1WR2A

Crystal structure of ph1788 from pyrococcus horikoshii ot3
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
237
structure length
235
Chain Sequence
MKEEAVRVIEEVLKQGRTAMVEYEAKQVLKAYGLPVPEEKLAKTLDEALEYAKEIGYPVVLKLMSPQILHKSDAKVVMLNIKNEEELKKKWEEIHENAKKYRPDAEILGVLVAPMLKPGREVIIGVTEDPQFGHAIMFGLGGIFVEILKDVTFRLVPITEKDARKMIQEIKAYPILAGAEEPADIDAIVDMLLKVSKLVDDLKDYIKEMDLNPVFVYNKGEGAVIVDSRIILKPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords hypothetical protein PH1789
publication title Crystal structure of PH1788 from Pyrococcus horikoshii Ot3
rcsb
source organism Pyrococcus horikoshii
molecule tags Structural genomics, unknown function
total genus 70
structure length 235
sequence length 237
ec nomenclature
pdb deposition date 2004-10-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13549 ATP-grasp_5 ATP-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.470.20 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 ATP-grasp fold, B domain 1wr2A01
3.30.1490.20 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 ATP-grasp fold, A domain 1wr2A02
2XCLA 3MWDA 4IWXA 2CNQA 2YWVA 5EZYF 5JQWA 4ZOLF 2V59A 4IIJF 2NU8B 4XX0B 3RV4A 2NU7B 4O7VA 2R7LA 5LOVF 2W6ZA 4O83A 2IP4A 2YZNA 4E4TA 3VOTA 3ORRA 5BPFA 3ORQA 3NUAA 4MV1A 1T36A 4EG0A 5H80A 2CNUA 4MV6A 4C5AA 4NYEA 2Z04A 1JKJB 5CB4F 2ZDQA 4HQ6A 3TINA 2NU9B 3TIGA 5D8DA 4ME6A 1JDEA 2R7MA 4Y8VB 4FFLA 4C5CA 2W6MA 3MWEA 5J2TF 2YRWA 3KAJA 1Z2OX 2GPSA 4FFMA 2NU6B 3RV3A 1KJJA 4O4LF 4HNUA 3RFCA 4I50F 4IHJF 2FB9A 2X0SA 4MAMA 1EUDB 1GSAA 3LP8A 3VMMA 1IOVA 2GQRA 2R86A 2Z02A 3MJFA 2GLTA 2DLNA 2DIKA 4O4IF 3TQTA 5BPHA 3Q2OA 1I7LA 2CZGA 1CQIB 1OBDA 1E4EB 4YBZB 4RZQA 5C1OA 2W71A 1M0WA 1KEEA 1CE8A 2YYAA 4I55F 5C1PA 1A9XA 3JZIA 3WNZA 3G8DA 4MV8A 3G8CA 2W6OA 5IYZF 2YS7A 2WYOA 2I8CA 1SCUB 5I47A 1KUTA 3R23A 3GIDA 2SCUB 4ZI7F 2I80A 3N8DA 1UC8A 1UC9A 4YAKB 2YL2A 5DMXA 1JDBB 4FFRA 3GLKA 3V4ZA 2GQSA 1GSHA 4L1KA 3HBLA 3K5HA 5BMVF 1BXRA 1VKZA 5C8YF 2GPWA 5HBRB 1GLVA 2I87A 2QK4A 1PK8A 4TV8F 3E5NA 1WR2A 1M0TA 2W6PA 2W6NA 4IWYA 2PN1A 3V4SA 2VR1A 5GONF 4O7LA 2R6FA 4O7YA 1C3OA 1C30A 4MV7A 3KALA 1VBGA 5KX5F 5CA0F 2J9GA 1B6RA 1IOWA 1VBHA 4C5BA 1JLLB 5JVLA 4O7TA 1KJ9A 1KC7A 4MV3A 1OBGA 1DV2A 4O7NA 4IZOA 3QFFA 3KREA 3JZFA 4HNTA 4WD3A 5CA1F 3R9RA 2FP4B 3R5XA 2CQYA 3JRWA 4TV9F 2YZLA 2ZDHA 3Q1KA 2YRXA 1M6VA 4O84A 4I4TF 2OLSA 1BNCA 4EGJA 2PBZA 4XYMB 3JRXA 1EUCB 1W96A 2C00A 1CQJB 4TUYF 3ETJA 4O7SA 1GGOA 4FGRA 5CAEB 2R87A 4FU0A 4EGQA 2HJWA 4O2AF 4O7ZA 2DWCA 4YJ2F 1PX2A 5J2UF 1KJ8A 5JQGF 4M9UA 4DIMA 2CNVA 2FPPB 2R84A 3WO0A 3DF7A 2R7KA 2R82A 3R5HA 3VPCA 4FFPA 3U54A 5JH7F 4YJ3F 2VQDA 3OUUA 2NUAB 3R5FA 4DLKA 3BG5A 1KJQA 3TIIA 3HO8A 1Z2NX 5HV6A 5LA6F 4FFOA 2FPGB 1E4EA 2YS6A 4O7RA 3K5IA 2HGSA 3U9SA 4MA0A 3KAKA 2ZDGA 2PVPA 2W6QA 1EZ1A 1B6SA 5LYJF 2V58A 3VPBA 3I12A 5JVDF 3AX6A 4MV9A 1W93A 4FE2A 4O4JF 3N6RA 1EHIA 2YZGA 1A48A 1DIKA 1ULZA 2XD4A 3VPDA 3SE7A 2FPIB 2QF7A 3U55A 3AW8A 4HR7A 3RUPA 1DV1A 4QSHA 1AUXA 5K2MA 3U9TA 2W70A 3UFXB 4ZHQF 3TW6A 4O82A 4O86A 4O4HF 3ETHA 2DZDA 3K3PA 2R85A 1I7NA 3LWBA 3VA7A 2YZMA 5FNVF 1CS0A 4XZ3B 1Z2PX 3WO1A 5KKNB 3OUZA 4MV4A 4YAJB 2VPQA 3HB9A 4O81A 1EYZA 5LP6F 4O2BF 2YW2A 4YB8B 4MA5A 1GSOA 2P0AA 4HNVA 4ZQIA 2V5AA 4FFNA 4XYLB 1KJIA 5LXTF 2R7NA 4O7WA 1AUVA 4WBNF 1KBLA
chains in the Genus database with same CATH superfamily
2XCLA 4MTDA 3MWDA 2DABA 4IWXA 3NBZB 3U0GA 3L2PA 2HVRA 2CNQA 3DTFA 4UCSA 1RJPA 2VA2A 2YWVA 5EZYF 5JQWA 2V4RA 4ZOLF 4EFBA 1TAEA 4X64H 3RB4A 4PZ6A 4O3NA 3HOXG 2V59A 2HGXA 4JI5H 4IIJF 2ASJA 5BWRA 5BWTA 2NU8B 3T99A 5KS8A 4J9QA 2JA6G 3I4MG 4XX0B 5KFCA 2W9AA 2PMZA 2FLPA 3RV4A 2ASLA 3T9AA 2NU7B 4RB2C 4O7VA 4CMDA 4YQWA 2R7LA 5LOVF 1SYXB 4ECQA 2W7PA 5DGAA 4TM5A 3N6XA 3T54A 2DPJA 1WSCA 3GIMA 2J6UA 3GTLA 2W6ZA 2JA7G 4O83A 4O3OA 3T5KA 2IP4A 2YZNA 5KT6A 2DPIA 4E4TA 4J9MA 4A3BG 1A0IA 3VOTA 3RIZA 5HNEA 4GC7A 1I6UA 5KFHA 3DAAA 2W9CB 1XMQH 4NZOA 5DGIA 4JI7H 4G3IA 3ORRA 1B04A 5KFLA 5BPFA 4I7HA 3PR5B 3FDSA 4A2BA 5A2QW 4F50A 1RYRA 4Q0YA 3ORQA 1E4GT 4X62H 2HHFA 2W7OA 2EIYA 4GKKH 3HT5A 1P8LA 3W1GA 4CKEA 3NUAA 2Q2UA 2VOBA 5EDWA 3JSNA 4JI3H 4MV1A 2JEGA 2AQ4A 2YCHA 2R93A 4DV4H 1T36A 3MR6A 2RGRA 3H4BA 4EG0A 5H80A 2CNUA 4MV6A 2UXCH 4C5AA 1V4YA 4RAYA 3Q8SB 4IRDA 4CKCA 3AYHB 4UCTA 2HDKA 3F8NA 2R8HA 2UUBH 4NYEA 3HXLA 5KFGA 4ETSA 2F4VH 3GTGA 2JA8G 2Z04A 1JKJB 5CB4F 2VUMA 2ZDQA 4HQ6A 5IYCG 2QB5A 5EWEA 3H4DA 3TINA 5CM0A 4LF7H 2B63A 2NU9B 3TIGA 5D8DA 4K0KH 4ME6A 3OSPA 3LMLA 5L1LA 2ATLA 5BYBA 4UCRA 3UZOA 2AGPA 1JDEA 2CW7A 2R7MA 3PO2G 1BJTA 2E2IA 4BBRG 4Y8VB 5KG3A 1S0OA 4FFLA 3Q8PB 4GLXA 3HOZG 4C5CA 3RGZA 4JI0H 2VQEH 2W6MA 3MWEA 1EKFA 2YRWA 3KAJA 5J2TF 1Z2OX 1GO3E 4RAZA 4EYHB 3N44B 3NC0B 5DQIA 3RJ0A 2GPSA 5I5WA 5F9NA 2BQRA 4QWBA 5KG1A 4LFCH 4A3LG 3GIIA 4KHPH 4LFBH 5LL6b 3PZPA 1N56A 4FFMA 2J6TA 3H40A 5C44G 2NU6B 3RV3A 1KJJA 4O4LF 1FVIA 3M9NB 4ECUA 5EOYA 2WAQE 4HNUA 4AYBE 3RFCA 1XMOH 4I50F 1SFOA 4IHJF 5KFYA 3T5JA 2BR0A 4Q8FA 4DQNA 2FB9A 2X0SA 4MAMA 3T9FA 1EUDB 1GSAA 4M7EA 3LP8A 5DGHA 3VMMA 3NGDA 5DG7A 1IOVA 2GQRA 2R86A 1ZQ7A 5L9XA 3MFIA 4EBCA 1FJGH 2Z02A 3MJFA 2GLTA 3OHAA 4DV6H 3OSNA 4NLGA 2DLNA 2DIKA 3CEBA 4JI6H 2HGWA 4DV7H 2ALZA 5C5JA 2UU9H 4F4YA 1CKNB 4RB0A 2O03A 4O4IF 3RAQA 5DAAA 5KG5A 3TQTA 5BPHA 5T14A 1KTAA 3Q2OA 1I7LA 3GDEA 3QZ8A 2CZGA 3QWUA 1M7JA 3G6XA 4DR2H 1HNZH 4J9NA 3W1BA 1S0NA 1HR0H 5F9LA 2JA6A 1CQIB 3KHRA 4QIWE 1OBDA 4ECRA 5KFWA 3KHLA 4RB3C 1E4EB 3S24A 5I60A 4O3RA 5L1KA 1Y1VG 2IMWP 1DGSA 4YBZB 2JA7A 2Q7DA 2XCAA 4X66H 1IBMH 2UVRA 2RF4A 1FKAH 4RZQA 5C1OA 3GV5B 2NVXA 2W71A 5KG0A 4A93G 3KTMA 1M0WA 2EJ3A 1KEEA 3I4NG 1CE8A 2YYAA 5EWFA 3TY8A 2IBKA 2ZM6H 4I55F 5C1PA 2VPSA 2R8IA 5D1OB 5KFOA 1A9XA 3JZIA 3T1HH 3WNZA 3G8DA 4QWDA 4LH7A 1RK6A 4DR7H 1WH2A 4MV8A 5KFUA 4F4WA 3G8CA 2W6OA 4UCUA 5IYZF 2YS7A 3M9MB 4EYIB 4PWQA 4DUYH 4ED2A 4IRKA 3GTMA 2EJ2A 4K6NA 2WYOA 2I8CA 5I5UA 2C2EA 5KFDA 5DISC 1SCUB 2W9BB 3RF2A 1V51A 2AU0A 2UVUA 5I47A 1KUTA 3R23A 3GIDA 1E4FT 4J9KA 1RYSA 1J5EH 2SCUB 4X65H 5LMNH 4IR1A 3T1YH 3IG0A 4ZI7F 3OTOH 1XDNA 2I80A 3BAAA 3N8DA 1X9NA 1UC8A 1UC9A 4YAKB 3LULA 5BWVA 2YL2A 5DMXA 1VAJA 3H0GG 3TW7A 1JDBB 4FFRA 1MZBA 1IYDA 3GLKA 2GQSA 3V4ZA 2W57A 4DV0H 2OH2A 1GSHA 4DR1H 1Y1WG 4L1KA 3HBLA 1ZAUA 3K5HA 2Y0SA 4JI1H 4QWEA 5KFBA 5BMVF 1BXRA 3N41B 1VKZA 5KG7A 5C8YF 4CMFA 5FR9A 2GPWA 3UYYA 5BR8H 5HBRB 3EYYA 4YR3A 4LF6H 1GLVA 1P16A 2I87A 2R7ZG 4ECTA 5KFFA 2QK4A 4DR4H 1G2WA 1PK8A 4TV8F 3PW0A 2R92G 1IYEA 3E5NA 4GLWA 4DV5H 1N34H 1WR2A 3PFFA 2HIXA 5KG4A 5BWWA 1M0TA 3DTGA 2W6PA 2W6NA 4IWYA 2R8JA 4A3CG 3EPGA 4A2AA 4O3QA 4IR9A 3BQ0A 5KFMA 4CC5A 1BGWA 2PN1A 3V4SA 1TWGA 3PR4A 2VR1A 3GQCA 5GONF 4CHIA 4J9OA 4JV5H 4O7LA 2R6FA 3Q8QB 2Q2TA 3N42B 4R8UA 4O7YA 3HKZE 3MR2A 2UUCH 3GIPA 3TY5A 4JI2H 1A3GA 4NXMH 1C3OA 1TWHA 4B3TH 2WB1E 4EBEA 3TQ1A 1C30A 3WWHA 5KFPA 1I1MA 5KT2A 4RUAA 4MV7A 3FKIG 4ECZA 3KALA 5C3EG 1VBGA 5IYDG 1GYFA 5KX5F 4FS2A 4O3SA 5CA0F 2QYZA 2J9GA 2EJ0A 5EWGA 2XIGA 1B6RA 1IOWA 1VBHA 3Q8RB 3RBEA 4JXUA 3GTPA 4C5BA 5C4XG 3VNNA 1ZETA 2AGQA 4A3KG 3IN5A 4ECXA 3J80W 3V6HA 1JLLB 5JVLA 2FKLA 4O7TA 2UXDH 1KJ9A 2R8GA 1KC7A 1WCMG 3CVZA 3BABA 3GILA 3G6YA 4A3FG 4MV3A 5I5VA 2HHHH 2W9BA 4JV1A 3FMAA 4TQSA 3H3VH 5KFQA 1Y1VA 1TA8A 4RNNA 2R8KA 5KFEA 4UCOA 4DL7A 1XNRH 1OBGA 3T5LA 1DV2A 3H20A 4O7NA 2HIVA 2ODTX 4APMA 4B3SH 4CE5A 2FK2A 2MCTA 3GIKA 5LMUH 3HOUG 3MWMA 5DGBA 3QZ7A 4IZOA 2RDJA 4AQYH 3QFFA 1I2LA 3KREA 4ED0A 4RNOA 3JZFA 4A3DG 4GKJH 2J6SA 4HNTA 4WD3A 5CA1F 3R9RA 3KHHA 2FP4B 3R5XA 3RB3A 2WE6A 2PMZE 4GC6A 3PW7A 2CQYA 3JRWA 3T7AA 5FD6A 4TV9F 2YZLA 3HOYG 5DQGA 3OHBA 3M9OB 4TVIA 4YR2A 4DV1H 2ZDHA 2W9CA 5I5SA 4HYKA 1L2ZA 2C22A 2COGA 2ZJTA 3TY9A 3KYHC 3Q1KA 3QQMA 2OWOA 3RGXA 2UVVA 2YRXA 4RCNA 2FK1A 3GTQA 1M6VA 1TWAA 4O84A 3BA8A 2NVYA 4DL2A 3UZBA 2JEFA 4J9LA 3C0FB 4O3PA 2Y4RA 4I4TF 3PO3G 3GB8B 1XNQH 1S97A 3T9DA 5BYAA 4ECSA 2OLSA 4UFZA 1BNCA 4DRFA 4EGJA 3H0GA 4DV2H 1B33N 3RAXA 3J7AK 2COJA 2PBZA 4XYMB 4F4XA 2CKZB 3GV8B 1Y1WA 3JRXA 4DAAA 1EUCB 4LF5H 1W96A 2HHFB 5JUMA 4J9PA 3PW5A 2FMAA 3SGIA 5L1IA 4DL4A 2C00A 3L4JA 2CFMA 4J9SA 1CQJB 2R7ZA 3PVXA 4Q43A 4TUYF 1K1QA 2C2DA 3ETJA 2R92A 4Q8EA 3SI8A 4O7SA 1GGOA 1S03G 4FGRA 3HOWG 3G6VA 5CAEB 5I5TA 2R87A 4FU0A 4FBUA 4DL3A 2V4QA 4EGQA 4DR3H 2JA5G 3LQSA 2XGQA 4DL6A 2HJWA 4BXXG 1N33H 4O2AF 4O7ZA 2DWCA 4IRCA 4YJ2F 1PX2A 3JZ6A 3HOVG 5J2UF 1JIHA 1XK5A 2CW8A 4BY7G 1KJ8A 5JQGF 4M9UA 2VUGA 4DIMA 5IWAH 3FKIA 4YHHH 5KFJA 4EBDA 4ED1A 2CNVA 1JX4A 2UUAH 5BWUA 3RR5A 2FPPB 2R84A 3WO0A 3MR3A 2A1HA 2FLNA 3DF7A 5KFXA 2R7KA 2R82A 4M0JA 3R5HA 3T9BA 1AN7A 3VPCA 5KFKA 4JI8H 5IT9W 3V6KA 4FFPA 4ECVA 3U54A 2C28A 5IP7G 5JH7F 4RZRA 4YJ3F 1N36H 2WAQA 4EQ5A 4AYBA 5KFVA 2VQDA 4WHXA 4FS1A 1ET0A 3MR5A 3OUUA 2NUAB 5DG9A 4JI4H 3R5FA 4IAJA 4RUCA 4CKBA 1I1KA 1WCMA 4DLKA 5IP9G 3BG5A 1KJQA 3WWIA 1CKNA 4Q4CA 2X5RA 3WWJA 2HG8A 4LH6A 1ZHSA 3BA9A 3TIIA 2KSWA 2W8LA 3PW2A 1IBKH 2WTFA 1S10A 5DLGA 3HO8A 1I1LA 1Z2NX 3T9CA 4PZ8A 5HV6A 5KFAA 5LA6F 1I3QA 4CC6A 4FFOA 5L1JA 5FPRA 4FBTA 2FPGB 1RJRA 1E4EA 2YS6A 2VQFH 1SEIA 1T3NA 2UXBH 4O7RA 5FLMG 3RBDA 4JV2A 4R7RA 4U7CA 4RU9A 3PN1A 3K5IA 4QIWA 1HNXH 1V9PA 4LSXA 5KFRA 3T9EA 4LSAA 1N48A 2HGSA 1HNWH 3U9SA 3BQ1A 4C2MA 5KFNA 4NZNA 4MTEA 4LF8H 4MA0A 2XCPA 3KAKA 4RNMA 3GIJA 2ZDGA 5D1OA 3GIQA 4F4ZA 3GTOA 4A3JG 4ED7A 4HN2A 3KXYT 4FM9A 2PVPA 3K3VA 2XC9A 2W6QA 4JV0A 3JAMW 4BWSC 3J81W 1EZ1A 1I94H 4DR6H 4JUZA 2RGVA 1B6SA 5LYJF 2V58A 5KT5A 5FLXW 3JSLA 5KFZA 3GJXB 3BQ2A 5KG2A 3EPIA 1IBLH 3VPBA 3I12A 5FD5A 5JVDF 3AX6A 5KFIA 3SNOA 1S0MA 2HVQA 2C2RA 4LMYA 1T94A 4MV9A 1K1SA 2YU9A 5DG8A 4ECYA 1W93A 2ZGIA 4FE2A 1ZHQA 3N40P 4JYAH 4O4JF 2FLLA 4NXNH 2JEIA 5CR5A 3N6RA 4EEQA 4QJFA 1I2KA 2HVSA 1EHIA 2YZGA 1CKOA 1A48A 1TWFA 2FJZA 5KFSA 3M4IA 4BY1G 1DIKA 5CE8A 2V9WA 1Y14B 4YY3H 1VS0A 3KHGA 3TEKA 5I5XA 1ULZA 2XD4A 3VPDA 3SE7A 4A3MG 2VA3A 4A3GG 5D1PA 2FPIB 2COIA 2QF7A 4E6NA 1TWCA 4J0MA 4Q4DA 3U55A 4QWCA 1K83A 3AW8A 5KT7A 4EFEA 4HR7A 4ED3A 2JA5A 3RTXA 2R93G 2RDIA 3RUPA 2Y0SE 1DAAA 1DV1A 3MFHA 1OWTA 4QSHA 1KT8A 1AUXA 4DV3H 1S68A 3V6JA 4RB1A 3RB6A 4U6PA 2IA6A 5K2MA 3NBYB 5FPOA 3U9TA 1S9FA 3GTKA 2W70A 3UFXB 4ZHQF 5KG6A 5DQHA 1EKPA 4ECWA 4PBCA 4DL5A 4EEYA 4A3EG 2BQUA 2VUMG 4Q44A 5KFTA 3TW6A 4O82A 4O86A 4TQRA 2ASDA 4O4HF 1RJQA 2B63G 5DLFA 4Q45A 3W5OA 4UCVA 5E25A 4ED6A 1CKMA 3UQ8A 3ETHA 4NZMA 3T5HA 3N43B 2DZDA 3K3PA 1I50A 4LF9H 4PZ7A 2R85A 5I5YA 3PW4A 1I7NA 3LWBA 2M05A 3L4KA 3VA7A 2BQ3A 1UNNC 2E5LH 2YZMA 3HKZA 4B3MH 5FJ8G 3CQZA 2C35B 5FNVF 1CS0A 4XZ3B 1RK5A 2WB1A 1Z2PX 3WO1A 3CSWA 5KT3A 1EKVA 5KKNB 3BACA 3OUZA 2ABJA 4MV4A 4LF4H 1N32H 4J9RA 4R8UB 2FK3A 5IYBG 3GV7B 4DR5H 4YAJB 5KT4A 3GTJA 4ED8A 2E2HA 2VPQA 3HB9A 4A3IG 2AGOA 4QW9A 2XGPA 4O81A 2JEJA 1EYZA 2W8KA 1A0GA 4O2BF 5LP6F 2FE3A 2YW2A 4PDBA 1JXLA 4YP3A 5K3WA 4QWAA 3RB0A 4OX9H 4BBSG 1WRVA 2DAAA 4YB8B 2WDTA 4LFAH 2UVWA 4MA5A 1GSOA 2P0AA 3BJYA 4HNVA 1R9TA 4QW8A 5BWXA 4UUGA 4B3RH 4ZQIA 2V5AA 1O75A 4DUZH 4YR0A 4FFNA 4XYLB 1KJIA 5LXTF 2R7NA 4O7WA 1AUVA 4WBNF 1KBLA
chains in the Genus database with same CATH topology
2XCLA 3MWDA 4IWXA 2CNQA 2YWVA 5EZYF 5JQWA 4ZOLF 2V59A 4IIJF 2NU8B 4XX0B 3RV4A 2NU7B 4O7VA 2R7LA 5LOVF 2W6ZA 4O83A 2IP4A 2YZNA 4E4TA 3VOTA 3ORRA 5BPFA 3ORQA 3NUAA 4MV1A 1T36A 4EG0A 5H80A 2CNUA 4MV6A 4C5AA 4NYEA 2Z04A 1JKJB 5CB4F 2ZDQA 4HQ6A 3TINA 2NU9B 3TIGA 5D8DA 4ME6A 1JDEA 2R7MA 4Y8VB 4FFLA 4C5CA 2W6MA 3MWEA 5J2TF 2YRWA 3KAJA 1Z2OX 2GPSA 4FFMA 2NU6B 3RV3A 1KJJA 4O4LF 4HNUA 3RFCA 4I50F 4IHJF 2FB9A 2X0SA 4MAMA 1EUDB 1GSAA 3LP8A 3VMMA 1IOVA 2GQRA 2R86A 2Z02A 3MJFA 2GLTA 2DLNA 2DIKA 4O4IF 3TQTA 5BPHA 3Q2OA 1I7LA 2CZGA 1CQIB 1OBDA 1E4EB 4YBZB 4RZQA 5C1OA 2W71A 1M0WA 1KEEA 1CE8A 2YYAA 4I55F 5C1PA 1A9XA 3JZIA 3WNZA 3G8DA 4MV8A 3G8CA 2W6OA 5IYZF 2YS7A 2WYOA 2I8CA 1SCUB 5I47A 1KUTA 3R23A 3GIDA 2SCUB 4ZI7F 2I80A 3N8DA 1UC8A 1UC9A 4YAKB 2YL2A 5DMXA 1JDBB 4FFRA 3GLKA 3V4ZA 2GQSA 1GSHA 4L1KA 3HBLA 3K5HA 5BMVF 1BXRA 1VKZA 5C8YF 2GPWA 5HBRB 1GLVA 2I87A 2QK4A 1PK8A 4TV8F 3E5NA 1WR2A 1M0TA 2W6PA 2W6NA 4IWYA 2PN1A 3V4SA 2VR1A 5GONF 4O7LA 2R6FA 4O7YA 1C3OA 1C30A 4MV7A 3KALA 1VBGA 5KX5F 5CA0F 2J9GA 1B6RA 1IOWA 1VBHA 4C5BA 1JLLB 5JVLA 4O7TA 1KJ9A 1KC7A 4MV3A 1OBGA 1DV2A 4O7NA 4IZOA 3QFFA 3KREA 3JZFA 4HNTA 4WD3A 5CA1F 3R9RA 2FP4B 3R5XA 2CQYA 3JRWA 4TV9F 2YZLA 2ZDHA 3Q1KA 2YRXA 1M6VA 4O84A 4I4TF 2OLSA 1BNCA 4EGJA 2PBZA 4XYMB 3JRXA 1EUCB 1W96A 2C00A 1CQJB 4TUYF 3ETJA 4O7SA 1GGOA 4FGRA 5CAEB 2R87A 4FU0A 4EGQA 2HJWA 4O2AF 4O7ZA 2DWCA 4YJ2F 1PX2A 5J2UF 1KJ8A 5JQGF 4M9UA 4DIMA 2CNVA 2FPPB 2R84A 3WO0A 3DF7A 2R7KA 2R82A 3R5HA 3VPCA 4FFPA 3U54A 5JH7F 4YJ3F 2VQDA 3OUUA 2NUAB 3R5FA 4DLKA 3BG5A 1KJQA 3TIIA 3HO8A 1Z2NX 5HV6A 5LA6F 4FFOA 2FPGB 1E4EA 2YS6A 4O7RA 3K5IA 2HGSA 3U9SA 4MA0A 3KAKA 2ZDGA 2PVPA 2W6QA 1EZ1A 1B6SA 5LYJF 2V58A 3VPBA 3I12A 5JVDF 3AX6A 4MV9A 1W93A 4FE2A 4O4JF 3N6RA 1EHIA 2YZGA 1A48A 1DIKA 1ULZA 2XD4A 3VPDA 3SE7A 2FPIB 2QF7A 3U55A 3AW8A 4HR7A 3RUPA 1DV1A 4QSHA 1AUXA 5K2MA 3U9TA 2W70A 3UFXB 4ZHQF 3TW6A 4O82A 4O86A 4O4HF 3ETHA 2DZDA 3K3PA 2R85A 1I7NA 3LWBA 3VA7A 2YZMA 5FNVF 1CS0A 4XZ3B 1Z2PX 3WO1A 5KKNB 3OUZA 4MV4A 4YAJB 2VPQA 3HB9A 4O81A 1EYZA 5LP6F 4O2BF 2YW2A 4YB8B 4MA5A 1GSOA 2P0AA 4HNVA 4ZQIA 2V5AA 4FFNA 4XYLB 1KJIA 5LXTF 2R7NA 4O7WA 1AUVA 4WBNF 1KBLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XCL A;  3MWD A;  4IWX A;  2CNQ A;  2YWV A;  5EZY F;  5JQW A;  4ZOL F;  2V59 A;  4IIJ F;  2NU8 B;  4XX0 B;  3RV4 A;  2NU7 B;  4O7V A;  2R7L A;  5LOV F;  2W6Z A;  4O83 A;  2IP4 A;  2YZN A;  4E4T A;  3VOT A;  3ORR A;  5BPF A;  3ORQ A;  3NUA A;  4MV1 A;  1T36 A;  4EG0 A;  5H80 A;  2CNU A;  4MV6 A;  4C5A A;  4NYE A;  2Z04 A;  1JKJ B;  5CB4 F;  2ZDQ A;  4HQ6 A;  3TIN A;  2NU9 B;  3TIG A;  5D8D A;  4ME6 A;  1JDE A;  2R7M A;  4Y8V B;  4FFL A;  4C5C A;  2W6M A;  3MWE A;  5J2T F;  2YRW A;  3KAJ A;  1Z2O X;  2GPS A;  4FFM A;  2NU6 B;  3RV3 A;  1KJJ A;  4O4L F;  4HNU A;  3RFC A;  4I50 F;  4IHJ F;  2FB9 A;  2X0S A;  4MAM A;  1EUD B;  1GSA A;  3LP8 A;  3VMM A;  1IOV A;  2GQR A;  2R86 A;  2Z02 A;  3MJF A;  2GLT A;  2DLN A;  2DIK A;  4O4I F;  3TQT A;  5BPH A;  3Q2O A;  1I7L A;  2CZG A;  1CQI B;  1OBD A;  1E4E B;  4YBZ B;  4RZQ A;  5C1O A;  2W71 A;  1M0W A;  1KEE A;  1CE8 A;  2YYA A;  4I55 F;  5C1P A;  1A9X A;  3JZI A;  3WNZ A;  3G8D A;  4MV8 A;  3G8C A;  2W6O A;  5IYZ F;  2YS7 A;  2WYO A;  2I8C A;  1SCU B;  5I47 A;  1KUT A;  3R23 A;  3GID A;  2SCU B;  4ZI7 F;  2I80 A;  3N8D A;  1UC8 A;  1UC9 A;  4YAK B;  2YL2 A;  5DMX A;  1JDB B;  4FFR A;  3GLK A;  3V4Z A;  2GQS A;  1GSH A;  4L1K A;  3HBL A;  3K5H A;  5BMV F;  1BXR A;  1VKZ A;  5C8Y F;  2GPW A;  5HBR B;  1GLV A;  2I87 A;  2QK4 A;  1PK8 A;  4TV8 F;  3E5N A;  1WR2 A;  1M0T A;  2W6P A;  2W6N A;  4IWY A;  2PN1 A;  3V4S A;  2VR1 A;  5GON F;  4O7L A;  2R6F A;  4O7Y A;  1C3O A;  1C30 A;  4MV7 A;  3KAL A;  1VBG A;  5KX5 F;  5CA0 F;  2J9G A;  1B6R A;  1IOW A;  1VBH A;  4C5B A;  1JLL B;  5JVL A;  4O7T A;  1KJ9 A;  1KC7 A;  4MV3 A;  1OBG A;  1DV2 A;  4O7N A;  4IZO A;  3QFF A;  3KRE A;  3JZF A;  4HNT A;  4WD3 A;  5CA1 F;  3R9R A;  2FP4 B;  3R5X A;  2CQY A;  3JRW A;  4TV9 F;  2YZL A;  2ZDH A;  3Q1K A;  2YRX A;  1M6V A;  4O84 A;  4I4T F;  2OLS A;  1BNC A;  4EGJ A;  2PBZ A;  4XYM B;  3JRX A;  1EUC B;  1W96 A;  2C00 A;  1CQJ B;  4TUY F;  3ETJ A;  4O7S A;  1GGO A;  4FGR A;  5CAE B;  2R87 A;  4FU0 A;  4EGQ A;  2HJW A;  4O2A F;  4O7Z A;  2DWC A;  4YJ2 F;  1PX2 A;  5J2U F;  1KJ8 A;  5JQG F;  4M9U A;  4DIM A;  2CNV A;  2FPP B;  2R84 A;  3WO0 A;  3DF7 A;  2R7K A;  2R82 A;  3R5H A;  3VPC A;  4FFP A;  3U54 A;  5JH7 F;  4YJ3 F;  2VQD A;  3OUU A;  2NUA B;  3R5F A;  4DLK A;  3BG5 A;  1KJQ A;  3TII A;  3HO8 A;  1Z2N X;  5HV6 A;  5LA6 F;  4FFO A;  2FPG B;  1E4E A;  2YS6 A;  4O7R A;  3K5I A;  2HGS A;  3U9S A;  4MA0 A;  3KAK A;  2ZDG A;  2PVP A;  2W6Q A;  1EZ1 A;  1B6S A;  5LYJ F;  2V58 A;  3VPB A;  3I12 A;  5JVD F;  3AX6 A;  4MV9 A;  1W93 A;  4FE2 A;  4O4J F;  3N6R A;  1EHI A;  2YZG A;  1A48 A;  1DIK A;  1ULZ A;  2XD4 A;  3VPD A;  3SE7 A;  2FPI B;  2QF7 A;  3U55 A;  3AW8 A;  4HR7 A;  3RUP A;  1DV1 A;  4QSH A;  1AUX A;  5K2M A;  3U9T A;  2W70 A;  3UFX B;  4ZHQ F;  3TW6 A;  4O82 A;  4O86 A;  4O4H F;  3ETH A;  2DZD A;  3K3P A;  2R85 A;  1I7N A;  3LWB A;  3VA7 A;  2YZM A;  5FNV F;  1CS0 A;  4XZ3 B;  1Z2P X;  3WO1 A;  5KKN B;  3OUZ A;  4MV4 A;  4YAJ B;  2VPQ A;  3HB9 A;  4O81 A;  1EYZ A;  5LP6 F;  4O2B F;  2YW2 A;  4YB8 B;  4MA5 A;  1GSO A;  2P0A A;  4HNV A;  4ZQI A;  2V5A A;  4FFN A;  4XYL B;  1KJI A;  5LXT F;  2R7N A;  4O7W A;  1AUV A;  4WBN F;  1KBL A; 
#chains in the Genus database with same CATH topology
 2XCL A;  4MTD A;  3MWD A;  2DAB A;  4IWX A;  3NBZ B;  3U0G A;  3L2P A;  2HVR A;  2CNQ A;  3DTF A;  4UCS A;  1RJP A;  2VA2 A;  2YWV A;  5EZY F;  5JQW A;  2V4R A;  4ZOL F;  4EFB A;  1TAE A;  4X64 H;  3RB4 A;  4PZ6 A;  4O3N A;  3HOX G;  2V59 A;  2HGX A;  4JI5 H;  4IIJ F;  2ASJ A;  5BWR A;  5BWT A;  2NU8 B;  3T99 A;  5KS8 A;  4J9Q A;  2JA6 G;  3I4M G;  4XX0 B;  5KFC A;  2W9A A;  2PMZ A;  2FLP A;  3RV4 A;  2ASL A;  3T9A A;  2NU7 B;  4RB2 C;  4O7V A;  4CMD A;  4YQW A;  2R7L A;  5LOV F;  1SYX B;  4ECQ A;  2W7P A;  5DGA A;  4TM5 A;  3N6X A;  3T54 A;  2DPJ A;  1WSC A;  3GIM A;  2J6U A;  3GTL A;  2W6Z A;  2JA7 G;  4O83 A;  4O3O A;  3T5K A;  2IP4 A;  2YZN A;  5KT6 A;  2DPI A;  4E4T A;  4J9M A;  4A3B G;  1A0I A;  3VOT A;  3RIZ A;  5HNE A;  4GC7 A;  1I6U A;  5KFH A;  3DAA A;  2W9C B;  1XMQ H;  4NZO A;  5DGI A;  4JI7 H;  4G3I A;  3ORR A;  1B04 A;  5KFL A;  5BPF A;  4I7H A;  3PR5 B;  3FDS A;  4A2B A;  5A2Q W;  4F50 A;  1RYR A;  4Q0Y A;  3ORQ A;  1E4G T;  4X62 H;  2HHF A;  2W7O A;  2EIY A;  4GKK H;  3HT5 A;  1P8L A;  3W1G A;  4CKE A;  3NUA A;  2Q2U A;  2VOB A;  5EDW A;  3JSN A;  4JI3 H;  4MV1 A;  2JEG A;  2AQ4 A;  2YCH A;  2R93 A;  4DV4 H;  1T36 A;  3MR6 A;  2RGR A;  3H4B A;  4EG0 A;  5H80 A;  2CNU A;  4MV6 A;  2UXC H;  4C5A A;  1V4Y A;  4RAY A;  3Q8S B;  4IRD A;  4CKC A;  3AYH B;  4UCT A;  2HDK A;  3F8N A;  2R8H A;  2UUB H;  4NYE A;  3HXL A;  5KFG A;  4ETS A;  2F4V H;  3GTG A;  2JA8 G;  2Z04 A;  1JKJ B;  5CB4 F;  2VUM A;  2ZDQ A;  4HQ6 A;  5IYC G;  2QB5 A;  5EWE A;  3H4D A;  3TIN A;  5CM0 A;  4LF7 H;  2B63 A;  2NU9 B;  3TIG A;  5D8D A;  4K0K H;  4ME6 A;  3OSP A;  3LML A;  5L1L A;  2ATL A;  5BYB A;  4UCR A;  3UZO A;  2AGP A;  1JDE A;  2CW7 A;  2R7M A;  3PO2 G;  1BJT A;  2E2I A;  4BBR G;  4Y8V B;  5KG3 A;  1S0O A;  4FFL A;  3Q8P B;  4GLX A;  3HOZ G;  4C5C A;  3RGZ A;  4JI0 H;  2VQE H;  2W6M A;  3MWE A;  1EKF A;  2YRW A;  3KAJ A;  5J2T F;  1Z2O X;  1GO3 E;  4RAZ A;  4EYH B;  3N44 B;  3NC0 B;  5DQI A;  3RJ0 A;  2GPS A;  5I5W A;  5F9N A;  2BQR A;  4QWB A;  5KG1 A;  4LFC H;  4A3L G;  3GII A;  4KHP H;  4LFB H;  5LL6 b;  3PZP A;  1N56 A;  4FFM A;  2J6T A;  3H40 A;  5C44 G;  2NU6 B;  3RV3 A;  1KJJ A;  4O4L F;  1FVI A;  3M9N B;  4ECU A;  5EOY A;  2WAQ E;  4HNU A;  4AYB E;  3RFC A;  1XMO H;  4I50 F;  1SFO A;  4IHJ F;  5KFY A;  3T5J A;  2BR0 A;  4Q8F A;  4DQN A;  2FB9 A;  2X0S A;  4MAM A;  3T9F A;  1EUD B;  1GSA A;  4M7E A;  3LP8 A;  5DGH A;  3VMM A;  3NGD A;  5DG7 A;  1IOV A;  2GQR A;  2R86 A;  1ZQ7 A;  5L9X A;  3MFI A;  4EBC A;  1FJG H;  2Z02 A;  3MJF A;  2GLT A;  3OHA A;  4DV6 H;  3OSN A;  4NLG A;  2DLN A;  2DIK A;  3CEB A;  4JI6 H;  2HGW A;  4DV7 H;  2ALZ A;  5C5J A;  2UU9 H;  4F4Y A;  1CKN B;  4RB0 A;  2O03 A;  4O4I F;  3RAQ A;  5DAA A;  5KG5 A;  3TQT A;  5BPH A;  5T14 A;  1KTA A;  3Q2O A;  1I7L A;  3GDE A;  3QZ8 A;  2CZG A;  3QWU A;  1M7J A;  3G6X A;  4DR2 H;  1HNZ H;  4J9N A;  3W1B A;  1S0N A;  1HR0 H;  5F9L A;  2JA6 A;  1CQI B;  3KHR A;  4QIW E;  1OBD A;  4ECR A;  5KFW A;  3KHL A;  4RB3 C;  1E4E B;  3S24 A;  5I60 A;  4O3R A;  5L1K A;  1Y1V G;  2IMW P;  1DGS A;  4YBZ B;  2JA7 A;  2Q7D A;  2XCA A;  4X66 H;  1IBM H;  2UVR A;  2RF4 A;  1FKA H;  4RZQ A;  5C1O A;  3GV5 B;  2NVX A;  2W71 A;  5KG0 A;  4A93 G;  3KTM A;  1M0W A;  2EJ3 A;  1KEE A;  3I4N G;  1CE8 A;  2YYA A;  5EWF A;  3TY8 A;  2IBK A;  2ZM6 H;  4I55 F;  5C1P A;  2VPS A;  2R8I A;  5D1O B;  5KFO A;  1A9X A;  3JZI A;  3T1H H;  3WNZ A;  3G8D A;  4QWD A;  4LH7 A;  1RK6 A;  4DR7 H;  1WH2 A;  4MV8 A;  5KFU A;  4F4W A;  3G8C A;  2W6O A;  4UCU A;  5IYZ F;  2YS7 A;  3M9M B;  4EYI B;  4PWQ A;  4DUY H;  4ED2 A;  4IRK A;  3GTM A;  2EJ2 A;  4K6N A;  2WYO A;  2I8C A;  5I5U A;  2C2E A;  5KFD A;  5DIS C;  1SCU B;  2W9B B;  3RF2 A;  1V51 A;  2AU0 A;  2UVU A;  5I47 A;  1KUT A;  3R23 A;  3GID A;  1E4F T;  4J9K A;  1RYS A;  1J5E H;  2SCU B;  4X65 H;  5LMN H;  4IR1 A;  3T1Y H;  3IG0 A;  4ZI7 F;  3OTO H;  1XDN A;  2I80 A;  3BAA A;  3N8D A;  1X9N A;  1UC8 A;  1UC9 A;  4YAK B;  3LUL A;  5BWV A;  2YL2 A;  5DMX A;  1VAJ A;  3H0G G;  3TW7 A;  1JDB B;  4FFR A;  1MZB A;  1IYD A;  3GLK A;  2GQS A;  3V4Z A;  2W57 A;  4DV0 H;  2OH2 A;  1GSH A;  4DR1 H;  1Y1W G;  4L1K A;  3HBL A;  1ZAU A;  3K5H A;  2Y0S A;  4JI1 H;  4QWE A;  5KFB A;  5BMV F;  1BXR A;  3N41 B;  1VKZ A;  5KG7 A;  5C8Y F;  4CMF A;  5FR9 A;  2GPW A;  3UYY A;  5BR8 H;  5HBR B;  3EYY A;  4YR3 A;  4LF6 H;  1GLV A;  1P16 A;  2I87 A;  2R7Z G;  4ECT A;  5KFF A;  2QK4 A;  4DR4 H;  1G2W A;  1PK8 A;  4TV8 F;  3PW0 A;  2R92 G;  1IYE A;  3E5N A;  4GLW A;  4DV5 H;  1N34 H;  1WR2 A;  3PFF A;  2HIX A;  5KG4 A;  5BWW A;  1M0T A;  3DTG A;  2W6P A;  2W6N A;  4IWY A;  2R8J A;  4A3C G;  3EPG A;  4A2A A;  4O3Q A;  4IR9 A;  3BQ0 A;  5KFM A;  4CC5 A;  1BGW A;  2PN1 A;  3V4S A;  1TWG A;  3PR4 A;  2VR1 A;  3GQC A;  5GON F;  4CHI A;  4J9O A;  4JV5 H;  4O7L A;  2R6F A;  3Q8Q B;  2Q2T A;  3N42 B;  4R8U A;  4O7Y A;  3HKZ E;  3MR2 A;  2UUC H;  3GIP A;  3TY5 A;  4JI2 H;  1A3G A;  4NXM H;  1C3O A;  1TWH A;  4B3T H;  2WB1 E;  4EBE A;  3TQ1 A;  1C30 A;  3WWH A;  5KFP A;  1I1M A;  5KT2 A;  4RUA A;  4MV7 A;  3FKI G;  4ECZ A;  3KAL A;  5C3E G;  1VBG A;  5IYD G;  1GYF A;  5KX5 F;  4FS2 A;  4O3S A;  5CA0 F;  2QYZ A;  2J9G A;  2EJ0 A;  5EWG A;  2XIG A;  1B6R A;  1IOW A;  1VBH A;  3Q8R B;  3RBE A;  4JXU A;  3GTP A;  4C5B A;  5C4X G;  3VNN A;  1ZET A;  2AGQ A;  4A3K G;  3IN5 A;  4ECX A;  3J80 W;  3V6H A;  1JLL B;  5JVL A;  2FKL A;  4O7T A;  2UXD H;  1KJ9 A;  2R8G A;  1KC7 A;  1WCM G;  3CVZ A;  3BAB A;  3GIL A;  3G6Y A;  4A3F G;  4MV3 A;  5I5V A;  2HHH H;  2W9B A;  4JV1 A;  3FMA A;  4TQS A;  3H3V H;  5KFQ A;  1Y1V A;  1TA8 A;  4RNN A;  2R8K A;  5KFE A;  4UCO A;  4DL7 A;  1XNR H;  1OBG A;  3T5L A;  1DV2 A;  3H20 A;  4O7N A;  2HIV A;  2ODT X;  4APM A;  4B3S H;  4CE5 A;  2FK2 A;  2MCT A;  3GIK A;  5LMU H;  3HOU G;  3MWM A;  5DGB A;  3QZ7 A;  4IZO A;  2RDJ A;  4AQY H;  3QFF A;  1I2L A;  3KRE A;  4ED0 A;  4RNO A;  3JZF A;  4A3D G;  4GKJ H;  2J6S A;  4HNT A;  4WD3 A;  5CA1 F;  3R9R A;  3KHH A;  2FP4 B;  3R5X A;  3RB3 A;  2WE6 A;  2PMZ E;  4GC6 A;  3PW7 A;  2CQY A;  3JRW A;  3T7A A;  5FD6 A;  4TV9 F;  2YZL A;  3HOY G;  5DQG A;  3OHB A;  3M9O B;  4TVI A;  4YR2 A;  4DV1 H;  2ZDH A;  2W9C A;  5I5S A;  4HYK A;  1L2Z A;  2C22 A;  2COG A;  2ZJT A;  3TY9 A;  3KYH C;  3Q1K A;  3QQM A;  2OWO A;  3RGX A;  2UVV A;  2YRX A;  4RCN A;  2FK1 A;  3GTQ A;  1M6V A;  1TWA A;  4O84 A;  3BA8 A;  2NVY A;  4DL2 A;  3UZB A;  2JEF A;  4J9L A;  3C0F B;  4O3P A;  2Y4R A;  4I4T F;  3PO3 G;  3GB8 B;  1XNQ H;  1S97 A;  3T9D A;  5BYA A;  4ECS A;  2OLS A;  4UFZ A;  1BNC A;  4DRF A;  4EGJ A;  3H0G A;  4DV2 H;  1B33 N;  3RAX A;  3J7A K;  2COJ A;  2PBZ A;  4XYM B;  4F4X A;  2CKZ B;  3GV8 B;  1Y1W A;  3JRX A;  4DAA A;  1EUC B;  4LF5 H;  1W96 A;  2HHF B;  5JUM A;  4J9P A;  3PW5 A;  2FMA A;  3SGI A;  5L1I A;  4DL4 A;  2C00 A;  3L4J A;  2CFM A;  4J9S A;  1CQJ B;  2R7Z A;  3PVX A;  4Q43 A;  4TUY F;  1K1Q A;  2C2D A;  3ETJ A;  2R92 A;  4Q8E A;  3SI8 A;  4O7S A;  1GGO A;  1S03 G;  4FGR A;  3HOW G;  3G6V A;  5CAE B;  5I5T A;  2R87 A;  4FU0 A;  4FBU A;  4DL3 A;  2V4Q A;  4EGQ A;  4DR3 H;  2JA5 G;  3LQS A;  2XGQ A;  4DL6 A;  2HJW A;  4BXX G;  1N33 H;  4O2A F;  4O7Z A;  2DWC A;  4IRC A;  4YJ2 F;  1PX2 A;  3JZ6 A;  3HOV G;  5J2U F;  1JIH A;  1XK5 A;  2CW8 A;  4BY7 G;  1KJ8 A;  5JQG F;  4M9U A;  2VUG A;  4DIM A;  5IWA H;  3FKI A;  4YHH H;  5KFJ A;  4EBD A;  4ED1 A;  2CNV A;  1JX4 A;  2UUA H;  5BWU A;  3RR5 A;  2FPP B;  2R84 A;  3WO0 A;  3MR3 A;  2A1H A;  2FLN A;  3DF7 A;  5KFX A;  2R7K A;  2R82 A;  4M0J A;  3R5H A;  3T9B A;  1AN7 A;  3VPC A;  5KFK A;  4JI8 H;  5IT9 W;  3V6K A;  4FFP A;  4ECV A;  3U54 A;  2C28 A;  5IP7 G;  5JH7 F;  4RZR A;  4YJ3 F;  1N36 H;  2WAQ A;  4EQ5 A;  4AYB A;  5KFV A;  2VQD A;  4WHX A;  4FS1 A;  1ET0 A;  3MR5 A;  3OUU A;  2NUA B;  5DG9 A;  4JI4 H;  3R5F A;  4IAJ A;  4RUC A;  4CKB A;  1I1K A;  1WCM A;  4DLK A;  5IP9 G;  3BG5 A;  1KJQ A;  3WWI A;  1CKN A;  4Q4C A;  2X5R A;  3WWJ A;  2HG8 A;  4LH6 A;  1ZHS A;  3BA9 A;  3TII A;  2KSW A;  2W8L A;  3PW2 A;  1IBK H;  2WTF A;  1S10 A;  5DLG A;  3HO8 A;  1I1L A;  1Z2N X;  3T9C A;  4PZ8 A;  5HV6 A;  5KFA A;  5LA6 F;  1I3Q A;  4CC6 A;  4FFO A;  5L1J A;  5FPR A;  4FBT A;  2FPG B;  1RJR A;  1E4E A;  2YS6 A;  2VQF H;  1SEI A;  1T3N A;  2UXB H;  4O7R A;  5FLM G;  3RBD A;  4JV2 A;  4R7R A;  4U7C A;  4RU9 A;  3PN1 A;  3K5I A;  4QIW A;  1HNX H;  1V9P A;  4LSX A;  5KFR A;  3T9E A;  4LSA A;  1N48 A;  2HGS A;  1HNW H;  3U9S A;  3BQ1 A;  4C2M A;  5KFN A;  4NZN A;  4MTE A;  4LF8 H;  4MA0 A;  2XCP A;  3KAK A;  4RNM A;  3GIJ A;  2ZDG A;  5D1O A;  3GIQ A;  4F4Z A;  3GTO A;  4A3J G;  4ED7 A;  4HN2 A;  3KXY T;  4FM9 A;  2PVP A;  3K3V A;  2XC9 A;  2W6Q A;  4JV0 A;  3JAM W;  4BWS C;  3J81 W;  1EZ1 A;  1I94 H;  4DR6 H;  4JUZ A;  2RGV A;  1B6S A;  5LYJ F;  2V58 A;  5KT5 A;  5FLX W;  3JSL A;  5KFZ A;  3GJX B;  3BQ2 A;  5KG2 A;  3EPI A;  1IBL H;  3VPB A;  3I12 A;  5FD5 A;  5JVD F;  3AX6 A;  5KFI A;  3SNO A;  1S0M A;  2HVQ A;  2C2R A;  4LMY A;  1T94 A;  4MV9 A;  1K1S A;  2YU9 A;  5DG8 A;  4ECY A;  1W93 A;  2ZGI A;  4FE2 A;  1ZHQ A;  3N40 P;  4JYA H;  4O4J F;  2FLL A;  4NXN H;  2JEI A;  5CR5 A;  3N6R A;  4EEQ A;  4QJF A;  1I2K A;  2HVS A;  1EHI A;  2YZG A;  1CKO A;  1A48 A;  1TWF A;  2FJZ A;  5KFS A;  3M4I A;  4BY1 G;  1DIK A;  5CE8 A;  2V9W A;  1Y14 B;  4YY3 H;  1VS0 A;  3KHG A;  3TEK A;  5I5X A;  1ULZ A;  2XD4 A;  3VPD A;  3SE7 A;  4A3M G;  2VA3 A;  4A3G G;  5D1P A;  2FPI B;  2COI A;  2QF7 A;  4E6N A;  1TWC A;  4J0M A;  4Q4D A;  3U55 A;  4QWC A;  1K83 A;  3AW8 A;  5KT7 A;  4EFE A;  4HR7 A;  4ED3 A;  2JA5 A;  3RTX A;  2R93 G;  2RDI A;  3RUP A;  2Y0S E;  1DAA A;  1DV1 A;  3MFH A;  1OWT A;  4QSH A;  1KT8 A;  1AUX A;  4DV3 H;  1S68 A;  3V6J A;  4RB1 A;  3RB6 A;  4U6P A;  2IA6 A;  5K2M A;  3NBY B;  5FPO A;  3U9T A;  1S9F A;  3GTK A;  2W70 A;  3UFX B;  4ZHQ F;  5KG6 A;  5DQH A;  1EKP A;  4ECW A;  4PBC A;  4DL5 A;  4EEY A;  4A3E G;  2BQU A;  2VUM G;  4Q44 A;  5KFT A;  3TW6 A;  4O82 A;  4O86 A;  4TQR A;  2ASD A;  4O4H F;  1RJQ A;  2B63 G;  5DLF A;  4Q45 A;  3W5O A;  4UCV A;  5E25 A;  4ED6 A;  1CKM A;  3UQ8 A;  3ETH A;  4NZM A;  3T5H A;  3N43 B;  2DZD A;  3K3P A;  1I50 A;  4LF9 H;  4PZ7 A;  2R85 A;  5I5Y A;  3PW4 A;  1I7N A;  3LWB A;  2M05 A;  3L4K A;  3VA7 A;  2BQ3 A;  1UNN C;  2E5L H;  2YZM A;  3HKZ A;  4B3M H;  5FJ8 G;  3CQZ A;  2C35 B;  5FNV F;  1CS0 A;  4XZ3 B;  1RK5 A;  2WB1 A;  1Z2P X;  3WO1 A;  3CSW A;  5KT3 A;  1EKV A;  5KKN B;  3BAC A;  3OUZ A;  2ABJ A;  4MV4 A;  4LF4 H;  1N32 H;  4J9R A;  4R8U B;  2FK3 A;  5IYB G;  3GV7 B;  4DR5 H;  4YAJ B;  5KT4 A;  3GTJ A;  4ED8 A;  2E2H A;  2VPQ A;  3HB9 A;  4A3I G;  2AGO A;  4QW9 A;  2XGP A;  4O81 A;  2JEJ A;  1EYZ A;  2W8K A;  1A0G A;  4O2B F;  5LP6 F;  2FE3 A;  2YW2 A;  4PDB A;  1JXL A;  4YP3 A;  5K3W A;  4QWA A;  3RB0 A;  4OX9 H;  4BBS G;  1WRV A;  2DAA A;  4YB8 B;  2WDT A;  4LFA H;  2UVW A;  4MA5 A;  1GSO A;  2P0A A;  3BJY A;  4HNV A;  1R9T A;  4QW8 A;  5BWX A;  4UUG A;  4B3R H;  4ZQI A;  2V5A A;  1O75 A;  4DUZ H;  4YR0 A;  4FFN A;  4XYL B;  1KJI A;  5LXT F;  2R7N A;  4O7W A;  1AUV A;  4WBN F;  1KBL A; 
#chains in the Genus database with same CATH homology
 2XCL A;  3MWD A;  4IWX A;  2CNQ A;  2YWV A;  5EZY F;  5JQW A;  4ZOL F;  2V59 A;  4IIJ F;  2NU8 B;  4XX0 B;  3RV4 A;  2NU7 B;  4O7V A;  2R7L A;  5LOV F;  2W6Z A;  4O83 A;  2IP4 A;  2YZN A;  4E4T A;  3VOT A;  3ORR A;  5BPF A;  3ORQ A;  3NUA A;  4MV1 A;  1T36 A;  4EG0 A;  5H80 A;  2CNU A;  4MV6 A;  4C5A A;  4NYE A;  2Z04 A;  1JKJ B;  5CB4 F;  2ZDQ A;  4HQ6 A;  3TIN A;  2NU9 B;  3TIG A;  5D8D A;  4ME6 A;  1JDE A;  2R7M A;  4Y8V B;  4FFL A;  4C5C A;  2W6M A;  3MWE A;  5J2T F;  2YRW A;  3KAJ A;  1Z2O X;  2GPS A;  4FFM A;  2NU6 B;  3RV3 A;  1KJJ A;  4O4L F;  4HNU A;  3RFC A;  4I50 F;  4IHJ F;  2FB9 A;  2X0S A;  4MAM A;  1EUD B;  1GSA A;  3LP8 A;  3VMM A;  1IOV A;  2GQR A;  2R86 A;  2Z02 A;  3MJF A;  2GLT A;  2DLN A;  2DIK A;  4O4I F;  3TQT A;  5BPH A;  3Q2O A;  1I7L A;  2CZG A;  1CQI B;  1OBD A;  1E4E B;  4YBZ B;  4RZQ A;  5C1O A;  2W71 A;  1M0W A;  1KEE A;  1CE8 A;  2YYA A;  4I55 F;  5C1P A;  1A9X A;  3JZI A;  3WNZ A;  3G8D A;  4MV8 A;  3G8C A;  2W6O A;  5IYZ F;  2YS7 A;  2WYO A;  2I8C A;  1SCU B;  5I47 A;  1KUT A;  3R23 A;  3GID A;  2SCU B;  4ZI7 F;  2I80 A;  3N8D A;  1UC8 A;  1UC9 A;  4YAK B;  2YL2 A;  5DMX A;  1JDB B;  4FFR A;  3GLK A;  3V4Z A;  2GQS A;  1GSH A;  4L1K A;  3HBL A;  3K5H A;  5BMV F;  1BXR A;  1VKZ A;  5C8Y F;  2GPW A;  5HBR B;  1GLV A;  2I87 A;  2QK4 A;  1PK8 A;  4TV8 F;  3E5N A;  1WR2 A;  1M0T A;  2W6P A;  2W6N A;  4IWY A;  2PN1 A;  3V4S A;  2VR1 A;  5GON F;  4O7L A;  2R6F A;  4O7Y A;  1C3O A;  1C30 A;  4MV7 A;  3KAL A;  1VBG A;  5KX5 F;  5CA0 F;  2J9G A;  1B6R A;  1IOW A;  1VBH A;  4C5B A;  1JLL B;  5JVL A;  4O7T A;  1KJ9 A;  1KC7 A;  4MV3 A;  1OBG A;  1DV2 A;  4O7N A;  4IZO A;  3QFF A;  3KRE A;  3JZF A;  4HNT A;  4WD3 A;  5CA1 F;  3R9R A;  2FP4 B;  3R5X A;  2CQY A;  3JRW A;  4TV9 F;  2YZL A;  2ZDH A;  3Q1K A;  2YRX A;  1M6V A;  4O84 A;  4I4T F;  2OLS A;  1BNC A;  4EGJ A;  2PBZ A;  4XYM B;  3JRX A;  1EUC B;  1W96 A;  2C00 A;  1CQJ B;  4TUY F;  3ETJ A;  4O7S A;  1GGO A;  4FGR A;  5CAE B;  2R87 A;  4FU0 A;  4EGQ A;  2HJW A;  4O2A F;  4O7Z A;  2DWC A;  4YJ2 F;  1PX2 A;  5J2U F;  1KJ8 A;  5JQG F;  4M9U A;  4DIM A;  2CNV A;  2FPP B;  2R84 A;  3WO0 A;  3DF7 A;  2R7K A;  2R82 A;  3R5H A;  3VPC A;  4FFP A;  3U54 A;  5JH7 F;  4YJ3 F;  2VQD A;  3OUU A;  2NUA B;  3R5F A;  4DLK A;  3BG5 A;  1KJQ A;  3TII A;  3HO8 A;  1Z2N X;  5HV6 A;  5LA6 F;  4FFO A;  2FPG B;  1E4E A;  2YS6 A;  4O7R A;  3K5I A;  2HGS A;  3U9S A;  4MA0 A;  3KAK A;  2ZDG A;  2PVP A;  2W6Q A;  1EZ1 A;  1B6S A;  5LYJ F;  2V58 A;  3VPB A;  3I12 A;  5JVD F;  3AX6 A;  4MV9 A;  1W93 A;  4FE2 A;  4O4J F;  3N6R A;  1EHI A;  2YZG A;  1A48 A;  1DIK A;  1ULZ A;  2XD4 A;  3VPD A;  3SE7 A;  2FPI B;  2QF7 A;  3U55 A;  3AW8 A;  4HR7 A;  3RUP A;  1DV1 A;  4QSH A;  1AUX A;  5K2M A;  3U9T A;  2W70 A;  3UFX B;  4ZHQ F;  3TW6 A;  4O82 A;  4O86 A;  4O4H F;  3ETH A;  2DZD A;  3K3P A;  2R85 A;  1I7N A;  3LWB A;  3VA7 A;  2YZM A;  5FNV F;  1CS0 A;  4XZ3 B;  1Z2P X;  3WO1 A;  5KKN B;  3OUZ A;  4MV4 A;  4YAJ B;  2VPQ A;  3HB9 A;  4O81 A;  1EYZ A;  5LP6 F;  4O2B F;  2YW2 A;  4YB8 B;  4MA5 A;  1GSO A;  2P0A A;  4HNV A;  4ZQI A;  2V5A A;  4FFN A;  4XYL B;  1KJI A;  5LXT F;  2R7N A;  4O7W A;  1AUV A;  4WBN F;  1KBL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...