1WRDA

Crystal structure of tom1 gat domain in complex with ubiquitin
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
98
structure length
98
Chain Sequence
GPLGSEQIGKLRSELEMVSGNVRVMSEMLTELVPTQAEPADLELLQELNRTCRAMQQRVLELIPQIANEQLTEELLIVNDNLNNVFLRHERFERFRTG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Target of Myb protein 1
publication title Structural basis for recognition of ubiquitinated cargo by Tom1-GAT domain.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein transport/signaling protein
total genus 39
structure length 98
sequence length 98
ec nomenclature
pdb deposition date 2004-10-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03127 GAT GAT domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.160 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 1wrdA00
2N2NA 1NWMX 1WR6A 1YD8G 2N9DA 1X79A 1O3XA 1NAFA 1WRDA 1OXZA
chains in the Genus database with same CATH superfamily
1UURA 2A72A 4H9SE 1VOMA 2XQ7A 4UF0B 4MBQA 3TLWA 2LSGA 3EDUA 2LSIA 2OV9A 1ZOYA 2W00A 3ANWB 1X79A 2WZHA 4H9NC 4EYUA 4BJMA 5FVKA 2XQ4A 3Q5WA 1U5PA 5HEJA 5FXXA 4HFHA 3UFGA 2BBHA 4TUYE 4DV5T 4LMJA 2ZM2A 5AFUL 3KBUA 2KMFA 2QYWA 4DO0A 3O1JA 3IEEA 1D0XA 2NOXA 2HHHT 4OYJA 3LFMA 3PDYA 2UXNB 5L3CB 2VL0A 5L47A 4LFAT 3F2EA 3CPZA 4CN4A 2DL1A 5CA1E 5HAXA 2X9HA 4X1YE 3OPCA 3B57A 1N34T 4IDOA 4MLKA 4BA9A 3PJAA 3P4QA 2WM9A 4CI2B 4ZEYA 4JUYA 4QXBB 5EZYE 5LHGB 4IE7A 3LBXB 2C0SA 5E0OA 1IBMT 3RRWA 4CZZB 3RQUA 3OYZA 3J9X1 2WDQA 4OK0A 2QA7A 3RX6A 4UVCB 3FZFB 2KZ7B 3FHNA 3VRAA 4C90A 2BG9B 3MJXA 2IW5B 4CXYA 4PFPA 5L4HA 3KV5A 1W0BA 4PNIA 3JADA 5FY0A 5AQKB 4F6RC 1JNRA 5L3GB 2I6HA 2J62A 3ZT7A 5JRCA 2UUAT 2YK0A 2KSRA 2Q9QC 5JR9B 4TZ4C 1WLXA 2LM9A 4TWDA 1SE7A 1FIOA 4YHHT 2J47A 2RP4A 5FVLA 4AI6A 2ZM8A 1OEDE 5LMNT 5CB4E 4DV2T 3IF8B 4BJNA 3PUQA 2XTLA 1OEDA 3C4WA 5LJMA 4KHPT 4WNKA 4KMCA 2WP9A 4ERRA 4DNDA 4HEAA 1BR0A 2A2FX 2DCFA 2XQ9A 4EAHA 2LM2A 3C64A 1WYBA 4JI6T 1HFAA 4QXCB 4QX8B 4ZI3D 4PJJA 2CCQA 4UEMA 3CX7B 3HKCE 2WU2A 2W61A 2Z6EA 3N9PA 4ZI3C 1MMDA 2X67A 4C91A 2LOSA 4H9OC 5FL1A 1D1AA 4Z8XA 4JI4T 1Z8UA 3ZYLA 1E2AA 1OEDC 2XASB 5CGMA 3FZMB 4JEHB 4DR7T 4EXTA 3OTOT 3LSVA 4JV5T 2J1DG 3PJAJ 1LVKA 5DABA 1I94T 1KEYA 3QNUA 2V7MA 2FJAA 4UR9A 2LEHA 2V5CA 1JNZA 4X5TA 5ABEA 2XQ5A 4LF4T 2X9XA 3W15B 2LKHA 2NP9A 3E0ZA 4HWCA 4IDPA 2X9WA 2W62A 4CI1B 3ONJA 5L3DB 3KDSE 3KBTA 3ZMSB 4EGWA 2WZIA 4LFBT 4OFZA 2V5DA 3J7Yq 4QKNA 2UUCT 2IDOB 3MXZA 5LBMA 4CXXA 2XAQB 5C8YE 1N32T 2XHEB 2MTQA 4TNWA 3I9WA 1T98A 3TLUA 4YJ3E 5F3JA 4ISTA 5AQMB 4ISSA 3ZN1B 4YTMA 5HWXA 3N5LA 2JIWA 3N9NA 2VWAA 3ESLA 2QRXA 1J1JA 3FB2A 4DUYT 2WU5A 2OLTA 4DR1T 2JQHA 3UU8A 3N9OA 5JDMA 4YFSA 2KWHA 5HXHA 4NPPA 3BK9A 4EB6E 4N78D 2YDQA 4YJ2E 5ABFA 2CWOA 2LLYA 2KT9A 5LP6E 4KUMB 4AQFC 5KX5E 4AKGA 3RQWA 3CIRA 5F8PA 2HPJA 2JMHA 4IDQA 4IT4A 2CM0A 4YY3T 5AQSB 4KBMB 2E8IA 4KI0F 5LB7B 5EK3A 3RHWA 5LYJE 2R6GF 3LJCA 3MACA 4U31A 2CHNA 4LF9T 4P1NA 2UXDT 5L3EB 3M3ZB 2LHRA 2V7LA 3NBXX 3C4XA 3CX8B 3HR0A 3CQXC 2PG8A 4U2ZA 2H89A 3PUGA 4O4JE 4TV9E 5AQLB 2WWVA 2BZBA 5FXVA 4GK0E 2WAUA 4H9QC 3AEDA 5LXTE 2E9XD 2SPCA 3CVRA 5TAOA 2FUPA 4LFCT 5LGTB 4O4HE 1UK5A 3RIFA 4QH1A 3SRZA 2V7JA 3UULA 3KINB 4LMLA 1HNZT 1HTJF 1IAPA 5HXRA 3P8CD 4AKRB 5JDFA 1EZ3A 4X66T 3RGLA 4K0KT 4HFBA 5LBQB 4B3RT 3NVOA 5FY7A 2VB6A 2VKDA 4HFIA 3CK6A 3RH3A 4U3CA 2RA1A 2B1EA 3AVSA 3N9LA 2XZEA 3AEGA 2C5KT 2KXPB 2HN1A 4HFVA 2X0YA 4L9IA 4Z90A 3P4PA 3PUXF 3NWIA 5H6QB 1KNPA 3FZHB 1XDOA 1T8BA 3OJAA 4Z91A 4EZHA 4A56A 5LG3A 3GN5B 4K0UA 2V6YA 4WBNE 3RIUC 3TKLB 4I4TE 4JBWF 5JDLA 1XMOT 5HWYA 3A7MA 2B76A 5FMNA 3BQLA 4PK4A 4OHFA 3ZJ2A 2KINB 2UXBT 1YW0A 1M7KA 5JQGE 2X0LB 2YU2A 2DWGA 2ZM6T 5CFBA 3AEBA 1XMQT 2EHOB 2HH7A 3L8RA 1G73A 1QUUA 1J5ET 3RRCA 2NTYA 1W09A 3QUJA 1MIWA 2M6IA 5IUXA 2C5JA 3P4RA 4F8HA 3EUHA 2IC9A 2XY8B 4OYKA 4TNVA 2P9BA 2ODUA 3JAFA 1MMGA 1NEKA 4DV3T 2NR4A 2MOZA 4ILBA 4JI2T 4A97A 2BVMA 4TV8E 2WBLA 3X1DA 4FJOA 4P0BA 2VVSA 3AAIA 3TLSA 1FMVA 4PJLA 2CRBA 4AQYT 2YOEA 4HWDA 2ES0A 4U74A 5HXCA 5J0ZA 3TLVA 3MZKB 2ODVA 3TLTA 2UU9T 3PUZF 1WR6A 2E5LT 4B3MT 5M4YA 3HKDE 2XSBA 1AJ3A 3QK6A 4U7YA 4KP3C 4CN6A 4IE4A 4LF5T 3T1YT 3AE5A 5AQJB 4YSZA 2A3DA 4DBRA 5JREA 1WRDA 3C98B 3MA9A 1IZNB 3I1AA 5H6RB 1GQEA 3AE4A 3LG7A 5AQPB 5DQVA 5HEGA 3F57A 5LHHB 3ABVA 2Q9QA 4MFRA 2ZMAA 2V7IA 5IWAT 3AECA 4EIWA 3ZMZB 4DV1T 2F4VT 2M67A 2LRLA 4ZOLE 3AXJA 1E1HB 1UX5A 4J2CA 4GK5E 3A8YC 3UU5A 3RYCE 2CBJA 3AE3A 3DJBA 4LF7T 2K24A 4U72A 2VKOA 2BG9E 4L5GA 5JDQA 4DUZT 3ETUA 3OYXA 2LJLA 3K3NA 2LSKA 4B6XA 2YINA 5LMUT 5C3JA 4HFCA 5LGUB 3UUMA 5JRCB 2AE9A 2YDSA 3ZJ1A 1BR2A 2CXFA 4PK5A 2W67A 1QSDA 4E7SA 4X65T 5LOVE 4G63A 3EVYA 2D2SA 3O1IA 1UCUA 2C5IT 3I0QA 4JEUB 4QWNB 3F31A 3SWHA 5J2TE 1NWMX 3OKQA 3VR8A 4JLEA 3UUBA 2BG9C 4CN1A 4GYSA 1NENA 2PTFA 5CA0E 2PFVA 3PUYF 4QX7B 4ADZA 3FXEB 4ANJA 2YDRA 2BS3A 4O2BE 5JH7E 3ZLIA 5KDMC 2AXDS 3D0TA 5JR9C 3CMLA 5LG4A 3RC3A 1HNXT 1HCIA 3CQCB 3NRXA 3H3MA 2XJ7A 3Q2MA 4M1PA 3VKGA 3N2KE 3AAAB 1YQ4A 5DQWA 4HN9A 5L2LA 5AQUB 4DIDB 4HWIB 4JI7T 4P09A 3ZKRA 4TWHA 5LGNB 3UUNA 1LVFA 2CHOA 2YN6A 5IHYA 2CLYB 2XQ8A 1L0VA 3A5XA 3AE1A 1OXZA 3FBZA 4YHJA 3AE8A 2XAHB 3KV9A 4ZXLA 2MPKA 5L3FB 2D0UA 2YKSA 3FZLB 5LHIB 3AE2A 3C51A 3BQKA 5J1GA 1HX8A 4LF8T 4AISA 2LE8A 1YD8G 1W9RA 4DR2T 3HA4A 4ZI2D 2E2AA 5ABGA 3T8OA 4IIJE 2JQKA 3IHRA 2RPAA 5ABHA 2VURA 2DLRA 4AQFA 2FJDA 2VQET 2JQ9A 2ZLYA 3EABA 1KK7A 4O4LE 1MIVA 1D1BA 3HKEE 3JCFA 1SA0E 3QB5K 4IGUA 5LA6E 1WCRA 4YXDA 4B3TT 2YEVC 5L3BB 3AE7A 1WR0A 3CQGB 5LJNA 4HKAA 4JI8T 3DTOA 5KMGP 5ABFB 1WYCA 4H9PC 5JDGA 4JI3T 1BR1A 3LK2B 3SFDA 4ZHQE 5FY1A 3PTRB 2WB5A 3JC6D 3Q5EA 3GMIA 1FMWA 2E9XA 4XZCA 4AQGA 4HWFA 3VRBA 4O2AE 3JC6C 2W0GA 4PW8A 3ZEFB 4HE8A 1V9DA 4AKIA 1ZEEA 2N1GA 2E5VA 1HS7A 5L4EA 3EDVA 2V8SV 3QC9A 2BS4A 1HX1B 3K8PC 3KVAA 2XPKA 3RC8A 5EK4A 4GKJT 2E9XC 4QXHB 2H7OA 5HEUA 2JQQA 3ZT6A 4ZZBA 3UT5E 4DV0T 2W4XA 1Y64B 2A9UA 3N2OA 1UGOA 1IBKT 4YLHA 4UIGA 4PAGA 4IDNA 3RPUA 3L3PA 3SOLA 3P50A 2V7KA 4IE6A 2WCAA 3KFWX 2NTXA 1D0ZA 1LRZA 3BQIA 3UFEA 3RIUA 4HFEA 3ZN0B 3CX6B 3PU3A 3V5SA 2K5BB 3LK3B 3WAJA 4TWFA 4YTPA 4WZXA 3RYHE 1FJGT 2UXCT 3RYIE 3K3QC 1YKHB 4LF6T 4G2AA 3E22E 2LSYA 1XNRT 5HXSA 1IJ5A 3HL6A 3K1SA 2Y48B 2WMNA 1ZV4X 2D5UA 5JTGA 4ILCA 4E7ZA 2X0HA 2LOPA 2H7VC 5HCMA 3K3OA 4CI3B 2V6YB 4ZZCA 4JI0T 4U7IA 3MKDA 4GIWA 4KX6A 3UU4A 2H3RA 3U3IA 2NWBA 2CBIA 4EYYR 1XWMA 5KXJA 2LSJA 1I6ZA 2QVAA 4PFOA 4LMKA 5AQIB 3ZMUB 3P4SA 1ZKEA 5HYAA 3OVUA 1XDPA 4X1KE 2NW9A 3G06A 3RF1A 1KNZA 1KNRA 2HN2A 5GONE 2XSAA 2WY2A 3H3AA 2BVLA 5AQGB 1Y01A 4DBQA 4H63H 4IHJE 4UF0A 2LT3A 2L8KA 5AQOB 1H7CA 5A1LA 1ZHCA 3EHZA 3ANWA 2VK9A 4HWHA 2FBWA 1HG5A 3P4WA 3VR9A 4DMVA 3EI0A 1W0AA 5LCYA 2X66A 2JMKA 4ILAA 3ONLC 5FKYA 5J2UE 3UQ7A 3WI3A 3QOFA 2V6XA 4H9RC 2IUBA 2JJ9A 4UVAB 1HG2A 1MMAA 2CEAA 2IAKA 2EHOD 2WDRA 4AXPA 4QHOA 1NAFA 1UX4A 1E7PA 5FP3A 3R84B 5HXEA 2EHOC 2XAFB 3CWZB 4YSXA 4ZS3A 1S35A 3PUWF 2N9DA 3AE9A 2VASA 4IREA 2LHNA 4MHCA 2XM2A 2XQ6A 3N9QA 3SFEA 4NIQA 2VQFT 1T72A 3N9MA 4IE5A 4DVDA 3FZKB 2W66A 4Q25A 3C50A 4IDZA 2L3LA 3VKHA 1KFYA 3P7IA 2VKJA 1MMNA 4PK6A 2Q9QB 3UU6A 4MALA 4DR6T 3FBLA 2IC6A 4XAXB 4UVBB 4CQIA 3AXJB 4GYRA 2MYSA 2XQYA 4HGAA 2XM1A 5JDNA 5EK2A 1YKEB 3LBXA 4XBFB 3WAKA 1MNDA 3VHLA 4PJNA 2XUEA 4DR5T 3DP7A 1G8XA 3RIAA 3KV4A 1YQ3A 2JRKA 2GK9A 2MAWA 2BG9A 2K9AA 3B13A 4DR3T 1CHUA 1FEWA 4GKKT 3ZCIA 5AQVB 4ZI7E 3PURA 2NW7A 2Q9QD 2K3WA 1R8IA 2WQYA 2Y8DA 5AQHB 5FYMA 3RKOA 5ETWA 4TN7B 4EV6A 5JR9A 3E08A 2HPLA 2D0TA 2MBGA 3LK42 2LRKA 5JDHA 1LKXA 4ASKA 2WWUA 1HF8A 1BR4A 3AEEA 2IMLA 2J4GA 3AEAA 1SHZC 5FXZA 1OEDB 1WFDA 1OWAA 3AA1B 2N2NA 1N33T 4WYVA 3EAMA 3L39A 2PJQA 4X62T 1ZP0A 4ZS2A 3AVRA 2G0UA 3AE6A 3ZSTA 4BAYB 1Z0PA 3Q5XA 2I59A 2BBJA 2YU1A 2DHRA 1X9BA 4DR4T 5IYZE 2BS2A 4NUVA 3AEFA 4NXNT 4A98A 3UUXB 3IBPA 3NRYA 2WDVA 2ZM0A 5BMVE 4QH5A 2ACXA 2W63A 4COFA 4EEDA 4U33A 2DWKA 2JPFA 1SUMB 2BKOA 3VU7H 1XNQT 1YXRA 1QLBA 2V26A 3O9XA 3KV6A 4CXWA 3B5MA 3O4XE 3RKGA 4JI5T 3Q9DA 2UUBT 2FJEA 2X51A 5C2TA 2V1DB 1S94A 2LKGA 4UXNB 3ZCJA 4GOUA 3S4UA 4O4IE 3U78A 2WSSV 1IBLT 5BR8T 4ZI2C 3QB5A 3UU3A 4YTNA 4HFDA 2H88A 2XAJB 5HCJA 5DJQC 4IL9A 2XQAA 5ADXL 3O1HA 2I0MA 3PUAA 1US7B 4EOZB 2L9QA 2BKPA 4YT0A 2CXDA 2CLYC 4DV6T 2VL8A 3ZSSA 3KVBA 3ZC0A 4NXMT 3UTKA 4A5XA 3PU8A 4B3ST 2BDEA 5AQTB 1VCTA 5AQFB 2FJBA 3AA6B 3V5UA 5JVDE 2OA5A 3NZPA 2X68A 2CXLA 2DI4A 5F5WA 2XQ3A 2Y6XA 3AA7B 3MK7C 1KF6A 2BKNA 1UUSA 2KWIB 3UQ4A 1N36T 4L0RA 1VRBA 4AIUA 2DNXA 2WS3A 3R6NA 4NUUA 4V1Av 3I9YA 4FI5A 2E9XB 4JI1T 1CUNA 2X9YA 2XAGB 4EZ4A 2D9DA 4O8SA 1DU2A 1T7SA 2CA5A 1HNWT 5HEOA 4TX5A 4IE0A 3PUSA 3GWHA 3AA0B 2CMRA 3Q5DA 3IA3A 4UV9B 5LNKA 2CPTA 3ZYMA 4OX9T 5AQRB 2CE7A 2CWYA 3HI2A 3I0OA 3AB3B 3NKZA 4H63V 3FXDB 4DV7T 3ZC1A 2UXXB 2IHR1 3NZQA 2KLQA 4HTEA 4X64T 3ONXA 4WBOA 3C4ZA 3OBVE 2NW8A 5FNVE 2VVNA 2VKHA 2K48A 1D0YA 3H37A 3GA8A 2QGSA 3ZT5A 3CKDA 3ETVA 4U2YA 4I43B 2IIUA 5AQNB 1M62A 4YSYA 4WW0A 4QH4A 1O3XA 2PBIA 3PUVF 3LDQB 4DMWA 4JYAT 4AKLA 4P0AA 1IJ6A 3ZMTB 3ZYKA 1HR0T 4X1IE 3RLFF 4IL4A 2ACZA 3N2GE 3PE0A 4UELA 4I55E 5FXWA 5CJ5A 4ILUA 3M65A 4EEBA 3GN5A 1J5WA 3JAEA 2KNDA 1XZYA 5FL0A 4DV4T 2M6BA 3AAEB 1B7TA 2WMOA 4PJMA 3HKBE 1VCSA 4X20E 4UV8B 1MIYA 3L09A 4I50E 3ZMVB 5HEHA 3RI5A 2W2UA 4KHZF 1MNEA 3SS1A 4I0UA 3ZPOA 4AKHA 3T1HT 3RYFE 1D1CA 1U4QA 3PV0F 5AQQB 2EHOA
chains in the Genus database with same CATH topology
2WAUA 5L3FB 2D0UA 2GK9A 2A72A 5LHIB 4H9QC 4H9SE 1VOMA 5LXTE 3C51A 4UF0B 2E9XD 2SPCA 3CVRA 2K9AA 3BQKA 3B13A 5J1GA 1HX8A 4MBQA 2LSGA 5TAOA 3EDUA 2LSIA 2LE8A 2W00A 3ANWB 1YD8G 1X79A 1FEWA 3ZCIA 4ZI7E 3HA4A 4H9NC 4ZI2D 3PURA 2NW7A 3T8OA 2Q9QD 4IIJE 4EYUA 5LGTB 4O4HE 4BJMA 3IHRA 2Y8DA 5FYMA 3RKOA 5ETWA 4TN7B 3SRZA 3Q5WA 5JR9A 2V7JA 3E08A 2HPLA 3KINB 2DLRA 3UULA 1U5PA 4AQFA 1HTJF 1IAPA 5FXXA 2D0TA 5HXRA 2MBGA 3LK42 5JDHA 3P8CD 4AKRB 5JDFA 1EZ3A 1LKXA 4TUYE 4ASKA 2WWUA 1HF8A 1BR4A 2ZLYA 2ZM2A 5LBQB 1KK7A 4O4LE 5FY7A 2VB6A 1SHZC 2VKDA 5AFUL 5FXZA 3KBUA 1MIVA 1D1BA 2KMFA 3HKEE 3RH3A 2RA1A 4DO0A 3O1JA 1OWAA 2B1EA 3AA1B 1SA0E 3AVSA 2N2NA 3N9LA 4IGUA 5LA6E 2C5KT 2PJQA 2YEVC 5L3BB 2KXPB 3IEEA 1D0XA 4ZS2A 2NOXA 4HFVA 3CQGB 3AVRA 4OYJA 2G0UA 5LJNA 4HKAA 4L9IA 3LFMA 4BAYB 3DTOA 2UXNB 1Z0PA 3PDYA 3Q5XA 5KMGP 5L3CB 1WYCA 2I59A 4H9PC 5JDGA 2YU1A 3F2EA 5H6QB 2DHRA 3CPZA 5IYZE 1BR1A 3LK2B 4NUVA 4ZHQE 5FY1A 3OJAA 3PTRB 3UUXB 5CA1E 4EZHA 4A56A 5HAXA 2X9HA 3GN5B 3IBPA 3NRYA 4K0UA 4X1YE 2ZM0A 3JC6D 3B57A 3GMIA 1FMWA 2E9XA 4XZCA 5BMVE 4MLKA 4WBNE 4AQGA 2ACXA 2W63A 3TKLB 4O2AE 3JC6C 4I4TE 2W0GA 4BA9A 2DWKA 2WM9A 4CI2B 4PW8A 4JUYA 3ZEFB 4QXBB 2JPFA 1V9DA 4HE8A 5JDLA 5HWYA 4AKIA 5EZYE 5LHGB 4IE7A 1ZEEA 3VU7H 2N1GA 3LBXB 5FMNA 2C0SA 3BQLA 4PK4A 4OHFA 5E0OA 2KINB 3ZJ2A 3RRWA 1HS7A 2V26A 1YW0A 3EDVA 3O9XA 3KV6A 5JQGE 4CXWA 2X0LB 2YU2A 4CZZB 3O4XE 3QC9A 2DWGA 3OYZA 3J9X1 4OK0A 2QA7A 3RX6A 3Q9DA 2X51A 2EHOB 2HH7A 4UVCB 2V1DB 1G73A 1QUUA 1S94A 3RRCA 2NTYA 3K8PC 2KZ7B 3FHNA 3QUJA 1MIWA 4UXNB 4C90A 2C5JA 3KVAA 3RC8A 3EUHA 2IC9A 5EK4A 3MJXA 2IW5B 4OYKA 4CXYA 3ZCJA 4PFPA 2P9BA 2E9XC 2ODUA 4GOUA 3S4UA 4QXHB 3KV5A 2H7OA 4PNIA 4O4IE 2JQQA 5FY0A 4F6RC 1MMGA 3UT5E 5L3GB 3U78A 2WSSV 5JRCA 1Y64B 4ZI2C 3N2OA 2YK0A 2Q9QC 4YLHA 5JR9B 4UIGA 4PAGA 2MOZA 2XAJB 4TZ4C 3RPUA 3L3PA 3SOLA 5DJQC 1WLXA 5ADXL 3O1HA 2LM9A 2V7KA 2BVMA 4TV8E 2WBLA 4IE6A 3PUAA 1FIOA 1US7B 4UVAB 4FJOA 3KFWX 2NTXA 2RP4A 4EOZB 4P0BA 2L9QA 4AI6A 1D0ZA 2CXDA 3AAIA 2ZM8A 1FMVA 2CLYC 2VL8A 1LRZA 3KVBA 3ZC0A 3BQIA 4PJLA 3UFEA 3UTKA 3PU8A 2BDEA 5CB4E 3ZN0B 3IF8B 3CX6B 4BJNA 3PU3A 3AA6B 3V5SA 2K5BB 3V5UA 5JVDE 3LK3B 2ES0A 3PUQA 3WAJA 4U74A 2OA5A 5HXCA 3NZPA 2XTLA 2X68A 3C4WA 3RYHE 2CXLA 2DI4A 3RYIE 3MZKB 2ODVA 5LJMA 4WNKA 2Y6XA 3K3QC 1YKHB 3AA7B 4KMCA 1WR6A 3MK7C 4G2AA 4ERRA 3E22E 4DNDA 4HEAA 1BR0A 2A2FX 2DCFA 2LSYA 1IJ5A 3HL6A 4EAHA 5HXSA 2Y48B 3C64A 2WMNA 1ZV4X 5M4YA 2KWIB 3HKDE 1WYBA 1HFAA 4QXCB 4QX8B 1AJ3A 3QK6A 4ZI3D 4KP3C 4L0RA 4IE4A 2D5UA 4PJJA 1VRBA 2CCQA 2DNXA 3CX7B 3HKCE 3KV9A 4UEMA 3R6NA 4E7ZA 4NUUA 4V1Av 2W61A 2Z6EA 2A3DA 4DBRA 3N9PA 2LOPA 5JREA 4ZI3C 1WRDA 3C98B 2H7VC 3I9YA 3K3OA 4FI5A 4CI3B 2E9XB 3MA9A 1MMDA 1CUNA 3MKDA 4GIWA 1IZNB 2X67A 3I1AA 4C91A 5H6RB 2H3RA 3U3IA 2LOSA 2NWBA 3LG7A 2X9YA 4H9OC 1D1AA 4Z8XA 5DQVA 3F57A 4EYYR 5LHHB 3ZYLA 2XAGB 2LSJA 4PFOA 4EZ4A 2Q9QA 4O8SA 3ZMUB 4MFRA 2ZMAA 2CA5A 2XASB 2V7IA 4TX5A 4JEHB 4IE0A 4EIWA 4EXTA 3ZMZB 1ZKEA 5HYAA 2M67A 3PUSA 3GWHA 4ZOLE 3AA0B 1E1HB 2CMRA 1UX5A 4J2CA 2J1DG 4GK5E 4X1KE 4UV9B 2NW9A 5LNKA 3ZYMA 3RYCE 1LVKA 3DJBA 2CE7A 2CWYA 3HI2A 5DABA 2K24A 2V7MA 4U72A 3I0OA 1KNZA 2VKOA 3AB3B 5GONE 4H63V 4L5GA 5JDQA 3FXDB 3ETUA 2LEHA 3H3AA 3OYXA 2LJLA 3K3NA 2BVLA 2LSKA 4B6XA 4DBQA 2YINA 4H63H 4IHJE 4UF0A 2LT3A 2L8KA 2X9XA 3W15B 5LGUB 2NP9A 3UUMA 3E0ZA 1H7CA 5A1LA 5JRCB 1ZHCA 3ANWA 2VK9A 3ZJ1A 1BR2A 3ZC1A 2UXXB 2X9WA 2W62A 2CXFA 1HG5A 3NZQA 4PK5A 4CI1B 2KLQA 5L3DB 1QSDA 4HTEA 4E7SA 4DMVA 3KDSE 3KBTA 5LCYA 4G63A 5LOVE 3ZMSB 2X66A 3EVYA 2JMKA 3ONXA 2D2SA 4OFZA 3O1IA 4WBOA 1UCUA 2C5IT 3J7Yq 4QKNA 3I0QA 3C4ZA 3MXZA 3OBVE 4JEUB 5J2UE 3WI3A 2NW8A 5LBMA 5FNVE 2XAQB 4CXXA 5C8YE 2VKHA 4H9RC 2K48A 2XHEB 1D0YA 2MTQA 2JJ9A 3GA8A 2QGSA 3H37A 1HG2A 1MMAA 2CEAA 4QWNB 2IAKA 2EHOD 3I9WA 3F31A 3SWHA 1T98A 5J2TE 4AXPA 3CKDA 1NWMX 4QHOA 4YJ3E 1NAFA 1UX4A 3OKQA 5FP3A 3R84B 3ETVA 4ISTA 5F3JA 5HXEA 2EHOC 2XAFB 4I43B 4ISSA 3CWZB 4JLEA 4ZS3A 3ZN1B 1S35A 5HWXA 3N5LA 3N9NA 2N9DA 2VWAA 3ESLA 2VASA 4GYSA 3FB2A 4WW0A 2LHNA 5CA0E 2PFVA 4QX7B 1O3XA 4MHCA 4ADZA 3FXEB 2PBIA 3N9QA 4ANJA 3N9OA 4DMWA 5JDMA 4AKLA 4O2BE 4YFSA 4P0AA 2KWHA 5JH7E 3ZLIA 5HXHA 1IJ6A 3N9MA 5KDMC 3BK9A 3ZMTB 4N78D 4EB6E 4IE5A 4YJ2E 2CWOA 3ZYKA 3D0TA 2KT9A 5JR9C 4X1IE 4DVDA 5LP6E 3CMLA 4KUMB 5LG4A 3RC3A 4AQFC 5KX5E 4AKGA 1HCIA 3CQCB 5F8PA 3C50A 3N2GE 3NRXA 3PE0A 4UELA 4I55E 5FXWA 2HPJA 2JMHA 4IDZA 2L3LA 2CM0A 4ILUA 3M65A 3VKHA 3Q2MA 3P7IA 3GN5A 4M1PA 4KBMB 2E8IA 2KNDA 5EK3A 2VKJA 5LYJE 1MMNA 4PK6A 3VKGA 2Q9QB 3N2KE 3LJCA 4MALA 3AAAB 3FBLA 5DQWA 2IC6A 3AAEB 3MACA 4HN9A 4XAXB 5L2LA 1B7TA 2WMOA 4PJMA 3HKBE 4UVBB 5L3EB 4P09A 4CQIA 4GYRA 4X20E 2MYSA 2LHRA 4UV8B 1MIYA 2XQYA 5LGNB 4HGAA 3UUNA 2V7LA 1LVFA 5JDNA 5EK2A 1YKEB 3NBXX 3C4XA 3LBXA 4XBFB 3L09A 4I50E 3CX8B 3HR0A 3WAKA 3CQXC 2PG8A 1MNDA 5IHYA 3VHLA 3ZMVB 2CLYB 3A5XA 4PJNA 1MNEA 3SS1A 2XUEA 3PUGA 3ZPOA 4AKHA 1OXZA 4O4JE 3DP7A 4TV9E 1G8XA 3FBZA 4YHJA 3RYFE 1D1CA 1U4QA 2BZBA 3KV4A 5FXVA 2XAHB 2JRKA 4GK0E 2EHOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2N2N A;  1NWM X;  1WR6 A;  1YD8 G;  2N9D A;  1X79 A;  1O3X A;  1NAF A;  1WRD A;  1OXZ A; 
#chains in the Genus database with same CATH topology
 1UUR A;  2A72 A;  4H9S E;  1VOM A;  2XQ7 A;  4UF0 B;  4MBQ A;  3TLW A;  2LSG A;  3EDU A;  2LSI A;  2OV9 A;  1ZOY A;  2W00 A;  3ANW B;  1X79 A;  2WZH A;  4H9N C;  4EYU A;  4BJM A;  5FVK A;  2XQ4 A;  3Q5W A;  1U5P A;  5HEJ A;  5FXX A;  4HFH A;  3UFG A;  2BBH A;  4TUY E;  4DV5 T;  4LMJ A;  2ZM2 A;  5AFU L;  3KBU A;  2KMF A;  2QYW A;  4DO0 A;  3O1J A;  3IEE A;  1D0X A;  2NOX A;  2HHH T;  4OYJ A;  3LFM A;  3PDY A;  2UXN B;  5L3C B;  2VL0 A;  5L47 A;  4LFA T;  3F2E A;  3CPZ A;  4CN4 A;  2DL1 A;  5CA1 E;  5HAX A;  2X9H A;  4X1Y E;  3OPC A;  3B57 A;  1N34 T;  4IDO A;  4MLK A;  4BA9 A;  3PJA A;  3P4Q A;  2WM9 A;  4CI2 B;  4ZEY A;  4JUY A;  4QXB B;  5EZY E;  5LHG B;  4IE7 A;  3LBX B;  2C0S A;  5E0O A;  1IBM T;  3RRW A;  4CZZ B;  3RQU A;  3OYZ A;  3J9X 1;  2WDQ A;  4OK0 A;  2QA7 A;  3RX6 A;  4UVC B;  3FZF B;  2KZ7 B;  3FHN A;  3VRA A;  4C90 A;  2BG9 B;  3MJX A;  2IW5 B;  4CXY A;  4PFP A;  5L4H A;  3KV5 A;  1W0B A;  4PNI A;  3JAD A;  5FY0 A;  5AQK B;  4F6R C;  1JNR A;  5L3G B;  2I6H A;  2J62 A;  3ZT7 A;  5JRC A;  2UUA T;  2YK0 A;  2KSR A;  2Q9Q C;  5JR9 B;  4TZ4 C;  1WLX A;  2LM9 A;  4TWD A;  1SE7 A;  1FIO A;  4YHH T;  2J47 A;  2RP4 A;  5FVL A;  4AI6 A;  2ZM8 A;  1OED E;  5LMN T;  5CB4 E;  4DV2 T;  3IF8 B;  4BJN A;  3PUQ A;  2XTL A;  1OED A;  3C4W A;  5LJM A;  4KHP T;  4WNK A;  4KMC A;  2WP9 A;  4ERR A;  4DND A;  4HEA A;  1BR0 A;  2A2F X;  2DCF A;  2XQ9 A;  4EAH A;  2LM2 A;  3C64 A;  1WYB A;  4JI6 T;  1HFA A;  4QXC B;  4QX8 B;  4ZI3 D;  4PJJ A;  2CCQ A;  4UEM A;  3CX7 B;  3HKC E;  2WU2 A;  2W61 A;  2Z6E A;  3N9P A;  4ZI3 C;  1MMD A;  2X67 A;  4C91 A;  2LOS A;  4H9O C;  5FL1 A;  1D1A A;  4Z8X A;  4JI4 T;  1Z8U A;  3ZYL A;  1E2A A;  1OED C;  2XAS B;  5CGM A;  3FZM B;  4JEH B;  4DR7 T;  4EXT A;  3OTO T;  3LSV A;  4JV5 T;  2J1D G;  3PJA J;  1LVK A;  5DAB A;  1I94 T;  1KEY A;  3QNU A;  2V7M A;  2FJA A;  4UR9 A;  2LEH A;  2V5C A;  1JNZ A;  4X5T A;  5ABE A;  2XQ5 A;  4LF4 T;  2X9X A;  3W15 B;  2LKH A;  2NP9 A;  3E0Z A;  4HWC A;  4IDP A;  2X9W A;  2W62 A;  4CI1 B;  3ONJ A;  5L3D B;  3KDS E;  3KBT A;  3ZMS B;  4EGW A;  2WZI A;  4LFB T;  4OFZ A;  2V5D A;  3J7Y q;  4QKN A;  2UUC T;  2IDO B;  3MXZ A;  5LBM A;  4CXX A;  2XAQ B;  5C8Y E;  1N32 T;  2XHE B;  2MTQ A;  4TNW A;  3I9W A;  1T98 A;  3TLU A;  4YJ3 E;  5F3J A;  4IST A;  5AQM B;  4ISS A;  3ZN1 B;  4YTM A;  5HWX A;  3N5L A;  2JIW A;  3N9N A;  2VWA A;  3ESL A;  2QRX A;  1J1J A;  3FB2 A;  4DUY T;  2WU5 A;  2OLT A;  4DR1 T;  2JQH A;  3UU8 A;  3N9O A;  5JDM A;  4YFS A;  2KWH A;  5HXH A;  4NPP A;  3BK9 A;  4EB6 E;  4N78 D;  2YDQ A;  4YJ2 E;  5ABF A;  2CWO A;  2LLY A;  2KT9 A;  5LP6 E;  4KUM B;  4AQF C;  5KX5 E;  4AKG A;  3RQW A;  3CIR A;  5F8P A;  2HPJ A;  2JMH A;  4IDQ A;  4IT4 A;  2CM0 A;  4YY3 T;  5AQS B;  4KBM B;  2E8I A;  4KI0 F;  5LB7 B;  5EK3 A;  3RHW A;  5LYJ E;  2R6G F;  3LJC A;  3MAC A;  4U31 A;  2CHN A;  4LF9 T;  4P1N A;  2UXD T;  5L3E B;  3M3Z B;  2LHR A;  2V7L A;  3NBX X;  3C4X A;  3CX8 B;  3HR0 A;  3CQX C;  2PG8 A;  4U2Z A;  2H89 A;  3PUG A;  4O4J E;  4TV9 E;  5AQL B;  2WWV A;  2BZB A;  5FXV A;  4GK0 E;  2WAU A;  4H9Q C;  3AED A;  5LXT E;  2E9X D;  2SPC A;  3CVR A;  5TAO A;  2FUP A;  4LFC T;  5LGT B;  4O4H E;  1UK5 A;  3RIF A;  4QH1 A;  3SRZ A;  2V7J A;  3UUL A;  3KIN B;  4LML A;  1HNZ T;  1HTJ F;  1IAP A;  5HXR A;  3P8C D;  4AKR B;  5JDF A;  1EZ3 A;  4X66 T;  3RGL A;  4K0K T;  4HFB A;  5LBQ B;  4B3R T;  3NVO A;  5FY7 A;  2VB6 A;  2VKD A;  4HFI A;  3CK6 A;  3RH3 A;  4U3C A;  2RA1 A;  2B1E A;  3AVS A;  3N9L A;  2XZE A;  3AEG A;  2C5K T;  2KXP B;  2HN1 A;  4HFV A;  2X0Y A;  4L9I A;  4Z90 A;  3P4P A;  3PUX F;  3NWI A;  5H6Q B;  1KNP A;  3FZH B;  1XDO A;  1T8B A;  3OJA A;  4Z91 A;  4EZH A;  4A56 A;  5LG3 A;  3GN5 B;  4K0U A;  2V6Y A;  4WBN E;  3RIU C;  3TKL B;  4I4T E;  4JBW F;  5JDL A;  1XMO T;  5HWY A;  3A7M A;  2B76 A;  5FMN A;  3BQL A;  4PK4 A;  4OHF A;  3ZJ2 A;  2KIN B;  2UXB T;  1YW0 A;  1M7K A;  5JQG E;  2X0L B;  2YU2 A;  2DWG A;  2ZM6 T;  5CFB A;  3AEB A;  1XMQ T;  2EHO B;  2HH7 A;  3L8R A;  1G73 A;  1QUU A;  1J5E T;  3RRC A;  2NTY A;  1W09 A;  3QUJ A;  1MIW A;  2M6I A;  5IUX A;  2C5J A;  3P4R A;  4F8H A;  3EUH A;  2IC9 A;  2XY8 B;  4OYK A;  4TNV A;  2P9B A;  2ODU A;  3JAF A;  1MMG A;  1NEK A;  4DV3 T;  2NR4 A;  2MOZ A;  4ILB A;  4JI2 T;  4A97 A;  2BVM A;  4TV8 E;  2WBL A;  3X1D A;  4FJO A;  4P0B A;  2VVS A;  3AAI A;  3TLS A;  1FMV A;  4PJL A;  2CRB A;  4AQY T;  2YOE A;  4HWD A;  2ES0 A;  4U74 A;  5HXC A;  5J0Z A;  3TLV A;  3MZK B;  2ODV A;  3TLT A;  2UU9 T;  3PUZ F;  1WR6 A;  2E5L T;  4B3M T;  5M4Y A;  3HKD E;  2XSB A;  1AJ3 A;  3QK6 A;  4U7Y A;  4KP3 C;  4CN6 A;  4IE4 A;  4LF5 T;  3T1Y T;  3AE5 A;  5AQJ B;  4YSZ A;  2A3D A;  4DBR A;  5JRE A;  1WRD A;  3C98 B;  3MA9 A;  1IZN B;  3I1A A;  5H6R B;  1GQE A;  3AE4 A;  3LG7 A;  5AQP B;  5DQV A;  5HEG A;  3F57 A;  5LHH B;  3ABV A;  2Q9Q A;  4MFR A;  2ZMA A;  2V7I A;  5IWA T;  3AEC A;  4EIW A;  3ZMZ B;  4DV1 T;  2F4V T;  2M67 A;  2LRL A;  4ZOL E;  3AXJ A;  1E1H B;  1UX5 A;  4J2C A;  4GK5 E;  3A8Y C;  3UU5 A;  3RYC E;  2CBJ A;  3AE3 A;  3DJB A;  4LF7 T;  2K24 A;  4U72 A;  2VKO A;  2BG9 E;  4L5G A;  5JDQ A;  4DUZ T;  3ETU A;  3OYX A;  2LJL A;  3K3N A;  2LSK A;  4B6X A;  2YIN A;  5LMU T;  5C3J A;  4HFC A;  5LGU B;  3UUM A;  5JRC B;  2AE9 A;  2YDS A;  3ZJ1 A;  1BR2 A;  2CXF A;  4PK5 A;  2W67 A;  1QSD A;  4E7S A;  4X65 T;  5LOV E;  4G63 A;  3EVY A;  2D2S A;  3O1I A;  1UCU A;  2C5I T;  3I0Q A;  4JEU B;  4QWN B;  3F31 A;  3SWH A;  5J2T E;  1NWM X;  3OKQ A;  3VR8 A;  4JLE A;  3UUB A;  2BG9 C;  4CN1 A;  4GYS A;  1NEN A;  2PTF A;  5CA0 E;  2PFV A;  3PUY F;  4QX7 B;  4ADZ A;  3FXE B;  4ANJ A;  2YDR A;  2BS3 A;  4O2B E;  5JH7 E;  3ZLI A;  5KDM C;  2AXD S;  3D0T A;  5JR9 C;  3CML A;  5LG4 A;  3RC3 A;  1HNX T;  1HCI A;  3CQC B;  3NRX A;  3H3M A;  2XJ7 A;  3Q2M A;  4M1P A;  3VKG A;  3N2K E;  3AAA B;  1YQ4 A;  5DQW A;  4HN9 A;  5L2L A;  5AQU B;  4DID B;  4HWI B;  4JI7 T;  4P09 A;  3ZKR A;  4TWH A;  5LGN B;  3UUN A;  1LVF A;  2CHO A;  2YN6 A;  5IHY A;  2CLY B;  2XQ8 A;  1L0V A;  3A5X A;  3AE1 A;  1OXZ A;  3FBZ A;  4YHJ A;  3AE8 A;  2XAH B;  3KV9 A;  4ZXL A;  2MPK A;  5L3F B;  2D0U A;  2YKS A;  3FZL B;  5LHI B;  3AE2 A;  3C51 A;  3BQK A;  5J1G A;  1HX8 A;  4LF8 T;  4AIS A;  2LE8 A;  1YD8 G;  1W9R A;  4DR2 T;  3HA4 A;  4ZI2 D;  2E2A A;  5ABG A;  3T8O A;  4IIJ E;  2JQK A;  3IHR A;  2RPA A;  5ABH A;  2VUR A;  2DLR A;  4AQF A;  2FJD A;  2VQE T;  2JQ9 A;  2ZLY A;  3EAB A;  1KK7 A;  4O4L E;  1MIV A;  1D1B A;  3HKE E;  3JCF A;  1SA0 E;  3QB5 K;  4IGU A;  5LA6 E;  1WCR A;  4YXD A;  4B3T T;  2YEV C;  5L3B B;  3AE7 A;  1WR0 A;  3CQG B;  5LJN A;  4HKA A;  4JI8 T;  3DTO A;  5KMG P;  5ABF B;  1WYC A;  4H9P C;  5JDG A;  4JI3 T;  1BR1 A;  3LK2 B;  3SFD A;  4ZHQ E;  5FY1 A;  3PTR B;  2WB5 A;  3JC6 D;  3Q5E A;  3GMI A;  1FMW A;  2E9X A;  4XZC A;  4AQG A;  4HWF A;  3VRB A;  4O2A E;  3JC6 C;  2W0G A;  4PW8 A;  3ZEF B;  4HE8 A;  1V9D A;  4AKI A;  1ZEE A;  2N1G A;  2E5V A;  1HS7 A;  5L4E A;  3EDV A;  2V8S V;  3QC9 A;  2BS4 A;  1HX1 B;  3K8P C;  3KVA A;  2XPK A;  3RC8 A;  5EK4 A;  4GKJ T;  2E9X C;  4QXH B;  2H7O A;  5HEU A;  2JQQ A;  3ZT6 A;  4ZZB A;  3UT5 E;  4DV0 T;  2W4X A;  1Y64 B;  2A9U A;  3N2O A;  1UGO A;  1IBK T;  4YLH A;  4UIG A;  4PAG A;  4IDN A;  3RPU A;  3L3P A;  3SOL A;  3P50 A;  2V7K A;  4IE6 A;  2WCA A;  3KFW X;  2NTX A;  1D0Z A;  1LRZ A;  3BQI A;  3UFE A;  3RIU A;  4HFE A;  3ZN0 B;  3CX6 B;  3PU3 A;  3V5S A;  2K5B B;  3LK3 B;  3WAJ A;  4TWF A;  4YTP A;  4WZX A;  3RYH E;  1FJG T;  2UXC T;  3RYI E;  3K3Q C;  1YKH B;  4LF6 T;  4G2A A;  3E22 E;  2LSY A;  1XNR T;  5HXS A;  1IJ5 A;  3HL6 A;  3K1S A;  2Y48 B;  2WMN A;  1ZV4 X;  2D5U A;  5JTG A;  4ILC A;  4E7Z A;  2X0H A;  2LOP A;  2H7V C;  5HCM A;  3K3O A;  4CI3 B;  2V6Y B;  4ZZC A;  4JI0 T;  4U7I A;  3MKD A;  4GIW A;  4KX6 A;  3UU4 A;  2H3R A;  3U3I A;  2NWB A;  2CBI A;  4EYY R;  1XWM A;  5KXJ A;  2LSJ A;  1I6Z A;  2QVA A;  4PFO A;  4LMK A;  5AQI B;  3ZMU B;  3P4S A;  1ZKE A;  5HYA A;  3OVU A;  1XDP A;  4X1K E;  2NW9 A;  3G06 A;  3RF1 A;  1KNZ A;  1KNR A;  2HN2 A;  5GON E;  2XSA A;  2WY2 A;  3H3A A;  2BVL A;  5AQG B;  1Y01 A;  4DBQ A;  4H63 H;  4IHJ E;  4UF0 A;  2LT3 A;  2L8K A;  5AQO B;  1H7C A;  5A1L A;  1ZHC A;  3EHZ A;  3ANW A;  2VK9 A;  4HWH A;  2FBW A;  1HG5 A;  3P4W A;  3VR9 A;  4DMV A;  3EI0 A;  1W0A A;  5LCY A;  2X66 A;  2JMK A;  4ILA A;  3ONL C;  5FKY A;  5J2U E;  3UQ7 A;  3WI3 A;  3QOF A;  2V6X A;  4H9R C;  2IUB A;  2JJ9 A;  4UVA B;  1HG2 A;  1MMA A;  2CEA A;  2IAK A;  2EHO D;  2WDR A;  4AXP A;  4QHO A;  1NAF A;  1UX4 A;  1E7P A;  5FP3 A;  3R84 B;  5HXE A;  2EHO C;  2XAF B;  3CWZ B;  4YSX A;  4ZS3 A;  1S35 A;  3PUW F;  2N9D A;  3AE9 A;  2VAS A;  4IRE A;  2LHN A;  4MHC A;  2XM2 A;  2XQ6 A;  3N9Q A;  3SFE A;  4NIQ A;  2VQF T;  1T72 A;  3N9M A;  4IE5 A;  4DVD A;  3FZK B;  2W66 A;  4Q25 A;  3C50 A;  4IDZ A;  2L3L A;  3VKH A;  1KFY A;  3P7I A;  2VKJ A;  1MMN A;  4PK6 A;  2Q9Q B;  3UU6 A;  4MAL A;  4DR6 T;  3FBL A;  2IC6 A;  4XAX B;  4UVB B;  4CQI A;  3AXJ B;  4GYR A;  2MYS A;  2XQY A;  4HGA A;  2XM1 A;  5JDN A;  5EK2 A;  1YKE B;  3LBX A;  4XBF B;  3WAK A;  1MND A;  3VHL A;  4PJN A;  2XUE A;  4DR5 T;  3DP7 A;  1G8X A;  3RIA A;  3KV4 A;  1YQ3 A;  2JRK A;  2GK9 A;  2MAW A;  2BG9 A;  2K9A A;  3B13 A;  4DR3 T;  1CHU A;  1FEW A;  4GKK T;  3ZCI A;  5AQV B;  4ZI7 E;  3PUR A;  2NW7 A;  2Q9Q D;  2K3W A;  1R8I A;  2WQY A;  2Y8D A;  5AQH B;  5FYM A;  3RKO A;  5ETW A;  4TN7 B;  4EV6 A;  5JR9 A;  3E08 A;  2HPL A;  2D0T A;  2MBG A;  3LK4 2;  2LRK A;  5JDH A;  1LKX A;  4ASK A;  2WWU A;  1HF8 A;  1BR4 A;  3AEE A;  2IML A;  2J4G A;  3AEA A;  1SHZ C;  5FXZ A;  1OED B;  1WFD A;  1OWA A;  3AA1 B;  2N2N A;  1N33 T;  4WYV A;  3EAM A;  3L39 A;  2PJQ A;  4X62 T;  1ZP0 A;  4ZS2 A;  3AVR A;  2G0U A;  3AE6 A;  3ZST A;  4BAY B;  1Z0P A;  3Q5X A;  2I59 A;  2BBJ A;  2YU1 A;  2DHR A;  1X9B A;  4DR4 T;  5IYZ E;  2BS2 A;  4NUV A;  3AEF A;  4NXN T;  4A98 A;  3UUX B;  3IBP A;  3NRY A;  2WDV A;  2ZM0 A;  5BMV E;  4QH5 A;  2ACX A;  2W63 A;  4COF A;  4EED A;  4U33 A;  2DWK A;  2JPF A;  1SUM B;  2BKO A;  3VU7 H;  1XNQ T;  1YXR A;  1QLB A;  2V26 A;  3O9X A;  3KV6 A;  4CXW A;  3B5M A;  3O4X E;  3RKG A;  4JI5 T;  3Q9D A;  2UUB T;  2FJE A;  2X51 A;  5C2T A;  2V1D B;  1S94 A;  2LKG A;  4UXN B;  3ZCJ A;  4GOU A;  3S4U A;  4O4I E;  3U78 A;  2WSS V;  1IBL T;  5BR8 T;  4ZI2 C;  3QB5 A;  3UU3 A;  4YTN A;  4HFD A;  2H88 A;  2XAJ B;  5HCJ A;  5DJQ C;  4IL9 A;  2XQA A;  5ADX L;  3O1H A;  2I0M A;  3PUA A;  1US7 B;  4EOZ B;  2L9Q A;  2BKP A;  4YT0 A;  2CXD A;  2CLY C;  4DV6 T;  2VL8 A;  3ZSS A;  3KVB A;  3ZC0 A;  4NXM T;  3UTK A;  4A5X A;  3PU8 A;  4B3S T;  2BDE A;  5AQT B;  1VCT A;  5AQF B;  2FJB A;  3AA6 B;  3V5U A;  5JVD E;  2OA5 A;  3NZP A;  2X68 A;  2CXL A;  2DI4 A;  5F5W A;  2XQ3 A;  2Y6X A;  3AA7 B;  3MK7 C;  1KF6 A;  2BKN A;  1UUS A;  2KWI B;  3UQ4 A;  1N36 T;  4L0R A;  1VRB A;  4AIU A;  2DNX A;  2WS3 A;  3R6N A;  4NUU A;  4V1A v;  3I9Y A;  4FI5 A;  2E9X B;  4JI1 T;  1CUN A;  2X9Y A;  2XAG B;  4EZ4 A;  2D9D A;  4O8S A;  1DU2 A;  1T7S A;  2CA5 A;  1HNW T;  5HEO A;  4TX5 A;  4IE0 A;  3PUS A;  3GWH A;  3AA0 B;  2CMR A;  3Q5D A;  3IA3 A;  4UV9 B;  5LNK A;  2CPT A;  3ZYM A;  4OX9 T;  5AQR B;  2CE7 A;  2CWY A;  3HI2 A;  3I0O A;  3AB3 B;  3NKZ A;  4H63 V;  3FXD B;  4DV7 T;  3ZC1 A;  2UXX B;  2IHR 1;  3NZQ A;  2KLQ A;  4HTE A;  4X64 T;  3ONX A;  4WBO A;  3C4Z A;  3OBV E;  2NW8 A;  5FNV E;  2VVN A;  2VKH A;  2K48 A;  1D0Y A;  3H37 A;  3GA8 A;  2QGS A;  3ZT5 A;  3CKD A;  3ETV A;  4U2Y A;  4I43 B;  2IIU A;  5AQN B;  1M62 A;  4YSY A;  4WW0 A;  4QH4 A;  1O3X A;  2PBI A;  3PUV F;  3LDQ B;  4DMW A;  4JYA T;  4AKL A;  4P0A A;  1IJ6 A;  3ZMT B;  3ZYK A;  1HR0 T;  4X1I E;  3RLF F;  4IL4 A;  2ACZ A;  3N2G E;  3PE0 A;  4UEL A;  4I55 E;  5FXW A;  5CJ5 A;  4ILU A;  3M65 A;  4EEB A;  3GN5 A;  1J5W A;  3JAE A;  2KND A;  1XZY A;  5FL0 A;  4DV4 T;  2M6B A;  3AAE B;  1B7T A;  2WMO A;  4PJM A;  3HKB E;  1VCS A;  4X20 E;  4UV8 B;  1MIY A;  3L09 A;  4I50 E;  3ZMV B;  5HEH A;  3RI5 A;  2W2U A;  4KHZ F;  1MNE A;  3SS1 A;  4I0U A;  3ZPO A;  4AKH A;  3T1H T;  3RYF E;  1D1C A;  1U4Q A;  3PV0 F;  5AQQ B;  2EHO A; 
#chains in the Genus database with same CATH homology
 2WAU A;  5L3F B;  2D0U A;  2GK9 A;  2A72 A;  5LHI B;  4H9Q C;  4H9S E;  1VOM A;  5LXT E;  3C51 A;  4UF0 B;  2E9X D;  2SPC A;  3CVR A;  2K9A A;  3BQK A;  3B13 A;  5J1G A;  1HX8 A;  4MBQ A;  2LSG A;  5TAO A;  3EDU A;  2LSI A;  2LE8 A;  2W00 A;  3ANW B;  1YD8 G;  1X79 A;  1FEW A;  3ZCI A;  4ZI7 E;  3HA4 A;  4H9N C;  4ZI2 D;  3PUR A;  2NW7 A;  3T8O A;  2Q9Q D;  4IIJ E;  4EYU A;  5LGT B;  4O4H E;  4BJM A;  3IHR A;  2Y8D A;  5FYM A;  3RKO A;  5ETW A;  4TN7 B;  3SRZ A;  3Q5W A;  5JR9 A;  2V7J A;  3E08 A;  2HPL A;  3KIN B;  2DLR A;  3UUL A;  1U5P A;  4AQF A;  1HTJ F;  1IAP A;  5FXX A;  2D0T A;  5HXR A;  2MBG A;  3LK4 2;  5JDH A;  3P8C D;  4AKR B;  5JDF A;  1EZ3 A;  1LKX A;  4TUY E;  4ASK A;  2WWU A;  1HF8 A;  1BR4 A;  2ZLY A;  2ZM2 A;  5LBQ B;  1KK7 A;  4O4L E;  5FY7 A;  2VB6 A;  1SHZ C;  2VKD A;  5AFU L;  5FXZ A;  3KBU A;  1MIV A;  1D1B A;  2KMF A;  3HKE E;  3RH3 A;  2RA1 A;  4DO0 A;  3O1J A;  1OWA A;  2B1E A;  3AA1 B;  1SA0 E;  3AVS A;  2N2N A;  3N9L A;  4IGU A;  5LA6 E;  2C5K T;  2PJQ A;  2YEV C;  5L3B B;  2KXP B;  3IEE A;  1D0X A;  4ZS2 A;  2NOX A;  4HFV A;  3CQG B;  3AVR A;  4OYJ A;  2G0U A;  5LJN A;  4HKA A;  4L9I A;  3LFM A;  4BAY B;  3DTO A;  2UXN B;  1Z0P A;  3PDY A;  3Q5X A;  5KMG P;  5L3C B;  1WYC A;  2I59 A;  4H9P C;  5JDG A;  2YU1 A;  3F2E A;  5H6Q B;  2DHR A;  3CPZ A;  5IYZ E;  1BR1 A;  3LK2 B;  4NUV A;  4ZHQ E;  5FY1 A;  3OJA A;  3PTR B;  3UUX B;  5CA1 E;  4EZH A;  4A56 A;  5HAX A;  2X9H A;  3GN5 B;  3IBP A;  3NRY A;  4K0U A;  4X1Y E;  2ZM0 A;  3JC6 D;  3B57 A;  3GMI A;  1FMW A;  2E9X A;  4XZC A;  5BMV E;  4MLK A;  4WBN E;  4AQG A;  2ACX A;  2W63 A;  3TKL B;  4O2A E;  3JC6 C;  4I4T E;  2W0G A;  4BA9 A;  2DWK A;  2WM9 A;  4CI2 B;  4PW8 A;  4JUY A;  3ZEF B;  4QXB B;  2JPF A;  1V9D A;  4HE8 A;  5JDL A;  5HWY A;  4AKI A;  5EZY E;  5LHG B;  4IE7 A;  1ZEE A;  3VU7 H;  2N1G A;  3LBX B;  5FMN A;  2C0S A;  3BQL A;  4PK4 A;  4OHF A;  5E0O A;  2KIN B;  3ZJ2 A;  3RRW A;  1HS7 A;  2V26 A;  1YW0 A;  3EDV A;  3O9X A;  3KV6 A;  5JQG E;  4CXW A;  2X0L B;  2YU2 A;  4CZZ B;  3O4X E;  3QC9 A;  2DWG A;  3OYZ A;  3J9X 1;  4OK0 A;  2QA7 A;  3RX6 A;  3Q9D A;  2X51 A;  2EHO B;  2HH7 A;  4UVC B;  2V1D B;  1G73 A;  1QUU A;  1S94 A;  3RRC A;  2NTY A;  3K8P C;  2KZ7 B;  3FHN A;  3QUJ A;  1MIW A;  4UXN B;  4C90 A;  2C5J A;  3KVA A;  3RC8 A;  3EUH A;  2IC9 A;  5EK4 A;  3MJX A;  2IW5 B;  4OYK A;  4CXY A;  3ZCJ A;  4PFP A;  2P9B A;  2E9X C;  2ODU A;  4GOU A;  3S4U A;  4QXH B;  3KV5 A;  2H7O A;  4PNI A;  4O4I E;  2JQQ A;  5FY0 A;  4F6R C;  1MMG A;  3UT5 E;  5L3G B;  3U78 A;  2WSS V;  5JRC A;  1Y64 B;  4ZI2 C;  3N2O A;  2YK0 A;  2Q9Q C;  4YLH A;  5JR9 B;  4UIG A;  4PAG A;  2MOZ A;  2XAJ B;  4TZ4 C;  3RPU A;  3L3P A;  3SOL A;  5DJQ C;  1WLX A;  5ADX L;  3O1H A;  2LM9 A;  2V7K A;  2BVM A;  4TV8 E;  2WBL A;  4IE6 A;  3PUA A;  1FIO A;  1US7 B;  4UVA B;  4FJO A;  3KFW X;  2NTX A;  2RP4 A;  4EOZ B;  4P0B A;  2L9Q A;  4AI6 A;  1D0Z A;  2CXD A;  3AAI A;  2ZM8 A;  1FMV A;  2CLY C;  2VL8 A;  1LRZ A;  3KVB A;  3ZC0 A;  3BQI A;  4PJL A;  3UFE A;  3UTK A;  3PU8 A;  2BDE A;  5CB4 E;  3ZN0 B;  3IF8 B;  3CX6 B;  4BJN A;  3PU3 A;  3AA6 B;  3V5S A;  2K5B B;  3V5U A;  5JVD E;  3LK3 B;  2ES0 A;  3PUQ A;  3WAJ A;  4U74 A;  2OA5 A;  5HXC A;  3NZP A;  2XTL A;  2X68 A;  3C4W A;  3RYH E;  2CXL A;  2DI4 A;  3RYI E;  3MZK B;  2ODV A;  5LJM A;  4WNK A;  2Y6X A;  3K3Q C;  1YKH B;  3AA7 B;  4KMC A;  1WR6 A;  3MK7 C;  4G2A A;  4ERR A;  3E22 E;  4DND A;  4HEA A;  1BR0 A;  2A2F X;  2DCF A;  2LSY A;  1IJ5 A;  3HL6 A;  4EAH A;  5HXS A;  2Y48 B;  3C64 A;  2WMN A;  1ZV4 X;  5M4Y A;  2KWI B;  3HKD E;  1WYB A;  1HFA A;  4QXC B;  4QX8 B;  1AJ3 A;  3QK6 A;  4ZI3 D;  4KP3 C;  4L0R A;  4IE4 A;  2D5U A;  4PJJ A;  1VRB A;  2CCQ A;  2DNX A;  3CX7 B;  3HKC E;  3KV9 A;  4UEM A;  3R6N A;  4E7Z A;  4NUU A;  4V1A v;  2W61 A;  2Z6E A;  2A3D A;  4DBR A;  3N9P A;  2LOP A;  5JRE A;  4ZI3 C;  1WRD A;  3C98 B;  2H7V C;  3I9Y A;  3K3O A;  4FI5 A;  4CI3 B;  2E9X B;  3MA9 A;  1MMD A;  1CUN A;  3MKD A;  4GIW A;  1IZN B;  2X67 A;  3I1A A;  4C91 A;  5H6R B;  2H3R A;  3U3I A;  2LOS A;  2NWB A;  3LG7 A;  2X9Y A;  4H9O C;  1D1A A;  4Z8X A;  5DQV A;  3F57 A;  4EYY R;  5LHH B;  3ZYL A;  2XAG B;  2LSJ A;  4PFO A;  4EZ4 A;  2Q9Q A;  4O8S A;  3ZMU B;  4MFR A;  2ZMA A;  2CA5 A;  2XAS B;  2V7I A;  4TX5 A;  4JEH B;  4IE0 A;  4EIW A;  4EXT A;  3ZMZ B;  1ZKE A;  5HYA A;  2M67 A;  3PUS A;  3GWH A;  4ZOL E;  3AA0 B;  1E1H B;  2CMR A;  1UX5 A;  4J2C A;  2J1D G;  4GK5 E;  4X1K E;  4UV9 B;  2NW9 A;  5LNK A;  3ZYM A;  3RYC E;  1LVK A;  3DJB A;  2CE7 A;  2CWY A;  3HI2 A;  5DAB A;  2K24 A;  2V7M A;  4U72 A;  3I0O A;  1KNZ A;  2VKO A;  3AB3 B;  5GON E;  4H63 V;  4L5G A;  5JDQ A;  3FXD B;  3ETU A;  2LEH A;  3H3A A;  3OYX A;  2LJL A;  3K3N A;  2BVL A;  2LSK A;  4B6X A;  4DBQ A;  2YIN A;  4H63 H;  4IHJ E;  4UF0 A;  2LT3 A;  2L8K A;  2X9X A;  3W15 B;  5LGU B;  2NP9 A;  3UUM A;  3E0Z A;  1H7C A;  5A1L A;  5JRC B;  1ZHC A;  3ANW A;  2VK9 A;  3ZJ1 A;  1BR2 A;  3ZC1 A;  2UXX B;  2X9W A;  2W62 A;  2CXF A;  1HG5 A;  3NZQ A;  4PK5 A;  4CI1 B;  2KLQ A;  5L3D B;  1QSD A;  4HTE A;  4E7S A;  4DMV A;  3KDS E;  3KBT A;  5LCY A;  4G63 A;  5LOV E;  3ZMS B;  2X66 A;  3EVY A;  2JMK A;  3ONX A;  2D2S A;  4OFZ A;  3O1I A;  4WBO A;  1UCU A;  2C5I T;  3J7Y q;  4QKN A;  3I0Q A;  3C4Z A;  3MXZ A;  3OBV E;  4JEU B;  5J2U E;  3WI3 A;  2NW8 A;  5LBM A;  5FNV E;  2XAQ B;  4CXX A;  5C8Y E;  2VKH A;  4H9R C;  2K48 A;  2XHE B;  1D0Y A;  2MTQ A;  2JJ9 A;  3GA8 A;  2QGS A;  3H37 A;  1HG2 A;  1MMA A;  2CEA A;  4QWN B;  2IAK A;  2EHO D;  3I9W A;  3F31 A;  3SWH A;  1T98 A;  5J2T E;  4AXP A;  3CKD A;  1NWM X;  4QHO A;  4YJ3 E;  1NAF A;  1UX4 A;  3OKQ A;  5FP3 A;  3R84 B;  3ETV A;  4IST A;  5F3J A;  5HXE A;  2EHO C;  2XAF B;  4I43 B;  4ISS A;  3CWZ B;  4JLE A;  4ZS3 A;  3ZN1 B;  1S35 A;  5HWX A;  3N5L A;  3N9N A;  2N9D A;  2VWA A;  3ESL A;  2VAS A;  4GYS A;  3FB2 A;  4WW0 A;  2LHN A;  5CA0 E;  2PFV A;  4QX7 B;  1O3X A;  4MHC A;  4ADZ A;  3FXE B;  2PBI A;  3N9Q A;  4ANJ A;  3N9O A;  4DMW A;  5JDM A;  4AKL A;  4O2B E;  4YFS A;  4P0A A;  2KWH A;  5JH7 E;  3ZLI A;  5HXH A;  1IJ6 A;  3N9M A;  5KDM C;  3BK9 A;  3ZMT B;  4N78 D;  4EB6 E;  4IE5 A;  4YJ2 E;  2CWO A;  3ZYK A;  3D0T A;  2KT9 A;  5JR9 C;  4X1I E;  4DVD A;  5LP6 E;  3CML A;  4KUM B;  5LG4 A;  3RC3 A;  4AQF C;  5KX5 E;  4AKG A;  1HCI A;  3CQC B;  5F8P A;  3C50 A;  3N2G E;  3NRX A;  3PE0 A;  4UEL A;  4I55 E;  5FXW A;  2HPJ A;  2JMH A;  4IDZ A;  2L3L A;  2CM0 A;  4ILU A;  3M65 A;  3VKH A;  3Q2M A;  3P7I A;  3GN5 A;  4M1P A;  4KBM B;  2E8I A;  2KND A;  5EK3 A;  2VKJ A;  5LYJ E;  1MMN A;  4PK6 A;  3VKG A;  2Q9Q B;  3N2K E;  3LJC A;  4MAL A;  3AAA B;  3FBL A;  5DQW A;  2IC6 A;  3AAE B;  3MAC A;  4HN9 A;  4XAX B;  5L2L A;  1B7T A;  2WMO A;  4PJM A;  3HKB E;  4UVB B;  5L3E B;  4P09 A;  4CQI A;  4GYR A;  4X20 E;  2MYS A;  2LHR A;  4UV8 B;  1MIY A;  2XQY A;  5LGN B;  4HGA A;  3UUN A;  2V7L A;  1LVF A;  5JDN A;  5EK2 A;  1YKE B;  3NBX X;  3C4X A;  3LBX A;  4XBF B;  3L09 A;  4I50 E;  3CX8 B;  3HR0 A;  3WAK A;  3CQX C;  2PG8 A;  1MND A;  5IHY A;  3VHL A;  3ZMV B;  2CLY B;  3A5X A;  4PJN A;  1MNE A;  3SS1 A;  2XUE A;  3PUG A;  3ZPO A;  4AKH A;  1OXZ A;  4O4J E;  3DP7 A;  4TV9 E;  1G8X A;  3FBZ A;  4YHJ A;  3RYF E;  1D1C A;  1U4Q A;  2BZB A;  3KV4 A;  5FXV A;  2XAH B;  2JRK A;  4GK0 E;  2EHO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...