQ6 A;  1PCX A;  4M78 A;  2J6K A;  3UA7 A;  3GIB A;  1V29 B;  1MMN A;  1PNJ A;  2ZIN A;  2JS2 A;  2KRN A;  3FIF A;  2ZPH B;  3VU3 C;  4PHC A;  1ZX6 A;  5DM7 R;  3EG2 A;  1X2K A;  1ATI A;  3QZ9 B;  1E7O A;  1ZQ1 A;  2QQB A;  4JZ3 A;  2RHS B;  1HD3 A;  4AT1 B;  4B9X A;  5KCO A;  1PSF A;  5C53 B;  4NL3 A;  2ZCF B;  3X26 B;  5GAN 4;  4OB3 B;  3VS4 A;  5GMK h;  2CJ9 A;  3FJP A;  2E70 A;  2WSE E;  2EGA A;  1BBU A;  1TS9 A;  3LYI A;  4E7I A;  2X4J A;  1YIJ A;  2M02 A;  3M57 A;  1VA7 A;  1ZA1 B;  1Z9Z A;  1RL2 A;  1RLP C;  3GP8 A;  4TVW A;  1M3B A;  4KGX B;  1VQ7 T;  2F2V A;  3A8L B;  4HVC A;  1UJY A;  1M90 U;  2ODR D;  3VV0 A;  4EO4 A;  3NGP A;  1X2G A;  2J3M A;  5LJ5 j;  4M7D F;  1UB4 A;  2GBQ A;  5AYF A;  2EJG A;  1TUG B;  3VQW A;  1PYS B;  3NTH A;  1GFD A;  1OX8 A;  2E12 A;  1M8M A;  2KAF A;  4J9G A;  1EX4 A;  2NYS A;  1KD1 R;  3DB4 A;  3A8O B;  1YHQ Q;  2EPD A;  1JJC B;  4YRG A;  2V1Q A;  2KE9 A;  3E1S A;  2EBP A;  4UPA A;  1IHW A;  4DEX A;  3QDF A;  4XTW A;  1WXT A;  4PFP A;  1G8X A;  3OYE A;  2JM8 A;  4OMQ A;  1XQH A;  2ESW A;  3G4S A;  1VQ7 Q;  1UG1 A;  2F2X A;  1SRM A;  2ZPB B;  4FT2 A;  3CCU Q;  1SG5 A;  1AWJ A;  3J80 E;  3L2U A;  3OYD A;  1U5S A;  2DER A;  4YRR A;  5FU7 C;  2JMA A;  3OSS C;  4M7A E;  2LDM A;  4M75 B;  1BCO A;  3EGX B;  3KBG A;  2DBM A;  1PYS A;  4F7U G;  2OJ2 A;  3G71 A;  1UUE A;  1R0B G;  2XGT A;  4FYX B;  3GNG A;  1MUZ A;  4EPC A;  2RD1 A;  3CCS T;  2XDP A;  3CCQ T;  2FEI A;  3I56 Q;  1MV3 A;  2A0F B;  1WLP B;  1EVL A;  2K57 A;  2P4R A;  4HCB A;  5KYX A;  3EG9 B;  3QZ5 B;  1H3H A;  2BUD A;  1AWW A;  2YLC A;  1NJI R;  3JCM g;  3EH2 A;  1D1C A;  3H6Z A;  2LRQ A;  1K73 U;  1AWX A;  2B86 A;  3A5Z A;  4Y92 A;  1SHG A;  4P73 C;  1ADJ A;  4LDW A;  2K9G A;  3RKW A;  4CRI A;  5FWC A;  3HRI A;  2M0O A;  3MKD A;  4HWT A;  5IHN A;  1JQQ A;  4A4H A;  1MHN A;  2Q7H A;  4YRK A;  2E5Q A;  3NMZ C;  3OYJ A;  2KRO A;  2A37 A;  2M1H A;  5GAM g;  1IRX A;  1K0X A;  3QYH B;  1Y0M A;  3RUX A;  2EQJ A;  2E3H A;  3JCM c;  4Z8A A;  1SSH A;  1NJ2 A;  4WJ3 M;  3G1J A;  1C1A A;  1SET A;  3QPH A;  2ABL A;  2FPF A;  2QHS A;  3A7U A;  5I22 A;  3CCE Q;  1TTH B;  2COW A;  1CSK A;  3QO5 A;  2DO3 A;  2YRD A;  5GAN 6;  2NUT A;  1NM7 A;  4IKF A;  2X4Y A;  3OMG A;  3O5Z A;  2ODR C;  1RAG B;  3HXY A;  4OMO A;  2FRY A;  2SRC A;  2PVO B;  2R57 A;  2ZGW A;  3TEH B;  4OF1 A;  2GCX A;  4JRQ A;  3HRS A;  1KHI A;  3PFS A;  2OX7 A;  4JS5 A;  2DVE A;  5HK0 A;  3IKM B;  3CCJ T;  2ROT A;  2CS7 A;  4V2S A;  3IG2 A;  3OA6 A;  1G5V A;  1G5I A;  2ZNJ A;  1FXX A;  3EFR A;  3JCM Q;  1OI1 A;  4YDQ A;  3JCM f;  2ZPI B;  4C92 F;  2HSP A;  1TSF A;  4M7D B;  3CCE T;  3E9G A;  1BBZ A;  4A4F A;  12AS A;  1Y71 A;  4PLL A;  4YCU A;  3ERR A;  4Y28 E;  3NET A;  2FL7 A;  3TEG A;  3M0T A;  2DIG A;  1KJW A;  4LNS A;  2O4X B;  2FB7 A;  2JS0 A;  2VC8 A;  1NLP C;  1I5L A;  4GLM A;  4A53 A;  3OB9 A;  2J3L A;  4WCI A;  2CP3 A;  4RTX A;  1VQ9 A;  4E7Z A;  2WAC A;  1M1F A;  1VQ5 Q;  2AMC B;  2YRV A;  3I55 A;  4PKC C;  4XU3 A;  4ANJ A;  2F5K A;  5A2Q E;  4C8Q D;  2LNV A;  5GAN e;  2LX9 A;  2YLB A;  4M78 B;  3TQ7 P;  4E7L A;  3RIR A;  2JUF A;  4PJO C;  4FU6 A;  1EVK A;  3KXT A;  4BDY A;  3JCM d;  3EHR A;  1X2H A;  1SSF A;  3JV3 A;  1AT1 B;  4FYV B;  1ZSZ C;  3HFN A;  4C8Q B;  4TQD A;  2IY5 B;  1HTT A;  2LQN A;  4J9E A;  2RQW A;  3CD6 Q;  4N4I A;  1W66 A;  4M78 D;  2GF7 A;  1QWE A;  3QBY A;  3OS2 A;  1YJN Q;  1G3S A;  2KMT A;  2A36 A;  1IL2 A;  4C0F A;  2CZ7 B;  1BYM A;  3QUI A;  3JCM b;  2CH4 W;  1NYF A;  1YJ9 Q;  2JOY A;  3OYM A;  2HCK A;  1HJD A;  2HNI A;  4JUV A;  1JBM A;  2E64 A;  5ECA A;  2R5M A;  5KYU B;  4N4G A;  3I7F A;  3I35 A;  4MML A;  3M4Y A;  4JJN K;  4L6V 5;  3OS1 A;  4LDV A;  4M77 C;  5GAN 8;  2E3I A;  4M7D G;  4FW1 A;  1BIA A;  3C94 A;  3GLX A;  2M51 A;  2XK0 A;  1ZLM A;  2LCC A;  5CKE A;  4DBF A;  2XD0 A;  4A4G A;  1TU0 B;  3DSQ A;  3VS5 A;  2K7A A;  1VYV A;  4HVV A;  5IHI A;  3VJP A;  1I5O B;  4JDS A;  2D0Q B;  3P8V A;  2DMO A;  4J6W A;  4F17 A;  8AT1 B;  3LSQ A;  5FU6 B;  4E6R A;  1Q86 R;  2AHJ B;  3CCQ A;  1AEY A;  2L2P A;  2F69 A;  4IUU A;  2PMF A;  2YUP A;  1LPL A;  3SFM A;  5K1X A;  1ADY A;  1Q7Y C;  1USY A;  3CBP A;  1R77 A;  3HSB A;  3RMS A;  3QJ6 A;  2Y4Y A;  4QQG A;  3OQ5 A;  4PJN A;  5CIU A;  2C0T A;  5DLQ E;  3QWY A;  4RCB A;  4R0K A;  4PJO F;  4PLI A;  3HFO A;  2FPD A;  3A74 A;  3URG A;  1VQO A;  2FZK B;  1H4V B;  2DZC A;  1C6V X;  2R5A A;  3G4S T;  1K9M U;  3L4G A;  3RGL A;  1UDL A;  3Q1J A;  4BB7 A;  2YWW A;  3LSS A;  3EG3 A;  4IUR A;  1Q81 U;  3WXM B;  2DXC A;  3QJY A;  2X4X A;  4PNO A;  4BY6 B;  1UGP B;  2QA4 A;  1GGM A;  1QE0 A;  4YRF A;  3F70 A;  4CS3 A;  4XEM A;  5FLX E;  4BAC A;  1M90 C;  2XKO C;  3V7S A;  4OP0 A;  4M77 F;  3L4G B;  2X3X D;  4IIM A;  1NJ1 A;  3QDR B;  2GTO A;  2PVG B;  2OTJ Q;  3G4S Q;  1VQ7 A;  4TVY A;  4LXC A;  2KXD A;  2K2V A;  3FJ5 A;  2QQ9 A;  1E1O A;  3JAM E;  4L59 A;  4F16 A;  1WLE A;  1G5H A;  3V7C A;  1U06 A;  3C12 A;  2DTH A;  2KRS A;  4K87 A;  4CS4 A;  2LP5 A;  3HPW A;  3VYG A;  3CD6 T;  1E6H A;  4C5G A;  4AFU C;  3SEM A;  2FO0 A;  2O4X A;  2CSQ A;  2K3Y A;  4K86 A;  1YFS A;  4CC3 A;  2MK5 A;  2ROL A;  4JZ4 A;  1YI2 T;  1WDX A;  3RES A;  2JVV A;  3MF2 A;  3PMI A;  3C4S A;  2O01 E;  2RHS A;  3QO7 A;  4M77 E;  1VQO T;  1OV3 A;  1YWO A;  2D8J A;  2Q5H A;  2G3R A;  1W6X A;  1PD1 A;  1QVG A;  2PUO B;  3MCA B;  3PZC A;  4R55 A;  5J39 A;  1SRL A;  4P3P A;  2DNU A;  3VKI A;  2EKO A;  4C8Q G;  3MEW A;  1YJW A;  3M0R A;  4HWS A;  4C92 B;  1RAA B;  4JJB A;  2K2M A;  4XU0 A;  4HVW A;  2HBW A;  5GAM j;  3SB2 A;  1H4Q A;  1XTD A;  4L87 A;  5KYU A;  1HC7 A;  1OOT A;  1QP2 A;  1L0W A;  1X43 A;  1PHT A;  3REB B;  1U8R A;  3A7R A;  2DL3 A;  1AD5 A;  2FYK A;  1M4Z A;  2O9S A;  3JCM h;  4EDU A;  1B34 B;  4HCC A;  4X34 A;  3CQT A;  4BW9 A;  2QDL A;  2RHQ B;  3PCO A;  1SER A;  4C92 A;  4A4K A;  4BI4 A;  3OYF A;  4OMF B;  1X6O A;  1M9S A;  1WJR A;  5A0D A;  4K88 A;  4M7D C;  4AFQ C;  4P74 A;  1WXU A;  3CCV A;  3CCR Q;  4ZIB A;  2EYZ A;  1ZUK A;  4CC2 A;  3JB9 G;  3EHQ A;  4MDX A;  5L8R E;  4AFS C;  5IHK A;  5GMK i;  3DB3 A;  4KUL A;  2AT1 B;  3SDZ A;  1N5Z A;  3ZFJ A;  3MP8 A;  2L3R A;  2GQV A;  1N6A A;  1V76 A;  4ZTF A;  2E5K A;  2FVU A;  1YJ9 A;  1WU7 A;  2JM9 A;  3G7Z A;  4NCX A;  1JU5 C;  3HKS A;  4J9C A;  2CZ0 B;  4HCZ A;  2C0O A;  3QO3 A;  1D09 B;  3CBO A;  2CP0 A;  3RBB B;  3HY1 A;  2F2W A;  3EFS A;  1TUD A;  4J9B A;  2P0K A;  1VQN A;  4QVC A;  1NJ8 A;  1QCN A;  2I4O A;  3QNE A;  3OW2 A;  4HT9 A;  1EOV A;  1KOG A;  4PJO A;  2BE9 B;  4TVR A;  3GBQ A;  3L2W A;  3CCS Q;  3VS0 A;  3M56 A;  1YP5 A;  5LJ5 f;  2HZY A;  3G1Z A;  2HBP A;  1Y96 B;  4E51 A;  1KQS P;  3M55 A;  3H0I A;  2CIM A;  2DL5 A;  3R07 A;  4NS5 A;  5IN1 A;  2K3X A;  4EMK C;  1GRI A;  2I2L A;  4QKU A;  1MND A;  3M53 A;  1H4S A;  1U1S A;  1YWP A;  4PJO E;  1MGQ A;  2H3J A;  2QHV A;  1R0C B;  1WYX A;  1AZG B;  4JS4 A;  2C0I A;  3SWN B;  4LDY A;  1WJQ A;  3T9N A;  4EMG A;  1N8R U;  3CPF A;  1T3S A;  2QI2 A;  3PGG A;  1I0C A;  2I4M A;  1QCF A;  2SEM A;  1IXD A;  1EQR A;  3OYC A;  1A0N B;  4FW2 A;  5KYW A;  4OMM A;  1TOV A;  4AG1 C;  1VQM T;  2KEA A;  4YPF A;  1NJ6 A;  1QVF A;  3UFG A;  2WSF E;  4JLG A;  2V1R A;  2JMC A;  1PD0 A;  5LJ5 d;  3REU A;  3TVT A;  3OD1 A;  4E2F B;  5HKC A;  3CCM Q;  4NOY A;  3G6E A;  3M4Q A;  2D8H A;  4F04 B;  2VXF A;  3G6E T;  3ZEH A;  2EQM A;  5LJ3 j;  3S6W A;  4C92 E;  4XK8 E;  4YCV A;  5GAN 7;  4WTO B;  5GAO m;  3UGQ A;  4FIB A;  2DK3 A;  3RMQ A;  2CGH A;  2IIM A;  5HY6 A;  2DRM A;  1H8K A;  2ZZF A;  1GL5 A;  3VS1 A;  2IVW A;  1WNL A;  1VQL Q;  4XTZ A;  1K4U S;  1PG5 B;  3MEY A;  5CKB A;  3QII A;  3I5R A;  5HK3 A;  3RER A;  5I11 A;  3CCQ Q;  5ELO A;  1U1T A;  1W70 A;  1GXI E;  1VQ8 T;  4O5V A;  1WHG A;  3A8G B;  4XQ3 A;  2EJ9 A;  3EGD A;  4PJM A;  3VQV A;  2JN0 A;  3HP9 A;  4D8K A;  2KQW A;  3A8M B;  3LGF A;  4D6W A;  4M77 A;  2I4L A;  2HL3 A;  2VWF A;  3OS0 A;  1WGS A;  2O9V A;  1W2B A;  3MJX A;  2RJF A;  2M16 A;  2P5I A;  3AT1 B;  5LJ3 f;  1B70 B;  2P0P A;  4WF2 A;  4GLK A;  1FMK A;  1ZSZ B;  5LJ3 h;  2P84 A;  4UP9 A;  5IH2 A;  4BDZ A;  1X69 A;  2DBK A;  1NYQ A;  4YRO A;  2QAS A;  2RJE A;  1PSE A;  3G71 T;  4J9H A;  3PIO A;  2YDL A;  5FWB A;  4YRT A;  1DJ7 B;  2EQK A;  1IZ6 A;  3X25 B;  4C0D B;  1UJ0 A;  3OYK A;  2BZX A;  3TEE A;  1D3B B;  4YRI A;  2BIV A;  4ZGJ B;  4LUD A;  1VQK Q;  2LCL A;  2D1X A;  4HCK A;  2RQT A;  2DEQ A;  2GGR A;  4C8Q F;  11AS A;  1VQN T;  2VGM A;  3MP1 A;  4RTW A;  1U3O A;  2MAM A;  1BI3 A;  2CYZ B;  3TUP A;  1QP3 A;  4X9C A;  3X28 B;  2FPE A;  3INZ A;  4YRC A;  3QYG B;  2COZ A;  3NEM A;  2A7Y A;  2LC4 A;  1CKB A;  1M2V A;  2A08 A;  3EG9 A;  1YJ9 T;  1QW1 A;  2E65 A;  1SES A;  2ARU A;  5HGQ A;  1ASY A;  4GY5 A;  4A63 B;  2ED1 A;  2DJQ A;  3GNF B;  4YRP A;  4K11 A;  3GOX A;  2IY5 A;  2QEX A;  1VQ4 A;  2DTI A;  4J9D A;  5LJ5 e;  1V1C A;  2HKN A;  4ME7 A;  3C0C A;  2X51 A;  2QDY B;  1JO8 A;  1H64 1;  4JLI A;  2O88 A;  1M2V B;  1I81 A;  2AZV A;  3LC0 A;  3R6N A;  3VYH B;  1FX7 A;  5GAN 3;  1N8R R;  1ZA2 B;  4LVK A;  1GCQ C;  2RA2 A;  2GTJ A;  3FRN A;  3OY9 A;  4OB1 B;  3JCM W;  1YIJ T;  4B6M A;  5KYY B;  5IAY A;  3PNW C;  5FW9 A;  1RAC B;  2JJ9 A;  3KFU A;  3HXV A;  2RO0 A;  4P74 C;  1J5W A;  1I07 A;  4FSX A;  3WVD B;  2QA4 Q;  2DF6 A;  2RI2 A;  4AG2 C;  4YRQ A;  3GF5 A;  5GAM d;  3PT9 A;  1Y7X A;  5GMK l;  3CPW P;  1OZ3 A;  1YHQ T;  4J5Y A;  3W3S A;  1SPK A;  1RAB B;  1RAE B;  3REX A;  2E1H A;  3HFV A;  2RNA A;  4IUP A;  2ATC B;  1XOV A;  1Q7Y U;  3CCU A;  2CJA A;  1N9S A;  3MEU A;  2DFU A;  6AT1 B;  2X3W D;  1WFW A;  4M78 F;  2P0Q A;  3KFV A;  4DOW A;  2HEQ A;  2PU9 B;  4RCC A;  5EG2 A;  1YNZ A;  3TSZ A;  4WI1 A;  1RAI B;  3KUF A;  3HHT B;  4H02 A;  1RI0 A;  2PQW A;  1YHQ A;  1VQK A;  1YI2 A;  2DVJ A;  2FZG B;  3QHS A;  4FL6 A;  1M8V A;  1KQ2 A;  1OUL A;  1OX9 A;  2VXE A;  4HA8 A;  3CD6 A;  2XU8 A;  1YB3 A;  1K8A R;  4OB0 B;  1ZHI A;  3BW1 A;  4C0D C;  3DLM A;  5FRM A;  2BE7 D;  2E41 A;  1WJS A;  4PL6 A;  2ARS A;  3EAE A;  2K5L A;  3P8Y A;  4M7A A;  3M4G A;  3EGX A;  3JB9 D;  2RQR A;  4P73 A;  3RNJ A;  1VQ4 T;  1YFR A;  1LCK A;  3LH0 A;  2DEU A;  4ZNX A;  1G3W A;  2Q7E A;  1KG1 A;  1G51 A;  3RDV A;  1W1F A;  4CH5 A;  4KGZ B;  1BCM A;  2RF0 A;  1NPR A;  1UE9 A;  4LVL A;  1KC8 U;  1NYG A;  4JRK A;  3IQL A;  1VQO Q;  4QQ6 A;  2K4Y A;  2CRE A;  1B7T A;  2J06 A;  4JRP A;  5CVI A;  5LL6 S;  4KH1 B;  3FLG A;  3CC4 A;  3FDR A;  4KUD K;  2X9H A;  2DJZ A;  1K8A U;  2DM1 A;  1KD1 U;  1USY C;  4M75 G;  1ARK A;  1K73 R;  4Q5W A;  4ZTJ A;  2HQH A;  4C5E A;  2RQU A;  4Y91 A;  2CSI A;  4MZM A;  1NBE B;  2JXB A;  4KQE A;  2GNC A;  1I1J A;  5KYW B;  3ASK A;  1O9S A;  2KSS A;  1PRL C;  2VV5 A;  2JT4 A;  3LH5 A;  2K5F A;  4OGE A;  3CC7 Q;  4OLF A;  1SKU B;  4LD9 K;  2O2O A;  4OML A;  1M1G A;  3CXC P;  2YT6 A;  4CI0 C;  2M0Y A;  5GJW B;  2BKD N;  1LVK A;  4H2Y A;  4YRN A;  3LWI A;  4IUQ A;  4E7S A;  3CCR T;  3TRE A;  1FYF A;  4C5H A;  1WZO A;  1YIT Q;  2D9T A;  3FB9 A;  1B34 A;  1AHJ B;  3V8J A;  4E7J A;  2DPP B;  2RHZ A;  4QVD A;  2DQ0 A;  4FSS A;  3E19 A;  4N4H A;  9ATC B;  4A54 A;  4ORZ A;  2HQE A;  2DZ9 A;  3IKL A;  3SHW A;  4TTV A;  1XNI A;  5IT9 E;  4DA4 A;  4RMO A;  2EGC A;  4XTY A;  3H9N A;  3MF1 A;  4A4E A;  3RF1 A;  1NE8 A;  2RH2 A;  2DYI A;  3OMC A;  5DY9 A;  1VUB A;  4XU2 A;  1VQ9 Q;  1M3A A;  2QEX Q;  2HDA A;  3JB9 H;  3UT1 A;  5D6Y A;  8ATC B;  1WI7 A;  4HVU A;  4E7H A;  1EIY B;  3JCM X;  3I56 T;  2EW3 A;  1QKW A;  3MP6 A;  3X20 B;  1ZUY A;  4C0Z A;  2QHT A;  3U23 A;  3SWN A;  4RG8 A;  3THK A;  4J7I A;  2L8D A;  1ZSZ A;  1ZSG A;  1KC8 C;  3L2V A;  4C8Q C;  1M1K U;  1VQM A;  3QXE B;  2KBT A;  4C5I A;  1YJN T;  3AHU A;  2D0N A;  5D6W A;  2E6N A;  2XDB A;  1X01 A;  2P4T A;  4GBQ A;  3UA6 A;  1VQ9 T;  2KGT A;  1IGU A;  3ZBD A;  4YTL A;  4HKE A;  1HK9 A;  1QWF A;  3JCM V;  2E6Z A;  2NWM A;  4HWP A;  1VYU A;  2DXT A;  2BTT A;  4P71 A;  1JRI A;  4RG2 A;  2VGN A;  2EL9 A;  1KSW A;  2Z0W A;  4M7D D;  2HQX A;  2Y4X A;  3CCE A;  1Q86 C;  4RTT A;  4CH4 A;  3M5A A;  1N8R C;  4J83 A;  2FRW A;  4ATO A;  2OAW A;  2V8I A;  1Y96 A;  4J9F A;  3EGD B;  2RPN A;  3CC2 A;  3CCJ A;  1X75 C;  3OYB A;  2AKW A;  1CKA A;  3V8K A;  5M9O A;  3E2U A;  3ZL7 C;  2QQA A;  2ZNI A;  1Q82 R;  3HRT A;  2Y90 A;  4M4Z A;  1B07 A;  2LCS A;  5FRN A;  1ZBX A;  4M78 G;  4L5G A;  2LJ3 A;  4CS2 A;  2QQR A;  1MMD A;  1EIY A;  1QKX A;  1NEG A;  1QLY A;  4MZT A;  5KH6 A;  4M7D E;  5CCA A;  2ZPF B;  5C0M A;  4LD6 A;  1T0H A;  4ZTU B;  4F7U E;  2ALY B;  4P72 C;  4J9I A;  5FU7 B;  4H2V A;  3S3O A;  4CC7 A;  3LW5 E;  3HFZ B;  4RMF A;  3GPL A;  5CK9 A;  4FT4 A;  2KY9 A;  2H3E B;  2MWO A;  1D0Y A;  4KGV B;  1QMC A;  2I4N A;  2OTJ T;  4HT8 A;  5E3I A;  5CQY A;  2DE0 X;  1X56 A;  1TWB A;  4CH6 A;  1M27 C;  1VQ5 A;  3CCV T;  3CCM A;  2P0L A;  2ZCE A;  1VQZ A;  2RMO A;  1D0X A;  3S3M A;  1UGR B;  4EX5 A;  2J7I A;  2OAU A;  4IUV A;  5L23 A;  1M1K R;  3JCM P;  4M7A F;  5CO7 A;  4M78 E;  4YRJ A;  2CP6 A;  1E22 A;  4M7A B;  2BZY A;  1WA7 A;  1VOM A;  2DDZ A;  1SHF A;  5CR2 A;  2EQU A;  5ELN A;  2AK5 A;  4EMK A;  3RKX A;  1W4S A;  2DRK A;  4ESR A;  1KHC A;  1YIT A;  2PZ1 A;  2LTO A;  1UHC A;  2CP7 A;  3CMQ A;  1WHH A;  4Z88 A;  2DL4 A;  2X35 A;  1JEG A;  1LOJ A;  3IAL A;  2J05 A;  3MEV A;  4XAX B;  4M7A D;  1YJW T;  3H0H A;  1H3Z A;  1QF6 A;  5J26 A;  2NS6 A;  3L2Z A;  2COY A;  4BE1 A;  2AMC A;  3HTZ A;  2X4W A;  1ASZ A;  3L2R A;  2ART A;  2RHX A;  2DD5 A;  2E4H A;  1Q86 U;  3V7R A;  2E10 A;  2ZTG A;  2OTL T;  1PC0 A;  3G6E Q;  1T3L A;  1YCY A;  2MYS A;  1R8O B;  2G6F X;  1AOJ A;  2K6D A;  3A7A A;  4QT7 A;  1WYD A;  4O6J A;  4PFZ A;  3M0Q A;  2NUP A;  5GJV B;  4B9W A;  1GCQ A;  4BE0 A;  4IUT A;  4JPB W;  1PRM C;  4RKU E;  5LJ5 g;  3ER0 A;  3EG1 A;  2KDS A;  1XJW B;  1K9M R;  1QVG P;  3VQY A;  1NYR A;  3P8D A;  4M77 G;  2VVK A;  3L1A A;  3CPW S;  1C0M A;  1FYN A;  1SEM A;  1PKS A;  4J7F A;  1YIJ Q;  3BY7 A;  5LJ3 e;  3VS7 A;  4RQF A;  3UDC A;  3JB9 I;  4AMC A;  5GAN g;  4PJJ A;  1HXD A;  3J7A F;  4H2W A;  3ICA A;  1OU8 A;  3VS3 A;  1NG2 A;  2MIO A;  2KK4 A;  3BE3 A;  2QA4 T;  4TWA A;  1K1Z A;  4BY6 C;  3VQX A;  3UPU A;  2CUD A;  3VBB A;  3E9H A;  2ZIO A;  3CC7 A;  3E9I A;  2EVR A;  2RI5 A;  4YP0 A;  3CCM T;  2LMJ A;  1RAD B;  5GAM h;  2DET A;  5GAO l;  2DQ3 A;  3BDL A;  2OTJ A;  4OMP A;  4RTZ A;  3SWN C;  2YSQ A;  3VRY A;  3HL8 A;  2ECZ A;  2QAZ A;  4M78 C;  2PVD B;  2L3S A;  3PMT A;  2EJF A;  5FRO A;  3HFZ A;  3CC2 Q;  2Q7G A;  1VQ6 T;  3D7S B;  2MPX C;  5KNN A;  2DD4 A;  1LJO A;  3MET A;  2C06 A;  2HMA A;  3MQZ A;  3ULR B;  3VUZ A;  2DIQ A;  2B8A A;  4O2D A;  4Q15 A;  1KK7 A;  4JJD A;  1NJ5 A;  4ELZ C;  4IIO A;  2K3B A;  1B8A A;  4AFZ C;  2EQI A;  3QO8 A;  1UGS B;  4YRL A;  2GFA A;  1Y57 A;  3A8H B;  1JXM A;  3H8Z A;  3CC2 T;  4EMH A;  2MI6 A;  1IB8 A;  2DIL A;  1LNX A;  1VQ4 Q;  4Z02 A;  1VQL A;  4M77 B;  2W10 A;  2NUT B;  4C8Q E;  1RAF B;  1Y07 A;  4OGC A;  4P3N A;  2FHD A;  2LJ0 A;  2DXB A;  4H2X B;  3UH0 A;  2LQW A;  1WHJ A;  5F5W A;  4YCW A;  4M75 A;  1VQM Q;  1KQ1 A;  1OZ2 A;  2KNB B;  2KT1 A;  1MMA A;  1YGB A;  4YRS A;  4ZN1 A;  2VYT A;  1JB0 E;  3BDU A;  2DAQ A;  1G2B A;  3P8H A;  4N0A C;  1YBY A;  2DLP A;  2PNI A;  1NNH A;  3CCL T;  4DQ2 A;  1K9M C;  5GAN f;  1JXO A;  1M2O A;  1ZUU A;  1WPY A;  5CAI A;  3MHX A;  2J6F A;  1Q95 G;  4RUG A;  4N0A A;  4PJO B;  5I2S A;  5GAN 2;  1VQP A;  1OEB A;  1BKB A;  1KD1 C;  1VIE A;  1GFC A;  2ALY A;  4BD3 A;  3I56 A;  7AT1 B;  3CMA T;  3OYA A;  4ZGD B;  1VQ8 Q;  4HT4 A;  3CEY A;  3M0U A;  3I55 T;  2PUK B;  3HXW A;  1G3Y A;  3CCL A;  3H0F A;  1D1A A;  2RHY A;  3QG1 A;  4BI8 B;  4C92 G;  2CH4 A;  2HL5 C;  3HRU A;  5GAO n;  3CCL Q;  4LDX A;  2XDD A;  3JSC A;  2CZ6 B;  3EFO B;  3QSU A;  4TVA A;  2GFU A;  2HD0 A;  3FEO A;  3CC4 Q;  4UP7 A;  2MCN A;  1B76 A;  3CXC A;  2KYM A;  4KBM B;  3RKY A;  1AWO A;  4M7A G;  3PVL A;  2EFI A;  3JCM J;  4G85 A;  2YUO A;  2FZC B;  2L3P A;  1YCS B;  1EFW A;  4RTV A;  3G71 Q;  3I55 Q;  5GAN d;  1X6G A;  4PG3 A;  4DBH A;  1VQ6 Q;  1P92 A;  3OBW A;  5C51 B;  2L89 A;  4Q6G A;  5A0L A;  3UF4 A;  3QKJ A;  3H41 A;  1M3C A;  3OYN A;  3C95 A;  5LJ3 g;  4OVA A;  1WQW A;  1LYL A;  2KXC A;  2MF2 A;  1M30 A;  4H2T A;  2NLU A;  4P3O A;  3HXU A;  2QGG A;  4BE2 A;  4LNP A;  1KFZ A;  5KE3 A;  1GBQ A;  2ZZE A;  2AKK A;  2E3C A;  4KH0 B;  2CZ1 B;  1H92 A;  4YYE A;  2XID A;  3M9Q A;  2A3L A;  2AKL A;  2O31 A;  3OYH A;  5GAO r;  4ELY C;  1YFN A;  2QTV A;  1D0Z A;  4LVI A;  4H2S A;  1TXQ A;  2LQK A;  4JJC A;  1MV0 B;  3M59 A;  3NEN A;  1PM3 A;  5GAN j;  4XTU A;  1IO6 A;  2CJB A;  3MEA A;  4F7U B;  2RJD A;  5HCK A;  1M1K C;  1H4T A;  1YFT A;  2J6O A;  2CT3 A;  1X6B A;  1MNE A;  1RI9 A;  2K79 A;  3TCJ A;  2RB6 A;  5CKH A;  3JRZ A;  3CC7 T;  2DA9 A;  1E24 A;  4M75 D;  4C92 D;  4PK4 A;  2LZ6 B;  5DLO A;  2L0A A;  1UGQ B;  3OYY A;  4F14 A;  2ZT5 A;  2NUP B;  4QVZ A;  3M0S A;  3RL6 A;  4E7K A;  1FMW A;  2RHQ A;  3PCO B;  2RJC A;  1I4K 1;  2RQV A;  1RIQ A;  3RAC A;  1X27 A;  3NPF A;  3O8V A;  3CCS A;  1BK2 A;  3JCM e;  1X2Q A;  4PFO A;  1BB9 A;  2KVQ G;  1KMN A;  4P5N A;  2D6F A;  1EIF A;  2KT8 A;  2CKK A;  1J3T A;  5J3B A;  2A28 A;  3OYL A;  4HWO A;  4P72 A;  3A31 A;  4M75 E;  4C92 C;  2CT4 A;  4M75 F;  1BU1 A;  4P71 C;  2ED0 A;  4RTU A;  1NLO C;  3CPW A;  3HRK A;  2QYZ A;  3EG0 A;  3CXC S;  4MMK A;  4PJO G;  2DKG A;  2DL8 A;  4FYY B;  5I21 A;  2KI7 A;  3UWN A;  1SRY A;  2QK0 A;  1C0A A;  3DKM A;  4EMK B;  2JTM A;  2DL7 A;  2OTL A;  2CUB A;  2NUZ A;  4X9D A;  2ZIM A;  5K1P A;  2LNH B;  2FG0 A;  3NFC A;  5CKD A;  4LN2 A;  3SD4 A;  1QVF S;  1X54 A;  2RN8 A;  4ZGE B;  2K5I A;  5GAM e;  2JTF A;  4YRM A;  1WHM A;  4M7A C;  3CCU T;  2IPO B;  5C52 B;  1VIF A;  3M54 A;  4MDW A;  3HXZ A;  2EYQ A;  3E9F A;  3LLR A;  4R56 A;  3OBY A;  4LDU A;  1E1T A;  2QTX A;  4OB2 B;  4PJO D;  1S72 T;  1O75 A;  2RHU A;  1B7Y A;  1YIT T;  2LT4 A;  1G83 A;  1B3Q A;  2EGE A;  2VAS A;  2LT1 A;  3OW2 S;  1N9W A;  2ZAE A;  1UTI A;  3J81 E;  1I8F A;  4LVJ A;  2QQS A;  2F5T X;  3M58 A;  3EH1 A;  1Q7Y R;  1UHF A;  2YRC A;  1RLQ C;  5EC7 A;  4HWR A;  2QG9 B;  2IG0 A;  1RUW A;  1TUC A;  5D6X A;  1S72 A;  1VQN Q;  4II1 A;  2XTI A;  1S72 Q;  1K9A A;  1VQ5 T;  3NHN A;  1TG0 A;  1IGQ A;  2DYB A;  1K76 A;  2QEX T;  1K0S A;  2RM4 A;  2QXF A;  2HAX A;  3OYI A;  5GAO p;  2VB6 A;  2RI3 A;  4WJ4 A;  2AKW B;  4ZN3 A;  2CP2 A;  2HKQ B;  2MWP A;  4H2X A;  4LE9 A;  4FYW B;  2W0Z A;  2LVM A;  2ZT7 A;  2ZXF A;  5GMK e;  3CME A;  1W2B P;  4LVM A;  2JNG A;  5I2M A;  3UAT A;  2V8J A;  4BI3 A;  5CQX A;  1ACM B;  3OS5 A;  4M77 D;  1IHV A;  3TU4 K;  1TH7 A;  3L2Q A;  1AVZ C;  3PVQ A;  1JJC A;  2Q5I A;  4XU1 A;  1KC8 R;  2ZR3 A;  5GAN 5;  4UP8 A;  4YRE A;  2L5Q A;  2PME A;  1G3T A;  4J6Y A;  3CCV Q;  3VS2 A;  3CCJ Q;  1UEC A;  3REA B;  4RTY A;  1OYX A;  3UGT A;  2ZT6 A;  4DPG A;  2XHC A;  3RR6 A;  2OI3 A;  4OMN A;  4XTV A;  4RQE A;  5KYY A;  4DBQ A;  1NPP A;  3V8L A;  2LX7 A;  3PE0 A;  2ZR2 A;  1K73 C;  4G84 A;  3DLL A;  2EWN A;  1Q81 R;  1KQS S;  1E6G A;  2CDT A;  2WSC E;  2RK1 A;  3A5Y A;  1MMG A;  1VQ8 A;  2ZT8 A;  1D1B A;  1FWZ A;  4NL2 A;  3PTA A;  2EYW A;  1OU9 A;  2ENM A;  4KR3 A;  1RAH B;  2KRM A;  3HTR A;  1YJN A;  1KMM A;  1UEB A;  2M9U A;  2V8K A;  4M75 C;  1YJW Q;  4MZP A;  1QVF P;  2YUQ A;  2MMP A;  1YN8 A;  3A32 A;  4C8Q A;  1Q82 C;  1GCP A;  1KIK A;  1Z7M A;  1YI2 Q;  3BJU A;  1ABO A;  3LX7 A;  3A98 A;  3LGL A;  5KYN A;  4X5O A;  2AZS A;  3L42 A;  1UFF A;  1NJI C;  1WX6 A;  5IXF A;  2ZZG A;  1BI2 A;  1ZBJ A;  2KYB A;  2MOX A;  2XIC A;  4Z89 A;  2QHU A;  1D3B A;  1JJ2 S;  2EIF A;  2CP5 A;  1VYT A;  5A0G A;  2EYX A;  4VUB A;  3VUB A;  1AZE A;  4F7U F;  2QGF B;  1M5Q 1;  3M4P A;  1JJ2 P;  4XEO A;  4DEY A;  5C6S A;  2XI9 A;  4KT0 E;  1KQS A;  4X1V A;  4J6X A;  4KUI A;  5GMK j;  4F7U A;  3QWX X;  3PIP A;  5FU6 C;  3M0P A;  2DU5 A;  3OW2 P;  4M7D A;  4EIK A;  3A5Z B;  3CCR A;  3VRZ A;  2GQI A;  4PJL A;  2R58 A;  1S1N A;  2AIR B;  1PWT A;  2DU7 A;  2VUB A;  5LJ5 h;  4J8O A;  1BIB A;  4H2U A;  4AH6 A;  4D8D A; 
#chains in the Genus database with same CATH homology
 3WQZ A;  4J15 A;  2LQ8 A;  3HY0 A;  2JZ2 A;  3JB9 F;  5LJ3 d;  2XG8 D;  3OYG A;  5KCH A;  1BBW A;  1N27 A;  5GAN h;  3CMA A;  2E5A A;  3TEH A;  1QVG S;  4DOV A;  1VQP T;  3R6O A;  1JJ2 A;  4RDX A;  1BI1 A;  4CH3 A;  4TVA B;  3CC4 T;  1X55 A;  1IRE B;  1W2B S;  5KE2 A;  5GAO q;  3P8B B;  2ZPE B;  1Q81 C;  2C8M A;  3P8T A;  2EAY A;  1Z7N A;  1K8A C;  5CKF A;  2RK2 A;  3NTI A;  2ZZD A;  4TQF A;  1B7Y B;  3LWH A;  3FC3 A;  3NEL A;  1Q82 U;  4KR2 A;  3NTK A;  4BWA A;  4XTX A;  4FM4 B;  2RHI A;  2DTO A;  1WQ7 A;  1VQL T;  2A8E A;  1NJI U;  1BI0 A;  4E47 A;  4P75 C;  3ME9 A;  3JB9 J;  1NZ9 A;  3WVE B;  1QVP A;  3CBM A;  1B70 A;  4ZTZ B;  3S3N A;  4JRI A;  4P75 A;  2DXU A;  4C0G A;  5GMK m;  4QW2 A;  2YHT A;  2G4C A;  2ZPG B;  3BFM A;  3QTC A;  2C7I A;  4QQD A;  3X24 B;  3CME T;  3MO8 A;  1VQK T;  4UC4 A;  3HXX A;  1N9R A;  5GAM f;  3N5B B;  4BUG A;  3OSV A;  1VQ6 A;  4M78 A;  3GIB A;  1V29 B;  2ZIN A;  3FIF A;  2ZPH B;  3VU3 C;  4PHC A;  5DM7 R;  1ATI A;  3QZ9 B;  1ZQ1 A;  2QQB A;  2RHS B;  4B9X A;  5KCO A;  1PSF A;  5C53 B;  4NL3 A;  2ZCF B;  3X26 B;  5GAN 4;  4OB3 B;  5GMK h;  2CJ9 A;  3FJP A;  2E70 A;  2WSE E;  1BBU A;  3LYI A;  4E7I A;  2X4J A;  1YIJ A;  3M57 A;  1RL2 A;  3GP8 A;  4TVW A;  1VQ7 T;  4HVC A;  3A8L B;  2ODR D;  1M90 U;  3VV0 A;  4EO4 A;  1X2G A;  2J3M A;  5LJ5 j;  4M7D F;  1UB4 A;  5AYF A;  2EJG A;  3VQW A;  1PYS B;  3NTH A;  2E12 A;  2KAF A;  3DB4 A;  3A8O B;  1JJC B;  4YRG A;  3E1S A;  4UPA A;  4XTW A;  3OYE A;  1XQH A;  3G4S A;  2ZPB B;  4FT2 A;  3J80 E;  3L2U A;  3OYD A;  4YRR A;  5FU7 C;  3OSS C;  4M7A E;  2LDM A;  4M75 B;  3KBG A;  1PYS A;  4F7U G;  3G71 A;  2XGT A;  3GNG A;  4EPC A;  2RD1 A;  3CCS T;  2XDP A;  3CCQ T;  1EVL A;  2K57 A;  4HCB A;  3QZ5 B;  2BUD A;  2YLC A;  3JCM g;  1K73 U;  3H6Z A;  2LRQ A;  3A5Z A;  4P73 C;  1ADJ A;  4LDW A;  3RKW A;  4CRI A;  3HRI A;  2M0O A;  4HWT A;  4A4H A;  1MHN A;  2Q7H A;  4YRK A;  2E5Q A;  3OYJ A;  2M1H A;  5GAM g;  3QYH B;  3RUX A;  2EQJ A;  3JCM c;  1NJ2 A;  4WJ3 M;  1SET A;  3QPH A;  2QHS A;  3A7U A;  3QO5 A;  2DO3 A;  5GAN 6;  4IKF A;  2X4Y A;  3OMG A;  2ODR C;  3HXY A;  2ZGW A;  3TEH B;  2PVO B;  2R57 A;  4OF1 A;  2GCX A;  4JRQ A;  3HRS A;  1KHI A;  3PFS A;  4JS5 A;  2DVE A;  5HK0 A;  3IKM B;  3CCJ T;  2CS7 A;  4V2S A;  3IG2 A;  3OA6 A;  1G5I A;  1G5V A;  2ZNJ A;  1FXX A;  3EFR A;  3JCM Q;  1OI1 A;  4YDQ A;  3JCM f;  2ZPI B;  4C92 F;  4M7D B;  3CCE T;  3E9G A;  4A4F A;  12AS A;  1Y71 A;  4YCU A;  4PLL A;  3ERR A;  4Y28 E;  3NET A;  2FL7 A;  3TEG A;  2DIG A;  4LNS A;  2O4X B;  2FB7 A;  2VC8 A;  1I5L A;  4A53 A;  3OB9 A;  2J3L A;  1VQ9 A;  2WAC A;  1M1F A;  2AMC B;  2YRV A;  3I55 A;  4PKC C;  4XU3 A;  2F5K A;  5A2Q E;  4C8Q D;  2LNV A;  5GAN e;  2LX9 A;  2YLB A;  4M78 B;  4E7L A;  3RIR A;  2JUF A;  4PJO C;  4FU6 A;  1EVK A;  3KXT A;  4BDY A;  3JCM d;  1X2H A;  1SSF A;  3HFN A;  4C8Q B;  4TQD A;  2IY5 B;  1HTT A;  1W66 A;  4N4I A;  4M78 D;  2GF7 A;  3QBY A;  3OS2 A;  1G3S A;  2KMT A;  1IL2 A;  4C0F A;  2CZ7 B;  1BYM A;  3QUI A;  3JCM b;  2JOY A;  3OYM A;  2HNI A;  4JUV A;  1JBM A;  2E64 A;  2R5M A;  3I7F A;  4N4G A;  4MML A;  3M4Y A;  4JJN K;  4L6V 5;  3OS1 A;  4LDV A;  4M77 C;  5GAN 8;  4M7D G;  1BIA A;  3C94 A;  3GLX A;  2XK0 A;  2LCC A;  5CKE A;  2XD0 A;  4A4G A;  3DSQ A;  3VJP A;  4JDS A;  2D0Q B;  3P8V A;  4J6W A;  3LSQ A;  5FU6 B;  2AHJ B;  3CCQ A;  2F69 A;  4IUU A;  2PMF A;  3SFM A;  5K1X A;  1ADY A;  1Q7Y C;  1USY A;  3CBP A;  3HSB A;  3RMS A;  3QJ6 A;  2Y4Y A;  4QQG A;  3OQ5 A;  5CIU A;  5DLQ E;  4RCB A;  4PJO F;  4PLI A;  3HFO A;  3A74 A;  3URG A;  1VQO A;  1H4V B;  2DZC A;  2R5A A;  3G4S T;  1K9M U;  3L4G A;  3RGL A;  3Q1J A;  4BB7 A;  3LSS A;  4IUR A;  1Q81 U;  3WXM B;  2DXC A;  3QJY A;  2X4X A;  4PNO A;  4BY6 B;  1UGP B;  2QA4 A;  1GGM A;  1QE0 A;  4YRF A;  3F70 A;  4CS3 A;  4XEM A;  5FLX E;  4BAC A;  1M90 C;  2XKO C;  3V7S A;  4OP0 A;  4M77 F;  3L4G B;  1NJ1 A;  3QDR B;  2PVG B;  1VQ7 A;  4TVY A;  2K2V A;  1E1O A;  2QQ9 A;  3JAM E;  4L59 A;  1WLE A;  1G5H A;  3V7C A;  3C12 A;  2DTH A;  4K87 A;  4CS4 A;  3HPW A;  3VYG A;  3CD6 T;  4C5G A;  2O4X A;  2K3Y A;  4K86 A;  1YFS A;  1YI2 T;  3RES A;  2JVV A;  3MF2 A;  3PMI A;  3C4S A;  2O01 E;  2RHS A;  3QO7 A;  4M77 E;  1VQO T;  2Q5H A;  2G3R A;  1QVG A;  2PUO B;  3MCA B;  3PZC A;  4R55 A;  5J39 A;  4P3P A;  3VKI A;  2EKO A;  4C8Q G;  3MEW A;  1YJW A;  4HWS A;  4C92 B;  4XU0 A;  5GAM j;  3SB2 A;  1H4Q A;  1XTD A;  4L87 A;  1HC7 A;  1QP2 A;  1L0W A;  1U8R A;  3A7R A;  2FYK A;  1M4Z A;  3JCM h;  4EDU A;  1B34 B;  4HCC A;  4X34 A;  4BW9 A;  2RHQ B;  3PCO A;  1SER A;  4C92 A;  4A4K A;  4BI4 A;  3OYF A;  4OMF B;  1X6O A;  1M9S A;  1WJR A;  5A0D A;  4K88 A;  4M7D C;  4P74 A;  3CCV A;  4ZIB A;  3JB9 G;  4MDX A;  5L8R E;  5GMK i;  3DB3 A;  4KUL A;  3SDZ A;  3ZFJ A;  3MP8 A;  2L3R A;  2GQV A;  1N6A A;  4ZTF A;  1YJ9 A;  2FVU A;  1WU7 A;  3G7Z A;  4NCX A;  3HKS A;  2CZ0 B;  4HCZ A;  3QO3 A;  3CBO A;  3HY1 A;  3EFS A;  1VQN A;  2P0K A;  4QVC A;  1NJ8 A;  2I4O A;  3QNE A;  3OW2 A;  4HT9 A;  1EOV A;  1KOG A;  4PJO A;  4TVR A;  3L2W A;  3M56 A;  5LJ5 f;  3G1Z A;  2HBP A;  1Y96 B;  4E51 A;  3M55 A;  2CIM A;  3R07 A;  4NS5 A;  5IN1 A;  2K3X A;  4EMK C;  2I2L A;  3M53 A;  1H4S A;  1U1S A;  4PJO E;  1MGQ A;  2H3J A;  2QHV A;  4JS4 A;  3SWN B;  4LDY A;  1WJQ A;  3T9N A;  4EMG A;  1N8R U;  3CPF A;  2QI2 A;  3PGG A;  2I4M A;  1EQR A;  3OYC A;  1VQM T;  4YPF A;  1NJ6 A;  1QVF A;  3UFG A;  2WSF E;  4JLG A;  3REU A;  5LJ5 d;  3OD1 A;  5HKC A;  4NOY A;  3G6E A;  3M4Q A;  2VXF A;  3G6E T;  3ZEH A;  2EQM A;  5LJ3 j;  3S6W A;  4C92 E;  4XK8 E;  4YCV A;  5GAN 7;  5GAO m;  3UGQ A;  4FIB A;  2DK3 A;  3RMQ A;  2CGH A;  5HY6 A;  2ZZF A;  2IVW A;  1WNL A;  4XTZ A;  3MEY A;  5CKB A;  3QII A;  5HK3 A;  3RER A;  5ELO A;  1U1T A;  1GXI E;  1VQ8 T;  4O5V A;  3A8G B;  4XQ3 A;  2EJ9 A;  3VQV A;  2JN0 A;  3HP9 A;  2KQW A;  3A8M B;  3LGF A;  4D6W A;  4M77 A;  2I4L A;  3OS0 A;  1WGS A;  1W2B A;  2RJF A;  2M16 A;  2P5I A;  5LJ3 f;  1B70 B;  2P0P A;  4WF2 A;  4GLK A;  5LJ3 h;  4UP9 A;  4BDZ A;  1NYQ A;  4YRO A;  2RJE A;  1PSE A;  3G71 T;  3PIO A;  4YRT A;  1DJ7 B;  2EQK A;  1IZ6 A;  3X25 B;  4C0D B;  3OYK A;  3TEE A;  1D3B B;  4YRI A;  2BIV A;  4ZGJ B;  2LCL A;  2DEQ A;  4C8Q F;  11AS A;  1VQN T;  2VGM A;  3MP1 A;  2MAM A;  1BI3 A;  2CYZ B;  3TUP A;  1QP3 A;  4X9C A;  3X28 B;  3INZ A;  4YRC A;  3QYG B;  3NEM A;  2A7Y A;  2LC4 A;  1YJ9 T;  1QW1 A;  2E65 A;  1SES A;  2ARU A;  5HGQ A;  1ASY A;  4GY5 A;  3GNF B;  4YRP A;  3GOX A;  2IY5 A;  2QEX A;  1VQ4 A;  2DTI A;  5LJ5 e;  4ME7 A;  2QDY B;  1H64 1;  4JLI A;  1I81 A;  3LC0 A;  3VYH B;  1FX7 A;  5GAN 3;  4LVK A;  2RA2 A;  3FRN A;  3OY9 A;  4OB1 B;  3JCM W;  1YIJ T;  5IAY A;  3PNW C;  3KFU A;  3HXV A;  2RO0 A;  4P74 C;  1J5W A;  4FSX A;  3WVD B;  2RI2 A;  4YRQ A;  3GF5 A;  5GAM d;  3PT9 A;  1Y7X A;  5GMK l;  1OZ3 A;  1YHQ T;  4J5Y A;  3W3S A;  3REX A;  2E1H A;  3HFV A;  4IUP A;  1XOV A;  2CJA A;  1Q7Y U;  3CCU A;  1N9S A;  3MEU A;  4M78 F;  2P0Q A;  4DOW A;  4RCC A;  2PU9 B;  5EG2 A;  4WI1 A;  3KUF A;  3HHT B;  4H02 A;  1RI0 A;  2PQW A;  1YHQ A;  1VQK A;  1YI2 A;  3QHS A;  4FL6 A;  1M8V A;  1KQ2 A;  2VXE A;  4HA8 A;  3CD6 A;  2XU8 A;  1YB3 A;  4OB0 B;  1ZHI A;  3BW1 A;  4C0D C;  3DLM A;  5FRM A;  2E41 A;  1WJS A;  4PL6 A;  2ARS A;  3EAE A;  2K5L A;  3P8Y A;  4M7A A;  3M4G A;  3JB9 D;  4P73 A;  1VQ4 T;  1YFR A;  3LH0 A;  1G3W A;  2Q7E A;  1KG1 A;  1G51 A;  4CH5 A;  1NPR A;  4LVL A;  1KC8 U;  4JRK A;  4QQ6 A;  2K4Y A;  4JRP A;  5CVI A;  5LL6 S;  3FLG A;  3CC4 A;  3FDR A;  4KUD K;  1K8A U;  2DJZ A;  1USY C;  1KD1 U;  4M75 G;  4Q5W A;  4ZTJ A;  4C5E A;  4Y91 A;  4MZM A;  4KQE A;  3ASK A;  1O9S A;  2KSS A;  2VV5 A;  2K5F A;  4OGE A;  4OLF A;  4LD9 K;  1M1G A;  4CI0 C;  2BKD N;  4H2Y A;  4YRN A;  3LWI A;  4IUQ A;  3CCR T;  3TRE A;  1FYF A;  4C5H A;  2D9T A;  3FB9 A;  1B34 A;  1AHJ B;  3V8J A;  4E7J A;  2RHZ A;  2DPP B;  4QVD A;  2DQ0 A;  3E19 A;  4N4H A;  4A54 A;  2HQE A;  2DZ9 A;  3IKL A;  4TTV A;  1XNI A;  5IT9 E;  4DA4 A;  4RMO A;  4XTY A;  3MF1 A;  4A4E A;  3RF1 A;  1NE8 A;  2RH2 A;  3OMC A;  5DY9 A;  1VUB A;  4XU2 A;  3JB9 H;  3UT1 A;  5D6Y A;  4E7H A;  1EIY B;  3JCM X;  3I56 T;  3MP6 A;  3X20 B;  4C0Z A;  2QHT A;  3SWN A;  4RG8 A;  4J7I A;  2L8D A;  1KC8 C;  3L2V A;  4C8Q C;  1M1K U;  1VQM A;  3QXE B;  4C5I A;  1YJN T;  3AHU A;  5D6W A;  2E6N A;  2XDB A;  1X01 A;  2P4T A;  1VQ9 T;  3ZBD A;  4YTL A;  4HKE A;  1HK9 A;  3JCM V;  2E6Z A;  4HWP A;  2DXT A;  4P71 A;  1JRI A;  4RG2 A;  2VGN A;  2EL9 A;  4M7D D;  2HQX A;  2Y4X A;  3CCE A;  1Q86 C;  4CH4 A;  3M5A A;  1N8R C;  4J83 A;  4ATO A;  2V8I A;  1Y96 A;  3CC2 A;  3CCJ A;  1X75 C;  3OYB A;  2AKW A;  3V8K A;  5M9O A;  2QQA A;  2ZNI A;  3HRT A;  2Y90 A;  5FRN A;  1ZBX A;  4M78 G;  4L5G A;  4CS2 A;  2QQR A;  1EIY A;  4MZT A;  5KH6 A;  4M7D E;  5CCA A;  2ZPF B;  5C0M A;  4LD6 A;  4ZTU B;  4F7U E;  2ALY B;  4P72 C;  5FU7 B;  4H2V A;  3S3O A;  3LW5 E;  3HFZ B;  4RMF A;  3GPL A;  5CK9 A;  4FT4 A;  2KY9 A;  2MWO A;  2I4N A;  2OTJ T;  4HT8 A;  5E3I A;  5CQY A;  1X56 A;  4CH6 A;  1VQ5 A;  3CCV T;  3CCM A;  2P0L A;  2ZCE A;  1VQZ A;  3S3M A;  1UGR B;  4EX5 A;  2OAU A;  4IUV A;  3JCM P;  4M7A F;  5CO7 A;  4M78 E;  4YRJ A;  1E22 A;  4M7A B;  2DDZ A;  5CR2 A;  2EQU A;  5ELN A;  4EMK A;  3RKX A;  1W4S A;  1KHC A;  1YIT A;  2LTO A;  3CMQ A;  2X35 A;  1LOJ A;  3IAL A;  3MEV A;  4XAX B;  4M7A D;  1YJW T;  1QF6 A;  1H3Z A;  5J26 A;  2NS6 A;  3L2Z A;  4BE1 A;  2AMC A;  3HTZ A;  2X4W A;  1ASZ A;  3L2R A;  2ART A;  2RHX A;  2DD5 A;  1Q86 U;  3V7R A;  2E10 A;  2ZTG A;  2OTL T;  1YCY A;  1R8O B;  3A7A A;  1WYD A;  4O6J A;  4B9W A;  4BE0 A;  4IUT A;  4RKU E;  5LJ5 g;  3ER0 A;  2KDS A;  3VQY A;  1NYR A;  3P8D A;  4M77 G;  3CPW S;  3L1A A;  4J7F A;  3BY7 A;  5LJ3 e;  4RQF A;  3UDC A;  3JB9 I;  5GAN g;  1HXD A;  3J7A F;  4H2W A;  3ICA A;  2KK4 A;  4TWA A;  2QA4 T;  4BY6 C;  3VQX A;  3UPU A;  3VBB A;  3E9H A;  2ZIO A;  3CC7 A;  3E9I A;  2RI5 A;  4YP0 A;  3CCM T;  5GAM h;  5GAO l;  2DQ3 A;  3BDL A;  2OTJ A;  3SWN C;  3HL8 A;  4M78 C;  2PVD B;  3PMT A;  2EJF A;  3HFZ A;  5FRO A;  2Q7G A;  1VQ6 T;  5KNN A;  2DD4 A;  1LJO A;  3MET A;  2C06 A;  3MQZ A;  3VUZ A;  2DIQ A;  2B8A A;  4O2D A;  4Q15 A;  1NJ5 A;  4ELZ C;  1B8A A;  3QO8 A;  1UGS B;  4YRL A;  2GFA A;  3A8H B;  3H8Z A;  3CC2 T;  4EMH A;  2MI6 A;  1LNX A;  4Z02 A;  1VQL A;  4M77 B;  4C8Q E;  1Y07 A;  4OGC A;  4P3N A;  2FHD A;  2DXB A;  4H2X B;  3UH0 A;  5F5W A;  4YCW A;  4M75 A;  1KQ1 A;  1OZ2 A;  1YGB A;  4YRS A;  4ZN1 A;  2VYT A;  1JB0 E;  3BDU A;  2DAQ A;  3P8H A;  4N0A C;  1YBY A;  1NNH A;  3CCL T;  4DQ2 A;  1K9M C;  5GAN f;  1WPY A;  5CAI A;  3MHX A;  4N0A A;  4PJO B;  5I2S A;  5GAN 2;  1VQP A;  1BKB A;  1KD1 C;  1VIE A;  2ALY A;  4BD3 A;  3I56 A;  3CMA T;  3OYA A;  4ZGD B;  4HT4 A;  3CEY A;  3I55 T;  2PUK B;  3HXW A;  1G3Y A;  3CCL A;  2RHY A;  3QG1 A;  4BI8 B;  4C92 G;  3HRU A;  5GAO n;  4LDX A;  2XDD A;  3JSC A;  2CZ6 B;  3QSU A;  4TVA A;  2GFU A;  2HD0 A;  3FEO A;  4UP7 A;  1B76 A;  3CXC A;  4KBM B;  3RKY A;  4M7A G;  3JCM J;  2EFI A;  4G85 A;  1EFW A;  5GAN d;  4PG3 A;  1P92 A;  3OBW A;  5C51 B;  2L89 A;  4Q6G A;  5A0L A;  3QKJ A;  3OYN A;  3C95 A;  5LJ3 g;  4OVA A;  1WQW A;  1LYL A;  2MF2 A;  4H2T A;  2NLU A;  4P3O A;  3HXU A;  4BE2 A;  5KE3 A;  2ZZE A;  2E3C A;  2CZ1 B;  4YYE A;  2XID A;  3M9Q A;  2A3L A;  3OYH A;  5GAO r;  4ELY C;  4LVI A;  4H2S A;  2LQK A;  3M59 A;  3NEN A;  5GAN j;  4XTU A;  2CJB A;  3MEA A;  4F7U B;  2RJD A;  1M1K C;  1H4T A;  1YFT A;  3TCJ A;  2RB6 A;  5CKH A;  3JRZ A;  3CC7 T;  1E24 A;  4M75 D;  4C92 D;  5DLO A;  1UGQ B;  3OYY A;  2ZT5 A;  4QVZ A;  3RL6 A;  4E7K A;  2RHQ A;  3PCO B;  2RJC A;  1I4K 1;  1RIQ A;  3RAC A;  3O8V A;  3CCS A;  3JCM e;  2KVQ G;  1KMN A;  4P5N A;  2D6F A;  1EIF A;  2CKK A;  5J3B A;  3OYL A;  4HWO A;  4P72 A;  3A31 A;  4M75 E;  4C92 C;  4M75 F;  4P71 C;  3CPW A;  3HRK A;  3CXC S;  4MMK A;  4PJO G;  2DKG A;  5I21 A;  1SRY A;  3UWN A;  1C0A A;  3DKM A;  4EMK B;  2JTM A;  2OTL A;  4X9D A;  2ZIM A;  5K1P A;  3NFC A;  5CKD A;  3SD4 A;  1QVF S;  1X54 A;  4ZGE B;  2K5I A;  5GAM e;  2JTF A;  4YRM A;  4M7A C;  3CCU T;  5C52 B;  1VIF A;  3M54 A;  4MDW A;  3HXZ A;  2EYQ A;  3E9F A;  3LLR A;  4R56 A;  3OBY A;  4LDU A;  1E1T A;  2QTX A;  4OB2 B;  4PJO D;  1S72 T;  1O75 A;  2RHU A;  1B7Y A;  1YIT T;  2LT4 A;  2LT1 A;  3OW2 S;  1N9W A;  3J81 E;  1I8F A;  4LVJ A;  2QQS A;  2F5T X;  3M58 A;  4HWR A;  2IG0 A;  5D6X A;  1S72 A;  4II1 A;  2XTI A;  1VQ5 T;  2QEX T;  2RM4 A;  2QXF A;  2HAX A;  3OYI A;  5GAO p;  2RI3 A;  4WJ4 A;  2AKW B;  4ZN3 A;  2MWP A;  4H2X A;  2LVM A;  2ZT7 A;  2ZXF A;  5GMK e;  3CME A;  4LVM A;  2JNG A;  5I2M A;  2V8J A;  4BI3 A;  5CQX A;  3OS5 A;  4M77 D;  3TU4 K;  1TH7 A;  3L2Q A;  1JJC A;  2Q5I A;  4XU1 A;  2ZR3 A;  5GAN 5;  4UP8 A;  4YRE A;  2L5Q A;  2PME A;  1G3T A;  4J6Y A;  1OYX A;  3UGT A;  2ZT6 A;  4DPG A;  2XHC A;  4XTV A;  4RQE A;  1NPP A;  3V8L A;  2ZR2 A;  1K73 C;  4G84 A;  3DLL A;  2EWN A;  1KQS S;  2WSC E;  2RK1 A;  3A5Y A;  1VQ8 A;  2ZT8 A;  1FWZ A;  4NL2 A;  3PTA A;  4KR3 A;  1YJN A;  1KMM A;  1UEB A;  2M9U A;  2V8K A;  4M75 C;  4MZP A;  2MMP A;  3A32 A;  4C8Q A;  1Q82 C;  1Z7M A;  3BJU A;  3LX7 A;  3LGL A;  4X5O A;  3L42 A;  1NJI C;  2ZZG A;  1BI2 A;  2XIC A;  2QHU A;  1JJ2 S;  1D3B A;  2EIF A;  5A0G A;  4VUB A;  3VUB A;  4F7U F;  1M5Q 1;  3M4P A;  4XEO A;  5C6S A;  2XI9 A;  4KT0 E;  1KQS A;  4J6X A;  4KUI A;  5GMK j;  4F7U A;  3PIP A;  5FU6 C;  2DU5 A;  4M7D A;  3A5Z B;  3CCR A;  2R58 A;  2DU7 A;  2VUB A;  5LJ5 h;  4J8O A;  1BIB A;  4H2U A;  4AH6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...