1WR7A

Solution structure of the third ww domain of nedd4-2
Total Genus 4
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
4
sequence length
41
structure length
41
Chain Sequence
b'GSPGIQSFLPPGWEMRIAPNGRPFFIDHNTKTTTWEDPRLK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Nedd4-2
publication title Solution structures of the WW domains of Nedd4-2
rcsb
source organism Mus musculus
molecule tags Ligase
total genus 4
structure length 41
sequence length 41
ec nomenclature ec 2.3.2.26: HECT-type E3 ubiquitin transferase.
pdb deposition date 2004-10-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00397 WW WW domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.70.10 Mainly Beta Single Sheet Ubiquitin Ligase Nedd4; Chain: W; Ubiquitin Ligase Nedd4; Chain: W; 1wr7A01
2Q5AA 2E45A 1K9RA 2DJYA 1YW5A 2ZQTA 4U85A 2DWVA 2L4JA 3KAHA 4U84A 3TCZA 1NMVA 2RE3A 3KADA 3LE4A 3KAFA 2DMVA 2LAJA 1PINA 4REXA 1EG3A 2ITKA 2JMFA 1WMVA 2XP5A 2XP3A 2YSBA 2KXQA 2XPBA 2XP8A 2ZR5A 4QIBA 2YSGA 2ZR6A 2JV4A 4E5RA 3KAGA 3OOBA 2XP4A 2ZQSA 2M8JA 2JX8A 2DK1A 1WR7A 2MDIA 2ZR4A 3KABA 5CQ2A 2ZQUA 2YSIA 1ZCNA 2XPAA 2XP7A 3CNGA 3TC5A 2BA1A 1K9QA 5AHTA 3KAIA 2YSFA 3KCEA 2YSHA 1O6WA 4U86A 1TK7A 3ODKA 2JXWA 2M3OW 3M85A 3M7NA 1F8AB 3TDBA 3WH0A 1I5HW 3L4HA 1JMQA 2ZAJA 2XP6A 2EZ5W 3NTPA 2DK7A 1EG4A 2XP9A 2ZQVA 2F21A 2M8IA
chains in the Genus database with same CATH superfamily
2Q5AA 3FS8A 2E45A 1K9RA 2DJYA 3PQHA 1YW5A 2ZQTA 5E65A 4U85A 2OWOA 2DWVA 2L4JA 3KAHA 4U84A 3TCZA 1NMVA 2RE3A 3KADA 5E64A 3LE4A 3KAFA 2DMVA 3FSCA 1RP5A 2LAJA 1PINA 4REXA 1EG3A 5E66A 2ITKA 2JMFA 1WMVA 2XP5A 2YAJB 2XP3A 2YSBA 2KXQA 2XPBA 2XP8A 3LKXB 4A0TA 2ZR5A 4QIBA 3MCBA 2YSGA 2ZR6A 2JV4A 4E5RA 3KAGA 3OOBA 2XP4A 2ZQSA 2M8JA 2JX8A 2Y8NB 2WADA 2DK1A 1WR7A 3MQHA 2MDIA 2ZR4A 3KABA 5CQ2A 2ZQUA 2YSIA 5E5WA 1ZCNA 2XPAA 2QRVA 2XP7A 3CNGA 3TC5A 2BA1A 1K9QA 5AHTA 3KAIA 2YSFA 3KCEA 2YSHA 1O6WA 4U86A 1TK7A 3MQGA 3ODKA 2JXWA 2M3OW 4A0UA 2WAEA 3M85A 1F8AB 3TDBA 3LKXA 3WH0A 3M7NA 1I5HW 3L4HA 1JMQA 2ZAJA 1FLCA 2XP6A 1TR8A 2EZ5W 4GLXA 5E62A 3NTPA 5U47A 2DK7A 1EG4A 2XP9A 2ZQVA 2F21A 3FSBA 3MCBB 2M8IA
chains in the Genus database with same CATH topology
2Q5AA 3FS8A 2E45A 1K9RA 2DJYA 3PQHA 1YW5A 2ZQTA 5E65A 4U85A 2OWOA 2DWVA 2L4JA 3KAHA 4U84A 3TCZA 1NMVA 2RE3A 3KADA 5E64A 3LE4A 3KAFA 2DMVA 3FSCA 1RP5A 2LAJA 1PINA 4REXA 1EG3A 5E66A 2ITKA 2JMFA 1WMVA 2XP5A 2YAJB 2XP3A 2YSBA 2KXQA 2XPBA 2XP8A 3LKXB 4A0TA 2ZR5A 4QIBA 3MCBA 2YSGA 2ZR6A 2JV4A 4E5RA 3KAGA 3OOBA 2XP4A 2ZQSA 2M8JA 2JX8A 2Y8NB 2WADA 2DK1A 1WR7A 3MQHA 2MDIA 2ZR4A 3KABA 5CQ2A 2ZQUA 2YSIA 5E5WA 1ZCNA 2XPAA 2QRVA 2XP7A 3CNGA 3TC5A 2BA1A 1K9QA 5AHTA 3KAIA 2YSFA 3KCEA 2YSHA 1O6WA 4U86A 1TK7A 3MQGA 3ODKA 2JXWA 2M3OW 4A0UA 2WAEA 3M85A 1F8AB 3TDBA 3LKXA 3WH0A 3M7NA 1I5HW 3L4HA 1JMQA 2ZAJA 1FLCA 2XP6A 1TR8A 2EZ5W 4GLXA 5E62A 3NTPA 5U47A 2DK7A 1EG4A 2XP9A 2ZQVA 2F21A 3FSBA 3MCBB 2M8IA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Q5A A;  2E45 A;  1K9R A;  2DJY A;  1YW5 A;  2ZQT A;  4U85 A;  2DWV A;  2L4J A;  3KAH A;  4U84 A;  3TCZ A;  1NMV A;  2RE3 A;  3KAD A;  3LE4 A;  3KAF A;  2DMV A;  2LAJ A;  1PIN A;  4REX A;  1EG3 A;  2ITK A;  2JMF A;  1WMV A;  2XP5 A;  2XP3 A;  2YSB A;  2KXQ A;  2XPB A;  2XP8 A;  2ZR5 A;  4QIB A;  2YSG A;  2ZR6 A;  2JV4 A;  4E5R A;  3KAG A;  3OOB A;  2XP4 A;  2ZQS A;  2M8J A;  2JX8 A;  2DK1 A;  1WR7 A;  2MDI A;  2ZR4 A;  3KAB A;  5CQ2 A;  2ZQU A;  2YSI A;  1ZCN A;  2XPA A;  2XP7 A;  3CNG A;  3TC5 A;  2BA1 A;  1K9Q A;  5AHT A;  3KAI A;  2YSF A;  3KCE A;  2YSH A;  1O6W A;  4U86 A;  1TK7 A;  3ODK A;  2JXW A;  2M3O W;  3M85 A;  3M7N A;  1F8A B;  3TDB A;  3WH0 A;  1I5H W;  3L4H A;  1JMQ A;  2ZAJ A;  2XP6 A;  2EZ5 W;  3NTP A;  2DK7 A;  1EG4 A;  2XP9 A;  2ZQV A;  2F21 A;  2M8I A; 
#chains in the Genus database with same CATH topology
 2Q5A A;  3FS8 A;  2E45 A;  1K9R A;  2DJY A;  3PQH A;  1YW5 A;  2ZQT A;  5E65 A;  4U85 A;  2OWO A;  2DWV A;  2L4J A;  3KAH A;  4U84 A;  3TCZ A;  1NMV A;  2RE3 A;  3KAD A;  5E64 A;  3LE4 A;  3KAF A;  2DMV A;  3FSC A;  1RP5 A;  2LAJ A;  1PIN A;  4REX A;  1EG3 A;  5E66 A;  2ITK A;  2JMF A;  1WMV A;  2XP5 A;  2YAJ B;  2XP3 A;  2YSB A;  2KXQ A;  2XPB A;  2XP8 A;  3LKX B;  4A0T A;  2ZR5 A;  4QIB A;  3MCB A;  2YSG A;  2ZR6 A;  2JV4 A;  4E5R A;  3KAG A;  3OOB A;  2XP4 A;  2ZQS A;  2M8J A;  2JX8 A;  2Y8N B;  2WAD A;  2DK1 A;  1WR7 A;  3MQH A;  2MDI A;  2ZR4 A;  3KAB A;  5CQ2 A;  2ZQU A;  2YSI A;  5E5W A;  1ZCN A;  2XPA A;  2QRV A;  2XP7 A;  3CNG A;  3TC5 A;  2BA1 A;  1K9Q A;  5AHT A;  3KAI A;  2YSF A;  3KCE A;  2YSH A;  1O6W A;  4U86 A;  1TK7 A;  3MQG A;  3ODK A;  2JXW A;  2M3O W;  4A0U A;  2WAE A;  3M85 A;  1F8A B;  3TDB A;  3LKX A;  3WH0 A;  3M7N A;  1I5H W;  3L4H A;  1JMQ A;  2ZAJ A;  1FLC A;  2XP6 A;  1TR8 A;  2EZ5 W;  4GLX A;  5E62 A;  3NTP A;  5U47 A;  2DK7 A;  1EG4 A;  2XP9 A;  2ZQV A;  2F21 A;  3FSB A;  3MCB B;  2M8I A; 
#chains in the Genus database with same CATH homology
 2Q5A A;  3FS8 A;  2E45 A;  1K9R A;  2DJY A;  3PQH A;  1YW5 A;  2ZQT A;  5E65 A;  4U85 A;  2OWO A;  2DWV A;  2L4J A;  3KAH A;  4U84 A;  3TCZ A;  1NMV A;  2RE3 A;  3KAD A;  5E64 A;  3LE4 A;  3KAF A;  2DMV A;  3FSC A;  1RP5 A;  2LAJ A;  1PIN A;  4REX A;  1EG3 A;  5E66 A;  2ITK A;  2JMF A;  1WMV A;  2XP5 A;  2YAJ B;  2XP3 A;  2YSB A;  2KXQ A;  2XPB A;  2XP8 A;  3LKX B;  4A0T A;  2ZR5 A;  4QIB A;  3MCB A;  2YSG A;  2ZR6 A;  2JV4 A;  4E5R A;  3KAG A;  3OOB A;  2XP4 A;  2ZQS A;  2M8J A;  2JX8 A;  2Y8N B;  2WAD A;  2DK1 A;  1WR7 A;  3MQH A;  2MDI A;  2ZR4 A;  3KAB A;  5CQ2 A;  2ZQU A;  2YSI A;  5E5W A;  1ZCN A;  2XPA A;  2QRV A;  2XP7 A;  3CNG A;  3TC5 A;  2BA1 A;  1K9Q A;  5AHT A;  3KAI A;  2YSF A;  3KCE A;  2YSH A;  1O6W A;  4U86 A;  1TK7 A;  3MQG A;  3ODK A;  2JXW A;  2M3O W;  4A0U A;  2WAE A;  3M85 A;  1F8A B;  3TDB A;  3LKX A;  3WH0 A;  3M7N A;  1I5H W;  3L4H A;  1JMQ A;  2ZAJ A;  1FLC A;  2XP6 A;  1TR8 A;  2EZ5 W;  4GLX A;  5E62 A;  3NTP A;  5U47 A;  2DK7 A;  1EG4 A;  2XP9 A;  2ZQV A;  2F21 A;  3FSB A;  3MCB B;  2M8I A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...