1WRDA

Crystal structure of tom1 gat domain in complex with ubiquitin
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
98
structure length
98
Chain Sequence
GPLGSEQIGKLRSELEMVSGNVRVMSEMLTELVPTQAEPADLELLQELNRTCRAMQQRVLELIPQIANEQLTEELLIVNDNLNNVFLRHERFERFRTG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural basis for recognition of ubiquitinated cargo by Tom1-GAT domain.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein transport/signaling protein
molecule keywords Target of Myb protein 1
total genus 39
structure length 98
sequence length 98
ec nomenclature
pdb deposition date 2004-10-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03127 GAT GAT domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.160 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 1wrdA00
2N2NA 1O3XA 1X79A 1OXZA 1WR6A 1WRDA 1YD8G 2N9DA 1NAFA 1NWMX
chains in the Genus database with same CATH superfamily
3PV0F 5JR9C 4ZZBA 3PURA 1OXZA 4AKLA 3BQIA 4IDQA 1D1BA 2GK9A 2V6YB 2MBGA 4F8HA 3AEFA 3MK7C 3WAKA 4DBRA 3WAJA 5HXCA 1IZNB 3Q5DA 4IE4A 1EZ3A 2V7KA 3C50A 3PUXF 2BS3A 5FY1A 5L4HA 4QXCB 4DMWA 5IUXA 5M4YA 2YU2A 3S4UA 4LF9T 1MNEA 3AEGA 3LSVA 4GKJT 3HR0A 4IE5A 4Z90A 2ACZA 5FKYA 4IL4A 3RKOA 3ZT5A 2WY2A 1E1HB 3CQCB 3KVBA 3P4WA 4CZZB 2D0TA 3K8PC 2CHOA 4ZI3D 2OA5A 2VB6A 3QOFA 4TNWA 2V5CA 2Y8DA 3OYXA 2WBLA 4UVAB 5AQVB 1XNRT 1CHUA 2N1GA 4FJOA 1WFDA 3PU3A 4X1IE 2B1EA 5TAOA 4ERRA 3TLUA 1OEDC 5AQOB 5AQUB 1LKXA 1QSDA 1Y01A 3DTOA 2EHOC 2HPLA 1MMGA 2E5LT 4WZXA 3FZHB 4TX5A 1E2AA 2NTXA 4JI6T 3O1JA 4ILUA 2YDRA 2CPTA 4PK5A 5CJ5A 3I9WA 2LSJA 5DABA 2UXBT 4HWFA 4ANJA 2W61A 4GK5E 3UT5E 2W0GA 4DR3T 1VRBA 5L3GB 1UX5A 3K3OA 4PFOA 1HNWT 2VKHA 4DV1T 1BR1A 5BR8T 1ZOYA 2YEVC 4PK6A 2LOSA 4UELA 2J62A 5HWYA 2LLYA 2WS3A 4AQFC 3EI0A 4LMLA 4AISA 4LF6T 1MNDA 4TV9E 3ZMTB 5AQHB 3GA8A 4JUYA 2ZM0A 2JPFA 3AE8A 4H9QC 4U33A 3TLVA 4EEBA 2XTLA 4WBNE 1X9BA 5LBQB 5F3JA 2KNDA 2JQQA 4HFDA 5LXTE 2XSBA 1WR6A 1Y64B 4OX9T 1OEDE 3IEEA 5FP3A 4TWFA 3UUMA 2R6GF 2NW8A 2LRLA 3AA1B 4HEAA 3K3NA 4ILCA 2XQ8A 2CWYA 3DP7A 2CA5A 2XAGB 4HWDA 1J5ET 4ZI2D 3ZLIA 5FY7A 4IE6A 3RIUC 2KINB 1HX8A 3HKCE 1U5PA 4UF0A 5L3BB 1FMWA 1KFYA 2PFVA 2MPKA 2Q9QA 4NUVA 2XQ4A 1XDOA 4JEUB 1W0BA 2QVAA 4HWIB 2VASA 3AXJA 4IT4A 3AE1A 1HCIA 3RQWA 5LHHB 5HEGA 3L09A 5FXVA 3H37A 4NIQA 1J5WA 1KEYA 5FL0A 4ZI3C 1YQ4A 2RP4A 3AE6A 3E08A 4N78D 5FXXA 4U2ZA 2HN2A 1ZEEA 2IC9A 3JC6D 3OBVE 3A7MA 4HFVA 2QRXA 2D2SA 4FI5A 2X9XA 2JJ9A 2K3WA 3ANWB 4CXXA 2WDRA 2H7VC 2UUBT 5F8PA 5E0OA 3RYHE 3FZMB 3H3AA 3UFGA 5LP6E 4WBOA 3CWZB 3SOLA 3P7IA 3EABA 1R8IA 3RGLA 3PJAJ 4KI0F 5JVDE 2YOEA 3ZC0A 4H63H 1OEDA 2WU5A 3ONXA 3P4RA 5FXZA 1W0AA 4CI2B 3RIUA 2I6HA 2VVNA 1SUMB 4LF4T 2WAUA 4A97A 2E2AA 2LHNA 2NWBA 4PJMA 2WSSV 3E0ZA 4UR9A 3UU8A 3ETUA 4CN6A 4DUZT 5JRCB 1I6ZA 1FEWA 4DR5T 3BQLA 3NBXX 3CVRA 3CX8B 1KNZA 5J0ZA 2JIWA 5AQSB 3RI5A 4P1NA 5LHGB 3I0OA 5KMGP 5ABEA 3N5LA 4JLEA 2G0UA 5IYZE 2BG9B 1KF6A 2NW7A 2L3LA 3UQ7A 3TLWA 2XQ9A 2XM2A 5LMNT 4Z8XA 4X1KE 4DV0T 1IBMT 2WWUA 4CQIA 2KWIB 4YFSA 1QLBA 1VCSA 5FVKA 3IF8B 3CKDA 5GONE 3P50A 2QGSA 3JC6C 3IA3A 3E22E 2CXLA 2JQ9A 5FVLA 1WLXA 4HFCA 2ODVA 4GYRA 4PJLA 4AIUA 2UUCT 2XAJB 4YSZA 1D0XA 4PAGA 4DMVA 4CI1B 5JR9A 5J1GA 4WYVA 2WM9A 2LKGA 3EUHA 4PFPA 1O3XA 4X64T 4IL9A 2VKDA 2PG8A 5DJQC 2NTYA 1XNQT 2IAKA 1WRDA 4HFIA 4CN1A 4YY3T 2V26A 2RA1A 4JV5T 4EZHA 2E9XD 2WZHA 4HFEA 4K0UA 4YTPA 5CFBA 5AQMB 4DV5T 3KBUA 4HE8A 3AEEA 2CHNA 4LMKA 4LF8T 2W63A 2YINA 4QWNB 2V6YA 5H6QB 3ZYLA 2V8SV 5C2TA 5HEJA 4X62T 3BK9A 4MALA 3VR9A 3D0TA 3PJAA 2LSKA 3PUSA 2K9AA 2N9DA 4ISTA 3TLSA 5AQPB 3ZMZB 2MAWA 5JQGE 3K3QC 3NKZA 3ZYMA 5LYJE 4M1PA 3RRWA 2V5DA 3N9OA 1MIVA 3AXJB 3RKGA 5LMUT 4YXDA 5L2LA 3CPZA 5CA0E 3AECA 5LJNA 2E9XA 4LFAT 3ZT7A 2K24A 3A5XA 5FNVE 3UUXB 2A2FX 4KHPT 3FBZA 3V5UA 4MBQA 4QHOA 4HGAA 1BR0A 3QB5A 2V7JA 1XDPA 2W67A 4Z91A 1WYBA 4J2CA 3RYIE 5LGNB 1T72A 2CXFA 4JEHB 2K48A 2I0MA 4ASKA 1E7PA 2OLTA 2L8KA 2DHRA 2VK9A 4YHHT 3AEDA 1G73A 5LNKA 5JDQA 1JNRA 4I50E 3CX7B 5ABFA 2UU9T 2CWOA 1LVFA 2J1DG 3A8YC 3MACA 3G06A 4KHZF 2JQHA 3I1AA 3LBXB 3PTRB 3SFDA 3QK6A 3OTOT 4WW0A 3RH3A 3U3IA 3OYZA 3JADA 1G8XA 4YSXA 3KFWX 3CK6A 4H9RC 5EZYE 2LKHA 4DV7T 4AKHA 2KT9A 2BVMA 3FXEB 4KBMB 4TZ4C 5AQFB 2N2NA 2XQ3A 4TWDA 4JI0T 2JQKA 1KK7A 3PUWF 2X66A 2IIUA 4YTNA 2ES0A 1UGOA 1YD8G 5HEUA 4AQFA 5KX5E 2JMHA 2L9QA 2M67A 4DV3T 3ZN0B 1IAPA 2CMRA 3ZEFB 5L47A 1YKEB 2IC6A 5AQGB 4H9PC 3C4XA 4HFHA 5IWAT 4JYAT 2AE9A 3QB5K 2NOXA 2WMOA 3ZSTA 2BKNA 3LK42 4EZ4A 5J2TE 1JNZA 2PTFA 2H7OA 2WMNA 4U7IA 2LE8A 1T98A 4EAHA 5HXEA 5LG4A 2QA7A 1V9DA 3I0QA 3MXZA 2ODUA 3DJBA 3N2OA 4MFRA 5IHYA 4OYKA 5FL1A 5LGTB 3J7Yq 4BAYB 3H3MA 1UCUA 5LJMA 4B3ST 1XWMA 4B6XA 2BDEA 4PNIA 2XAHB 3P4PA 1FIOA 4GIWA 4UF0B 3ZJ2A 4A98A 4JI4T 3Q5WA 1UX4A 3KVAA 3SFEA 2EHOD 4EOZB 2F4VT 2BZBA 4EYUA 3PUAA 3PUQA 1HX1B 2WB5A 3LJCA 2W4XA 2QYWA 1WYCA 2X67A 1VCTA 1LRZA 5EK3A 3TKLB 3O9XA 2UUAT 3VKHA 4QXHB 5LGUB 1AJ3A 1T8BA 1KNPA 2VKOA 4O8SA 1YXRA 1T7SA 5FMNA 5CA1E 1YKHB 1HFAA 3B13A 3L8RA 3UFEA 5LOVE 3VRBA 4YJ2E 3ZKRA 4AKIA 5CB4E 4U31A 2MOZA 3LG7A 4DV4T 3AE5A 3CIRA 2C0SA 2IDOB 3BQKA 2CBJA 3N9NA 4OFZA 4LFCT 1XZYA 1YW0A 2NW9A 5F5WA 1HTJF 2V7MA 4HFBA 4H9NC 3RRCA 2B76A 2WZIA 3HKDE 3PUVF 2I59A 3T1HT 1W09A 1FJGT 1KNRA 3ZMSB 3KV6A 1N32T 4ZEYA 2LJLA 1Z0PA 5LCYA 3R6NA 1H7CA 2WU2A 2V6XA 4YT0A 1MMAA 3AE2A 3GN5B 1IJ6A 3KV5A 4A56A 4LMJA 5LG3A 2VL8A 3RLFF 4EEDA 4GYSA 2BVLA 4NUUA 1N33T 4WNKA 1XMQT 2ZM8A 4UEMA 1MMNA 1U4QA 4JI7T 2CCQA 2DLRA 4ILAA 4PW8A 5JDHA 4DV6T 4QH1A 4HKAA 4EV6A 2XM1A 5HXRA 3ZMUB 4JI3T 3EDVA 1X79A 3LBXA 2PBIA 4AQGA 3LK3B 1BR4A 3M65A 4TN7B 1M62A 3B57A 3LFMA 2RPAA 3KV9A 3VHLA 3AAEB 5J2UE 1D1CA 2C5KT 1NENA 3AEAA 4QXBB 1S35A 5AQKB 2Y6XA 3ZPOA 2Z6EA 4YSYA 2XAQB 2BG9C 2J4GA 2M6BA 2VL0A 2WQYA 3NRYA 3ZT6A 1FMVA 3ONLC 3GMIA 5JDFA 4DBQA 2HH7A 2BBHA 2C5IT 3O4XE 3JAFA 2FJAA 3N2KE 2NR4A 3ONJA 1WR0A 4IIJE 5HXSA 2DWGA 1D0YA 2DCFA 3Q2MA 3T8OA 4TV8E 1J1JA 2PJQA 2JMKA 4MHCA 4JI5T 3F2EA 3RPUA 2OV9A 3UU4A 5L3CB 4C91A 2Q9QC 3C98B 3HKBE 3VR8A 4YHJA 4IE0A 2WP9A 1L0VA 2EHOB 2IHR1 4AKRB 2BS4A 5HEHA 4LFBT 1S94A 3HL6A 4H63V 5FY0A 1NEKA 1OEDB 4QX7B 2LT3A 3EHZA 4HWHA 3NWIA 4I4TE 2LOPA 4H9OC 3F57A 4EXTA 4B3TT 4A5XA 2XSAA 2YN6A 3SS1A 3RC8A 4CI3B 5AFUL 2XQ6A 4ZS2A 5ETWA 1VOMA 5HYAA 4HN9A 1US7B 2LHRA 4ZI7E 2BBJA 1SA0E 3QNUA 4PK4A 4COFA 1N36T 1B7TA 3AB3B 3N2GE 4E7SA 3KBTA 2CEAA 3J9X1 2YU1A 5JDMA 1DU2A 4I55E 2E9XC 5LB7B 3MJXA 4C90A 4JI1T 3CMLA 4GOUA 4DV2T 1D1AA 2XY8B 4L0RA 2M6IA 4DVDA 3CQGB 3W15B 3ETVA 4L5GA 3MKDA 5HCMA 4O4LE 3RQUA 2DI4A 2LEHA 3CQXC 3FB2A 5HAXA 3RF1A 2UXXB 2W62A 2V7IA 4KUMB 2V1DB 4UIGA 1M7KA 3JCFA 3ZCJA 4AQYT 3KDSE 1ZP0A 2IMLA 4I0UA 3PUGA 3ZN1B 4BJMA 5JR9B 5KXJA 1HR0T 3NZPA 3T1YT 5LA6E 2D5UA 5ABFB 2FJEA 2UXNB 1ZV4X 1SHZC 5JDGA 5C8YE 1HNXT 1LVKA 2X0HA 4QKNA 3P4QA 2Q9QD 3O1HA 3IBPA 2V7LA 2EHOA 2MYSA 2YDSA 4IHJE 3VRAA 1I94T 4HTEA 1YQ3A 3FXDB 4U2YA 4ZXLA 1Z8UA 5A1LA 2D9DA 4O2BE 4F6RC 3Q5XA 2BS2A 4JI8T 2FBWA 4ZI2C 3P8CD 2KLQA 4P0BA 4TNVA 3PE0A 5AQQB 3AA0B 4DR1T 3L3PA 5KDMC 5JTGA 4NPPA 5DQVA 5BMVE 2LM2A 3FBLA 4G2AA 3R84B 3RYFE 3JAEA 4IDNA 4V1Av 2UXCT 4O4JE 4I43B 2X9WA 3N9LA 4ZOLE 3SRZA 5EK2A 4TUYE 3OVUA 4P09A 2BKPA 5C3JA 3AA6B 2D0UA 2ZLYA 5HEOA 2LSGA 2BG9E 2XUEA 3VU7H 3ZYKA 4X65T 3VKGA 4IDZA 2FUPA 2X9HA 2XPKA 4DR7T 3V5SA 2W2UA 2KMFA 2NP9A 4BA9A 1QUUA 5ABHA 2YKSA 2XQYA 3FZLB 4EB6E 5JRCA 3EDUA 4QX8B 4IGUA 4YJ3E 5EK4A 3ZSSA 4B3MT 4QH5A 5FXWA 4LF7T 3AAIA 3RC3A 3K1SA 4DNDA 3AE7A 3ESLA 3Q5EA 2VQET 3FZKB 3ZC1A 4CN4A 3ANWA 4ZS3A 3AEBA 4JI2T 3UU5A 4ISSA 4DIDB 4PJNA 4ADZA 1ZHCA 4OK0A 2XZEA 3F31A 5H6RB 5ABGA 4EGWA 1MIYA 2IW5B 2BKOA 2XQ5A 2A72A 3OKQA 2J47A 4O4IE 2C5JA 3MZKB 2ZM2A 3UQ4A 1OWAA 4QH4A 3UULA 4O4HE 4BJNA 2VWAA 2Y48B 4GKKT 4AI6A 2HN1A 2X9YA 2LM9A 2WCAA 3UUBA 4YLHA 4P0AA 2XQAA 2XASB 2LSYA 2CE7A 4ILBA 5AQIB 2H89A 4EIWA 3LDQB 4CXWA 1HS7A 2A3DA 1SE7A 3NVOA 3WI3A 3I9YA 3RIAA 4KMCA 2Q9QB 5DQWA 1IBLT 4UVCB 3UUNA 3ZCIA 5AQLB 3C4WA 3L39A 4ZZCA 2XJ7A 4NXMT 1NAFA 2X0LB 2VKJA 5FYMA 4X1YE 3UU3A 3N9MA 4DO0A 3B5MA 4L9IA 4X5TA 3UTKA 1HF8A 1WCRA 2H88A 2WDVA 2X68A 3PU8A 3Q9DA 2XQ7A 2YDQA 3PUYF 3LK2B 3O1IA 1HNZT 4U72A 4DR2T 4XBFB 2UXDT 2FJBA 4U74A 4X66T 2X51A 2LRKA 1GQEA 2MTQA 4PJJA 2E8IA 4TWHA 4UV8B 2VVSA 4XZCA 5AQTB 4X20E 3EAMA 5JDNA 4DR6T 3ZJ1A 4G63A 2FJDA 4AXPA 4EYYR 2VURA 2W00A 2JRKA 3FHNA 2LSIA 4Q25A 5L3EB 3P4SA 2A9UA 2YK0A 4ZHQE 4LF5T 3AE3A 3NZQA 4U7YA 4B3RT 4UV9B 4E7ZA 4DUYT 3KV4A 4AKGA 5CGMA 2WDQA 4IDPA 2AXDS 1CUNA 1IJ5A 3NRXA 2HPJA 3C64A 4JBWF 2ACXA 4GK0E 4KX6A 4OYJA 2VQFT 1IBKT 4YTMA 3KINB 2KSRA 3PUZF 5JDLA 2CLYB 3UU6A 1MMDA 2ZMAA 3M3ZB 3N9PA 4O2AE 5HCJA 3X1DA 4NXNT 5JREA 3GWHA 3ZMVB 3AE4A 4MLKA 4UVBB 4U3CA 3MA9A 2X0YA 2W66A 4H9SE 5HXHA 1MIWA 1UURA 3C4ZA 2H3RA 2CLYC 2DNXA 4HWCA 3RX6A 5LHIB 4DR4T 4K0KT 2BG9A 2CM0A 3QUJA 2P9BA 4UXNB 5ADXL 5HWXA 2DWKA 4CXYA 1D0ZA 4OHFA 4XAXB 3IHRA 5JH7E 2XAFB 3HA4A 3RYCE 2E5VA 3ABVA 2E9XB 3TLTA 3FZFB 2CBIA 3RIFA 3AAAB 3GN5A 3RHWA 3SWHA 2K5BB 2KZ7B 3AVRA 1ZKEA 2IUBA 2ZM6T 1HG5A 2SPCA 5AQJB 1N34T 2HHHT 2CRBA 5AQRB 3HI2A 3PDYA 4IDOA 5L3FB 1UK5A 1UUSA 5L4EA 4IE7A 3AA7B 2KXPB 1W9RA 3OPCA 1NWMX 3QC9A 4KP3C 3AE9A 2XHEB 3HKEE 2WWVA 1XMOT 3OJAA 2KWHA 3AVSA 3C51A 5LBMA 3EVYA 1BR2A 5AQNB 2CXDA 3CX6B 5L3DB 3N9QA 4IREA 2DL1A 3U78A 1HG2A
chains in the Genus database with same CATH topology
5JR9C 3PURA 1OXZA 4AKLA 3BQIA 1D1BA 2GK9A 2MBGA 3WAJA 3MK7C 3WAKA 4DBRA 5HXCA 1IZNB 4IE4A 1EZ3A 2V7KA 3C50A 5FY1A 4DMWA 5M4YA 4QXCB 2YU2A 3S4UA 1MNEA 3HR0A 4IE5A 3RKOA 1E1HB 3CQCB 3KVBA 4CZZB 2D0TA 3K8PC 4ZI3D 2OA5A 2VB6A 2Y8DA 3OYXA 2WBLA 4UVAB 2N1GA 4FJOA 4ERRA 3PU3A 4X1IE 2B1EA 5TAOA 1LKXA 1QSDA 3DTOA 2EHOC 2HPLA 1MMGA 4TX5A 2NTXA 3O1JA 4ILUA 4PK5A 3I9WA 2LSJA 5DABA 4ANJA 2W61A 4GK5E 3UT5E 2W0GA 1VRBA 5L3GB 1UX5A 3K3OA 4PFOA 2VKHA 1BR1A 2YEVC 4PK6A 2LOSA 4UELA 5HWYA 4AQFC 1MNDA 4TV9E 3ZMTB 3GA8A 4JUYA 2ZM0A 2JPFA 4H9QC 4WBNE 2XTLA 5LBQB 5F3JA 2KNDA 2JQQA 5LXTE 1WR6A 1Y64B 3IEEA 5FP3A 3UUMA 3AA1B 2NW8A 4HEAA 3K3NA 2CWYA 3DP7A 2CA5A 2XAGB 4ZI2D 3ZLIA 5FY7A 4IE6A 1HX8A 2KINB 3HKCE 1U5PA 4UF0A 5L3BB 1FMWA 2PFVA 2Q9QA 4NUVA 4JEUB 2VASA 1HCIA 5LHHB 3L09A 5FXVA 3H37A 4ZI3C 2RP4A 3E08A 4N78D 5FXXA 1ZEEA 2IC9A 3JC6D 3OBVE 4HFVA 2D2SA 4FI5A 2X9XA 2JJ9A 3ANWB 4CXXA 2H7VC 5F8PA 5E0OA 3RYHE 3H3AA 5LP6E 4WBOA 3CWZB 3SOLA 3P7IA 5JVDE 3ZC0A 4H63H 3ONXA 5FXZA 4CI2B 2WAUA 2NWBA 2LHNA 4PJMA 2WSSV 3E0ZA 3ETUA 1FEWA 3BQLA 3NBXX 3CVRA 3CX8B 1KNZA 5LHGB 3I0OA 5KMGP 3N5LA 4JLEA 2G0UA 5IYZE 2NW7A 2L3LA 4Z8XA 4X1KE 2WWUA 4CQIA 2KWIB 4YFSA 3IF8B 3CKDA 5GONE 2QGSA 3JC6C 5JREA 3E22E 2CXLA 1WLXA 4PJLA 2ODVA 4GYRA 2XAJB 1D0XA 4PAGA 4DMVA 4CI1B 5JR9A 5J1GA 2WM9A 3EUHA 4PFPA 1O3XA 2VKDA 2PG8A 5DJQC 2NTYA 2IAKA 1WRDA 2V26A 2RA1A 4EZHA 2E9XD 4K0UA 3KBUA 4HE8A 2W63A 2YINA 4QWNB 5H6QB 3ZYLA 3BK9A 4MALA 3D0TA 3PUSA 2LSKA 4ISTA 2K9AA 2N9DA 3ZMZB 5JQGE 3K3QC 3ZYMA 5LYJE 4M1PA 3RRWA 3N9OA 1MIVA 5L2LA 3CPZA 5CA0E 5LJNA 2E9XA 2K24A 3A5XA 5FNVE 3UUXB 2A2FX 3FBZA 3V5UA 4MBQA 4QHOA 4HGAA 1BR0A 2V7JA 3RYIE 1WYBA 4J2CA 5LGNB 4JEHB 2CXFA 2K48A 4ASKA 2VK9A 2L8KA 2DHRA 5LNKA 1G73A 5JDQA 4I50E 3CX7B 2CWOA 1LVFA 2J1DG 3MACA 3I1AA 3LBXB 3PTRB 3QK6A 4WW0A 3RH3A 3U3IA 3OYZA 1G8XA 3KFWX 4H9RC 5EZYE 2KT9A 2BVMA 3FXEB 4KBMB 4TZ4C 2N2NA 1KK7A 2X66A 2ES0A 4AQFA 1YD8G 5KX5E 2JMHA 2L9QA 2M67A 3ZN0B 1IAPA 2CMRA 3ZEFB 1YKEB 2IC6A 4H9PC 3C4XA 5J2TE 2NOXA 2WMOA 3LK42 4EZ4A 2WMNA 5HXEA 2H7OA 4EAHA 5LG4A 2LE8A 1T98A 2QA7A 1V9DA 3I0QA 3MXZA 2ODUA 3DJBA 3N2OA 4MFRA 5IHYA 4OYKA 5LGTB 3J7Yq 4BAYB 5LJMA 1UCUA 4B6XA 2BDEA 4PNIA 2XAHB 1FIOA 4GIWA 4UF0B 3ZJ2A 3Q5WA 1UX4A 3KVAA 4EOZB 2EHOD 2BZBA 4EYUA 3PUAA 3PUQA 3LJCA 1WYCA 2X67A 5EK3A 1LRZA 3TKLB 3O9XA 3VKHA 4QXHB 1AJ3A 5HXHA 2VKOA 4O8SA 5FMNA 5CA1E 1YKHB 1HFAA 3B13A 3UFEA 4YJ2E 5LOVE 4AKIA 5CB4E 2MOZA 3LG7A 2C0SA 3BQKA 3N9NA 4OFZA 1YW0A 2NW9A 1HTJF 2V7MA 4H9NC 3RRCA 3HKDE 2I59A 3ZMSB 3KV6A 2LJLA 1Z0PA 5LCYA 3R6NA 1H7CA 1MMAA 3GN5B 4A56A 1IJ6A 3KV5A 2VL8A 4GYSA 2BVLA 4NUUA 4WNKA 2ZM8A 4UEMA 1MMNA 1U4QA 2CCQA 2DLRA 4PW8A 5JDHA 4HKAA 5HXRA 3ZMUB 3EDVA 1X79A 3LBXA 2PBIA 4AQGA 3LK3B 1BR4A 3M65A 4TN7B 3B57A 3LFMA 3KV9A 3VHLA 3AAEB 5J2UE 1D1CA 2C5KT 4QXBB 3ZPOA 5JRCB 1S35A 2Y6XA 2Z6EA 2XAQB 3NRYA 1FMVA 5JDFA 3GMIA 4DBQA 2HH7A 2C5IT 3O4XE 3N2KE 4IIJE 5HXSA 2DWGA 1D0YA 2DCFA 3Q2MA 3T8OA 4TV8E 2PJQA 2JMKA 4MHCA 3F2EA 3RPUA 5L3CB 4C91A 2Q9QC 3C98B 3HKBE 4YHJA 4IE0A 4AKRB 2EHOB 1S94A 3HL6A 4H63V 5FY0A 4QX7B 4ZS2A 2LT3A 4I4TE 2LOPA 4H9OC 3F57A 4EXTA 3SS1A 3RC8A 4CI3B 5AFUL 5ETWA 5HYAA 1VOMA 4HN9A 1US7B 2LHRA 4ZI7E 1SA0E 4PK4A 1B7TA 3AB3B 3N2GE 3KBTA 2CEAA 3J9X1 2YU1A 5JDMA 4I55E 2E9XC 3MJXA 4C90A 3CMLA 4GOUA 1D1AA 4L0RA 4DVDA 3CQGB 3W15B 3ETVA 4L5GA 3MKDA 4O4LE 2DI4A 3FB2A 3CQXC 2LEHA 5HAXA 4E7SA 2UXXB 2W62A 2V7IA 4KUMB 2V1DB 4UIGA 3ZCJA 3KDSE 3ZN1B 3PUGA 4BJMA 5JR9B 3NZPA 5LA6E 2D5UA 2UXNB 1ZV4X 1SHZC 5JDGA 5C8YE 1LVKA 4QKNA 2Q9QD 3O1HA 3IBPA 2V7LA 2EHOA 2MYSA 4IHJE 4HTEA 3FXDB 5A1LA 4O2BE 4F6RC 3Q5XA 4ZI2C 3P8CD 2KLQA 4P0BA 3PE0A 3AA0B 3L3PA 5KDMC 5DQVA 5BMVE 3FBLA 4G2AA 3R84B 3RYFE 4V1Av 4O4JE 4I43B 2X9WA 3N9LA 4ZOLE 3SRZA 5EK2A 4TUYE 4P09A 3AA6B 2D0UA 2ZLYA 2LSGA 2XUEA 3ZYKA 3VU7H 3VKGA 4IDZA 2X9HA 3V5SA 2KMFA 2NP9A 4BA9A 1QUUA 2XQYA 4EB6E 5JRCA 3EDUA 4QX8B 4IGUA 4YJ3E 5EK4A 5FXWA 3AAIA 3RC3A 4DNDA 3ESLA 3ZC1A 3ANWA 4ZS3A 4ISSA 4PJNA 4ADZA 1ZHCA 4OK0A 3F31A 5H6RB 1MIYA 2IW5B 2A72A 3OKQA 4O4IE 2C5JA 3MZKB 2ZM2A 3UULA 1OWAA 4BJNA 4O4HE 2VWAA 2Y48B 4AI6A 2X9YA 2LM9A 4YLHA 4P0AA 2XASB 2LSYA 2CE7A 4EIWA 1HS7A 4CXWA 2A3DA 3WI3A 3I9YA 4KMCA 2Q9QB 5DQWA 4UVCB 3UUNA 3ZCIA 3C4WA 1NAFA 2X0LB 2VKJA 5FYMA 4X1YE 4DO0A 3N9MA 4L9IA 3UTKA 1HF8A 3PU8A 3Q9DA 2X68A 3LK2B 3O1IA 4U72A 4XBFB 4U74A 2X51A 2MTQA 4PJJA 4UV8B 2E8IA 5JDNA 4XZCA 4X20E 3ZJ1A 4G63A 5L3EB 4AXPA 4EYYR 2W00A 5LGUB 2JRKA 3FHNA 2LSIA 4AKHA 2YK0A 4ZHQE 3NZQA 4UV9B 4E7ZA 3KV4A 4AKGA 3NRXA 1CUNA 1IJ5A 2HPJA 3C64A 2ACXA 4GK0E 4OYJA 3KINB 5JDLA 2CLYB 1MMDA 2ZMAA 3N9PA 4O2AE 3GWHA 3ZMVB 4MLKA 4UVBB 3MA9A 4H9SE 1MIWA 3C4ZA 2H3RA 2CLYC 2DNXA 3RX6A 5LHIB 3QUJA 2CM0A 4UXNB 2P9BA 5ADXL 5HWXA 2DWKA 4CXYA 1D0ZA 4OHFA 4XAXB 3IHRA 5JH7E 2XAFB 3HA4A 3RYCE 2E9XB 3AAAB 3GN5A 3SWHA 2K5BB 2KZ7B 3AVRA 1ZKEA 1HG5A 2SPCA 3HI2A 3PDYA 5L3FB 4IE7A 3AA7B 2KXPB 3QC9A 1NWMX 4KP3C 2XHEB 3HKEE 3OJAA 2KWHA 3AVSA 3C51A 5LBMA 3EVYA 1BR2A 2CXDA 3CX6B 5L3DB 3N9QA 3U78A 1HG2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2N2N A;  1O3X A;  1X79 A;  1OXZ A;  1WR6 A;  1WRD A;  1YD8 G;  2N9D A;  1NAF A;  1NWM X; 
#chains in the Genus database with same CATH topology
 3PV0 F;  5JR9 C;  4ZZB A;  3PUR A;  1OXZ A;  4AKL A;  3BQI A;  4IDQ A;  1D1B A;  2GK9 A;  2V6Y B;  2MBG A;  4F8H A;  3AEF A;  3MK7 C;  3WAK A;  4DBR A;  3WAJ A;  5HXC A;  1IZN B;  3Q5D A;  4IE4 A;  1EZ3 A;  2V7K A;  3C50 A;  3PUX F;  2BS3 A;  5FY1 A;  5L4H A;  4QXC B;  4DMW A;  5IUX A;  5M4Y A;  2YU2 A;  3S4U A;  4LF9 T;  1MNE A;  3AEG A;  3LSV A;  4GKJ T;  3HR0 A;  4IE5 A;  4Z90 A;  2ACZ A;  5FKY A;  4IL4 A;  3RKO A;  3ZT5 A;  2WY2 A;  1E1H B;  3CQC B;  3KVB A;  3P4W A;  4CZZ B;  2D0T A;  3K8P C;  2CHO A;  4ZI3 D;  2OA5 A;  2VB6 A;  3QOF A;  4TNW A;  2V5C A;  2Y8D A;  3OYX A;  2WBL A;  4UVA B;  5AQV B;  1XNR T;  1CHU A;  2N1G A;  4FJO A;  1WFD A;  3PU3 A;  4X1I E;  2B1E A;  5TAO A;  4ERR A;  3TLU A;  1OED C;  5AQO B;  5AQU B;  1LKX A;  1QSD A;  1Y01 A;  3DTO A;  2EHO C;  2HPL A;  1MMG A;  2E5L T;  4WZX A;  3FZH B;  4TX5 A;  1E2A A;  2NTX A;  4JI6 T;  3O1J A;  4ILU A;  2YDR A;  2CPT A;  4PK5 A;  5CJ5 A;  3I9W A;  2LSJ A;  5DAB A;  2UXB T;  4HWF A;  4ANJ A;  2W61 A;  4GK5 E;  3UT5 E;  2W0G A;  4DR3 T;  1VRB A;  5L3G B;  1UX5 A;  3K3O A;  4PFO A;  1HNW T;  2VKH A;  4DV1 T;  1BR1 A;  5BR8 T;  1ZOY A;  2YEV C;  4PK6 A;  2LOS A;  4UEL A;  2J62 A;  5HWY A;  2LLY A;  2WS3 A;  4AQF C;  3EI0 A;  4LML A;  4AIS A;  4LF6 T;  1MND A;  4TV9 E;  3ZMT B;  5AQH B;  3GA8 A;  4JUY A;  2ZM0 A;  2JPF A;  3AE8 A;  4H9Q C;  4U33 A;  3TLV A;  4EEB A;  2XTL A;  4WBN E;  1X9B A;  5LBQ B;  5F3J A;  2KND A;  2JQQ A;  4HFD A;  5LXT E;  2XSB A;  1WR6 A;  1Y64 B;  4OX9 T;  1OED E;  3IEE A;  5FP3 A;  4TWF A;  3UUM A;  2R6G F;  2NW8 A;  2LRL A;  3AA1 B;  4HEA A;  3K3N A;  4ILC A;  2XQ8 A;  2CWY A;  3DP7 A;  2CA5 A;  2XAG B;  4HWD A;  1J5E T;  4ZI2 D;  3ZLI A;  5FY7 A;  4IE6 A;  3RIU C;  2KIN B;  1HX8 A;  3HKC E;  1U5P A;  4UF0 A;  5L3B B;  1FMW A;  1KFY A;  2PFV A;  2MPK A;  2Q9Q A;  4NUV A;  2XQ4 A;  1XDO A;  4JEU B;  1W0B A;  2QVA A;  4HWI B;  2VAS A;  3AXJ A;  4IT4 A;  3AE1 A;  1HCI A;  3RQW A;  5LHH B;  5HEG A;  3L09 A;  5FXV A;  3H37 A;  4NIQ A;  1J5W A;  1KEY A;  5FL0 A;  4ZI3 C;  1YQ4 A;  2RP4 A;  3AE6 A;  3E08 A;  4N78 D;  5FXX A;  4U2Z A;  2HN2 A;  1ZEE A;  2IC9 A;  3JC6 D;  3OBV E;  3A7M A;  4HFV A;  2QRX A;  2D2S A;  4FI5 A;  2X9X A;  2JJ9 A;  2K3W A;  3ANW B;  4CXX A;  2WDR A;  2H7V C;  2UUB T;  5F8P A;  5E0O A;  3RYH E;  3FZM B;  3H3A A;  3UFG A;  5LP6 E;  4WBO A;  3CWZ B;  3SOL A;  3P7I A;  3EAB A;  1R8I A;  3RGL A;  3PJA J;  4KI0 F;  5JVD E;  2YOE A;  3ZC0 A;  4H63 H;  1OED A;  2WU5 A;  3ONX A;  3P4R A;  5FXZ A;  1W0A A;  4CI2 B;  3RIU A;  2I6H A;  2VVN A;  1SUM B;  4LF4 T;  2WAU A;  4A97 A;  2E2A A;  2LHN A;  2NWB A;  4PJM A;  2WSS V;  3E0Z A;  4UR9 A;  3UU8 A;  3ETU A;  4CN6 A;  4DUZ T;  5JRC B;  1I6Z A;  1FEW A;  4DR5 T;  3BQL A;  3NBX X;  3CVR A;  3CX8 B;  1KNZ A;  5J0Z A;  2JIW A;  5AQS B;  3RI5 A;  4P1N A;  5LHG B;  3I0O A;  5KMG P;  5ABE A;  3N5L A;  4JLE A;  2G0U A;  5IYZ E;  2BG9 B;  1KF6 A;  2NW7 A;  2L3L A;  3UQ7 A;  3TLW A;  2XQ9 A;  2XM2 A;  5LMN T;  4Z8X A;  4X1K E;  4DV0 T;  1IBM T;  2WWU A;  4CQI A;  2KWI B;  4YFS A;  1QLB A;  1VCS A;  5FVK A;  3IF8 B;  3CKD A;  5GON E;  3P50 A;  2QGS A;  3JC6 C;  3IA3 A;  3E22 E;  2CXL A;  2JQ9 A;  5FVL A;  1WLX A;  4HFC A;  2ODV A;  4GYR A;  4PJL A;  4AIU A;  2UUC T;  2XAJ B;  4YSZ A;  1D0X A;  4PAG A;  4DMV A;  4CI1 B;  5JR9 A;  5J1G A;  4WYV A;  2WM9 A;  2LKG A;  3EUH A;  4PFP A;  1O3X A;  4X64 T;  4IL9 A;  2VKD A;  2PG8 A;  5DJQ C;  2NTY A;  1XNQ T;  2IAK A;  1WRD A;  4HFI A;  4CN1 A;  4YY3 T;  2V26 A;  2RA1 A;  4JV5 T;  4EZH A;  2E9X D;  2WZH A;  4HFE A;  4K0U A;  4YTP A;  5CFB A;  5AQM B;  4DV5 T;  3KBU A;  4HE8 A;  3AEE A;  2CHN A;  4LMK A;  4LF8 T;  2W63 A;  2YIN A;  4QWN B;  2V6Y A;  5H6Q B;  3ZYL A;  2V8S V;  5C2T A;  5HEJ A;  4X62 T;  3BK9 A;  4MAL A;  3VR9 A;  3D0T A;  3PJA A;  2LSK A;  3PUS A;  2K9A A;  2N9D A;  4IST A;  3TLS A;  5AQP B;  3ZMZ B;  2MAW A;  5JQG E;  3K3Q C;  3NKZ A;  3ZYM A;  5LYJ E;  4M1P A;  3RRW A;  2V5D A;  3N9O A;  1MIV A;  3AXJ B;  3RKG A;  5LMU T;  4YXD A;  5L2L A;  3CPZ A;  5CA0 E;  3AEC A;  5LJN A;  2E9X A;  4LFA T;  3ZT7 A;  2K24 A;  3A5X A;  5FNV E;  3UUX B;  2A2F X;  4KHP T;  3FBZ A;  3V5U A;  4MBQ A;  4QHO A;  4HGA A;  1BR0 A;  3QB5 A;  2V7J A;  1XDP A;  2W67 A;  4Z91 A;  1WYB A;  4J2C A;  3RYI E;  5LGN B;  1T72 A;  2CXF A;  4JEH B;  2K48 A;  2I0M A;  4ASK A;  1E7P A;  2OLT A;  2L8K A;  2DHR A;  2VK9 A;  4YHH T;  3AED A;  1G73 A;  5LNK A;  5JDQ A;  1JNR A;  4I50 E;  3CX7 B;  5ABF A;  2UU9 T;  2CWO A;  1LVF A;  2J1D G;  3A8Y C;  3MAC A;  3G06 A;  4KHZ F;  2JQH A;  3I1A A;  3LBX B;  3PTR B;  3SFD A;  3QK6 A;  3OTO T;  4WW0 A;  3RH3 A;  3U3I A;  3OYZ A;  3JAD A;  1G8X A;  4YSX A;  3KFW X;  3CK6 A;  4H9R C;  5EZY E;  2LKH A;  4DV7 T;  4AKH A;  2KT9 A;  2BVM A;  3FXE B;  4KBM B;  4TZ4 C;  5AQF B;  2N2N A;  2XQ3 A;  4TWD A;  4JI0 T;  2JQK A;  1KK7 A;  3PUW F;  2X66 A;  2IIU A;  4YTN A;  2ES0 A;  1UGO A;  1YD8 G;  5HEU A;  4AQF A;  5KX5 E;  2JMH A;  2L9Q A;  2M67 A;  4DV3 T;  3ZN0 B;  1IAP A;  2CMR A;  3ZEF B;  5L47 A;  1YKE B;  2IC6 A;  5AQG B;  4H9P C;  3C4X A;  4HFH A;  5IWA T;  4JYA T;  2AE9 A;  3QB5 K;  2NOX A;  2WMO A;  3ZST A;  2BKN A;  3LK4 2;  4EZ4 A;  5J2T E;  1JNZ A;  2PTF A;  2H7O A;  2WMN A;  4U7I A;  2LE8 A;  1T98 A;  4EAH A;  5HXE A;  5LG4 A;  2QA7 A;  1V9D A;  3I0Q A;  3MXZ A;  2ODU A;  3DJB A;  3N2O A;  4MFR A;  5IHY A;  4OYK A;  5FL1 A;  5LGT B;  3J7Y q;  4BAY B;  3H3M A;  1UCU A;  5LJM A;  4B3S T;  1XWM A;  4B6X A;  2BDE A;  4PNI A;  2XAH B;  3P4P A;  1FIO A;  4GIW A;  4UF0 B;  3ZJ2 A;  4A98 A;  4JI4 T;  3Q5W A;  1UX4 A;  3KVA A;  3SFE A;  2EHO D;  4EOZ B;  2F4V T;  2BZB A;  4EYU A;  3PUA A;  3PUQ A;  1HX1 B;  2WB5 A;  3LJC A;  2W4X A;  2QYW A;  1WYC A;  2X67 A;  1VCT A;  1LRZ A;  5EK3 A;  3TKL B;  3O9X A;  2UUA T;  3VKH A;  4QXH B;  5LGU B;  1AJ3 A;  1T8B A;  1KNP A;  2VKO A;  4O8S A;  1YXR A;  1T7S A;  5FMN A;  5CA1 E;  1YKH B;  1HFA A;  3B13 A;  3L8R A;  3UFE A;  5LOV E;  3VRB A;  4YJ2 E;  3ZKR A;  4AKI A;  5CB4 E;  4U31 A;  2MOZ A;  3LG7 A;  4DV4 T;  3AE5 A;  3CIR A;  2C0S A;  2IDO B;  3BQK A;  2CBJ A;  3N9N A;  4OFZ A;  4LFC T;  1XZY A;  1YW0 A;  2NW9 A;  5F5W A;  1HTJ F;  2V7M A;  4HFB A;  4H9N C;  3RRC A;  2B76 A;  2WZI A;  3HKD E;  3PUV F;  2I59 A;  3T1H T;  1W09 A;  1FJG T;  1KNR A;  3ZMS B;  3KV6 A;  1N32 T;  4ZEY A;  2LJL A;  1Z0P A;  5LCY A;  3R6N A;  1H7C A;  2WU2 A;  2V6X A;  4YT0 A;  1MMA A;  3AE2 A;  3GN5 B;  1IJ6 A;  3KV5 A;  4A56 A;  4LMJ A;  5LG3 A;  2VL8 A;  3RLF F;  4EED A;  4GYS A;  2BVL A;  4NUU A;  1N33 T;  4WNK A;  1XMQ T;  2ZM8 A;  4UEM A;  1MMN A;  1U4Q A;  4JI7 T;  2CCQ A;  2DLR A;  4ILA A;  4PW8 A;  5JDH A;  4DV6 T;  4QH1 A;  4HKA A;  4EV6 A;  2XM1 A;  5HXR A;  3ZMU B;  4JI3 T;  3EDV A;  1X79 A;  3LBX A;  2PBI A;  4AQG A;  3LK3 B;  1BR4 A;  3M65 A;  4TN7 B;  1M62 A;  3B57 A;  3LFM A;  2RPA A;  3KV9 A;  3VHL A;  3AAE B;  5J2U E;  1D1C A;  2C5K T;  1NEN A;  3AEA A;  4QXB B;  1S35 A;  5AQK B;  2Y6X A;  3ZPO A;  2Z6E A;  4YSY A;  2XAQ B;  2BG9 C;  2J4G A;  2M6B A;  2VL0 A;  2WQY A;  3NRY A;  3ZT6 A;  1FMV A;  3ONL C;  3GMI A;  5JDF A;  4DBQ A;  2HH7 A;  2BBH A;  2C5I T;  3O4X E;  3JAF A;  2FJA A;  3N2K E;  2NR4 A;  3ONJ A;  1WR0 A;  4IIJ E;  5HXS A;  2DWG A;  1D0Y A;  2DCF A;  3Q2M A;  3T8O A;  4TV8 E;  1J1J A;  2PJQ A;  2JMK A;  4MHC A;  4JI5 T;  3F2E A;  3RPU A;  2OV9 A;  3UU4 A;  5L3C B;  4C91 A;  2Q9Q C;  3C98 B;  3HKB E;  3VR8 A;  4YHJ A;  4IE0 A;  2WP9 A;  1L0V A;  2EHO B;  2IHR 1;  4AKR B;  2BS4 A;  5HEH A;  4LFB T;  1S94 A;  3HL6 A;  4H63 V;  5FY0 A;  1NEK A;  1OED B;  4QX7 B;  2LT3 A;  3EHZ A;  4HWH A;  3NWI A;  4I4T E;  2LOP A;  4H9O C;  3F57 A;  4EXT A;  4B3T T;  4A5X A;  2XSA A;  2YN6 A;  3SS1 A;  3RC8 A;  4CI3 B;  5AFU L;  2XQ6 A;  4ZS2 A;  5ETW A;  1VOM A;  5HYA A;  4HN9 A;  1US7 B;  2LHR A;  4ZI7 E;  2BBJ A;  1SA0 E;  3QNU A;  4PK4 A;  4COF A;  1N36 T;  1B7T A;  3AB3 B;  3N2G E;  4E7S A;  3KBT A;  2CEA A;  3J9X 1;  2YU1 A;  5JDM A;  1DU2 A;  4I55 E;  2E9X C;  5LB7 B;  3MJX A;  4C90 A;  4JI1 T;  3CML A;  4GOU A;  4DV2 T;  1D1A A;  2XY8 B;  4L0R A;  2M6I A;  4DVD A;  3CQG B;  3W15 B;  3ETV A;  4L5G A;  3MKD A;  5HCM A;  4O4L E;  3RQU A;  2DI4 A;  2LEH A;  3CQX C;  3FB2 A;  5HAX A;  3RF1 A;  2UXX B;  2W62 A;  2V7I A;  4KUM B;  2V1D B;  4UIG A;  1M7K A;  3JCF A;  3ZCJ A;  4AQY T;  3KDS E;  1ZP0 A;  2IML A;  4I0U A;  3PUG A;  3ZN1 B;  4BJM A;  5JR9 B;  5KXJ A;  1HR0 T;  3NZP A;  3T1Y T;  5LA6 E;  2D5U A;  5ABF B;  2FJE A;  2UXN B;  1ZV4 X;  1SHZ C;  5JDG A;  5C8Y E;  1HNX T;  1LVK A;  2X0H A;  4QKN A;  3P4Q A;  2Q9Q D;  3O1H A;  3IBP A;  2V7L A;  2EHO A;  2MYS A;  2YDS A;  4IHJ E;  3VRA A;  1I94 T;  4HTE A;  1YQ3 A;  3FXD B;  4U2Y A;  4ZXL A;  1Z8U A;  5A1L A;  2D9D A;  4O2B E;  4F6R C;  3Q5X A;  2BS2 A;  4JI8 T;  2FBW A;  4ZI2 C;  3P8C D;  2KLQ A;  4P0B A;  4TNV A;  3PE0 A;  5AQQ B;  3AA0 B;  4DR1 T;  3L3P A;  5KDM C;  5JTG A;  4NPP A;  5DQV A;  5BMV E;  2LM2 A;  3FBL A;  4G2A A;  3R84 B;  3RYF E;  3JAE A;  4IDN A;  4V1A v;  2UXC T;  4O4J E;  4I43 B;  2X9W A;  3N9L A;  4ZOL E;  3SRZ A;  5EK2 A;  4TUY E;  3OVU A;  4P09 A;  2BKP A;  5C3J A;  3AA6 B;  2D0U A;  2ZLY A;  5HEO A;  2LSG A;  2BG9 E;  2XUE A;  3VU7 H;  3ZYK A;  4X65 T;  3VKG A;  4IDZ A;  2FUP A;  2X9H A;  2XPK A;  4DR7 T;  3V5S A;  2W2U A;  2KMF A;  2NP9 A;  4BA9 A;  1QUU A;  5ABH A;  2YKS A;  2XQY A;  3FZL B;  4EB6 E;  5JRC A;  3EDU A;  4QX8 B;  4IGU A;  4YJ3 E;  5EK4 A;  3ZSS A;  4B3M T;  4QH5 A;  5FXW A;  4LF7 T;  3AAI A;  3RC3 A;  3K1S A;  4DND A;  3AE7 A;  3ESL A;  3Q5E A;  2VQE T;  3FZK B;  3ZC1 A;  4CN4 A;  3ANW A;  4ZS3 A;  3AEB A;  4JI2 T;  3UU5 A;  4ISS A;  4DID B;  4PJN A;  4ADZ A;  1ZHC A;  4OK0 A;  2XZE A;  3F31 A;  5H6R B;  5ABG A;  4EGW A;  1MIY A;  2IW5 B;  2BKO A;  2XQ5 A;  2A72 A;  3OKQ A;  2J47 A;  4O4I E;  2C5J A;  3MZK B;  2ZM2 A;  3UQ4 A;  1OWA A;  4QH4 A;  3UUL A;  4O4H E;  4BJN A;  2VWA A;  2Y48 B;  4GKK T;  4AI6 A;  2HN1 A;  2X9Y A;  2LM9 A;  2WCA A;  3UUB A;  4YLH A;  4P0A A;  2XQA A;  2XAS B;  2LSY A;  2CE7 A;  4ILB A;  5AQI B;  2H89 A;  4EIW A;  3LDQ B;  4CXW A;  1HS7 A;  2A3D A;  1SE7 A;  3NVO A;  3WI3 A;  3I9Y A;  3RIA A;  4KMC A;  2Q9Q B;  5DQW A;  1IBL T;  4UVC B;  3UUN A;  3ZCI A;  5AQL B;  3C4W A;  3L39 A;  4ZZC A;  2XJ7 A;  4NXM T;  1NAF A;  2X0L B;  2VKJ A;  5FYM A;  4X1Y E;  3UU3 A;  3N9M A;  4DO0 A;  3B5M A;  4L9I A;  4X5T A;  3UTK A;  1HF8 A;  1WCR A;  2H88 A;  2WDV A;  2X68 A;  3PU8 A;  3Q9D A;  2XQ7 A;  2YDQ A;  3PUY F;  3LK2 B;  3O1I A;  1HNZ T;  4U72 A;  4DR2 T;  4XBF B;  2UXD T;  2FJB A;  4U74 A;  4X66 T;  2X51 A;  2LRK A;  1GQE A;  2MTQ A;  4PJJ A;  2E8I A;  4TWH A;  4UV8 B;  2VVS A;  4XZC A;  5AQT B;  4X20 E;  3EAM A;  5JDN A;  4DR6 T;  3ZJ1 A;  4G63 A;  2FJD A;  4AXP A;  4EYY R;  2VUR A;  2W00 A;  2JRK A;  3FHN A;  2LSI A;  4Q25 A;  5L3E B;  3P4S A;  2A9U A;  2YK0 A;  4ZHQ E;  4LF5 T;  3AE3 A;  3NZQ A;  4U7Y A;  4B3R T;  4UV9 B;  4E7Z A;  4DUY T;  3KV4 A;  4AKG A;  5CGM A;  2WDQ A;  4IDP A;  2AXD S;  1CUN A;  1IJ5 A;  3NRX A;  2HPJ A;  3C64 A;  4JBW F;  2ACX A;  4GK0 E;  4KX6 A;  4OYJ A;  2VQF T;  1IBK T;  4YTM A;  3KIN B;  2KSR A;  3PUZ F;  5JDL A;  2CLY B;  3UU6 A;  1MMD A;  2ZMA A;  3M3Z B;  3N9P A;  4O2A E;  5HCJ A;  3X1D A;  4NXN T;  5JRE A;  3GWH A;  3ZMV B;  3AE4 A;  4MLK A;  4UVB B;  4U3C A;  3MA9 A;  2X0Y A;  2W66 A;  4H9S E;  5HXH A;  1MIW A;  1UUR A;  3C4Z A;  2H3R A;  2CLY C;  2DNX A;  4HWC A;  3RX6 A;  5LHI B;  4DR4 T;  4K0K T;  2BG9 A;  2CM0 A;  3QUJ A;  2P9B A;  4UXN B;  5ADX L;  5HWX A;  2DWK A;  4CXY A;  1D0Z A;  4OHF A;  4XAX B;  3IHR A;  5JH7 E;  2XAF B;  3HA4 A;  3RYC E;  2E5V A;  3ABV A;  2E9X B;  3TLT A;  3FZF B;  2CBI A;  3RIF A;  3AAA B;  3GN5 A;  3RHW A;  3SWH A;  2K5B B;  2KZ7 B;  3AVR A;  1ZKE A;  2IUB A;  2ZM6 T;  1HG5 A;  2SPC A;  5AQJ B;  1N34 T;  2HHH T;  2CRB A;  5AQR B;  3HI2 A;  3PDY A;  4IDO A;  5L3F B;  1UK5 A;  1UUS A;  5L4E A;  4IE7 A;  3AA7 B;  2KXP B;  1W9R A;  3OPC A;  1NWM X;  3QC9 A;  4KP3 C;  3AE9 A;  2XHE B;  3HKE E;  2WWV A;  1XMO T;  3OJA A;  2KWH A;  3AVS A;  3C51 A;  5LBM A;  3EVY A;  1BR2 A;  5AQN B;  2CXD A;  3CX6 B;  5L3D B;  3N9Q A;  4IRE A;  2DL1 A;  3U78 A;  1HG2 A; 
#chains in the Genus database with same CATH homology
 5JR9 C;  3PUR A;  1OXZ A;  4AKL A;  3BQI A;  1D1B A;  2GK9 A;  2MBG A;  3WAJ A;  3MK7 C;  3WAK A;  4DBR A;  5HXC A;  1IZN B;  4IE4 A;  1EZ3 A;  2V7K A;  3C50 A;  5FY1 A;  4DMW A;  5M4Y A;  4QXC B;  2YU2 A;  3S4U A;  1MNE A;  3HR0 A;  4IE5 A;  3RKO A;  1E1H B;  3CQC B;  3KVB A;  4CZZ B;  2D0T A;  3K8P C;  4ZI3 D;  2OA5 A;  2VB6 A;  2Y8D A;  3OYX A;  2WBL A;  4UVA B;  2N1G A;  4FJO A;  4ERR A;  3PU3 A;  4X1I E;  2B1E A;  5TAO A;  1LKX A;  1QSD A;  3DTO A;  2EHO C;  2HPL A;  1MMG A;  4TX5 A;  2NTX A;  3O1J A;  4ILU A;  4PK5 A;  3I9W A;  2LSJ A;  5DAB A;  4ANJ A;  2W61 A;  4GK5 E;  3UT5 E;  2W0G A;  1VRB A;  5L3G B;  1UX5 A;  3K3O A;  4PFO A;  2VKH A;  1BR1 A;  2YEV C;  4PK6 A;  2LOS A;  4UEL A;  5HWY A;  4AQF C;  1MND A;  4TV9 E;  3ZMT B;  3GA8 A;  4JUY A;  2ZM0 A;  2JPF A;  4H9Q C;  4WBN E;  2XTL A;  5LBQ B;  5F3J A;  2KND A;  2JQQ A;  5LXT E;  1WR6 A;  1Y64 B;  3IEE A;  5FP3 A;  3UUM A;  3AA1 B;  2NW8 A;  4HEA A;  3K3N A;  2CWY A;  3DP7 A;  2CA5 A;  2XAG B;  4ZI2 D;  3ZLI A;  5FY7 A;  4IE6 A;  1HX8 A;  2KIN B;  3HKC E;  1U5P A;  4UF0 A;  5L3B B;  1FMW A;  2PFV A;  2Q9Q A;  4NUV A;  4JEU B;  2VAS A;  1HCI A;  5LHH B;  3L09 A;  5FXV A;  3H37 A;  4ZI3 C;  2RP4 A;  3E08 A;  4N78 D;  5FXX A;  1ZEE A;  2IC9 A;  3JC6 D;  3OBV E;  4HFV A;  2D2S A;  4FI5 A;  2X9X A;  2JJ9 A;  3ANW B;  4CXX A;  2H7V C;  5F8P A;  5E0O A;  3RYH E;  3H3A A;  5LP6 E;  4WBO A;  3CWZ B;  3SOL A;  3P7I A;  5JVD E;  3ZC0 A;  4H63 H;  3ONX A;  5FXZ A;  4CI2 B;  2WAU A;  2NWB A;  2LHN A;  4PJM A;  2WSS V;  3E0Z A;  3ETU A;  1FEW A;  3BQL A;  3NBX X;  3CVR A;  3CX8 B;  1KNZ A;  5LHG B;  3I0O A;  5KMG P;  3N5L A;  4JLE A;  2G0U A;  5IYZ E;  2NW7 A;  2L3L A;  4Z8X A;  4X1K E;  2WWU A;  4CQI A;  2KWI B;  4YFS A;  3IF8 B;  3CKD A;  5GON E;  2QGS A;  3JC6 C;  5JRE A;  3E22 E;  2CXL A;  1WLX A;  4PJL A;  2ODV A;  4GYR A;  2XAJ B;  1D0X A;  4PAG A;  4DMV A;  4CI1 B;  5JR9 A;  5J1G A;  2WM9 A;  3EUH A;  4PFP A;  1O3X A;  2VKD A;  2PG8 A;  5DJQ C;  2NTY A;  2IAK A;  1WRD A;  2V26 A;  2RA1 A;  4EZH A;  2E9X D;  4K0U A;  3KBU A;  4HE8 A;  2W63 A;  2YIN A;  4QWN B;  5H6Q B;  3ZYL A;  3BK9 A;  4MAL A;  3D0T A;  3PUS A;  2LSK A;  4IST A;  2K9A A;  2N9D A;  3ZMZ B;  5JQG E;  3K3Q C;  3ZYM A;  5LYJ E;  4M1P A;  3RRW A;  3N9O A;  1MIV A;  5L2L A;  3CPZ A;  5CA0 E;  5LJN A;  2E9X A;  2K24 A;  3A5X A;  5FNV E;  3UUX B;  2A2F X;  3FBZ A;  3V5U A;  4MBQ A;  4QHO A;  4HGA A;  1BR0 A;  2V7J A;  3RYI E;  1WYB A;  4J2C A;  5LGN B;  4JEH B;  2CXF A;  2K48 A;  4ASK A;  2VK9 A;  2L8K A;  2DHR A;  5LNK A;  1G73 A;  5JDQ A;  4I50 E;  3CX7 B;  2CWO A;  1LVF A;  2J1D G;  3MAC A;  3I1A A;  3LBX B;  3PTR B;  3QK6 A;  4WW0 A;  3RH3 A;  3U3I A;  3OYZ A;  1G8X A;  3KFW X;  4H9R C;  5EZY E;  2KT9 A;  2BVM A;  3FXE B;  4KBM B;  4TZ4 C;  2N2N A;  1KK7 A;  2X66 A;  2ES0 A;  4AQF A;  1YD8 G;  5KX5 E;  2JMH A;  2L9Q A;  2M67 A;  3ZN0 B;  1IAP A;  2CMR A;  3ZEF B;  1YKE B;  2IC6 A;  4H9P C;  3C4X A;  5J2T E;  2NOX A;  2WMO A;  3LK4 2;  4EZ4 A;  2WMN A;  5HXE A;  2H7O A;  4EAH A;  5LG4 A;  2LE8 A;  1T98 A;  2QA7 A;  1V9D A;  3I0Q A;  3MXZ A;  2ODU A;  3DJB A;  3N2O A;  4MFR A;  5IHY A;  4OYK A;  5LGT B;  3J7Y q;  4BAY B;  5LJM A;  1UCU A;  4B6X A;  2BDE A;  4PNI A;  2XAH B;  1FIO A;  4GIW A;  4UF0 B;  3ZJ2 A;  3Q5W A;  1UX4 A;  3KVA A;  4EOZ B;  2EHO D;  2BZB A;  4EYU A;  3PUA A;  3PUQ A;  3LJC A;  1WYC A;  2X67 A;  5EK3 A;  1LRZ A;  3TKL B;  3O9X A;  3VKH A;  4QXH B;  1AJ3 A;  5HXH A;  2VKO A;  4O8S A;  5FMN A;  5CA1 E;  1YKH B;  1HFA A;  3B13 A;  3UFE A;  4YJ2 E;  5LOV E;  4AKI A;  5CB4 E;  2MOZ A;  3LG7 A;  2C0S A;  3BQK A;  3N9N A;  4OFZ A;  1YW0 A;  2NW9 A;  1HTJ F;  2V7M A;  4H9N C;  3RRC A;  3HKD E;  2I59 A;  3ZMS B;  3KV6 A;  2LJL A;  1Z0P A;  5LCY A;  3R6N A;  1H7C A;  1MMA A;  3GN5 B;  4A56 A;  1IJ6 A;  3KV5 A;  2VL8 A;  4GYS A;  2BVL A;  4NUU A;  4WNK A;  2ZM8 A;  4UEM A;  1MMN A;  1U4Q A;  2CCQ A;  2DLR A;  4PW8 A;  5JDH A;  4HKA A;  5HXR A;  3ZMU B;  3EDV A;  1X79 A;  3LBX A;  2PBI A;  4AQG A;  3LK3 B;  1BR4 A;  3M65 A;  4TN7 B;  3B57 A;  3LFM A;  3KV9 A;  3VHL A;  3AAE B;  5J2U E;  1D1C A;  2C5K T;  4QXB B;  3ZPO A;  5JRC B;  1S35 A;  2Y6X A;  2Z6E A;  2XAQ B;  3NRY A;  1FMV A;  5JDF A;  3GMI A;  4DBQ A;  2HH7 A;  2C5I T;  3O4X E;  3N2K E;  4IIJ E;  5HXS A;  2DWG A;  1D0Y A;  2DCF A;  3Q2M A;  3T8O A;  4TV8 E;  2PJQ A;  2JMK A;  4MHC A;  3F2E A;  3RPU A;  5L3C B;  4C91 A;  2Q9Q C;  3C98 B;  3HKB E;  4YHJ A;  4IE0 A;  4AKR B;  2EHO B;  1S94 A;  3HL6 A;  4H63 V;  5FY0 A;  4QX7 B;  4ZS2 A;  2LT3 A;  4I4T E;  2LOP A;  4H9O C;  3F57 A;  4EXT A;  3SS1 A;  3RC8 A;  4CI3 B;  5AFU L;  5ETW A;  5HYA A;  1VOM A;  4HN9 A;  1US7 B;  2LHR A;  4ZI7 E;  1SA0 E;  4PK4 A;  1B7T A;  3AB3 B;  3N2G E;  3KBT A;  2CEA A;  3J9X 1;  2YU1 A;  5JDM A;  4I55 E;  2E9X C;  3MJX A;  4C90 A;  3CML A;  4GOU A;  1D1A A;  4L0R A;  4DVD A;  3CQG B;  3W15 B;  3ETV A;  4L5G A;  3MKD A;  4O4L E;  2DI4 A;  3FB2 A;  3CQX C;  2LEH A;  5HAX A;  4E7S A;  2UXX B;  2W62 A;  2V7I A;  4KUM B;  2V1D B;  4UIG A;  3ZCJ A;  3KDS E;  3ZN1 B;  3PUG A;  4BJM A;  5JR9 B;  3NZP A;  5LA6 E;  2D5U A;  2UXN B;  1ZV4 X;  1SHZ C;  5JDG A;  5C8Y E;  1LVK A;  4QKN A;  2Q9Q D;  3O1H A;  3IBP A;  2V7L A;  2EHO A;  2MYS A;  4IHJ E;  4HTE A;  3FXD B;  5A1L A;  4O2B E;  4F6R C;  3Q5X A;  4ZI2 C;  3P8C D;  2KLQ A;  4P0B A;  3PE0 A;  3AA0 B;  3L3P A;  5KDM C;  5DQV A;  5BMV E;  3FBL A;  4G2A A;  3R84 B;  3RYF E;  4V1A v;  4O4J E;  4I43 B;  2X9W A;  3N9L A;  4ZOL E;  3SRZ A;  5EK2 A;  4TUY E;  4P09 A;  3AA6 B;  2D0U A;  2ZLY A;  2LSG A;  2XUE A;  3ZYK A;  3VU7 H;  3VKG A;  4IDZ A;  2X9H A;  3V5S A;  2KMF A;  2NP9 A;  4BA9 A;  1QUU A;  2XQY A;  4EB6 E;  5JRC A;  3EDU A;  4QX8 B;  4IGU A;  4YJ3 E;  5EK4 A;  5FXW A;  3AAI A;  3RC3 A;  4DND A;  3ESL A;  3ZC1 A;  3ANW A;  4ZS3 A;  4ISS A;  4PJN A;  4ADZ A;  1ZHC A;  4OK0 A;  3F31 A;  5H6R B;  1MIY A;  2IW5 B;  2A72 A;  3OKQ A;  4O4I E;  2C5J A;  3MZK B;  2ZM2 A;  3UUL A;  1OWA A;  4BJN A;  4O4H E;  2VWA A;  2Y48 B;  4AI6 A;  2X9Y A;  2LM9 A;  4YLH A;  4P0A A;  2XAS B;  2LSY A;  2CE7 A;  4EIW A;  1HS7 A;  4CXW A;  2A3D A;  3WI3 A;  3I9Y A;  4KMC A;  2Q9Q B;  5DQW A;  4UVC B;  3UUN A;  3ZCI A;  3C4W A;  1NAF A;  2X0L B;  2VKJ A;  5FYM A;  4X1Y E;  4DO0 A;  3N9M A;  4L9I A;  3UTK A;  1HF8 A;  3PU8 A;  3Q9D A;  2X68 A;  3LK2 B;  3O1I A;  4U72 A;  4XBF B;  4U74 A;  2X51 A;  2MTQ A;  4PJJ A;  4UV8 B;  2E8I A;  5JDN A;  4XZC A;  4X20 E;  3ZJ1 A;  4G63 A;  5L3E B;  4AXP A;  4EYY R;  2W00 A;  5LGU B;  2JRK A;  3FHN A;  2LSI A;  4AKH A;  2YK0 A;  4ZHQ E;  3NZQ A;  4UV9 B;  4E7Z A;  3KV4 A;  4AKG A;  3NRX A;  1CUN A;  1IJ5 A;  2HPJ A;  3C64 A;  2ACX A;  4GK0 E;  4OYJ A;  3KIN B;  5JDL A;  2CLY B;  1MMD A;  2ZMA A;  3N9P A;  4O2A E;  3GWH A;  3ZMV B;  4MLK A;  4UVB B;  3MA9 A;  4H9S E;  1MIW A;  3C4Z A;  2H3R A;  2CLY C;  2DNX A;  3RX6 A;  5LHI B;  3QUJ A;  2CM0 A;  4UXN B;  2P9B A;  5ADX L;  5HWX A;  2DWK A;  4CXY A;  1D0Z A;  4OHF A;  4XAX B;  3IHR A;  5JH7 E;  2XAF B;  3HA4 A;  3RYC E;  2E9X B;  3AAA B;  3GN5 A;  3SWH A;  2K5B B;  2KZ7 B;  3AVR A;  1ZKE A;  1HG5 A;  2SPC A;  3HI2 A;  3PDY A;  5L3F B;  4IE7 A;  3AA7 B;  2KXP B;  3QC9 A;  1NWM X;  4KP3 C;  2XHE B;  3HKE E;  3OJA A;  2KWH A;  3AVS A;  3C51 A;  5LBM A;  3EVY A;  1BR2 A;  2CXD A;  3CX6 B;  5L3D B;  3N9Q A;  3U78 A;  1HG2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...