1WRDA

Crystal structure of tom1 gat domain in complex with ubiquitin
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
98
structure length
98
Chain Sequence
GPLGSEQIGKLRSELEMVSGNVRVMSEMLTELVPTQAEPADLELLQELNRTCRAMQQRVLELIPQIANEQLTEELLIVNDNLNNVFLRHERFERFRTG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural basis for recognition of ubiquitinated cargo by Tom1-GAT domain.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein transport/signaling protein
molecule keywords Target of Myb protein 1
total genus 39
structure length 98
sequence length 98
ec nomenclature
pdb deposition date 2004-10-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03127 GAT GAT domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.160 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 1wrdA00
1NAFA 1OXZA 1O3XA 1WRDA 1YD8G 2N9DA 1X79A 1NWMX 2N2NA 1WR6A
chains in the Genus database with same CATH superfamily
1WRDA 2XSAA 2E9XC 3HR0A 4HE8A 4QXBB 5LA6E 3UUMA 2MAWA 2YN6A 3N2KE 1T72A 2OA5A 4QH4A 4YJ2E 1CHUA 3AE1A 4X1KE 4JI4T 3NRYA 1HG2A 2JJ9A 4GIWA 4UF0B 4QX8B 3RKGA 3V5UA 2KZ7B 3VR9A 5LGTB 5LNKA 2KT9A 2CLYB 2X51A 1XNRT 2C5JA 3NVOA 3RIFA 3N9PA 4AKIA 2CXFA 5L3FB 2MTQA 3UU8A 5FMNA 2VKHA 3VHLA 2Q9QA 3NKZA 3UU3A 4CXYA 2DLRA 2E8IA 3P50A 5KDMC 2CM0A 3B57A 4IE4A 3ZMZB 2IDOB 3D0TA 4UEMA 2ODVA 5HCMA 5HWYA 2G0UA 2WWUA 4GKJT 1UURA 4TN7B 5CB4E 3UU6A 3A5XA 4BJNA 5JDFA 2X0YA 4YY3T 3AEDA 2V7JA 3CQXC 4GOUA 2XAQB 2WCAA 3TLVA 4ISSA 4H63H 3J7Yq 1G8XA 2HHHT 5ADXL 3OJAA 4PJNA 1D1AA 1HR0T 2CCQA 1XDOA 2JQQA 3L09A 3VR8A 4EB6E 2JMKA 4F6RC 4WBOA 4MBQA 5F3JA 1DU2A 1OWAA 4CI3B 2BG9B 2KMFA 3RKOA 2IHR1 3L3PA 1SUMB 2IMLA 2PFVA 5FVLA 4HWFA 5KXJA 1E2AA 1OEDE 2P9BA 5JDMA 4Q25A 3K1SA 3P4RA 4UVAB 2N2NA 2XTLA 2JMHA 2BKPA 2JQHA 3QNUA 5AQIB 3EI0A 5L4HA 4N78D 5C2TA 4IT4A 4DR3T 1HNXT 3T8OA 2K5BB 2B1EA 2NW8A 3AE2A 3SOLA 5J2TE 1NWMX 4IL4A 3SFEA 5DJQC 4OYKA 3HI2A 2E2AA 2M6BA 1OEDB 3QK6A 4HWIB 1YKHB 1WCRA 3E0ZA 4X1YE 3J9X1 4A98A 3LBXB 5JREA 4JI7T 4LF5T 1R8IA 2WDVA 2KWIB 4G2AA 1VCSA 1XNQT 2RA1A 3CQGB 4IHJE 4ASKA 4Z90A 1HNZT 4H9QC 3GN5A 3RYCE 3EHZA 3ZYKA 4DVDA 5AQSB 4K0KT 4DMWA 3PTRB 3P4QA 4WBNE 2R6GF 3E08A 3QC9A 5AQGB 3NRXA 1L0VA 3FZFB 4BJMA 3AA1B 4P0BA 5JR9A 1D0ZA 3Q2MA 2V5CA 3ZYLA 2JQ9A 3W15B 4DBRA 1Y01A 2RPAA 2XQ3A 1B7TA 3EABA 3LDQB 4X20E 4AIUA 1SE7A 3T1YT 4JEHB 3EDVA 1MMDA 2WAUA 2NP9A 2WS3A 4JI2T 3G06A 3GMIA 3MA9A 5DQWA 3UTKA 2XASB 3FZHB 4O2AE 3ZJ2A 5DQVA 4LF4T 3BQIA 2XQAA 4CZZB 5AQFB 5HEGA 2A3DA 4YFSA 2UUBT 4E7SA 2FJEA 3Q9DA 4WZXA 2NTYA 2V7KA 3K8PC 1IBLT 3PUZF 3ZPOA 3PUXF 3UFEA 2FUPA 2CBIA 3LK42 3MXZA 3OBVE 5M4YA 1LRZA 5LOVE 2XHEB 2Q9QD 4TWHA 4JI0T 3O1HA 2NOXA 1WYCA 4IE5A 2NW7A 4ILAA 5AQTB 2BKNA 4HTEA 1D0XA 3CWZB 3F57A 4PJJA 4I43B 5HCJA 3RIUA 1HTJF 4EIWA 2WU5A 2XQ6A 1ZEEA 4EXTA 2D0TA 3B5MA 2L8KA 3FZLB 5IHYA 3IA3A 1J5WA 3L39A 1I94T 2KINB 5EK4A 5AQKB 4UV9B 5JRCB 2HPJA 3AA0B 4OK0A 3UUNA 4A56A 2ZM8A 3CQCB 4EGWA 3UU4A 4JI6T 4FI5A 1US7B 3Q5WA 3HL6A 4TV8E 1IBKT 3KV6A 3RIAA 4MALA 3P4SA 1IBMT 2GK9A 5L3DB 2V1DB 2RP4A 4IIJE 4U74A 4PFOA 2LHNA 2LEHA 4X66T 4HKAA 2YU2A 4YSYA 2H3RA 1NEKA 1CUNA 1WLXA 1XZYA 2DL1A 2LE8A 2DWKA 2LSJA 2PTFA 2DWGA 3ETUA 3K3OA 3I0OA 4U2ZA 3RH3A 1UCUA 5IUXA 2XPKA 4B3TT 2LKHA 2NTXA 4UVCB 2CHOA 5LB7B 2BBJA 1H7CA 2XM1A 2ZM2A 5AQVB 5AQUB 3S4UA 3MJXA 1HF8A 1SHZC 2H89A 5L4EA 4A97A 2WQYA 4YSXA 2BBHA 2AE9A 2BG9A 4KBMB 4CXXA 3I1AA 2BVLA 2XAFB 4HFDA 5HWXA 4H9SE 4UELA 4WW0A 5LBQB 1ZHCA 3GWHA 1T98A 2FJBA 2WY2A 2XAGB 4IDPA 2JRKA 3ANWA 4EEDA 2KWHA 3SRZA 3DP7A 5FXWA 3AAAB 3WAKA 1D1BA 1JNZA 4YJ3E 5JRCA 5ETWA 2YKSA 2IAKA 3CX7B 3FZKB 1QSDA 1YQ4A 4HFBA 4PK5A 4CN1A 4GYSA 2W67A 1LKXA 4JBWF 3C51A 1D1CA 4U7IA 5LG4A 4AQGA 5LMNT 1MNEA 2WMOA 1KNRA 4NXNT 5AQHB 2WSSV 4I50E 4QWNB 4CN6A 2F4VT 2LSKA 5J1GA 2W0GA 3MACA 4GK5E 1N33T 4DBQA 3H37A 3K3NA 1MMAA 2W2UA 2Y8DA 4LMLA 5JTGA 2W63A 4GYRA 1VRBA 3CK6A 2CWOA 2N1GA 3AAIA 3P4WA 2JIWA 4ILBA 4I0UA 4J2CA 5C8YE 5L47A 2VQET 4DV0T 3ZC0A 3UULA 3M65A 2UUAT 3I9WA 3OKQA 4LFCT 2J47A 2DI4A 4IL9A 3AE6A 4NUVA 4XZCA 3ANWB 4LF9T 1JNRA 3Q5DA 5FXVA 4LFAT 4HWDA 2X9YA 4DR2T 2XQ5A 2X68A 4EZ4A 1YD8G 2EHOB 4DV7T 4O4HE 4WYVA 4DR6T 2QGSA 4TX5A 3X1DA 5HYAA 4ZZBA 2K3WA 1HX1B 3AE4A 4TNWA 4U2YA 5FY7A 3JAEA 4C91A 5CA0E 2WWVA 4LF8T 4CXWA 3RYFE 2A9UA 2Q9QC 2VURA 4JI3T 2W66A 3RC8A 1KFYA 4U72A 5LMUT 4ZOLE 2UUCT 2DNXA 4AKLA 1KEYA 2IW5B 3PUWF 5AFUL 2FJAA 1UX5A 2MPKA 2IC9A 2VL8A 3C98B 5H6QB 4DV1T 1HS7A 1E1HB 1KF6A 4O2BE 4ZEYA 1W0BA 5LHHB 4MHCA 4HWCA 3KINB 3C4XA 5ABGA 4JI5T 1X9BA 3KBUA 4B6XA 2UXBT 4NPPA 1MIVA 4ISTA 4NUUA 2J4GA 3TLSA 4AKRB 2CPTA 3AAEB 4IDZA 2ZM6T 2KXPB 1MNDA 5CA1E 4EOZB 3OVUA 1N36T 4AKHA 3AEFA 2C5IT 3ONLC 1LVKA 3MK7C 5CFBA 2BKOA 5L3GB 1W09A 5LHGB 1BR0A 5JDGA 2QRXA 5AQMB 3UT5E 1HCIA 2XQ8A 4JV5T 3CX8B 3Q5XA 2IC6A 4QXHB 3PURA 1Z8UA 1BR1A 2UXXB 5EZYE 2NW9A 5FKYA 3NZQA 5DABA 2XQYA 2MBGA 4P1NA 4U3CA 3V5SA 4BAYB 2E9XB 3IHRA 5JH7E 2CE7A 2CXLA 3VU7H 4EZHA 5LGNB 4JI1T 4PW8A 2V6YB 1OEDA 3QB5K 4YT0A 1MIYA 2LJLA 3VRBA 1IZNB 1WFDA 3QUJA 4Z91A 4DO0A 2CMRA 4QHOA 3KV9A 3ZLIA 2WDRA 3ZEFB 2J62A 5AQRB 3EVYA 5HXHA 2CHNA 2LM9A 2NWBA 3ETVA 3N9MA 5AQPB 3C50A 4UIGA 3KFWX 4COFA 3PUYF 4QXCB 2V26A 5HEHA 5J0ZA 3HKBE 5L2LA 5HEUA 4CI2B 4DR4T 2YDSA 5LYJE 5HXEA 3N9QA 2FJDA 3BQKA 1QLBA 2VASA 4C90A 4WNKA 4DMVA 4MLKA 5JDQA 3AECA 3VKHA 2HN2A 2VK9A 5HAXA 3CVRA 2E9XD 4L0RA 2EHOD 4AQFA 2VB6A 2X0HA 3MKDA 4LMJA 2QVAA 3TLWA 3ZCIA 4KI0F 5HEJA 5KMGP 3SWHA 3VRAA 3C64A 4CQIA 4IDQA 4YTMA 5JR9C 2D9DA 2VVSA 5LBMA 3SS1A 2V7LA 3U78A 1UK5A 2XQ4A 1MMNA 2SPCA 4DNDA 3LK2B 4NIQA 3PUAA 3AVSA 3PV0F 4PJLA 4IDNA 3AE9A 4U31A 3PUSA 2CRBA 3P7IA 2JQKA 4M1PA 4TV9E 4JLEA 4ZZCA 4AI6A 2BS3A 1QUUA 2ACXA 2BS4A 2CA5A 3LJCA 2CEAA 2VKJA 5H6RB 3N9LA 1XMOT 2X9XA 1BR2A 3ONXA 5F8PA 2BS2A 3RRWA 3ESLA 3IEEA 3EUHA 2LRLA 1FJGT 2LSGA 1D0YA 2E9XA 2XAJB 3ZC1A 2VL0A 4MFRA 3P4PA 5FVKA 4HGAA 3KV4A 3IF8B 2KLQA 2XUEA 3B13A 2Z6EA 2LM2A 3N9OA 4EV6A 1KNZA 2NR4A 4F8HA 2X67A 1V9DA 4UVBB 1J5ET 3ZCJA 3M3ZB 3ZN1B 3NBXX 4O4JE 4AXPA 4LFBT 3HKDE 4V1Av 4JUYA 4PAGA 1J1JA 2VKOA 2YU1A 3DTOA 4ZI3D 3U3IA 5ABHA 3ZYMA 2M6IA 1FIOA 1YKEB 4P09A 1ZOYA 2H7OA 2K24A 3KVAA 4O4IE 2W62A 5FP3A 4A5XA 4KX6A 2LSIA 3AVRA 3P8CD 2VWAA 3AXJB 3PUQA 4B3RT 3AE7A 5JQGE 4AISA 1FMVA 5FYMA 5LXTE 1S35A 3WAJA 2QYWA 1XWMA 2LKGA 3ZKRA 4O8SA 4IDOA 1U5PA 1X79A 3CPZA 1KNPA 2LOPA 2ZLYA 2CBJA 2LHRA 2YOEA 3QB5A 1EZ3A 3AEBA 4X1IE 5LG3A 1ZKEA 2M67A 1BR4A 3N2OA 5CGMA 3MZKB 2ZMAA 3A7MA 4LF7T 2J1DG 2ODUA 3DJBA 3CIRA 3RQUA 3ZMVB 3JADA 2OLTA 3ZT7A 1HFAA 3PUVF 4H9RC 1AJ3A 4YSZA 2EHOC 2BG9C 4I4TE 2BDEA 2YDRA 4KHPT 5TAOA 5C3JA 3O9XA 4TWDA 2HPLA 1O3XA 4KP3C 5FL1A 3F2EA 3ZSTA 4KUMB 3FXEB 4NXMT 4UXNB 4X65T 4UR9A 1UX4A 4U7YA 3ZMSB 2E5VA 3AEAA 3RGLA 4PNIA 2LRKA 5HEOA 5L3EB 4DV6T 3TKLB 3NZPA 4HFIA 4P0AA 2ZM0A 4K0UA 4CN4A 1NENA 2KNDA 1E7PA 2B76A 5LHIB 3JC6C 4QH5A 4OFZA 1OEDC 2WZHA 5HXRA 3KV5A 1YQ3A 3UQ7A 1Y64B 4JI8T 1N32T 2QA7A 3I9YA 3KDSE 3R84B 3PJAJ 3FXDB 4ZHQE 5JDNA 2YDQA 5FY1A 3OYZA 4YXDA 2WBLA 3NWIA 4GK0E 4HN9A 5LGUB 4JEUB 2VQFT 3QOFA 4DR1T 2VKDA 2H7VC 4H63V 1Z0PA 2D5UA 2LOSA 2LSYA 4HFEA 5AQOB 2WDQA 5AQNB 3RC3A 4AQYT 3UU5A 1SA0E 2XQ7A 2CWYA 1T8BA 4KHZF 2Y48B 3BQLA 3C4WA 3RHWA 4X62T 3UFGA 2MYSA 5EK3A 4DV5T 2WB5A 2A72A 3PU3A 5JDHA 1N34T 2AXDS 2V5DA 1M62A 4ZS3A 1U4QA 2V7MA 2W00A 4EEBA 2ES0A 4DR5T 3O4XE 1UGOA 4ZI3C 3AXJA 3EDUA 2MOZA 3FZMB 4HFCA 3ZN0B 1W9RA 3O1JA 4KMCA 3TLTA 4BA9A 5IWAT 2YEVC 3LFMA 2XJ7A 3PUGA 3KVBA 4H9NC 4TWFA 1UUSA 4OYJA 2DHRA 2A2FX 2UU9T 2X9HA 5F5WA 3A8YC 3TLUA 4ANJA 3OYXA 4PK6A 5IYZE 4B3MT 5J2UE 3VKGA 2XAHB 3PDYA 2D2SA 2FBWA 4DV4T 1MMGA 3ONJA 3N5LA 2CLYC 1IAPA 2ACZA 2D0UA 3JAFA 4HWHA 3CKDA 2WP9A 5A1LA 1LVFA 2IIUA 2V7IA 4EAHA 5LP6E 4IE0A 4HEAA 3I0QA 2BVMA 1KK7A 2WM9A 2WU2A 2XM2A 3FHNA 3JC6D 3RRCA 5L3BB 2X0LB 4X64T 3IBPA 3F31A 2OV9A 2X66A 1VOMA 2WZIA 4ZS2A 5FXXA 1G73A 3OTOT 4XAXB 3UQ4A 2BZBA 3RI5A 3ZMUB 5LCYA 5LJMA 4DUZT 3K3QC 1S94A 3EAMA 4AKGA 4GKKT 4PK4A 3AE8A 3PE0A 3WI3A 3HKEE 2WMNA 3O1IA 4ADZA 1GQEA 3AA7B 3CX6B 3E22E 4DIDB 4TUYE 3H3MA 2E5LT 1MIWA 1WR6A 4H9OC 3ZT5A 1IJ6A 2PBIA 2I6HA 4L9IA 2JPFA 2L9QA 3PJAA 3LBXA 4IREA 3RPUA 3C4ZA 4G63A 3FBLA 4PFPA 3RF1A 1IJ5A 3ZSSA 4ZI2D 4DV2T 4X5TA 3T1HT 3PU8A 2VVNA 2PG8A 4PJMA 4TNVA 1HX8A 1OXZA 4HFVA 4U33A 5CJ5A 1VCTA 2V8SV 2W4XA 3ZT6A 4Z8XA 4ERRA 1W0AA 3RX6A 2PJQA 3FB2A 4ZI7E 5BMVE 4H9PC 3LSVA 2V6YA 4FJOA 5L3CB 1WYBA 3LG7A 4OHFA 2I59A 4I55E 3KBTA 4LF6T 1XDPA 1ZP0A 2BG9E 4LMKA 3OPCA 5JVDE 4XBFB 1T7SA 4EYYR 4IGUA 5ABFB 4DR7T 5LJNA 2UXNB 2N9DA 2W61A 3SFDA 5JDLA 5ABEA 4UF0A 5FY0A 2X9WA 2Y6XA 4YHJA 3R6NA 3RYIE 4OX9T 1YW0A 2HH7A 2EHOA 5KX5E 1ZV4X 2Q9QB 3AEGA 2KSRA 4ILUA 4YLHA 3RYHE 4HFHA 4ILCA 1HG5A 1FMWA 3UUBA 2C5KT 3AEEA 3GA8A 2V6XA 4O4LE 4AQFC 4L5GA 4DUYT 3BK9A 4YTPA 3JCFA 3N2GE 4IE6A 5AQLB 4DV3T 4JYAT 1HNWT 5ABFA 3AE5A 4QH1A 5HXSA 3AA6B 5JR9B 3FBZA 5E0OA 2H88A 2K48A 3UUXB 2L3LA 5HXCA 2CXDA 5EK2A 3Q5EA 4EYUA 4QX7B 1XMQT 1M7KA 2UXDT 5GONE 4B3ST 5AQQB 1NAFA 3CMLA 2I0MA 2XZEA 3GN5B 5FNVE 5FL0A 2UXCT 3ZJ1A 2XQ9A 5FXZA 3ZMTB 1I6ZA 2HN1A 2XY8B 3HKCE 4YHHT 1YXRA 3L8RA 5AQJB 3ABVA 1FEWA 3H3AA 3HA4A 3RLFF 3N9NA 2LLYA 4CI1B 2C0SA 2DCFA 1WR0A 2YK0A 2IUBA 3LK3B 4QKNA 4UV8B 3RQWA 4ZI2C 4ZXLA 2XSBA 2YINA 4TZ4C 4IE7A 3AE3A 3RIUC 4E7ZA 2K9AA 3AB3B 4YTNA 5BR8T 2LT3A
chains in the Genus database with same CATH topology
1WRDA 3HR0A 2E9XC 4HE8A 4QXBB 5LA6E 3UUMA 3N2KE 2OA5A 4YJ2E 4X1KE 3NRYA 1HG2A 2JJ9A 4GIWA 4UF0B 4QX8B 5LGTB 2KZ7B 5LNKA 2KT9A 2CLYB 2X51A 2C5JA 4AKIA 3N9PA 2CXFA 2MTQA 5FMNA 2VKHA 3VHLA 2Q9QA 4CXYA 2DLRA 2E8IA 5KDMC 2CM0A 3B57A 4IE4A 3ZMZB 3D0TA 4UEMA 2ODVA 5HWYA 2G0UA 2WWUA 4TN7B 5CB4E 3A5XA 4BJNA 5JDFA 2V7JA 3CQXC 4GOUA 2XAQB 4ISSA 4H63H 3J7Yq 1G8XA 5ADXL 3OJAA 4PJNA 1D1AA 2CCQA 2JQQA 3L09A 4EB6E 2JMKA 4F6RC 4WBOA 4MBQA 5F3JA 1OWAA 4CI3B 2KMFA 3RKOA 3L3PA 2PFVA 2P9BA 5JDMA 4UVAB 2N2NA 2XTLA 2JMHA 4N78D 3T8OA 2K5BB 2B1EA 2NW8A 3SOLA 5J2TE 1NWMX 5DJQC 4OYKA 3HI2A 3QK6A 4X1YE 1YKHB 3J9X1 3E0ZA 5JREA 3LBXB 2KWIB 4G2AA 2RA1A 3CQGB 4IHJE 4ASKA 4H9QC 3GN5A 3RYCE 4DVDA 3ZYKA 4DMWA 3PTRB 4WBNE 3E08A 3QC9A 3NRXA 4BJMA 3AA1B 4P0BA 5JR9A 1D0ZA 3Q2MA 3ZYLA 3W15B 4DBRA 4X20E 1B7TA 4JEHB 3EDVA 1MMDA 2WAUA 2NP9A 3ZJ2A 3MA9A 3GMIA 5DQWA 3UTKA 2XASB 4O2AE 5DQVA 3BQIA 4CZZB 2A3DA 4YFSA 4E7SA 3Q9DA 2NTYA 2V7KA 3K8PC 3ZPOA 3UFEA 3LK42 3MXZA 3OBVE 5M4YA 1LRZA 5LOVE 2XHEB 2Q9QD 3O1HA 2NOXA 1WYCA 4IE5A 2NW7A 4HTEA 4PJJA 1D0XA 3CWZB 3F57A 4I43B 4EIWA 1HTJF 1ZEEA 4EXTA 2D0TA 5IHYA 2L8KA 2KINB 5EK4A 4UV9B 5JRCB 2HPJA 3AA0B 4OK0A 3UUNA 4A56A 3CQCB 2ZM8A 4FI5A 1US7B 3Q5WA 3HL6A 4TV8E 3KV6A 4MALA 2GK9A 5L3DB 2V1DB 2RP4A 4IIJE 4U74A 4PFOA 2LHNA 2LEHA 4HKAA 2YU2A 2H3RA 1CUNA 1WLXA 2LE8A 3ETUA 2DWKA 2LSJA 3K3OA 2DWGA 3RH3A 3I0OA 1UCUA 2NTXA 4UVCB 1H7CA 2ZM2A 3S4UA 3MJXA 1HF8A 1SHZC 4KBMB 4CXXA 3I1AA 2BVLA 2XAFB 5HWXA 4H9SE 4UELA 4WW0A 5LBQB 1ZHCA 3GWHA 1T98A 2XAGB 2JRKA 3ANWA 2KWHA 3SRZA 3DP7A 5FXWA 3AAAB 3WAKA 1D1BA 4YJ3E 5JRCA 5ETWA 2IAKA 3CX7B 1QSDA 5L3FB 4PK5A 3VKGA 4GYSA 1LKXA 5LG4A 3C51A 1D1CA 4AQGA 1MNEA 2WMOA 2WSSV 4I50E 4QWNB 2LSKA 5J1GA 2W0GA 3MACA 4GK5E 4DBQA 3H37A 3K3NA 1MMAA 2Y8DA 2W63A 4GYRA 1VRBA 2CWOA 2N1GA 3AAIA 4J2CA 3ZC0A 5C8YE 3UULA 3M65A 3I9WA 3OKQA 2DI4A 4NUVA 4XZCA 3ANWB 5FXVA 2X9YA 2X68A 4EZ4A 1YD8G 2EHOB 4O4HE 2QGSA 4TX5A 5HYAA 5FY7A 4C91A 5CA0E 4CXWA 3RYFE 2Q9QC 3RC8A 4U72A 4ZOLE 2DNXA 4AKLA 2IW5B 5AFUL 1UX5A 2IC9A 2VL8A 3C98B 5H6QB 1HS7A 1E1HB 4O2BE 5LHHB 4MHCA 3KINB 3C4XA 3KBUA 4B6XA 1MIVA 4ISTA 4NUUA 4AKRB 3AAEB 4IDZA 2KXPB 1MNDA 5CA1E 4EOZB 4AKHA 2C5IT 1LVKA 3MK7C 1BR0A 5LHGB 5JDGA 3UT5E 1HCIA 3CX8B 3Q5XA 2IC6A 4QXHB 3PURA 2UXXB 1BR1A 5EZYE 2NW9A 2MBGA 3NZQA 5DABA 2XQYA 3V5SA 4BAYB 5JH7E 2E9XB 3IHRA 2CE7A 2CXLA 3VU7H 4EZHA 5LGNB 4PW8A 1MIYA 2LJLA 1IZNB 3QUJA 4DO0A 2CMRA 4QHOA 3KV9A 3ZLIA 3ZEFB 3EVYA 5HXHA 2LM9A 2NWBA 3ETVA 5L3GB 3N9MA 5LXTE 3C50A 4UIGA 3KFWX 4QXCB 5L2LA 2V26A 3HKBE 4CI2B 5LYJE 5HXEA 3N9QA 3BQKA 4C90A 2VASA 4WNKA 4DMVA 4MLKA 5JDQA 3VKHA 2VK9A 5HAXA 3CVRA 2E9XD 4L0RA 2EHOD 4AQFA 2VB6A 3MKDA 3ZCIA 4AXPA 5KMGP 3SWHA 4CQIA 3C64A 5JR9C 5LBMA 3SS1A 2V7LA 3U78A 1MMNA 2SPCA 4DNDA 3LK2B 4PJLA 3PUAA 3AVSA 3PUSA 3P7IA 4M1PA 4TV9E 4JLEA 4AI6A 1QUUA 2ACXA 3LJCA 2CA5A 2CEAA 2VKJA 5H6RB 3N9LA 2X9XA 1BR2A 3ONXA 5F8PA 3RRWA 3ESLA 3IEEA 3EUHA 2LSGA 1D0YA 2E9XA 2XAJB 3ZC1A 4MFRA 4HGAA 3KV4A 3IF8B 2KLQA 2XUEA 3B13A 2Z6EA 3N9OA 2X67A 1V9DA 4UVBB 3ZCJA 3ZN1B 3NBXX 4O4JE 3HKDE 4V1Av 4JUYA 4PAGA 4ZI3D 2VKOA 2YU1A 3DTOA 3U3IA 3ZYMA 1FIOA 1YKEB 4P09A 2H7OA 2K24A 3KVAA 4O4IE 2W62A 5FP3A 2LSIA 3AVRA 3P8CD 2VWAA 3PUQA 5JQGE 1FMVA 5FYMA 1S35A 3WAJA 4O8SA 1U5PA 1X79A 3CPZA 2LOPA 2ZLYA 2LHRA 4X1IE 1EZ3A 1ZKEA 2M67A 1BR4A 3N2OA 3MZKB 2ZMAA 3DJBA 2J1DG 2ODUA 3ZMVB 1HFAA 4H9RC 1AJ3A 2EHOC 4I4TE 2BDEA 5TAOA 3O9XA 2HPLA 1O3XA 4KP3C 3F2EA 4KUMB 3FXEB 4UXNB 1UX4A 3ZMSB 4PNIA 5L3EB 3TKLB 3NZPA 4P0AA 2ZM0A 4K0UA 2KNDA 5LHIB 3JC6C 4OFZA 5HXRA 3KV5A 1Y64B 2QA7A 3I9YA 3KDSE 3R84B 4ZHQE 3FXDB 5JDNA 5FY1A 3OYZA 2WBLA 4GK0E 4HN9A 5LGUB 4JEUB 2VKDA 2H7VC 4H63V 1Z0PA 2D5UA 2LOSA 2LSYA 3RC3A 1SA0E 2CWYA 2Y48B 3BQLA 3C4WA 2MYSA 5EK3A 2A72A 3PU3A 5JDHA 4ZS3A 1U4QA 2V7MA 2W00A 2ES0A 3O4XE 4ZI3C 3EDUA 2MOZA 3ZN0B 3O1JA 4KMCA 4BA9A 2YEVC 3LFMA 3PUGA 3KVBA 4H9NC 4OYJA 2DHRA 2A2FX 2X9HA 4ANJA 3OYXA 4PK6A 5IYZE 5J2UE 2XAHB 3PDYA 2D2SA 1MMGA 3N5LA 2CLYC 1IAPA 2D0UA 3CKDA 5A1LA 1LVFA 2V7IA 4EAHA 4IE0A 4HEAA 3I0QA 2BVMA 1KK7A 2WM9A 3JC6D 3FHNA 3RRCA 5L3BB 2X0LB 3IBPA 3F31A 2X66A 1VOMA 4ZS2A 5FXXA 1G73A 4XAXB 2BZBA 3ZMUB 5LCYA 5LJMA 3K3QC 1S94A 4AKGA 4PK4A 3PE0A 3WI3A 3HKEE 2WMNA 3O1IA 4ADZA 3AA7B 3CX6B 3E22E 4TUYE 1MIWA 1WR6A 4H9OC 1IJ6A 2PBIA 4L9IA 3RPUA 2JPFA 2L9QA 3LBXA 4ZI2D 3C4ZA 4G63A 3FBLA 4PFPA 1IJ5A 3PU8A 2PG8A 4PJMA 1HX8A 1OXZA 4HFVA 1KNZA 4Z8XA 4ERRA 5BMVE 3RX6A 2PJQA 3FB2A 4ZI7E 4H9PC 4FJOA 5L3CB 1WYBA 3LG7A 4OHFA 2I59A 4I55E 3KBTA 5JVDE 4XBFB 4EYYR 4IGUA 5LJNA 2UXNB 2N9DA 2W61A 5JDLA 4UF0A 5FY0A 2X9WA 2Y6XA 4YHJA 3R6NA 3RYIE 1YW0A 2HH7A 2EHOA 5KX5E 1ZV4X 2Q9QB 4ILUA 4YLHA 3RYHE 3V5UA 4AQFC 1HG5A 1FMWA 2C5KT 3GA8A 4O4LE 4L5GA 3BK9A 3N2GE 4IE6A 5HXSA 3AA6B 5JR9B 3FBZA 5E0OA 2K48A 3UUXB 2L3LA 5HXCA 2CXDA 5EK2A 4EYUA 4QX7B 5GONE 1NAFA 3CMLA 3GN5B 5FNVE 3ZJ1A 5FXZA 3ZMTB 3HKCE 1FEWA 3H3AA 3HA4A 3N9NA 4CI1B 5LP6E 2C0SA 2DCFA 2YK0A 3LK3B 4UV8B 4QKNA 4ZI2C 2YINA 4TZ4C 4IE7A 4E7ZA 2K9AA 3AB3B 2LT3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NAF A;  1OXZ A;  1O3X A;  1WRD A;  1YD8 G;  2N9D A;  1X79 A;  1NWM X;  2N2N A;  1WR6 A; 
#chains in the Genus database with same CATH topology
 1WRD A;  2XSA A;  2E9X C;  3HR0 A;  4HE8 A;  4QXB B;  5LA6 E;  3UUM A;  2MAW A;  2YN6 A;  3N2K E;  1T72 A;  2OA5 A;  4QH4 A;  4YJ2 E;  1CHU A;  3AE1 A;  4X1K E;  4JI4 T;  3NRY A;  1HG2 A;  2JJ9 A;  4GIW A;  4UF0 B;  4QX8 B;  3RKG A;  3V5U A;  2KZ7 B;  3VR9 A;  5LGT B;  5LNK A;  2KT9 A;  2CLY B;  2X51 A;  1XNR T;  2C5J A;  3NVO A;  3RIF A;  3N9P A;  4AKI A;  2CXF A;  5L3F B;  2MTQ A;  3UU8 A;  5FMN A;  2VKH A;  3VHL A;  2Q9Q A;  3NKZ A;  3UU3 A;  4CXY A;  2DLR A;  2E8I A;  3P50 A;  5KDM C;  2CM0 A;  3B57 A;  4IE4 A;  3ZMZ B;  2IDO B;  3D0T A;  4UEM A;  2ODV A;  5HCM A;  5HWY A;  2G0U A;  2WWU A;  4GKJ T;  1UUR A;  4TN7 B;  5CB4 E;  3UU6 A;  3A5X A;  4BJN A;  5JDF A;  2X0Y A;  4YY3 T;  3AED A;  2V7J A;  3CQX C;  4GOU A;  2XAQ B;  2WCA A;  3TLV A;  4ISS A;  4H63 H;  3J7Y q;  1G8X A;  2HHH T;  5ADX L;  3OJA A;  4PJN A;  1D1A A;  1HR0 T;  2CCQ A;  1XDO A;  2JQQ A;  3L09 A;  3VR8 A;  4EB6 E;  2JMK A;  4F6R C;  4WBO A;  4MBQ A;  5F3J A;  1DU2 A;  1OWA A;  4CI3 B;  2BG9 B;  2KMF A;  3RKO A;  2IHR 1;  3L3P A;  1SUM B;  2IML A;  2PFV A;  5FVL A;  4HWF A;  5KXJ A;  1E2A A;  1OED E;  2P9B A;  5JDM A;  4Q25 A;  3K1S A;  3P4R A;  4UVA B;  2N2N A;  2XTL A;  2JMH A;  2BKP A;  2JQH A;  3QNU A;  5AQI B;  3EI0 A;  5L4H A;  4N78 D;  5C2T A;  4IT4 A;  4DR3 T;  1HNX T;  3T8O A;  2K5B B;  2B1E A;  2NW8 A;  3AE2 A;  3SOL A;  5J2T E;  1NWM X;  4IL4 A;  3SFE A;  5DJQ C;  4OYK A;  3HI2 A;  2E2A A;  2M6B A;  1OED B;  3QK6 A;  4HWI B;  1YKH B;  1WCR A;  3E0Z A;  4X1Y E;  3J9X 1;  4A98 A;  3LBX B;  5JRE A;  4JI7 T;  4LF5 T;  1R8I A;  2WDV A;  2KWI B;  4G2A A;  1VCS A;  1XNQ T;  2RA1 A;  3CQG B;  4IHJ E;  4ASK A;  4Z90 A;  1HNZ T;  4H9Q C;  3GN5 A;  3RYC E;  3EHZ A;  3ZYK A;  4DVD A;  5AQS B;  4K0K T;  4DMW A;  3PTR B;  3P4Q A;  4WBN E;  2R6G F;  3E08 A;  3QC9 A;  5AQG B;  3NRX A;  1L0V A;  3FZF B;  4BJM A;  3AA1 B;  4P0B A;  5JR9 A;  1D0Z A;  3Q2M A;  2V5C A;  3ZYL A;  2JQ9 A;  3W15 B;  4DBR A;  1Y01 A;  2RPA A;  2XQ3 A;  1B7T A;  3EAB A;  3LDQ B;  4X20 E;  4AIU A;  1SE7 A;  3T1Y T;  4JEH B;  3EDV A;  1MMD A;  2WAU A;  2NP9 A;  2WS3 A;  4JI2 T;  3G06 A;  3GMI A;  3MA9 A;  5DQW A;  3UTK A;  2XAS B;  3FZH B;  4O2A E;  3ZJ2 A;  5DQV A;  4LF4 T;  3BQI A;  2XQA A;  4CZZ B;  5AQF B;  5HEG A;  2A3D A;  4YFS A;  2UUB T;  4E7S A;  2FJE A;  3Q9D A;  4WZX A;  2NTY A;  2V7K A;  3K8P C;  1IBL T;  3PUZ F;  3ZPO A;  3PUX F;  3UFE A;  2FUP A;  2CBI A;  3LK4 2;  3MXZ A;  3OBV E;  5M4Y A;  1LRZ A;  5LOV E;  2XHE B;  2Q9Q D;  4TWH A;  4JI0 T;  3O1H A;  2NOX A;  1WYC A;  4IE5 A;  2NW7 A;  4ILA A;  5AQT B;  2BKN A;  4HTE A;  1D0X A;  3CWZ B;  3F57 A;  4PJJ A;  4I43 B;  5HCJ A;  3RIU A;  1HTJ F;  4EIW A;  2WU5 A;  2XQ6 A;  1ZEE A;  4EXT A;  2D0T A;  3B5M A;  2L8K A;  3FZL B;  5IHY A;  3IA3 A;  1J5W A;  3L39 A;  1I94 T;  2KIN B;  5EK4 A;  5AQK B;  4UV9 B;  5JRC B;  2HPJ A;  3AA0 B;  4OK0 A;  3UUN A;  4A56 A;  2ZM8 A;  3CQC B;  4EGW A;  3UU4 A;  4JI6 T;  4FI5 A;  1US7 B;  3Q5W A;  3HL6 A;  4TV8 E;  1IBK T;  3KV6 A;  3RIA A;  4MAL A;  3P4S A;  1IBM T;  2GK9 A;  5L3D B;  2V1D B;  2RP4 A;  4IIJ E;  4U74 A;  4PFO A;  2LHN A;  2LEH A;  4X66 T;  4HKA A;  2YU2 A;  4YSY A;  2H3R A;  1NEK A;  1CUN A;  1WLX A;  1XZY A;  2DL1 A;  2LE8 A;  2DWK A;  2LSJ A;  2PTF A;  2DWG A;  3ETU A;  3K3O A;  3I0O A;  4U2Z A;  3RH3 A;  1UCU A;  5IUX A;  2XPK A;  4B3T T;  2LKH A;  2NTX A;  4UVC B;  2CHO A;  5LB7 B;  2BBJ A;  1H7C A;  2XM1 A;  2ZM2 A;  5AQV B;  5AQU B;  3S4U A;  3MJX A;  1HF8 A;  1SHZ C;  2H89 A;  5L4E A;  4A97 A;  2WQY A;  4YSX A;  2BBH A;  2AE9 A;  2BG9 A;  4KBM B;  4CXX A;  3I1A A;  2BVL A;  2XAF B;  4HFD A;  5HWX A;  4H9S E;  4UEL A;  4WW0 A;  5LBQ B;  1ZHC A;  3GWH A;  1T98 A;  2FJB A;  2WY2 A;  2XAG B;  4IDP A;  2JRK A;  3ANW A;  4EED A;  2KWH A;  3SRZ A;  3DP7 A;  5FXW A;  3AAA B;  3WAK A;  1D1B A;  1JNZ A;  4YJ3 E;  5JRC A;  5ETW A;  2YKS A;  2IAK A;  3CX7 B;  3FZK B;  1QSD A;  1YQ4 A;  4HFB A;  4PK5 A;  4CN1 A;  4GYS A;  2W67 A;  1LKX A;  4JBW F;  3C51 A;  1D1C A;  4U7I A;  5LG4 A;  4AQG A;  5LMN T;  1MNE A;  2WMO A;  1KNR A;  4NXN T;  5AQH B;  2WSS V;  4I50 E;  4QWN B;  4CN6 A;  2F4V T;  2LSK A;  5J1G A;  2W0G A;  3MAC A;  4GK5 E;  1N33 T;  4DBQ A;  3H37 A;  3K3N A;  1MMA A;  2W2U A;  2Y8D A;  4LML A;  5JTG A;  2W63 A;  4GYR A;  1VRB A;  3CK6 A;  2CWO A;  2N1G A;  3AAI A;  3P4W A;  2JIW A;  4ILB A;  4I0U A;  4J2C A;  5C8Y E;  5L47 A;  2VQE T;  4DV0 T;  3ZC0 A;  3UUL A;  3M65 A;  2UUA T;  3I9W A;  3OKQ A;  4LFC T;  2J47 A;  2DI4 A;  4IL9 A;  3AE6 A;  4NUV A;  4XZC A;  3ANW B;  4LF9 T;  1JNR A;  3Q5D A;  5FXV A;  4LFA T;  4HWD A;  2X9Y A;  4DR2 T;  2XQ5 A;  2X68 A;  4EZ4 A;  1YD8 G;  2EHO B;  4DV7 T;  4O4H E;  4WYV A;  4DR6 T;  2QGS A;  4TX5 A;  3X1D A;  5HYA A;  4ZZB A;  2K3W A;  1HX1 B;  3AE4 A;  4TNW A;  4U2Y A;  5FY7 A;  3JAE A;  4C91 A;  5CA0 E;  2WWV A;  4LF8 T;  4CXW A;  3RYF E;  2A9U A;  2Q9Q C;  2VUR A;  4JI3 T;  2W66 A;  3RC8 A;  1KFY A;  4U72 A;  5LMU T;  4ZOL E;  2UUC T;  2DNX A;  4AKL A;  1KEY A;  2IW5 B;  3PUW F;  5AFU L;  2FJA A;  1UX5 A;  2MPK A;  2IC9 A;  2VL8 A;  3C98 B;  5H6Q B;  4DV1 T;  1HS7 A;  1E1H B;  1KF6 A;  4O2B E;  4ZEY A;  1W0B A;  5LHH B;  4MHC A;  4HWC A;  3KIN B;  3C4X A;  5ABG A;  4JI5 T;  1X9B A;  3KBU A;  4B6X A;  2UXB T;  4NPP A;  1MIV A;  4IST A;  4NUU A;  2J4G A;  3TLS A;  4AKR B;  2CPT A;  3AAE B;  4IDZ A;  2ZM6 T;  2KXP B;  1MND A;  5CA1 E;  4EOZ B;  3OVU A;  1N36 T;  4AKH A;  3AEF A;  2C5I T;  3ONL C;  1LVK A;  3MK7 C;  5CFB A;  2BKO A;  5L3G B;  1W09 A;  5LHG B;  1BR0 A;  5JDG A;  2QRX A;  5AQM B;  3UT5 E;  1HCI A;  2XQ8 A;  4JV5 T;  3CX8 B;  3Q5X A;  2IC6 A;  4QXH B;  3PUR A;  1Z8U A;  1BR1 A;  2UXX B;  5EZY E;  2NW9 A;  5FKY A;  3NZQ A;  5DAB A;  2XQY A;  2MBG A;  4P1N A;  4U3C A;  3V5S A;  4BAY B;  2E9X B;  3IHR A;  5JH7 E;  2CE7 A;  2CXL A;  3VU7 H;  4EZH A;  5LGN B;  4JI1 T;  4PW8 A;  2V6Y B;  1OED A;  3QB5 K;  4YT0 A;  1MIY A;  2LJL A;  3VRB A;  1IZN B;  1WFD A;  3QUJ A;  4Z91 A;  4DO0 A;  2CMR A;  4QHO A;  3KV9 A;  3ZLI A;  2WDR A;  3ZEF B;  2J62 A;  5AQR B;  3EVY A;  5HXH A;  2CHN A;  2LM9 A;  2NWB A;  3ETV A;  3N9M A;  5AQP B;  3C50 A;  4UIG A;  3KFW X;  4COF A;  3PUY F;  4QXC B;  2V26 A;  5HEH A;  5J0Z A;  3HKB E;  5L2L A;  5HEU A;  4CI2 B;  4DR4 T;  2YDS A;  5LYJ E;  5HXE A;  3N9Q A;  2FJD A;  3BQK A;  1QLB A;  2VAS A;  4C90 A;  4WNK A;  4DMV A;  4MLK A;  5JDQ A;  3AEC A;  3VKH A;  2HN2 A;  2VK9 A;  5HAX A;  3CVR A;  2E9X D;  4L0R A;  2EHO D;  4AQF A;  2VB6 A;  2X0H A;  3MKD A;  4LMJ A;  2QVA A;  3TLW A;  3ZCI A;  4KI0 F;  5HEJ A;  5KMG P;  3SWH A;  3VRA A;  3C64 A;  4CQI A;  4IDQ A;  4YTM A;  5JR9 C;  2D9D A;  2VVS A;  5LBM A;  3SS1 A;  2V7L A;  3U78 A;  1UK5 A;  2XQ4 A;  1MMN A;  2SPC A;  4DND A;  3LK2 B;  4NIQ A;  3PUA A;  3AVS A;  3PV0 F;  4PJL A;  4IDN A;  3AE9 A;  4U31 A;  3PUS A;  2CRB A;  3P7I A;  2JQK A;  4M1P A;  4TV9 E;  4JLE A;  4ZZC A;  4AI6 A;  2BS3 A;  1QUU A;  2ACX A;  2BS4 A;  2CA5 A;  3LJC A;  2CEA A;  2VKJ A;  5H6R B;  3N9L A;  1XMO T;  2X9X A;  1BR2 A;  3ONX A;  5F8P A;  2BS2 A;  3RRW A;  3ESL A;  3IEE A;  3EUH A;  2LRL A;  1FJG T;  2LSG A;  1D0Y A;  2E9X A;  2XAJ B;  3ZC1 A;  2VL0 A;  4MFR A;  3P4P A;  5FVK A;  4HGA A;  3KV4 A;  3IF8 B;  2KLQ A;  2XUE A;  3B13 A;  2Z6E A;  2LM2 A;  3N9O A;  4EV6 A;  1KNZ A;  2NR4 A;  4F8H A;  2X67 A;  1V9D A;  4UVB B;  1J5E T;  3ZCJ A;  3M3Z B;  3ZN1 B;  3NBX X;  4O4J E;  4AXP A;  4LFB T;  3HKD E;  4V1A v;  4JUY A;  4PAG A;  1J1J A;  2VKO A;  2YU1 A;  3DTO A;  4ZI3 D;  3U3I A;  5ABH A;  3ZYM A;  2M6I A;  1FIO A;  1YKE B;  4P09 A;  1ZOY A;  2H7O A;  2K24 A;  3KVA A;  4O4I E;  2W62 A;  5FP3 A;  4A5X A;  4KX6 A;  2LSI A;  3AVR A;  3P8C D;  2VWA A;  3AXJ B;  3PUQ A;  4B3R T;  3AE7 A;  5JQG E;  4AIS A;  1FMV A;  5FYM A;  5LXT E;  1S35 A;  3WAJ A;  2QYW A;  1XWM A;  2LKG A;  3ZKR A;  4O8S A;  4IDO A;  1U5P A;  1X79 A;  3CPZ A;  1KNP A;  2LOP A;  2ZLY A;  2CBJ A;  2LHR A;  2YOE A;  3QB5 A;  1EZ3 A;  3AEB A;  4X1I E;  5LG3 A;  1ZKE A;  2M67 A;  1BR4 A;  3N2O A;  5CGM A;  3MZK B;  2ZMA A;  3A7M A;  4LF7 T;  2J1D G;  2ODU A;  3DJB A;  3CIR A;  3RQU A;  3ZMV B;  3JAD A;  2OLT A;  3ZT7 A;  1HFA A;  3PUV F;  4H9R C;  1AJ3 A;  4YSZ A;  2EHO C;  2BG9 C;  4I4T E;  2BDE A;  2YDR A;  4KHP T;  5TAO A;  5C3J A;  3O9X A;  4TWD A;  2HPL A;  1O3X A;  4KP3 C;  5FL1 A;  3F2E A;  3ZST A;  4KUM B;  3FXE B;  4NXM T;  4UXN B;  4X65 T;  4UR9 A;  1UX4 A;  4U7Y A;  3ZMS B;  2E5V A;  3AEA A;  3RGL A;  4PNI A;  2LRK A;  5HEO A;  5L3E B;  4DV6 T;  3TKL B;  3NZP A;  4HFI A;  4P0A A;  2ZM0 A;  4K0U A;  4CN4 A;  1NEN A;  2KND A;  1E7P A;  2B76 A;  5LHI B;  3JC6 C;  4QH5 A;  4OFZ A;  1OED C;  2WZH A;  5HXR A;  3KV5 A;  1YQ3 A;  3UQ7 A;  1Y64 B;  4JI8 T;  1N32 T;  2QA7 A;  3I9Y A;  3KDS E;  3R84 B;  3PJA J;  3FXD B;  4ZHQ E;  5JDN A;  2YDQ A;  5FY1 A;  3OYZ A;  4YXD A;  2WBL A;  3NWI A;  4GK0 E;  4HN9 A;  5LGU B;  4JEU B;  2VQF T;  3QOF A;  4DR1 T;  2VKD A;  2H7V C;  4H63 V;  1Z0P A;  2D5U A;  2LOS A;  2LSY A;  4HFE A;  5AQO B;  2WDQ A;  5AQN B;  3RC3 A;  4AQY T;  3UU5 A;  1SA0 E;  2XQ7 A;  2CWY A;  1T8B A;  4KHZ F;  2Y48 B;  3BQL A;  3C4W A;  3RHW A;  4X62 T;  3UFG A;  2MYS A;  5EK3 A;  4DV5 T;  2WB5 A;  2A72 A;  3PU3 A;  5JDH A;  1N34 T;  2AXD S;  2V5D A;  1M62 A;  4ZS3 A;  1U4Q A;  2V7M A;  2W00 A;  4EEB A;  2ES0 A;  4DR5 T;  3O4X E;  1UGO A;  4ZI3 C;  3AXJ A;  3EDU A;  2MOZ A;  3FZM B;  4HFC A;  3ZN0 B;  1W9R A;  3O1J A;  4KMC A;  3TLT A;  4BA9 A;  5IWA T;  2YEV C;  3LFM A;  2XJ7 A;  3PUG A;  3KVB A;  4H9N C;  4TWF A;  1UUS A;  4OYJ A;  2DHR A;  2A2F X;  2UU9 T;  2X9H A;  5F5W A;  3A8Y C;  3TLU A;  4ANJ A;  3OYX A;  4PK6 A;  5IYZ E;  4B3M T;  5J2U E;  3VKG A;  2XAH B;  3PDY A;  2D2S A;  2FBW A;  4DV4 T;  1MMG A;  3ONJ A;  3N5L A;  2CLY C;  1IAP A;  2ACZ A;  2D0U A;  3JAF A;  4HWH A;  3CKD A;  2WP9 A;  5A1L A;  1LVF A;  2IIU A;  2V7I A;  4EAH A;  5LP6 E;  4IE0 A;  4HEA A;  3I0Q A;  2BVM A;  1KK7 A;  2WM9 A;  2WU2 A;  2XM2 A;  3FHN A;  3JC6 D;  3RRC A;  5L3B B;  2X0L B;  4X64 T;  3IBP A;  3F31 A;  2OV9 A;  2X66 A;  1VOM A;  2WZI A;  4ZS2 A;  5FXX A;  1G73 A;  3OTO T;  4XAX B;  3UQ4 A;  2BZB A;  3RI5 A;  3ZMU B;  5LCY A;  5LJM A;  4DUZ T;  3K3Q C;  1S94 A;  3EAM A;  4AKG A;  4GKK T;  4PK4 A;  3AE8 A;  3PE0 A;  3WI3 A;  3HKE E;  2WMN A;  3O1I A;  4ADZ A;  1GQE A;  3AA7 B;  3CX6 B;  3E22 E;  4DID B;  4TUY E;  3H3M A;  2E5L T;  1MIW A;  1WR6 A;  4H9O C;  3ZT5 A;  1IJ6 A;  2PBI A;  2I6H A;  4L9I A;  2JPF A;  2L9Q A;  3PJA A;  3LBX A;  4IRE A;  3RPU A;  3C4Z A;  4G63 A;  3FBL A;  4PFP A;  3RF1 A;  1IJ5 A;  3ZSS A;  4ZI2 D;  4DV2 T;  4X5T A;  3T1H T;  3PU8 A;  2VVN A;  2PG8 A;  4PJM A;  4TNV A;  1HX8 A;  1OXZ A;  4HFV A;  4U33 A;  5CJ5 A;  1VCT A;  2V8S V;  2W4X A;  3ZT6 A;  4Z8X A;  4ERR A;  1W0A A;  3RX6 A;  2PJQ A;  3FB2 A;  4ZI7 E;  5BMV E;  4H9P C;  3LSV A;  2V6Y A;  4FJO A;  5L3C B;  1WYB A;  3LG7 A;  4OHF A;  2I59 A;  4I55 E;  3KBT A;  4LF6 T;  1XDP A;  1ZP0 A;  2BG9 E;  4LMK A;  3OPC A;  5JVD E;  4XBF B;  1T7S A;  4EYY R;  4IGU A;  5ABF B;  4DR7 T;  5LJN A;  2UXN B;  2N9D A;  2W61 A;  3SFD A;  5JDL A;  5ABE A;  4UF0 A;  5FY0 A;  2X9W A;  2Y6X A;  4YHJ A;  3R6N A;  3RYI E;  4OX9 T;  1YW0 A;  2HH7 A;  2EHO A;  5KX5 E;  1ZV4 X;  2Q9Q B;  3AEG A;  2KSR A;  4ILU A;  4YLH A;  3RYH E;  4HFH A;  4ILC A;  1HG5 A;  1FMW A;  3UUB A;  2C5K T;  3AEE A;  3GA8 A;  2V6X A;  4O4L E;  4AQF C;  4L5G A;  4DUY T;  3BK9 A;  4YTP A;  3JCF A;  3N2G E;  4IE6 A;  5AQL B;  4DV3 T;  4JYA T;  1HNW T;  5ABF A;  3AE5 A;  4QH1 A;  5HXS A;  3AA6 B;  5JR9 B;  3FBZ A;  5E0O A;  2H88 A;  2K48 A;  3UUX B;  2L3L A;  5HXC A;  2CXD A;  5EK2 A;  3Q5E A;  4EYU A;  4QX7 B;  1XMQ T;  1M7K A;  2UXD T;  5GON E;  4B3S T;  5AQQ B;  1NAF A;  3CML A;  2I0M A;  2XZE A;  3GN5 B;  5FNV E;  5FL0 A;  2UXC T;  3ZJ1 A;  2XQ9 A;  5FXZ A;  3ZMT B;  1I6Z A;  2HN1 A;  2XY8 B;  3HKC E;  4YHH T;  1YXR A;  3L8R A;  5AQJ B;  3ABV A;  1FEW A;  3H3A A;  3HA4 A;  3RLF F;  3N9N A;  2LLY A;  4CI1 B;  2C0S A;  2DCF A;  1WR0 A;  2YK0 A;  2IUB A;  3LK3 B;  4QKN A;  4UV8 B;  3RQW A;  4ZI2 C;  4ZXL A;  2XSB A;  2YIN A;  4TZ4 C;  4IE7 A;  3AE3 A;  3RIU C;  4E7Z A;  2K9A A;  3AB3 B;  4YTN A;  5BR8 T;  2LT3 A; 
#chains in the Genus database with same CATH homology
 1WRD A;  3HR0 A;  2E9X C;  4HE8 A;  4QXB B;  5LA6 E;  3UUM A;  3N2K E;  2OA5 A;  4YJ2 E;  4X1K E;  3NRY A;  1HG2 A;  2JJ9 A;  4GIW A;  4UF0 B;  4QX8 B;  5LGT B;  2KZ7 B;  5LNK A;  2KT9 A;  2CLY B;  2X51 A;  2C5J A;  4AKI A;  3N9P A;  2CXF A;  2MTQ A;  5FMN A;  2VKH A;  3VHL A;  2Q9Q A;  4CXY A;  2DLR A;  2E8I A;  5KDM C;  2CM0 A;  3B57 A;  4IE4 A;  3ZMZ B;  3D0T A;  4UEM A;  2ODV A;  5HWY A;  2G0U A;  2WWU A;  4TN7 B;  5CB4 E;  3A5X A;  4BJN A;  5JDF A;  2V7J A;  3CQX C;  4GOU A;  2XAQ B;  4ISS A;  4H63 H;  3J7Y q;  1G8X A;  5ADX L;  3OJA A;  4PJN A;  1D1A A;  2CCQ A;  2JQQ A;  3L09 A;  4EB6 E;  2JMK A;  4F6R C;  4WBO A;  4MBQ A;  5F3J A;  1OWA A;  4CI3 B;  2KMF A;  3RKO A;  3L3P A;  2PFV A;  2P9B A;  5JDM A;  4UVA B;  2N2N A;  2XTL A;  2JMH A;  4N78 D;  3T8O A;  2K5B B;  2B1E A;  2NW8 A;  3SOL A;  5J2T E;  1NWM X;  5DJQ C;  4OYK A;  3HI2 A;  3QK6 A;  4X1Y E;  1YKH B;  3J9X 1;  3E0Z A;  5JRE A;  3LBX B;  2KWI B;  4G2A A;  2RA1 A;  3CQG B;  4IHJ E;  4ASK A;  4H9Q C;  3GN5 A;  3RYC E;  4DVD A;  3ZYK A;  4DMW A;  3PTR B;  4WBN E;  3E08 A;  3QC9 A;  3NRX A;  4BJM A;  3AA1 B;  4P0B A;  5JR9 A;  1D0Z A;  3Q2M A;  3ZYL A;  3W15 B;  4DBR A;  4X20 E;  1B7T A;  4JEH B;  3EDV A;  1MMD A;  2WAU A;  2NP9 A;  3ZJ2 A;  3MA9 A;  3GMI A;  5DQW A;  3UTK A;  2XAS B;  4O2A E;  5DQV A;  3BQI A;  4CZZ B;  2A3D A;  4YFS A;  4E7S A;  3Q9D A;  2NTY A;  2V7K A;  3K8P C;  3ZPO A;  3UFE A;  3LK4 2;  3MXZ A;  3OBV E;  5M4Y A;  1LRZ A;  5LOV E;  2XHE B;  2Q9Q D;  3O1H A;  2NOX A;  1WYC A;  4IE5 A;  2NW7 A;  4HTE A;  4PJJ A;  1D0X A;  3CWZ B;  3F57 A;  4I43 B;  4EIW A;  1HTJ F;  1ZEE A;  4EXT A;  2D0T A;  5IHY A;  2L8K A;  2KIN B;  5EK4 A;  4UV9 B;  5JRC B;  2HPJ A;  3AA0 B;  4OK0 A;  3UUN A;  4A56 A;  3CQC B;  2ZM8 A;  4FI5 A;  1US7 B;  3Q5W A;  3HL6 A;  4TV8 E;  3KV6 A;  4MAL A;  2GK9 A;  5L3D B;  2V1D B;  2RP4 A;  4IIJ E;  4U74 A;  4PFO A;  2LHN A;  2LEH A;  4HKA A;  2YU2 A;  2H3R A;  1CUN A;  1WLX A;  2LE8 A;  3ETU A;  2DWK A;  2LSJ A;  3K3O A;  2DWG A;  3RH3 A;  3I0O A;  1UCU A;  2NTX A;  4UVC B;  1H7C A;  2ZM2 A;  3S4U A;  3MJX A;  1HF8 A;  1SHZ C;  4KBM B;  4CXX A;  3I1A A;  2BVL A;  2XAF B;  5HWX A;  4H9S E;  4UEL A;  4WW0 A;  5LBQ B;  1ZHC A;  3GWH A;  1T98 A;  2XAG B;  2JRK A;  3ANW A;  2KWH A;  3SRZ A;  3DP7 A;  5FXW A;  3AAA B;  3WAK A;  1D1B A;  4YJ3 E;  5JRC A;  5ETW A;  2IAK A;  3CX7 B;  1QSD A;  5L3F B;  4PK5 A;  3VKG A;  4GYS A;  1LKX A;  5LG4 A;  3C51 A;  1D1C A;  4AQG A;  1MNE A;  2WMO A;  2WSS V;  4I50 E;  4QWN B;  2LSK A;  5J1G A;  2W0G A;  3MAC A;  4GK5 E;  4DBQ A;  3H37 A;  3K3N A;  1MMA A;  2Y8D A;  2W63 A;  4GYR A;  1VRB A;  2CWO A;  2N1G A;  3AAI A;  4J2C A;  3ZC0 A;  5C8Y E;  3UUL A;  3M65 A;  3I9W A;  3OKQ A;  2DI4 A;  4NUV A;  4XZC A;  3ANW B;  5FXV A;  2X9Y A;  2X68 A;  4EZ4 A;  1YD8 G;  2EHO B;  4O4H E;  2QGS A;  4TX5 A;  5HYA A;  5FY7 A;  4C91 A;  5CA0 E;  4CXW A;  3RYF E;  2Q9Q C;  3RC8 A;  4U72 A;  4ZOL E;  2DNX A;  4AKL A;  2IW5 B;  5AFU L;  1UX5 A;  2IC9 A;  2VL8 A;  3C98 B;  5H6Q B;  1HS7 A;  1E1H B;  4O2B E;  5LHH B;  4MHC A;  3KIN B;  3C4X A;  3KBU A;  4B6X A;  1MIV A;  4IST A;  4NUU A;  4AKR B;  3AAE B;  4IDZ A;  2KXP B;  1MND A;  5CA1 E;  4EOZ B;  4AKH A;  2C5I T;  1LVK A;  3MK7 C;  1BR0 A;  5LHG B;  5JDG A;  3UT5 E;  1HCI A;  3CX8 B;  3Q5X A;  2IC6 A;  4QXH B;  3PUR A;  2UXX B;  1BR1 A;  5EZY E;  2NW9 A;  2MBG A;  3NZQ A;  5DAB A;  2XQY A;  3V5S A;  4BAY B;  5JH7 E;  2E9X B;  3IHR A;  2CE7 A;  2CXL A;  3VU7 H;  4EZH A;  5LGN B;  4PW8 A;  1MIY A;  2LJL A;  1IZN B;  3QUJ A;  4DO0 A;  2CMR A;  4QHO A;  3KV9 A;  3ZLI A;  3ZEF B;  3EVY A;  5HXH A;  2LM9 A;  2NWB A;  3ETV A;  5L3G B;  3N9M A;  5LXT E;  3C50 A;  4UIG A;  3KFW X;  4QXC B;  5L2L A;  2V26 A;  3HKB E;  4CI2 B;  5LYJ E;  5HXE A;  3N9Q A;  3BQK A;  4C90 A;  2VAS A;  4WNK A;  4DMV A;  4MLK A;  5JDQ A;  3VKH A;  2VK9 A;  5HAX A;  3CVR A;  2E9X D;  4L0R A;  2EHO D;  4AQF A;  2VB6 A;  3MKD A;  3ZCI A;  4AXP A;  5KMG P;  3SWH A;  4CQI A;  3C64 A;  5JR9 C;  5LBM A;  3SS1 A;  2V7L A;  3U78 A;  1MMN A;  2SPC A;  4DND A;  3LK2 B;  4PJL A;  3PUA A;  3AVS A;  3PUS A;  3P7I A;  4M1P A;  4TV9 E;  4JLE A;  4AI6 A;  1QUU A;  2ACX A;  3LJC A;  2CA5 A;  2CEA A;  2VKJ A;  5H6R B;  3N9L A;  2X9X A;  1BR2 A;  3ONX A;  5F8P A;  3RRW A;  3ESL A;  3IEE A;  3EUH A;  2LSG A;  1D0Y A;  2E9X A;  2XAJ B;  3ZC1 A;  4MFR A;  4HGA A;  3KV4 A;  3IF8 B;  2KLQ A;  2XUE A;  3B13 A;  2Z6E A;  3N9O A;  2X67 A;  1V9D A;  4UVB B;  3ZCJ A;  3ZN1 B;  3NBX X;  4O4J E;  3HKD E;  4V1A v;  4JUY A;  4PAG A;  4ZI3 D;  2VKO A;  2YU1 A;  3DTO A;  3U3I A;  3ZYM A;  1FIO A;  1YKE B;  4P09 A;  2H7O A;  2K24 A;  3KVA A;  4O4I E;  2W62 A;  5FP3 A;  2LSI A;  3AVR A;  3P8C D;  2VWA A;  3PUQ A;  5JQG E;  1FMV A;  5FYM A;  1S35 A;  3WAJ A;  4O8S A;  1U5P A;  1X79 A;  3CPZ A;  2LOP A;  2ZLY A;  2LHR A;  4X1I E;  1EZ3 A;  1ZKE A;  2M67 A;  1BR4 A;  3N2O A;  3MZK B;  2ZMA A;  3DJB A;  2J1D G;  2ODU A;  3ZMV B;  1HFA A;  4H9R C;  1AJ3 A;  2EHO C;  4I4T E;  2BDE A;  5TAO A;  3O9X A;  2HPL A;  1O3X A;  4KP3 C;  3F2E A;  4KUM B;  3FXE B;  4UXN B;  1UX4 A;  3ZMS B;  4PNI A;  5L3E B;  3TKL B;  3NZP A;  4P0A A;  2ZM0 A;  4K0U A;  2KND A;  5LHI B;  3JC6 C;  4OFZ A;  5HXR A;  3KV5 A;  1Y64 B;  2QA7 A;  3I9Y A;  3KDS E;  3R84 B;  4ZHQ E;  3FXD B;  5JDN A;  5FY1 A;  3OYZ A;  2WBL A;  4GK0 E;  4HN9 A;  5LGU B;  4JEU B;  2VKD A;  2H7V C;  4H63 V;  1Z0P A;  2D5U A;  2LOS A;  2LSY A;  3RC3 A;  1SA0 E;  2CWY A;  2Y48 B;  3BQL A;  3C4W A;  2MYS A;  5EK3 A;  2A72 A;  3PU3 A;  5JDH A;  4ZS3 A;  1U4Q A;  2V7M A;  2W00 A;  2ES0 A;  3O4X E;  4ZI3 C;  3EDU A;  2MOZ A;  3ZN0 B;  3O1J A;  4KMC A;  4BA9 A;  2YEV C;  3LFM A;  3PUG A;  3KVB A;  4H9N C;  4OYJ A;  2DHR A;  2A2F X;  2X9H A;  4ANJ A;  3OYX A;  4PK6 A;  5IYZ E;  5J2U E;  2XAH B;  3PDY A;  2D2S A;  1MMG A;  3N5L A;  2CLY C;  1IAP A;  2D0U A;  3CKD A;  5A1L A;  1LVF A;  2V7I A;  4EAH A;  4IE0 A;  4HEA A;  3I0Q A;  2BVM A;  1KK7 A;  2WM9 A;  3JC6 D;  3FHN A;  3RRC A;  5L3B B;  2X0L B;  3IBP A;  3F31 A;  2X66 A;  1VOM A;  4ZS2 A;  5FXX A;  1G73 A;  4XAX B;  2BZB A;  3ZMU B;  5LCY A;  5LJM A;  3K3Q C;  1S94 A;  4AKG A;  4PK4 A;  3PE0 A;  3WI3 A;  3HKE E;  2WMN A;  3O1I A;  4ADZ A;  3AA7 B;  3CX6 B;  3E22 E;  4TUY E;  1MIW A;  1WR6 A;  4H9O C;  1IJ6 A;  2PBI A;  4L9I A;  3RPU A;  2JPF A;  2L9Q A;  3LBX A;  4ZI2 D;  3C4Z A;  4G63 A;  3FBL A;  4PFP A;  1IJ5 A;  3PU8 A;  2PG8 A;  4PJM A;  1HX8 A;  1OXZ A;  4HFV A;  1KNZ A;  4Z8X A;  4ERR A;  5BMV E;  3RX6 A;  2PJQ A;  3FB2 A;  4ZI7 E;  4H9P C;  4FJO A;  5L3C B;  1WYB A;  3LG7 A;  4OHF A;  2I59 A;  4I55 E;  3KBT A;  5JVD E;  4XBF B;  4EYY R;  4IGU A;  5LJN A;  2UXN B;  2N9D A;  2W61 A;  5JDL A;  4UF0 A;  5FY0 A;  2X9W A;  2Y6X A;  4YHJ A;  3R6N A;  3RYI E;  1YW0 A;  2HH7 A;  2EHO A;  5KX5 E;  1ZV4 X;  2Q9Q B;  4ILU A;  4YLH A;  3RYH E;  3V5U A;  4AQF C;  1HG5 A;  1FMW A;  2C5K T;  3GA8 A;  4O4L E;  4L5G A;  3BK9 A;  3N2G E;  4IE6 A;  5HXS A;  3AA6 B;  5JR9 B;  3FBZ A;  5E0O A;  2K48 A;  3UUX B;  2L3L A;  5HXC A;  2CXD A;  5EK2 A;  4EYU A;  4QX7 B;  5GON E;  1NAF A;  3CML A;  3GN5 B;  5FNV E;  3ZJ1 A;  5FXZ A;  3ZMT B;  3HKC E;  1FEW A;  3H3A A;  3HA4 A;  3N9N A;  4CI1 B;  5LP6 E;  2C0S A;  2DCF A;  2YK0 A;  3LK3 B;  4UV8 B;  4QKN A;  4ZI2 C;  2YIN A;  4TZ4 C;  4IE7 A;  4E7Z A;  2K9A A;  3AB3 B;  2LT3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...