1WR2A

Crystal structure of ph1788 from pyrococcus horikoshii ot3
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
237
structure length
235
Chain Sequence
b'MKEEAVRVIEEVLKQGRTAMVEYEAKQVLKAYGLPVPEEKLAKTLDEALEYAKEIGYPVVLKLMSPQILHKSDAKVVMLNIKNEEELKKKWEEIHENAKKYRPDAEILGVLVAPMLKPGREVIIGVTEDPQFGHAIMFGLGGIFVEILKDVTFRLVPITEKDARKMIQEIKAYPILAGAEEPADIDAIVDMLLKVSKLVDDLKDYIKEMDLNPVFVYNKGEGAVIVDSRIILKPK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords hypothetical protein PH1789
publication title Crystal structure of PH1788 from Pyrococcus horikoshii Ot3
rcsb
source organism Pyrococcus horikoshii
molecule tags Structural genomics, unknown function
total genus 70
structure length 235
sequence length 237
ec nomenclature
pdb deposition date 2004-10-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13549 ATP-grasp_5 ATP-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.470.20 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 ATP-grasp fold, B domain 1wr2A01
3.30.1490.20 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 ATP-grasp fold, A domain 1wr2A02
4ZHQF 2R82A 2W6ZA 1GSOA 4YAKB 4L1KA 3TQTA 2R87A 1E4EA 4O7WA 2R7LA 4O82A 1BNCA 2SCUB 1C30A 2NU8B 1W93A 1C3OA 2YZMA 5KX5F 4MAMA 2IP4A 1EZ1A 1JKJB 4NYEA 1GSHA 5JVDF 2R7MA 1SCUB 3HBLA 4O7RA 1CS0A 3U54A 4XYLB 4TV9F 4FFNA 4IIJF 4HNTA 1IOWA 5CB4F 3K3PA 4O4LF 4FU0A 3U55A 4MV6A 4HQ6A 1B6SA 5CA1F 3HB9A 3LP8A 5HBRB 2I87A 3R5XA 5H80A 2CNVA 5BPHA 1M6VA 2YZNA 4EGJA 4HR7A 3KREA 3VPDA 5GONF 5BPFA 1CQIB 2FPPB 4MA0A 2CNQA 3LWBA 4MA5A 2OLSA 4O2AF 4O7YA 4I4TF 5C1PA 1M0TA 1KC7A 2YZLA 1OBGA 2NUAB 3Q1KA 4WBNF 2R7KA 2W6PA 4XX0B 3R9RA 4HNUA 1DV2A 4EGQA 4IWYA 3TW6A 3QFFA 3VOTA 5JQWA 1CE8A 1VBGA 1JLLB 5J2UF 2CZGA 4MV7A 2C00A 1AUVA 1E4EB 1JDBB 4I50F 4ZI7F 2VR1A 4EG0A 1OBDA 1M0WA 3G8DA 5HV6A 1KJ8A 3ETHA 4O81A 4O86A 2QF7A 5C8YF 5LYJF 3WNZA 1A9XA 2GQRA 2PVPA 4M9UA 4O7NA 2FB9A 4FGRA 4DIMA 4FFMA 3ORQA 3KALA 4O7ZA 4C5BA 1VBHA 4MV9A 3RV4A 3V4ZA 5JQGF 3RV3A 1JDEA 4IWXA 4O4JF 3MWEA 2DWCA 2V58A 4QSHA 2X0SA 1GLVA 1B6RA 5JVLA 2XD4A 1T36A 4XZ3B 3KAJA 1BXRA 5LA6F 2HGSA 1CQJB 2W70A 2YWVA 5EZYF 5C1OA 1UC8A 3TINA 3K5HA 4FFRA 1A48A 3TIGA 4YB8B 1EUDB 1KJQA 3RUPA 2HJWA 2FPIB 2R7NA 2CQYA 3ORRA 4YAJB 1GGOA 2ZDHA 4IHJF 2I8CA 4MV8A 4MV4A 1WR2A 4O83A 3RFCA 1KEEA 2W71A 3TIIA 5J2TF 3UFXB 1UC9A 2XCLA 2GPWA 4FFPA 2Z02A 3N8DA 4FFLA 2PBZA 3MWDA 4Y8VB 4C5CA 3V4SA 3OUZA 1KJ9A 2NU6B 1I7LA 3JRXA 1Z2PX 2R6FA 2R84A 3G8CA 1KBLA 1EYZA 3MJFA 2FP4B 1GSAA 4MV3A 4YJ2F 1KJJA 4O7LA 3SE7A 2R86A 2YS6A 5CA0F 2W6QA 5FNVF 3K5IA 5KKNB 2PN1A 4O7TA 5JH7F 3R5FA 4O7VA 4O84A 2J9GA 2VPQA 2W6OA 5IYZF 3Q2OA 1Z2NX 3DF7A 4WD3A 1DIKA 3ETJA 4ME6A 3WO1A 1VKZA 2YW2A 5LOVF 1I7NA 2YZGA 3BG5A 4TV8F 2FPGB 4E4TA 1KJIA 2QK4A 4O2BF 3N6RA 2CNUA 3VPBA 3JZIA 5D8DA 4FE2A 2YRXA 4TUYF 2GLTA 2WYOA 2VQDA 3JZFA 1KUTA 4YJ3F 3I12A 3KAKA 1PX2A 4MV1A 1ULZA 2V59A 2V5AA 2W6MA 1Z2OX 5LP6F 1AUXA 2NU9B 2P0AA 1EUCB 2GQSA 4IZOA 1W96A 5CAEB 4O4HF 5BMVF 4FFOA 2ZDGA 2Z04A 2GPSA 3E5NA 4I55F 2ZDQA 3NUAA 2R85A 3VPCA 3GLKA 3R23A 3GIDA 5K2MA 3U9SA 4O4IF 4ZQIA 4ZOLF 5I47A 2YS7A 2YL2A 1DV1A 2I80A 4RZQA 4O7SA 3WO0A 3VA7A 2NU7B 2W6NA 2DZDA 3U9TA 3JRWA 3AW8A 2DIKA 4YBZB 1PK8A 3HO8A 2DLNA 1IOVA 2YRWA 4HNVA 5DMXA 2YYAA 3R5HA 4XYMB 3OUUA 3AX6A 4DLKA 1EHIA 5LXTF 4C5AA 3VMMA
chains in the Genus database with same CATH superfamily
1L2ZA 4ZHQF 4ECUA 4ED6A 2R82A 4RB3C 3M9NB 4DL4A 2W6ZA 1S0MA 1GSOA 4YAKB 4L1KA 1SEIA 3TQTA 1Y1VG 3T5JA 2R87A 1E4EA 4U7CA 3QQMA 4QWCA 3W5OA 2JEGA 1TWHA 3HOXG 2DPJA 1IYEA 4O7WA 5FPRA 2Q7DA 2R7LA 4O82A 2COGA 5LL6b 1BNCA 4F4ZA 2SCUB 5IYBG 4X64H 1C30A 1WRVA 5KFKA 3RAQA 2NU8B 1CKMA 1W93A 1C3OA 2YZMA 1BJTA 1S68A 2JA7A 5KX5F 2WAQA 1Y1WG 4UCRA 2UXBH 1HNWH 4MAMA 4TQRA 2IP4A 2UVWA 1EZ1A 4DL6A 3SGIA 1HNXH 3GTJA 1JKJB 3GV7B 3GTGA 3BACA 5KG3A 3MR3A 3PO3G 4DR1H 4NYEA 1GSHA 3G6XA 4JI0H 5JVDF 1HNZH 5KFZA 2WAQE 2W9CA 1IBMH 2R8JA 2XCPA 3UQ8A 2W9AA 4O3NA 5DQGA 4BXXG 1WH2A 2R7MA 1TA8A 4RUAA 5I5VA 4DR7H 1SCUB 3HBLA 4O7RA 1CS0A 3U54A 2O03A 3W1GA 4A93G 4O3PA 4JI4H 4AYBA 3J80W 2JEIA 2X5RA 5BWRA 5FD5A 2B63G 4JV5H 1ZHSA 4DV2H 4GC7A 3MR2A 3BA9A 4PZ8A 4CHIA 3KHHA 3OHAA 3MR5A 4XYLB 3I4NG 3CSWA 4R8UB 4TV9F 3RBDA 4FFNA 4IAJA 4AYBE 4RAZA 4LF4H 3JAMW 3SI8A 4IIJF 4HNTA 5KG7A 4QWEA 4Q0YA 1FKAH 1IOWA 3GQCA 2JEJA 1FJGH 3OSPA 5KFDA 5KFSA 3G6YA 2BQ3A 3NBYB 5CB4F 1B33N 4O3OA 3K3PA 3Q8PB 4JI1H 1EKPA 4LH6A 2HVRA 2ZGIA 4O4LF 2JA6A 5CE8A 4LFAH 4A3MG 3H40A 4FU0A 1J5EH 4LFCH 4A3GG 2RF4A 4MV6A 4HQ6A 2HG8A 1B6SA 4LH7A 3U55A 4OX9H 1R9TA 3IN5A 5CA1F 3HB9A 2UVUA 2JA5A 5KFMA 4EEYA 2FE3A 2R8HA 3BA8A 3QZ8A 1JX4A 1EKFA 3TW7A 4ECSA 1SYXB 2XCAA 4LMYA 2PMZA 2J6SA 4DR4H 3LP8A 4KHPH 3RGXA 3BQ2A 4DL7A 5HBRB 2I87A 2W9BB 3R5XA 5H80A 4YQWA 2CNVA 5C4XG 1N36H 5BPHA 1M6VA 5KFAA 2YZNA 5KFCA 4EGJA 5K3WA 5FLXW 3H0GA 4ECZA 4HR7A 4ED3A 4B3SH 5KT7A 5KFNA 3KREA 3VPDA 2RDJA 1V9PA 4BBSG 3GIKA 4ECWA 1TWGA 5GONF 5BPFA 5I5TA 5KS8A 5EWEA 1CQIB 2FPPB 4PWQA 3LMLA 3BJYA 4J9MA 1FVIA 4GC6A 2UXCH 4RZRA 4MA0A 4ECRA 4ED2A 4CC5A 2Q2UA 4UFZA 3T1HH 5L1IA 1RYSA 5IP9G 2CNQA 2EJ0A 4RB1A 4J9SA 2DABA 1JXLA 3LWBA 4MA5A 5CR5A 3KYHC 2OLSA 2ASLA 4O7YA 4O2AF 3H4BA 5BYAA 4I4TF 1XNRH 4GKJH 5C1PA 1M0TA 4A3LG 4F4YA 1IYDA 1KC7A 4MTEA 2YZLA 1CKNB 1OBGA 4HYKA 4PZ6A 3WWJA 2QYZA 3T7AA 3GIQA 2R8KA 2A1HA 3GTOA 5KG4A 5DGBA 2V9WA 2NUAB 4UCVA 3Q1KA 4WBNF 2OH2A 4EFBA 4UCUA 4NZOA 4J9QA 4AQYH 4WHXA 4DV3H 3GTKA 4BWSC 5I5SA 2R7ZA 1GYFA 1I1KA 1K1SA 1CKOA 2R7KA 2XC9A 2W6PA 4XX0B 2BQRA 1I2LA 3R9RA 4HNUA 2W57A 1DV2A 3LQSA 4EGQA 4DR5H 1XMQH 2UUBH 1I1LA 5C3EG 3CEBA 4IWYA 3TW6A 3QFFA 5FR9A 3VOTA 4CE5A 4JI3H 3T9EA 3AYHB 5JQWA 5KFOA 1WCMA 3RGZA 1CE8A 1I50A 1BGWA 1VBGA 3G6VA 5EWGA 2UUAH 3M9MB 1JLLB 2V4QA 5IWAH 5I60A 5L1LA 1I2KA 5J2UF 1S10A 1N56A 2JA8G 2CZGA 4MV7A 2C00A 1AUVA 3GIJA 1E4EB 1DGSA 1JDBB 4I50F 4Q4DA 5D1PA 2YCHA 4ZI7F 2XGQA 4QW9A 5DG8A 2VR1A 4EG0A 4O3RA 5DQIA 1OBDA 1M0WA 1EKVA 3G8DA 4PBCA 5HV6A 1KJ8A 2Y0SA 4J9NA 3RBEA 2ALZA 5I5XA 3ETHA 4O81A 1IBLH 4O86A 3DTGA 4JV0A 2QF7A 4A3BG 3N6XA 5C8YF 5KFYA 2COJA 2FMAA 3CVZA 1Y1VA 5JUMA 5LYJF 2E2IA 3LULA 4J9OA 3GTMA 4LF5H 3WNZA 3V6KA 4JV1A 3FKIG 4NLGA 3T5KA 5I5UA 2IA6A 2C35B 1A9XA 1ZAUA 2GQRA 1KTAA 2PVPA 4UCOA 4CKEA 5DLGA 3HOUG 4DV6H 4M9UA 4O7NA 3MFIA 2FB9A 3T9AA 5DQHA 3DTFA 1Y1WA 4FGRA 1P16A 4DIMA 4FFMA 3ORQA 4JUZA 3KALA 3PFFA 4FS1A 3RR5A 4O7ZA 5KFIA 5IYDG 2J6UA 4C5BA 2C28A 4LF9H 1VBHA 4MV9A 5D1OA 3RV4A 3FKIA 4DV7H 3Q8QB 5T14A 5I5WA 3U0GA 4J0MA 3GTLA 1A0GA 3V4ZA 4PZ7A 3N40P 4JI6H 2ASJA 5JQGF 3RB3A 3RV3A 1JDEA 5BWTA 4IWXA 4RAYA 2ZM6H 3NC0B 4O4JF 5KG5A 4DRFA 1G2WA 3H3VH 2B63A 3MWEA 5KFWA 5F9LA 1Y14B 3GV8B 5E25A 3H20A 2DWCA 3PW5A 3T1YH 2V58A 4QSHA 2HGXA 1VAJA 3L2PA 4CC6A 4EYIB 2ASDA 2X0SA 4R8UA 2IBKA 2CW8A 4RB2C 3VNNA 4UCTA 1GLVA 1XK5A 1B6RA 3OTOH 3EPIA 1S97A 5CM0A 1E4FT 3GIMA 5JVLA 2XD4A 1T36A 4XZ3B 3UYYA 3KAJA 1BXRA 3RIZA 3F8NA 3T54A 5LA6F 2HGSA 3HXLA 5F9NA 3PW7A 1K1QA 3WWHA 5KFLA 4YY3H 1CQJB 1WSCA 4YHHH 5LMNH 5BWXA 2W70A 1XMOH 2FK1A 3GIPA 2YWVA 2OWOA 5L1KA 3HOWG 2VA3A 2RGRA 1A3GA 2CFMA 2AQ4A 5KFJA 5EZYF 3C0FB 3PZPA 2FLPA 2PMZE 2UVVA 5KT2A 5C1OA 1UC8A 3BQ1A 2HIXA 2M05A 5FPOA 4JXUA 3GJXB 2HIVA 3TINA 2VUGA 3K5HA 4FFRA 1RJPA 4J9LA 1A48A 1N48A 3HOYG 4DR6H 3TIGA 4RB0A 3PW4A 4YB8B 2HHFA 2C2DA 1EUDB 1XDNA 2W8KA 5HNEA 3N42B 4J9PA 1UNNC 5DAAA 3PVXA 4A2BA 1KJQA 4LSAA 2W9BA 2FK2A 3RUPA 3UZOA 1N34H 3FDSA 3CQZA 4Q8EA 3MR6A 2HJWA 3BABA 5KFGA 2FPIB 4FM9A 2R7NA 2CQYA 4J9KA 4UUGA 4M7EA 4DV0H 1DAAA 1T3NA 2NVXA 3ORRA 2R8IA 2FLNA 4YAJB 1GGOA 2ZDHA 4IHJF 5IP7G 3Q8SB 4LF6H 2COIA 1S03G 2I8CA 4MV8A 5EOYA 4MV4A 1WR2A 4DV5H 1RYRA 5DGAA 4UCSA 4O83A 4HN2A 4A3EG 2VUMA 4ED0A 2AGQA 4Q44A 3RFCA 4O3QA 5KFXA 1XNQH 2BR0A 4NZMA 5DLFA 4QWBA 4K0KH 3RJ0A 3T9DA 4YR2A 3W1BA 1I94H 4F4XA 2JEFA 1KEEA 1E4GT 4EBDA 1V4YA 2W71A 2R93G 2VQEH 1K83A 3TIIA 3OSNA 5J2TF 4CKBA 3UFXB 5KFQA 1OWTA 1UC9A 4BBRG 5KT3A 1S9FA 2XCLA 4ED8A 2GPWA 4ECVA 4F4WA 2VA2A 4IRCA 4FFPA 3J7AK 2Z02A 3N8DA 2W7PA 2VUMG 4FFLA 5LMUH 2PBZA 1O75A 3PO2G 3MWDA 4Y8VB 3RF2A 4C5CA 3TQ1A 4BY7G 2W8LA 4TVIA 2HVSA 4RNMA 3V4SA 2KSWA 2E2HA 3OUZA 1KJ9A 3GILA 4FBTA 5L9XA 3PR5B 4ECTA 2NU6B 1I7LA 3JRXA 4QJFA 4FS2A 2WB1A 5BWWA 4C2MA 1Z2PX 2HDKA 2NVYA 3N44B 1VS0A 3MWMA 4ED7A 3T9BA 5EDWA 3GV5B 2R6FA 5BR8H 3EYYA 4JI7H 2R84A 3G8CA 4X66H 1KBLA 1EYZA 4ECQA 3MJFA 4DUYH 3TY5A 5DG7A 4CMFA 2FP4B 1GSAA 4MV3A 4YJ2F 4Q43A 1N33H 4U6PA 1KJJA 1I3QA 1S0OA 4O7LA 3SE7A 2R86A 2YS6A 4EYHB 4QIWA 5CA0F 1V51A 3KTMA 5KFFA 5BWUA 2HHHH 3GTQA 2W6QA 3JSNA 3K5IA 5FNVF 5KKNB 2PN1A 5KG6A 4O7TA 5JH7F 3T99A 1RK6A 2RDIA 4DR3H 3R5FA 3PW0A 2BQUA 4O7VA 3HT5A 1HR0H 4O84A 2Y0SE 3RB0A 3JZ6A 2J9GA 3N41B 4BY1G 2C22A 3GDEA 2VPQA 4QIWE 2CKZB 2W6OA 3JSLA 3HOZG 5IYZF 3J81W 2E5LH 3TY9A 2R8GA 5KFUA 1A0IA 4JI2H 2W9CB 3Q2OA 5KT6A 1Z2NX 3DF7A 1AN7A 4A3DG 2ABJA 4WD3A 4RUCA 4QWDA 5DGHA 1P8LA 1DIKA 4DAAA 3ETJA 4YR0A 4ME6A 3WO1A 1VKZA 5I5YA 2YW2A 4GLWA 5LOVF 1I7NA 2YZGA 3PW2A 2JA7G 4R7RA 2EJ3A 2UUCH 3GIIA 4X62H 3BG5A 4JI5H 4TV8F 5FD6A 2J6TA 2FJZA 4FBUA 1RJQA 4MTDA 2FPGB 5D1OB 1ET0A 2HGWA 4E4TA 4A2AA 4DR2H 1S0NA 1KJIA 2QK4A 1IBKH 4O3SA 3NBZB 4Q45A 4B3RH 4O2BF 3N6RA 5FJ8G 2CNUA 3VPBA 3V6JA 2AGPA 2UU9H 3T5HA 1I6UA 3HOVG 3RAXA 1TWAA 5C44G 2YU9A 5KFVA 5KT5A 1MZBA 3JZIA 3M9OB 4IR1A 5D8DA 4FE2A 3WWIA 2C2EA 4LFBH 2YRXA 2EIYA 2VOBA 4TUYF 2GLTA 2WYOA 3UZBA 4JYAH 2VQDA 3JZFA 3IG0A 1KUTA 2VQFH 4DL3A 4YJ3F 2AGOA 1TAEA 4NXMH 2ODTX 3I12A 3KAKA 1PX2A 4RU9A 2UXDH 4M0JA 4A3KG 4B3MH 3MFHA 5KG0A 3KHGA 4CMDA 4A3IG 4A3FG 4A3CG 4EFEA 5IT9W 2JA6G 4MV1A 1RJRA 1ULZA 3L4JA 1ZETA 3FMAA 5BYBA 5KG1A 5IYCG 2V59A 2Q2TA 2V5AA 2R92G 2W6MA 4K6NA 2FLLA 1Z2OX 2RGVA 5LP6F 3GB8B 5KFPA 3QWUA 3BQ0A 4LF8H 2JA5G 2C2RA 1AUXA 2NU9B 2XIGA 2W7OA 1ZQ7A 4TQSA 5KFBA 3H4DA 4YR3A 2P0AA 1EUCB 2GQSA 3EPGA 5DISC 3KHRA 3T5LA 4IZOA 3T9CA 3NGDA 2EJ2A 4DV1H 5EWFA 4EQ5A 4LSXA 4F50A 4IRKA 1W96A 5CAEB 4RNOA 1SFOA 1JIHA 4GLXA 4O4HF 2AU0A 2R92A 5BMVF 1M7JA 5DGIA 3PR4A 1X9NA 4FFOA 5KG2A 3T9FA 2ZDGA 2V4RA 3H0GG 3N43B 2Z04A 2GPSA 3E5NA 4PDBA 2WE6A 4I55F 4IRDA 2ZDQA 1I1MA 2HHFB 3QZ7A 3NUAA 2R85A 2IMWP 4Q4CA 2WTFA 4I7HA 2DAAA 3VPCA 4EEQA 3GLKA 3R23A 2VPSA 4QWAA 3GIDA 5K2MA 2FK3A 4QW8A 3U9SA 2WDTA 3BAAA 3M4IA 5KFRA 4GKKH 4O4IF 4A3JG 3RB6A 3GTPA 1KT8A 1GO3E 1T94A 4E6NA 4ZQIA 4ZOLF 4J9RA 4DL5A 3TY8A 5I47A 3OHBA 4X65H 4B3TH 2F4VH 5DG9A 4RNNA 2ATLA 2YS7A 2YL2A 4DV4H 1DV1A 4ECXA 2I80A 2Y4RA 4RZQA 4O7SA 3KHLA 2CW7A 5BWVA 3WO0A 3VA7A 5KT4A 5L1JA 2DPIA 2NU7B 3DAAA 1TWFA 4Q8FA 2W6NA 1TWCA 1B04A 4EBCA 2UVRA 2DZDA 4NZNA 3U9TA 3RB4A 2R7ZG 3L4KA 4G3IA 3JRWA 2ZJTA 5C5JA 3AW8A 4IR9A 3K3VA 3KXYT 2DIKA 4YBZB 1CKNA 3S24A 5A2QW 2XGPA 4EBEA 1PK8A 4YP3A 2MCTA 3HO8A 2DLNA 4DL2A 1IOVA 3HKZA 5FLMG 4DUZH 2YRWA 4JI8H 4DQNA 4HNVA 4TM5A 3I4MG 1N32H 5DMXA 4CKCA 2YYAA 2R93A 3R5HA 1WCMG 4JV2A 2QB5A 5KFHA 1RK5A 1ZHQA 5KFEA 3HKZE 4ETSA 3SNOA 4NXNH 3RTXA 2WB1E 3PN1A 4LF7H 4XYMB 5KFTA 4ECYA 3OUUA 4ED1A 3V6HA 3AX6A 4DLKA 3TEKA 2FKLA 1EHIA 4RCNA 5LXTF 4C5AA 3Q8RB 3VMMA 4APMA 2HVQA
chains in the Genus database with same CATH topology
4ZHQF 2R82A 2W6ZA 1GSOA 4YAKB 4L1KA 3TQTA 2R87A 1E4EA 4O7WA 2R7LA 4O82A 1BNCA 2SCUB 1C30A 2NU8B 1W93A 1C3OA 2YZMA 5KX5F 4MAMA 2IP4A 1EZ1A 1JKJB 4NYEA 1GSHA 5JVDF 2R7MA 1SCUB 3HBLA 4O7RA 1CS0A 3U54A 4XYLB 4TV9F 4FFNA 4IIJF 4HNTA 1IOWA 5CB4F 3K3PA 4O4LF 4FU0A 3U55A 4MV6A 4HQ6A 1B6SA 5CA1F 3HB9A 3LP8A 5HBRB 2I87A 3R5XA 5H80A 2CNVA 5BPHA 1M6VA 2YZNA 4EGJA 4HR7A 3KREA 3VPDA 5GONF 5BPFA 1CQIB 2FPPB 4MA0A 2CNQA 3LWBA 4MA5A 2OLSA 4O2AF 4O7YA 4I4TF 5C1PA 1M0TA 1KC7A 2YZLA 1OBGA 2NUAB 3Q1KA 4WBNF 2R7KA 2W6PA 4XX0B 3R9RA 4HNUA 1DV2A 4EGQA 4IWYA 3TW6A 3QFFA 3VOTA 5JQWA 1CE8A 1VBGA 1JLLB 5J2UF 2CZGA 4MV7A 2C00A 1AUVA 1E4EB 1JDBB 4I50F 4ZI7F 2VR1A 4EG0A 1OBDA 1M0WA 3G8DA 5HV6A 1KJ8A 3ETHA 4O81A 4O86A 2QF7A 5C8YF 5LYJF 3WNZA 1A9XA 2GQRA 2PVPA 4M9UA 4O7NA 2FB9A 4FGRA 4DIMA 4FFMA 3ORQA 3KALA 4O7ZA 4C5BA 1VBHA 4MV9A 3RV4A 3V4ZA 5JQGF 3RV3A 1JDEA 4IWXA 4O4JF 3MWEA 2DWCA 2V58A 4QSHA 2X0SA 1GLVA 1B6RA 5JVLA 2XD4A 1T36A 4XZ3B 3KAJA 1BXRA 5LA6F 2HGSA 1CQJB 2W70A 2YWVA 5EZYF 5C1OA 1UC8A 3TINA 3K5HA 4FFRA 1A48A 3TIGA 4YB8B 1EUDB 1KJQA 3RUPA 2HJWA 2FPIB 2R7NA 2CQYA 3ORRA 4YAJB 1GGOA 2ZDHA 4IHJF 2I8CA 4MV8A 4MV4A 1WR2A 4O83A 3RFCA 1KEEA 2W71A 3TIIA 5J2TF 3UFXB 1UC9A 2XCLA 2GPWA 4FFPA 2Z02A 3N8DA 4FFLA 2PBZA 3MWDA 4Y8VB 4C5CA 3V4SA 3OUZA 1KJ9A 2NU6B 1I7LA 3JRXA 1Z2PX 2R6FA 2R84A 3G8CA 1KBLA 1EYZA 3MJFA 2FP4B 1GSAA 4MV3A 4YJ2F 1KJJA 4O7LA 3SE7A 2R86A 2YS6A 5CA0F 2W6QA 5FNVF 3K5IA 5KKNB 2PN1A 4O7TA 5JH7F 3R5FA 4O7VA 4O84A 2J9GA 2VPQA 2W6OA 5IYZF 3Q2OA 1Z2NX 3DF7A 4WD3A 1DIKA 3ETJA 4ME6A 3WO1A 1VKZA 2YW2A 5LOVF 1I7NA 2YZGA 3BG5A 4TV8F 2FPGB 4E4TA 1KJIA 2QK4A 4O2BF 3N6RA 2CNUA 3VPBA 3JZIA 5D8DA 4FE2A 2YRXA 4TUYF 2GLTA 2WYOA 2VQDA 3JZFA 1KUTA 4YJ3F 3I12A 3KAKA 1PX2A 4MV1A 1ULZA 2V59A 2V5AA 2W6MA 1Z2OX 5LP6F 1AUXA 2NU9B 2P0AA 1EUCB 2GQSA 4IZOA 1W96A 5CAEB 4O4HF 5BMVF 4FFOA 2ZDGA 2Z04A 2GPSA 3E5NA 4I55F 2ZDQA 3NUAA 2R85A 3VPCA 3GLKA 3R23A 3GIDA 5K2MA 3U9SA 4O4IF 4ZQIA 4ZOLF 5I47A 2YS7A 2YL2A 1DV1A 2I80A 4RZQA 4O7SA 3WO0A 3VA7A 2NU7B 2W6NA 2DZDA 3U9TA 3JRWA 3AW8A 2DIKA 4YBZB 1PK8A 3HO8A 2DLNA 1IOVA 2YRWA 4HNVA 5DMXA 2YYAA 3R5HA 4XYMB 3OUUA 3AX6A 4DLKA 1EHIA 5LXTF 4C5AA 3VMMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ZHQ F;  2R82 A;  2W6Z A;  1GSO A;  4YAK B;  4L1K A;  3TQT A;  2R87 A;  1E4E A;  4O7W A;  2R7L A;  4O82 A;  1BNC A;  2SCU B;  1C30 A;  2NU8 B;  1W93 A;  1C3O A;  2YZM A;  5KX5 F;  4MAM A;  2IP4 A;  1EZ1 A;  1JKJ B;  4NYE A;  1GSH A;  5JVD F;  2R7M A;  1SCU B;  3HBL A;  4O7R A;  1CS0 A;  3U54 A;  4XYL B;  4TV9 F;  4FFN A;  4IIJ F;  4HNT A;  1IOW A;  5CB4 F;  3K3P A;  4O4L F;  4FU0 A;  3U55 A;  4MV6 A;  4HQ6 A;  1B6S A;  5CA1 F;  3HB9 A;  3LP8 A;  5HBR B;  2I87 A;  3R5X A;  5H80 A;  2CNV A;  5BPH A;  1M6V A;  2YZN A;  4EGJ A;  4HR7 A;  3KRE A;  3VPD A;  5GON F;  5BPF A;  1CQI B;  2FPP B;  4MA0 A;  2CNQ A;  3LWB A;  4MA5 A;  2OLS A;  4O2A F;  4O7Y A;  4I4T F;  5C1P A;  1M0T A;  1KC7 A;  2YZL A;  1OBG A;  2NUA B;  3Q1K A;  4WBN F;  2R7K A;  2W6P A;  4XX0 B;  3R9R A;  4HNU A;  1DV2 A;  4EGQ A;  4IWY A;  3TW6 A;  3QFF A;  3VOT A;  5JQW A;  1CE8 A;  1VBG A;  1JLL B;  5J2U F;  2CZG A;  4MV7 A;  2C00 A;  1AUV A;  1E4E B;  1JDB B;  4I50 F;  4ZI7 F;  2VR1 A;  4EG0 A;  1OBD A;  1M0W A;  3G8D A;  5HV6 A;  1KJ8 A;  3ETH A;  4O81 A;  4O86 A;  2QF7 A;  5C8Y F;  5LYJ F;  3WNZ A;  1A9X A;  2GQR A;  2PVP A;  4M9U A;  4O7N A;  2FB9 A;  4FGR A;  4DIM A;  4FFM A;  3ORQ A;  3KAL A;  4O7Z A;  4C5B A;  1VBH A;  4MV9 A;  3RV4 A;  3V4Z A;  5JQG F;  3RV3 A;  1JDE A;  4IWX A;  4O4J F;  3MWE A;  2DWC A;  2V58 A;  4QSH A;  2X0S A;  1GLV A;  1B6R A;  5JVL A;  2XD4 A;  1T36 A;  4XZ3 B;  3KAJ A;  1BXR A;  5LA6 F;  2HGS A;  1CQJ B;  2W70 A;  2YWV A;  5EZY F;  5C1O A;  1UC8 A;  3TIN A;  3K5H A;  4FFR A;  1A48 A;  3TIG A;  4YB8 B;  1EUD B;  1KJQ A;  3RUP A;  2HJW A;  2FPI B;  2R7N A;  2CQY A;  3ORR A;  4YAJ B;  1GGO A;  2ZDH A;  4IHJ F;  2I8C A;  4MV8 A;  4MV4 A;  1WR2 A;  4O83 A;  3RFC A;  1KEE A;  2W71 A;  3TII A;  5J2T F;  3UFX B;  1UC9 A;  2XCL A;  2GPW A;  4FFP A;  2Z02 A;  3N8D A;  4FFL A;  2PBZ A;  3MWD A;  4Y8V B;  4C5C A;  3V4S A;  3OUZ A;  1KJ9 A;  2NU6 B;  1I7L A;  3JRX A;  1Z2P X;  2R6F A;  2R84 A;  3G8C A;  1KBL A;  1EYZ A;  3MJF A;  2FP4 B;  1GSA A;  4MV3 A;  4YJ2 F;  1KJJ A;  4O7L A;  3SE7 A;  2R86 A;  2YS6 A;  5CA0 F;  2W6Q A;  5FNV F;  3K5I A;  5KKN B;  2PN1 A;  4O7T A;  5JH7 F;  3R5F A;  4O7V A;  4O84 A;  2J9G A;  2VPQ A;  2W6O A;  5IYZ F;  3Q2O A;  1Z2N X;  3DF7 A;  4WD3 A;  1DIK A;  3ETJ A;  4ME6 A;  3WO1 A;  1VKZ A;  2YW2 A;  5LOV F;  1I7N A;  2YZG A;  3BG5 A;  4TV8 F;  2FPG B;  4E4T A;  1KJI A;  2QK4 A;  4O2B F;  3N6R A;  2CNU A;  3VPB A;  3JZI A;  5D8D A;  4FE2 A;  2YRX A;  4TUY F;  2GLT A;  2WYO A;  2VQD A;  3JZF A;  1KUT A;  4YJ3 F;  3I12 A;  3KAK A;  1PX2 A;  4MV1 A;  1ULZ A;  2V59 A;  2V5A A;  2W6M A;  1Z2O X;  5LP6 F;  1AUX A;  2NU9 B;  2P0A A;  1EUC B;  2GQS A;  4IZO A;  1W96 A;  5CAE B;  4O4H F;  5BMV F;  4FFO A;  2ZDG A;  2Z04 A;  2GPS A;  3E5N A;  4I55 F;  2ZDQ A;  3NUA A;  2R85 A;  3VPC A;  3GLK A;  3R23 A;  3GID A;  5K2M A;  3U9S A;  4O4I F;  4ZQI A;  4ZOL F;  5I47 A;  2YS7 A;  2YL2 A;  1DV1 A;  2I80 A;  4RZQ A;  4O7S A;  3WO0 A;  3VA7 A;  2NU7 B;  2W6N A;  2DZD A;  3U9T A;  3JRW A;  3AW8 A;  2DIK A;  4YBZ B;  1PK8 A;  3HO8 A;  2DLN A;  1IOV A;  2YRW A;  4HNV A;  5DMX A;  2YYA A;  3R5H A;  4XYM B;  3OUU A;  3AX6 A;  4DLK A;  1EHI A;  5LXT F;  4C5A A;  3VMM A; 
#chains in the Genus database with same CATH topology
 1L2Z A;  4ZHQ F;  4ECU A;  4ED6 A;  2R82 A;  4RB3 C;  3M9N B;  4DL4 A;  2W6Z A;  1S0M A;  1GSO A;  4YAK B;  4L1K A;  1SEI A;  3TQT A;  1Y1V G;  3T5J A;  2R87 A;  1E4E A;  4U7C A;  3QQM A;  4QWC A;  3W5O A;  2JEG A;  1TWH A;  3HOX G;  2DPJ A;  1IYE A;  4O7W A;  5FPR A;  2Q7D A;  2R7L A;  4O82 A;  2COG A;  5LL6 b;  1BNC A;  4F4Z A;  2SCU B;  5IYB G;  4X64 H;  1C30 A;  1WRV A;  5KFK A;  3RAQ A;  2NU8 B;  1CKM A;  1W93 A;  1C3O A;  2YZM A;  1BJT A;  1S68 A;  2JA7 A;  5KX5 F;  2WAQ A;  1Y1W G;  4UCR A;  2UXB H;  1HNW H;  4MAM A;  4TQR A;  2IP4 A;  2UVW A;  1EZ1 A;  4DL6 A;  3SGI A;  1HNX H;  3GTJ A;  1JKJ B;  3GV7 B;  3GTG A;  3BAC A;  5KG3 A;  3MR3 A;  3PO3 G;  4DR1 H;  4NYE A;  1GSH A;  3G6X A;  4JI0 H;  5JVD F;  1HNZ H;  5KFZ A;  2WAQ E;  2W9C A;  1IBM H;  2R8J A;  2XCP A;  3UQ8 A;  2W9A A;  4O3N A;  5DQG A;  4BXX G;  1WH2 A;  2R7M A;  1TA8 A;  4RUA A;  5I5V A;  4DR7 H;  1SCU B;  3HBL A;  4O7R A;  1CS0 A;  3U54 A;  2O03 A;  3W1G A;  4A93 G;  4O3P A;  4JI4 H;  4AYB A;  3J80 W;  2JEI A;  2X5R A;  5BWR A;  5FD5 A;  2B63 G;  4JV5 H;  1ZHS A;  4DV2 H;  4GC7 A;  3MR2 A;  3BA9 A;  4PZ8 A;  4CHI A;  3KHH A;  3OHA A;  3MR5 A;  4XYL B;  3I4N G;  3CSW A;  4R8U B;  4TV9 F;  3RBD A;  4FFN A;  4IAJ A;  4AYB E;  4RAZ A;  4LF4 H;  3JAM W;  3SI8 A;  4IIJ F;  4HNT A;  5KG7 A;  4QWE A;  4Q0Y A;  1FKA H;  1IOW A;  3GQC A;  2JEJ A;  1FJG H;  3OSP A;  5KFD A;  5KFS A;  3G6Y A;  2BQ3 A;  3NBY B;  5CB4 F;  1B33 N;  4O3O A;  3K3P A;  3Q8P B;  4JI1 H;  1EKP A;  4LH6 A;  2HVR A;  2ZGI A;  4O4L F;  2JA6 A;  5CE8 A;  4LFA H;  4A3M G;  3H40 A;  4FU0 A;  1J5E H;  4LFC H;  4A3G G;  2RF4 A;  4MV6 A;  4HQ6 A;  2HG8 A;  1B6S A;  4LH7 A;  3U55 A;  4OX9 H;  1R9T A;  3IN5 A;  5CA1 F;  3HB9 A;  2UVU A;  2JA5 A;  5KFM A;  4EEY A;  2FE3 A;  2R8H A;  3BA8 A;  3QZ8 A;  1JX4 A;  1EKF A;  3TW7 A;  4ECS A;  1SYX B;  2XCA A;  4LMY A;  2PMZ A;  2J6S A;  4DR4 H;  3LP8 A;  4KHP H;  3RGX A;  3BQ2 A;  4DL7 A;  5HBR B;  2I87 A;  2W9B B;  3R5X A;  5H80 A;  4YQW A;  2CNV A;  5C4X G;  1N36 H;  5BPH A;  1M6V A;  5KFA A;  2YZN A;  5KFC A;  4EGJ A;  5K3W A;  5FLX W;  3H0G A;  4ECZ A;  4HR7 A;  4ED3 A;  4B3S H;  5KT7 A;  5KFN A;  3KRE A;  3VPD A;  2RDJ A;  1V9P A;  4BBS G;  3GIK A;  4ECW A;  1TWG A;  5GON F;  5BPF A;  5I5T A;  5KS8 A;  5EWE A;  1CQI B;  2FPP B;  4PWQ A;  3LML A;  3BJY A;  4J9M A;  1FVI A;  4GC6 A;  2UXC H;  4RZR A;  4MA0 A;  4ECR A;  4ED2 A;  4CC5 A;  2Q2U A;  4UFZ A;  3T1H H;  5L1I A;  1RYS A;  5IP9 G;  2CNQ A;  2EJ0 A;  4RB1 A;  4J9S A;  2DAB A;  1JXL A;  3LWB A;  4MA5 A;  5CR5 A;  3KYH C;  2OLS A;  2ASL A;  4O7Y A;  4O2A F;  3H4B A;  5BYA A;  4I4T F;  1XNR H;  4GKJ H;  5C1P A;  1M0T A;  4A3L G;  4F4Y A;  1IYD A;  1KC7 A;  4MTE A;  2YZL A;  1CKN B;  1OBG A;  4HYK A;  4PZ6 A;  3WWJ A;  2QYZ A;  3T7A A;  3GIQ A;  2R8K A;  2A1H A;  3GTO A;  5KG4 A;  5DGB A;  2V9W A;  2NUA B;  4UCV A;  3Q1K A;  4WBN F;  2OH2 A;  4EFB A;  4UCU A;  4NZO A;  4J9Q A;  4AQY H;  4WHX A;  4DV3 H;  3GTK A;  4BWS C;  5I5S A;  2R7Z A;  1GYF A;  1I1K A;  1K1S A;  1CKO A;  2R7K A;  2XC9 A;  2W6P A;  4XX0 B;  2BQR A;  1I2L A;  3R9R A;  4HNU A;  2W57 A;  1DV2 A;  3LQS A;  4EGQ A;  4DR5 H;  1XMQ H;  2UUB H;  1I1L A;  5C3E G;  3CEB A;  4IWY A;  3TW6 A;  3QFF A;  5FR9 A;  3VOT A;  4CE5 A;  4JI3 H;  3T9E A;  3AYH B;  5JQW A;  5KFO A;  1WCM A;  3RGZ A;  1CE8 A;  1I50 A;  1BGW A;  1VBG A;  3G6V A;  5EWG A;  2UUA H;  3M9M B;  1JLL B;  2V4Q A;  5IWA H;  5I60 A;  5L1L A;  1I2K A;  5J2U F;  1S10 A;  1N56 A;  2JA8 G;  2CZG A;  4MV7 A;  2C00 A;  1AUV A;  3GIJ A;  1E4E B;  1DGS A;  1JDB B;  4I50 F;  4Q4D A;  5D1P A;  2YCH A;  4ZI7 F;  2XGQ A;  4QW9 A;  5DG8 A;  2VR1 A;  4EG0 A;  4O3R A;  5DQI A;  1OBD A;  1M0W A;  1EKV A;  3G8D A;  4PBC A;  5HV6 A;  1KJ8 A;  2Y0S A;  4J9N A;  3RBE A;  2ALZ A;  5I5X A;  3ETH A;  4O81 A;  1IBL H;  4O86 A;  3DTG A;  4JV0 A;  2QF7 A;  4A3B G;  3N6X A;  5C8Y F;  5KFY A;  2COJ A;  2FMA A;  3CVZ A;  1Y1V A;  5JUM A;  5LYJ F;  2E2I A;  3LUL A;  4J9O A;  3GTM A;  4LF5 H;  3WNZ A;  3V6K A;  4JV1 A;  3FKI G;  4NLG A;  3T5K A;  5I5U A;  2IA6 A;  2C35 B;  1A9X A;  1ZAU A;  2GQR A;  1KTA A;  2PVP A;  4UCO A;  4CKE A;  5DLG A;  3HOU G;  4DV6 H;  4M9U A;  4O7N A;  3MFI A;  2FB9 A;  3T9A A;  5DQH A;  3DTF A;  1Y1W A;  4FGR A;  1P16 A;  4DIM A;  4FFM A;  3ORQ A;  4JUZ A;  3KAL A;  3PFF A;  4FS1 A;  3RR5 A;  4O7Z A;  5KFI A;  5IYD G;  2J6U A;  4C5B A;  2C28 A;  4LF9 H;  1VBH A;  4MV9 A;  5D1O A;  3RV4 A;  3FKI A;  4DV7 H;  3Q8Q B;  5T14 A;  5I5W A;  3U0G A;  4J0M A;  3GTL A;  1A0G A;  3V4Z A;  4PZ7 A;  3N40 P;  4JI6 H;  2ASJ A;  5JQG F;  3RB3 A;  3RV3 A;  1JDE A;  5BWT A;  4IWX A;  4RAY A;  2ZM6 H;  3NC0 B;  4O4J F;  5KG5 A;  4DRF A;  1G2W A;  3H3V H;  2B63 A;  3MWE A;  5KFW A;  5F9L A;  1Y14 B;  3GV8 B;  5E25 A;  3H20 A;  2DWC A;  3PW5 A;  3T1Y H;  2V58 A;  4QSH A;  2HGX A;  1VAJ A;  3L2P A;  4CC6 A;  4EYI B;  2ASD A;  2X0S A;  4R8U A;  2IBK A;  2CW8 A;  4RB2 C;  3VNN A;  4UCT A;  1GLV A;  1XK5 A;  1B6R A;  3OTO H;  3EPI A;  1S97 A;  5CM0 A;  1E4F T;  3GIM A;  5JVL A;  2XD4 A;  1T36 A;  4XZ3 B;  3UYY A;  3KAJ A;  1BXR A;  3RIZ A;  3F8N A;  3T54 A;  5LA6 F;  2HGS A;  3HXL A;  5F9N A;  3PW7 A;  1K1Q A;  3WWH A;  5KFL A;  4YY3 H;  1CQJ B;  1WSC A;  4YHH H;  5LMN H;  5BWX A;  2W70 A;  1XMO H;  2FK1 A;  3GIP A;  2YWV A;  2OWO A;  5L1K A;  3HOW G;  2VA3 A;  2RGR A;  1A3G A;  2CFM A;  2AQ4 A;  5KFJ A;  5EZY F;  3C0F B;  3PZP A;  2FLP A;  2PMZ E;  2UVV A;  5KT2 A;  5C1O A;  1UC8 A;  3BQ1 A;  2HIX A;  2M05 A;  5FPO A;  4JXU A;  3GJX B;  2HIV A;  3TIN A;  2VUG A;  3K5H A;  4FFR A;  1RJP A;  4J9L A;  1A48 A;  1N48 A;  3HOY G;  4DR6 H;  3TIG A;  4RB0 A;  3PW4 A;  4YB8 B;  2HHF A;  2C2D A;  1EUD B;  1XDN A;  2W8K A;  5HNE A;  3N42 B;  4J9P A;  1UNN C;  5DAA A;  3PVX A;  4A2B A;  1KJQ A;  4LSA A;  2W9B A;  2FK2 A;  3RUP A;  3UZO A;  1N34 H;  3FDS A;  3CQZ A;  4Q8E A;  3MR6 A;  2HJW A;  3BAB A;  5KFG A;  2FPI B;  4FM9 A;  2R7N A;  2CQY A;  4J9K A;  4UUG A;  4M7E A;  4DV0 H;  1DAA A;  1T3N A;  2NVX A;  3ORR A;  2R8I A;  2FLN A;  4YAJ B;  1GGO A;  2ZDH A;  4IHJ F;  5IP7 G;  3Q8S B;  4LF6 H;  2COI A;  1S03 G;  2I8C A;  4MV8 A;  5EOY A;  4MV4 A;  1WR2 A;  4DV5 H;  1RYR A;  5DGA A;  4UCS A;  4O83 A;  4HN2 A;  4A3E G;  2VUM A;  4ED0 A;  2AGQ A;  4Q44 A;  3RFC A;  4O3Q A;  5KFX A;  1XNQ H;  2BR0 A;  4NZM A;  5DLF A;  4QWB A;  4K0K H;  3RJ0 A;  3T9D A;  4YR2 A;  3W1B A;  1I94 H;  4F4X A;  2JEF A;  1KEE A;  1E4G T;  4EBD A;  1V4Y A;  2W71 A;  2R93 G;  2VQE H;  1K83 A;  3TII A;  3OSN A;  5J2T F;  4CKB A;  3UFX B;  5KFQ A;  1OWT A;  1UC9 A;  4BBR G;  5KT3 A;  1S9F A;  2XCL A;  4ED8 A;  2GPW A;  4ECV A;  4F4W A;  2VA2 A;  4IRC A;  4FFP A;  3J7A K;  2Z02 A;  3N8D A;  2W7P A;  2VUM G;  4FFL A;  5LMU H;  2PBZ A;  1O75 A;  3PO2 G;  3MWD A;  4Y8V B;  3RF2 A;  4C5C A;  3TQ1 A;  4BY7 G;  2W8L A;  4TVI A;  2HVS A;  4RNM A;  3V4S A;  2KSW A;  2E2H A;  3OUZ A;  1KJ9 A;  3GIL A;  4FBT A;  5L9X A;  3PR5 B;  4ECT A;  2NU6 B;  1I7L A;  3JRX A;  4QJF A;  4FS2 A;  2WB1 A;  5BWW A;  4C2M A;  1Z2P X;  2HDK A;  2NVY A;  3N44 B;  1VS0 A;  3MWM A;  4ED7 A;  3T9B A;  5EDW A;  3GV5 B;  2R6F A;  5BR8 H;  3EYY A;  4JI7 H;  2R84 A;  3G8C A;  4X66 H;  1KBL A;  1EYZ A;  4ECQ A;  3MJF A;  4DUY H;  3TY5 A;  5DG7 A;  4CMF A;  2FP4 B;  1GSA A;  4MV3 A;  4YJ2 F;  4Q43 A;  1N33 H;  4U6P A;  1KJJ A;  1I3Q A;  1S0O A;  4O7L A;  3SE7 A;  2R86 A;  2YS6 A;  4EYH B;  4QIW A;  5CA0 F;  1V51 A;  3KTM A;  5KFF A;  5BWU A;  2HHH H;  3GTQ A;  2W6Q A;  3JSN A;  3K5I A;  5FNV F;  5KKN B;  2PN1 A;  5KG6 A;  4O7T A;  5JH7 F;  3T99 A;  1RK6 A;  2RDI A;  4DR3 H;  3R5F A;  3PW0 A;  2BQU A;  4O7V A;  3HT5 A;  1HR0 H;  4O84 A;  2Y0S E;  3RB0 A;  3JZ6 A;  2J9G A;  3N41 B;  4BY1 G;  2C22 A;  3GDE A;  2VPQ A;  4QIW E;  2CKZ B;  2W6O A;  3JSL A;  3HOZ G;  5IYZ F;  3J81 W;  2E5L H;  3TY9 A;  2R8G A;  5KFU A;  1A0I A;  4JI2 H;  2W9C B;  3Q2O A;  5KT6 A;  1Z2N X;  3DF7 A;  1AN7 A;  4A3D G;  2ABJ A;  4WD3 A;  4RUC A;  4QWD A;  5DGH A;  1P8L A;  1DIK A;  4DAA A;  3ETJ A;  4YR0 A;  4ME6 A;  3WO1 A;  1VKZ A;  5I5Y A;  2YW2 A;  4GLW A;  5LOV F;  1I7N A;  2YZG A;  3PW2 A;  2JA7 G;  4R7R A;  2EJ3 A;  2UUC H;  3GII A;  4X62 H;  3BG5 A;  4JI5 H;  4TV8 F;  5FD6 A;  2J6T A;  2FJZ A;  4FBU A;  1RJQ A;  4MTD A;  2FPG B;  5D1O B;  1ET0 A;  2HGW A;  4E4T A;  4A2A A;  4DR2 H;  1S0N A;  1KJI A;  2QK4 A;  1IBK H;  4O3S A;  3NBZ B;  4Q45 A;  4B3R H;  4O2B F;  3N6R A;  5FJ8 G;  2CNU A;  3VPB A;  3V6J A;  2AGP A;  2UU9 H;  3T5H A;  1I6U A;  3HOV G;  3RAX A;  1TWA A;  5C44 G;  2YU9 A;  5KFV A;  5KT5 A;  1MZB A;  3JZI A;  3M9O B;  4IR1 A;  5D8D A;  4FE2 A;  3WWI A;  2C2E A;  4LFB H;  2YRX A;  2EIY A;  2VOB A;  4TUY F;  2GLT A;  2WYO A;  3UZB A;  4JYA H;  2VQD A;  3JZF A;  3IG0 A;  1KUT A;  2VQF H;  4DL3 A;  4YJ3 F;  2AGO A;  1TAE A;  4NXM H;  2ODT X;  3I12 A;  3KAK A;  1PX2 A;  4RU9 A;  2UXD H;  4M0J A;  4A3K G;  4B3M H;  3MFH A;  5KG0 A;  3KHG A;  4CMD A;  4A3I G;  4A3F G;  4A3C G;  4EFE A;  5IT9 W;  2JA6 G;  4MV1 A;  1RJR A;  1ULZ A;  3L4J A;  1ZET A;  3FMA A;  5BYB A;  5KG1 A;  5IYC G;  2V59 A;  2Q2T A;  2V5A A;  2R92 G;  2W6M A;  4K6N A;  2FLL A;  1Z2O X;  2RGV A;  5LP6 F;  3GB8 B;  5KFP A;  3QWU A;  3BQ0 A;  4LF8 H;  2JA5 G;  2C2R A;  1AUX A;  2NU9 B;  2XIG A;  2W7O A;  1ZQ7 A;  4TQS A;  5KFB A;  3H4D A;  4YR3 A;  2P0A A;  1EUC B;  2GQS A;  3EPG A;  5DIS C;  3KHR A;  3T5L A;  4IZO A;  3T9C A;  3NGD A;  2EJ2 A;  4DV1 H;  5EWF A;  4EQ5 A;  4LSX A;  4F50 A;  4IRK A;  1W96 A;  5CAE B;  4RNO A;  1SFO A;  1JIH A;  4GLX A;  4O4H F;  2AU0 A;  2R92 A;  5BMV F;  1M7J A;  5DGI A;  3PR4 A;  1X9N A;  4FFO A;  5KG2 A;  3T9F A;  2ZDG A;  2V4R A;  3H0G G;  3N43 B;  2Z04 A;  2GPS A;  3E5N A;  4PDB A;  2WE6 A;  4I55 F;  4IRD A;  2ZDQ A;  1I1M A;  2HHF B;  3QZ7 A;  3NUA A;  2R85 A;  2IMW P;  4Q4C A;  2WTF A;  4I7H A;  2DAA A;  3VPC A;  4EEQ A;  3GLK A;  3R23 A;  2VPS A;  4QWA A;  3GID A;  5K2M A;  2FK3 A;  4QW8 A;  3U9S A;  2WDT A;  3BAA A;  3M4I A;  5KFR A;  4GKK H;  4O4I F;  4A3J G;  3RB6 A;  3GTP A;  1KT8 A;  1GO3 E;  1T94 A;  4E6N A;  4ZQI A;  4ZOL F;  4J9R A;  4DL5 A;  3TY8 A;  5I47 A;  3OHB A;  4X65 H;  4B3T H;  2F4V H;  5DG9 A;  4RNN A;  2ATL A;  2YS7 A;  2YL2 A;  4DV4 H;  1DV1 A;  4ECX A;  2I80 A;  2Y4R A;  4RZQ A;  4O7S A;  3KHL A;  2CW7 A;  5BWV A;  3WO0 A;  3VA7 A;  5KT4 A;  5L1J A;  2DPI A;  2NU7 B;  3DAA A;  1TWF A;  4Q8F A;  2W6N A;  1TWC A;  1B04 A;  4EBC A;  2UVR A;  2DZD A;  4NZN A;  3U9T A;  3RB4 A;  2R7Z G;  3L4K A;  4G3I A;  3JRW A;  2ZJT A;  5C5J A;  3AW8 A;  4IR9 A;  3K3V A;  3KXY T;  2DIK A;  4YBZ B;  1CKN A;  3S24 A;  5A2Q W;  2XGP A;  4EBE A;  1PK8 A;  4YP3 A;  2MCT A;  3HO8 A;  2DLN A;  4DL2 A;  1IOV A;  3HKZ A;  5FLM G;  4DUZ H;  2YRW A;  4JI8 H;  4DQN A;  4HNV A;  4TM5 A;  3I4M G;  1N32 H;  5DMX A;  4CKC A;  2YYA A;  2R93 A;  3R5H A;  1WCM G;  4JV2 A;  2QB5 A;  5KFH A;  1RK5 A;  1ZHQ A;  5KFE A;  3HKZ E;  4ETS A;  3SNO A;  4NXN H;  3RTX A;  2WB1 E;  3PN1 A;  4LF7 H;  4XYM B;  5KFT A;  4ECY A;  3OUU A;  4ED1 A;  3V6H A;  3AX6 A;  4DLK A;  3TEK A;  2FKL A;  1EHI A;  4RCN A;  5LXT F;  4C5A A;  3Q8R B;  3VMM A;  4APM A;  2HVQ A; 
#chains in the Genus database with same CATH homology
 4ZHQ F;  2R82 A;  2W6Z A;  1GSO A;  4YAK B;  4L1K A;  3TQT A;  2R87 A;  1E4E A;  4O7W A;  2R7L A;  4O82 A;  1BNC A;  2SCU B;  1C30 A;  2NU8 B;  1W93 A;  1C3O A;  2YZM A;  5KX5 F;  4MAM A;  2IP4 A;  1EZ1 A;  1JKJ B;  4NYE A;  1GSH A;  5JVD F;  2R7M A;  1SCU B;  3HBL A;  4O7R A;  1CS0 A;  3U54 A;  4XYL B;  4TV9 F;  4FFN A;  4IIJ F;  4HNT A;  1IOW A;  5CB4 F;  3K3P A;  4O4L F;  4FU0 A;  3U55 A;  4MV6 A;  4HQ6 A;  1B6S A;  5CA1 F;  3HB9 A;  3LP8 A;  5HBR B;  2I87 A;  3R5X A;  5H80 A;  2CNV A;  5BPH A;  1M6V A;  2YZN A;  4EGJ A;  4HR7 A;  3KRE A;  3VPD A;  5GON F;  5BPF A;  1CQI B;  2FPP B;  4MA0 A;  2CNQ A;  3LWB A;  4MA5 A;  2OLS A;  4O2A F;  4O7Y A;  4I4T F;  5C1P A;  1M0T A;  1KC7 A;  2YZL A;  1OBG A;  2NUA B;  3Q1K A;  4WBN F;  2R7K A;  2W6P A;  4XX0 B;  3R9R A;  4HNU A;  1DV2 A;  4EGQ A;  4IWY A;  3TW6 A;  3QFF A;  3VOT A;  5JQW A;  1CE8 A;  1VBG A;  1JLL B;  5J2U F;  2CZG A;  4MV7 A;  2C00 A;  1AUV A;  1E4E B;  1JDB B;  4I50 F;  4ZI7 F;  2VR1 A;  4EG0 A;  1OBD A;  1M0W A;  3G8D A;  5HV6 A;  1KJ8 A;  3ETH A;  4O81 A;  4O86 A;  2QF7 A;  5C8Y F;  5LYJ F;  3WNZ A;  1A9X A;  2GQR A;  2PVP A;  4M9U A;  4O7N A;  2FB9 A;  4FGR A;  4DIM A;  4FFM A;  3ORQ A;  3KAL A;  4O7Z A;  4C5B A;  1VBH A;  4MV9 A;  3RV4 A;  3V4Z A;  5JQG F;  3RV3 A;  1JDE A;  4IWX A;  4O4J F;  3MWE A;  2DWC A;  2V58 A;  4QSH A;  2X0S A;  1GLV A;  1B6R A;  5JVL A;  2XD4 A;  1T36 A;  4XZ3 B;  3KAJ A;  1BXR A;  5LA6 F;  2HGS A;  1CQJ B;  2W70 A;  2YWV A;  5EZY F;  5C1O A;  1UC8 A;  3TIN A;  3K5H A;  4FFR A;  1A48 A;  3TIG A;  4YB8 B;  1EUD B;  1KJQ A;  3RUP A;  2HJW A;  2FPI B;  2R7N A;  2CQY A;  3ORR A;  4YAJ B;  1GGO A;  2ZDH A;  4IHJ F;  2I8C A;  4MV8 A;  4MV4 A;  1WR2 A;  4O83 A;  3RFC A;  1KEE A;  2W71 A;  3TII A;  5J2T F;  3UFX B;  1UC9 A;  2XCL A;  2GPW A;  4FFP A;  2Z02 A;  3N8D A;  4FFL A;  2PBZ A;  3MWD A;  4Y8V B;  4C5C A;  3V4S A;  3OUZ A;  1KJ9 A;  2NU6 B;  1I7L A;  3JRX A;  1Z2P X;  2R6F A;  2R84 A;  3G8C A;  1KBL A;  1EYZ A;  3MJF A;  2FP4 B;  1GSA A;  4MV3 A;  4YJ2 F;  1KJJ A;  4O7L A;  3SE7 A;  2R86 A;  2YS6 A;  5CA0 F;  2W6Q A;  5FNV F;  3K5I A;  5KKN B;  2PN1 A;  4O7T A;  5JH7 F;  3R5F A;  4O7V A;  4O84 A;  2J9G A;  2VPQ A;  2W6O A;  5IYZ F;  3Q2O A;  1Z2N X;  3DF7 A;  4WD3 A;  1DIK A;  3ETJ A;  4ME6 A;  3WO1 A;  1VKZ A;  2YW2 A;  5LOV F;  1I7N A;  2YZG A;  3BG5 A;  4TV8 F;  2FPG B;  4E4T A;  1KJI A;  2QK4 A;  4O2B F;  3N6R A;  2CNU A;  3VPB A;  3JZI A;  5D8D A;  4FE2 A;  2YRX A;  4TUY F;  2GLT A;  2WYO A;  2VQD A;  3JZF A;  1KUT A;  4YJ3 F;  3I12 A;  3KAK A;  1PX2 A;  4MV1 A;  1ULZ A;  2V59 A;  2V5A A;  2W6M A;  1Z2O X;  5LP6 F;  1AUX A;  2NU9 B;  2P0A A;  1EUC B;  2GQS A;  4IZO A;  1W96 A;  5CAE B;  4O4H F;  5BMV F;  4FFO A;  2ZDG A;  2Z04 A;  2GPS A;  3E5N A;  4I55 F;  2ZDQ A;  3NUA A;  2R85 A;  3VPC A;  3GLK A;  3R23 A;  3GID A;  5K2M A;  3U9S A;  4O4I F;  4ZQI A;  4ZOL F;  5I47 A;  2YS7 A;  2YL2 A;  1DV1 A;  2I80 A;  4RZQ A;  4O7S A;  3WO0 A;  3VA7 A;  2NU7 B;  2W6N A;  2DZD A;  3U9T A;  3JRW A;  3AW8 A;  2DIK A;  4YBZ B;  1PK8 A;  3HO8 A;  2DLN A;  1IOV A;  2YRW A;  4HNV A;  5DMX A;  2YYA A;  3R5H A;  4XYM B;  3OUU A;  3AX6 A;  4DLK A;  1EHI A;  5LXT F;  4C5A A;  3VMM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...