1WRDA

Crystal structure of tom1 gat domain in complex with ubiquitin
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
98
structure length
98
Chain Sequence
GPLGSEQIGKLRSELEMVSGNVRVMSEMLTELVPTQAEPADLELLQELNRTCRAMQQRVLELIPQIANEQLTEELLIVNDNLNNVFLRHERFERFRTG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Target of Myb protein 1
publication title Structural basis for recognition of ubiquitinated cargo by Tom1-GAT domain.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein transport/signaling protein
total genus 39
structure length 98
sequence length 98
ec nomenclature
pdb deposition date 2004-10-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03127 GAT GAT domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.160 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 1wrdA00
1NWMX 1WR6A 1YD8G 2N2NA 1OXZA 2N9DA 1WRDA 1X79A 1NAFA 1O3XA
chains in the Genus database with same CATH superfamily
1QSDA 2BVLA 4CXYA 2LM2A 5JR9C 4A56A 2VL8A 4ERRA 4G2AA 4PK4A 2KWIB 2WQYA 4U2YA 4B3RT 1AJ3A 3P8CD 3RF1A 1UUSA 3PUVF 2V26A 3ZMVB 2FJEA 5BMVE 3BQIA 4EEDA 3AE7A 5JDHA 4KX6A 2XAGB 2D0TA 5JDFA 1ZP0A 1N34T 1BR4A 3PV0F 5HWYA 3AE3A 3PURA 4YXDA 4MALA 1WFDA 1UX4A 2Q9QC 1T98A 2BKPA 3EUHA 3HR0A 4HFEA 5M4YA 3ZT5A 3KV5A 3O1IA 2HN2A 5HXSA 1KEYA 3RYFE 3PUYF 5CA0E 3AXJA 3AE9A 3AA7B 4DV1T 1T7SA 3HI2A 4HFBA 4TZ4C 4PNIA 3CQCB 5DQWA 1UCUA 2AE9A 2KSRA 1Y64B 3UU6A 5FL0A 4ZZBA 3VRBA 2MYSA 3ZPOA 3AVRA 1UGOA 4CN1A 3PUAA 4CN6A 4TNVA 5AQMB 2H89A 1BR2A 3LK2B 3JAFA 1WYBA 2C5JA 3PUWF 2NR4A 3LJCA 3SOLA 4JEUB 3AE1A 4HKAA 3LFMA 2V7JA 2BG9C 3MACA 5FY1A 5LB7B 4JEHB 2QA7A 5AQHB 4DO0A 3C50A 2CA5A 4B3ST 5L3CB 2VQET 3T1HT 4CXWA 4OHFA 4UV9B 2W67A 2J1DG 3N2GE 5EK4A 5FY0A 2OA5A 5LA6E 4B6XA 4L5GA 2LT3A 3HKDE 2CXFA 1Z8UA 3ZSSA 3NBXX 2IDOB 5AQTB 3OYZA 2HN1A 3AA1B 4QH4A 3VRAA 5LG3A 4CN4A 1HG2A 1L0VA 5LHGB 4COFA 3QB5A 1HFAA 4H63V 4F8HA 3VR8A 5L4EA 4H9PC 5HWXA 1IJ5A 3LK3B 3NZQA 2RA1A 1M62A 5LGTB 5J0ZA 3R6NA 2XQYA 2BBJA 1W09A 5EK3A 4LMLA 2XY8B 3N5LA 2YN6A 5JVDE 3ZMSB 4U72A 4YTMA 5FXWA 3ESLA 3JAEA 4JI5T 5LOVE 3PUQA 4DUYT 2X67A 3HA4A 4O8SA 2XSBA 4AKIA 2BKOA 1OEDB 3H3MA 5HAXA 4EXTA 2OLTA 3X1DA 5E0OA 4NUVA 3UUNA 5JREA 4YY3T 4GKJT 1E2AA 4AKLA 4PFPA 3S4UA 1LVKA 2CLYC 2ZM2A 4H9NC 3KDSE 5HCMA 3ETUA 4U31A 1MIVA 3WI3A 1FEWA 5HXHA 2VURA 1ZHCA 3JC6D 2YU2A 5L3GB 1XNQT 1XMQT 3DP7A 1OEDE 4TWHA 2NTYA 5L3DB 4IDZA 5ABHA 2N1GA 4BJNA 2KNDA 3AEEA 2UXDT 2N9DA 3ZYLA 4DR5T 4EB6E 3MJXA 3M65A 4ZS2A 3K3NA 1BR0A 4DR6T 3B13A 1W0BA 1U4QA 5HEUA 3AE5A 3N9PA 3RRWA 3P4SA 3J7Yq 3N2KE 3ZT6A 2HPLA 4IREA 1CHUA 3MA9A 2BS2A 3VR9A 2ES0A 2X0LB 2V6YB 1N33T 4GIWA 4DR2T 4AI6A 1KNPA 5JR9B 2DHRA 3CKDA 3NVOA 3RYCE 2XQ4A 4O4LE 5JRCB 5JDQA 3C4ZA 4TWDA 1KFYA 4PK5A 1SE7A 2LJLA 4EZ4A 5LMUT 4ANJA 2NOXA 3ETVA 1U5PA 2C5IT 4AKGA 1HX8A 1X9BA 2XASB 3SFEA 3CVRA 2YK0A 4WYVA 3EABA 3ZN0B 2ZMAA 1WRDA 4HEAA 2V7MA 5F5WA 5AQKB 2CWYA 1WR6A 3KBUA 2Q9QB 3FHNA 1YKEB 3CX8B 4HFIA 1IBKT 2DLRA 5ETWA 4MLKA 5LMNT 4EZHA 4AIUA 4O2BE 4ZXLA 4ASKA 4KHPT 4BAYB 3GMIA 2NW9A 4EYUA 2IMLA 2E8IA 3TLTA 3FZHB 3RPUA 2ZM6T 3LSVA 3PTRB 4OYJA 2VKJA 3B5MA 4X20E 4YSYA 2X66A 1MNDA 2XUEA 3RC8A 3B57A 3F31A 4AQFC 4P0AA 3TLSA 2LRKA 3ONJA 3AEBA 1B7TA 5C3JA 3L3PA 1ZOYA 2WU2A 2N2NA 3VKGA 3Q2MA 4IE7A 3ZKRA 1ZEEA 2FUPA 4DNDA 1X79A 3RH3A 3RKGA 3QB5K 2V5CA 1LKXA 2BG9B 2W63A 2E5VA 4DV2T 3A5XA 3RI5A 4GK5E 5AQOB 4A97A 3ANWA 4C91A 2DL1A 5IWAT 2NW8A 2CXDA 3UFEA 4QXHB 4DUZT 5CFBA 2MAWA 4EIWA 3FZLB 1OEDA 2XQ5A 2X9XA 2BG9E 1EZ3A 2PJQA 4LFCT 4NIQA 4WZXA 2MPKA 2Y8DA 3FZFB 3GA8A 4L9IA 5FMNA 2RP4A 3AEAA 5DJQC 4EOZB 4ZS3A 5TAOA 3UU3A 4QX7B 5JTGA 4IE4A 4Q25A 4YHHT 5JQGE 1VRBA 3Q9DA 5FVKA 2WAUA 5LHHB 2K48A 2NTXA 4WBOA 4PJNA 3O9XA 2X68A 2BKNA 4EAHA 4U7IA 5H6RB 2DWKA 2HH7A 3D0TA 1UK5A 4JI7T 3AEFA 3T1YT 4B3MT 1S94A 4GYSA 1J1JA 3P4WA 1W9RA 2UUAT 1I94T 2JJ9A 2K3WA 3ZMUB 4AQYT 2A9UA 3N9NA 4LMJA 1YD8G 4ZI3C 4ZI2C 4QX8B 3ZMTB 4IIJE 2CLYB 4CXXA 4PK6A 5JH7E 2V7KA 2QVAA 1WYCA 4DV3T 2W4XA 5JR9A 4PW8A 3NKZA 2LHNA 2Y6XA 4DIDB 3ONLC 3L09A 4TX5A 4LFBT 3RLFF 3CX7B 4X5TA 1I6ZA 1VOMA 4DV6T 2IUBA 4JI2T 2YINA 1XWMA 4YJ3E 1WR0A 4CI2B 2WBLA 5FXZA 2ZLYA 2FJAA 5F8PA 2LOSA 3I0OA 4I50E 3FZKB 4PAGA 1M7KA 5EZYE 2B1EA 4WW0A 3U3IA 4P09A 1HR0T 2WP9A 1QLBA 4BJMA 3UUBA 2WY2A 5L4HA 3ZJ2A 2IHR1 1MMDA 1D0YA 1ZKEA 4G63A 2VVSA 2XQ7A 3O4XE 1D1BA 3NZPA 4GK0E 5KX5E 4DBQA 2MTQA 2XZEA 2SPCA 1O3XA 2QYWA 4IE5A 1HNWT 2CBIA 2YDQA 3HKEE 3N9MA 1Z0PA 5IHYA 2JQKA 2IIUA 3IEEA 5HYAA 2JMKA 3PUZF 3PE0A 3RQWA 4IDPA 4KMCA 3N2OA 3K3QC 4H9QC 3OKQA 2W62A 4TUYE 3RQUA 4ZI3D 4ZI2D 1JNZA 4ZHQE 3IA3A 1VCSA 2BG9A 4X66T 2Y48B 2X0HA 5AQFB 1UX5A 3N9LA 5J2UE 2DI4A 4DR4T 3CK6A 3Q5XA 3W15B 4LF8T 2YU1A 5FY7A 3RYHE 2H7VC 2Q9QD 2XTLA 5AQSB 4ADZA 2XJ7A 1QUUA 2BS4A 3AAAB 3ZLIA 4H9OC 5HEJA 3DJBA 5F3JA 3ZC1A 4TV8E 5FVLA 3PU3A 3HL6A 5AQJB 5FP3A 4QKNA 3OBVE 5AQNB 1W0AA 1G8XA 3BQLA 2E9XC 4U7YA 1T72A 3H3AA 2PG8A 4MBQA 3RIFA 1D1AA 5LHIB 2KMFA 3O1JA 4UIGA 4LFAT 3GN5A 4JI8T 4I55E 2W61A 3UUMA 3MKDA 2XQ8A 4E7ZA 2CHOA 2HPJA 2GK9A 2H3RA 3SWHA 2M6IA 1E7PA 5HEOA 1NENA 1FMVA 3K1SA 2G0UA 2CBJA 2ACXA 3UQ7A 1H7CA 4JI4T 4ILUA 4TV9E 3ZYMA 3MZKB 2JQ9A 2EHOC 2VL0A 3EVYA 2BDEA 3O1HA 4MFRA 3MK7C 5ABEA 5CA1E 1JNRA 2J62A 3UU4A 4YT0A 3KFWX 3PJAA 4YFSA 1XMOT 3AE6A 1MMAA 1WCRA 4X1KE 4YHJA 2LEHA 2CCQA 5JDMA 3BK9A 3ZSTA 1N36T 3NRYA 3KVAA 3ZJ1A 4LF6T 3PUGA 3KVBA 1HCIA 3UQ4A 5DQVA 4OYKA 1HX1B 2PFVA 5KXJA 2YDSA 3RIUC 4A98A 3L39A 3DTOA 2VVNA 4IL9A 2CRBA 4X1YE 4AKRB 1XZYA 5KDMC 3CIRA 3ZCJA 3OTOT 4HWFA 5H6QB 3V5SA 1V9DA 2RPAA 3P4QA 2H7OA 5LNKA 3CWZB 3LG7A 1D1CA 5AQRB 4A5XA 1E1HB 4ILBA 3FXDB 4HE8A 5LGNB 4HFVA 4JI3T 4AXPA 1LVFA 3OYXA 3CQGB 1N32T 2VWAA 1IJ6A 1FIOA 3CQXC 4M1PA 1XDPA 2VB6A 3AEGA 4P1NA 2F4VT 3N9QA 2V7IA 4GYRA 4ILCA 5HXCA 2WCAA 2XAQB 4L0RA 2ZM0A 2DNXA 3AXJB 2LSGA 5LJNA 2XQ3A 1HTJF 1UURA 3RRCA 3Q5EA 5LXTE 2LSIA 4TWFA 3A7MA 3GWHA 4TNWA 2JMHA 3LK42 4QH5A 2PBIA 2KINB 4DV4T 2ZM8A 4XZCA 4KUMB 4DV0T 3TLVA 1IAPA 2UXCT 4UVCB 4JV5T 2L8KA 4DVDA 4UXNB 1YW0A 2WDQA 3KV9A 2WMNA 2E5LT 1OXZA 4IE0A 4EYYR 3M3ZB 4IDQA 4J2CA 4JI1T 3UTKA 3ZT7A 5LGUB 1MNEA 2JQQA 3ZN1B 4UEMA 4NUUA 4X64T 5FXVA 3VKHA 5L2LA 4AQFA 2KZ7B 4ISTA 1MMNA 2PTFA 4YTNA 3K8PC 4HWCA 4UV8B 4NPPA 2LKHA 3AA6B 2XQ6A 2WSSV 4YTPA 4K0UA 4DR7T 2WDRA 3EHZA 3H37A 2X9YA 3C4XA 5LBQB 2JQHA 2XQ9A 2ACZA 2LLYA 2QRXA 4UR9A 3TKLB 4EGWA 5LYJE 1HNZT 3AE4A 4JLEA 2C0SA 1XDOA 4JI6T 5AFUL 4KBMB 3QC9A 1YKHB 2BBHA 1NEKA 3Q5DA 3CX6B 3C64A 2W2UA 1SA0E 2CEAA 2A2FX 2FJDA 4UELA 5FXXA 4ZI7E 5ADXL 1R8IA 2LSJA 1KF6A 3RGLA 2CXLA 4X62T 3E08A 4PJJA 2E9XB 1GQEA 4LF9T 2LM9A 3FBLA 5ABFB 5AQVB 2WZHA 4PFOA 2X51A 2KT9A 3OPCA 3RKOA 4HWIB 4O2AE 2LRLA 2UXNB 4EEBA 1FMWA 4NXMT 3AVSA 2K9AA 1G73A 1YXRA 4LF7T 3UU8A 2I0MA 3VHLA 4PJLA 4YSZA 1KK7A 2V6YA 1YQ3A 3ZYKA 3JADA 2M6BA 4DMVA 4XAXB 4OK0A 3IBPA 2X9HA 5JDGA 4LMKA 4QH1A 5JRCA 4YLHA 2VQFT 2WMOA 3NWIA 5JDLA 2EHOB 2WU5A 4KP3C 5AQGB 2YDRA 5L47A 2A3DA 4IHJE 2UXXB 3PUSA 2LHRA 2V1DB 3G06A 2V8SV 3ONXA 5BR8T 3RHWA 4OX9T 2IW5B 3AEDA 2L9QA 2W66A 4X65T 1VCTA 5FYMA 4QHOA 2X9WA 2Q9QA 2KLQA 3UT5E 1IBMT 3ZEFB 2LKGA 4AQGA 4U74A 1J5WA 1MMGA 4U33A 4UF0B 4CQIA 3EAMA 4CZZB 3KV4A 3Q5WA 3IF8B 4HFCA 2BS3A 5IUXA 3E0ZA 3LDQB 1HG5A 3I0QA 2UXBT 4AKHA 4FJOA 2VKHA 4AISA 4WBNE 1XNRT 3TLUA 2JRKA 4XBFB 3P4PA 2XAHB 3N9OA 3IHRA 3PJAJ 2I59A 4IGUA 2W0GA 2A72A 4X1IE 5A1LA 1T8BA 2JIWA 2L3LA 2VASA 3JC6C 5HEGA 5FNVE 2BZBA 4E7SA 2KXPB 3FBZA 2J4GA 2LSYA 1US7B 2XAFB 4YJ2E 1KNZA 3AECA 4KI0F 2B76A 1FJGT 4I0UA 2BVMA 3KBTA 4CI1B 5HXRA 3UFGA 4EV6A 4LF4T 1D0XA 2M67A 5FKYA 2CMRA 3C4WA 2VK9A 1S35A 4QWNB 4O4HE 4JYAT 3RYIE 2V7LA 3R84B 3TLWA 3QNUA 2WM9A 2J47A 3KINB 5LG4A 2YOEA 2VKDA 3EDVA 2XM1A 4JBWF 3NRXA 5DABA 2V6XA 4Z90A 3RC3A 2P9BA 1DU2A 2C5KT 5LBMA 2CE7A 1CUNA 3QK6A 3ANWB 2DWGA 2CWOA 2IC9A 2D2SA 3AE8A 3CMLA 4TN7B 2YKSA 3UUXB 3F2EA 2D0UA 2E9XA 4DR1T 1NAFA 5L3BB 2FJBA 2UUCT 5ABFA 4IDOA 1OWAA 4N78D 4GOUA 3FB2A 4H9SE 3V5UA 5AQIB 3BQKA 3LBXB 4K0KT 2FBWA 5KMGP 1SHZC 3P7IA 5J2TE 4V1Av 3RIAA 4OFZA 2NP9A 2LE8A 1D0ZA 4Z8XA 4C90A 3UULA 4LF5T 2K5BB 2KWHA 2JPFA 2CPTA 2R6GF 4F6RC 2ODUA 1WLXA 5LJMA 2HHHT 2EHOA 4QXBB 4Z91A 2WB5A 5CJ5A 1HS7A 5LCYA 3VU7H 5AQQB 4NXNT 3PUXF 4DBRA 1HF8A 4UVAB 2MOZA 3OJAA 3AAEB 5HCJA 4WNKA 4B3TT 4O4JE 2E9XD 2WDVA 3U78A 2XQAA 3FZMB 3MXZA 5IYZE 4ZEYA 4U3CA 3SS1A 4DV5T 4HGAA 1KNRA 3RIUA 4UF0A 4JUYA 4GKKT 2V5DA 5AQUB 3I9YA 1IZNB 3I9WA 4MHCA 1SUMB 2ODVA 2WZIA 4HFHA 4IE6A 3KV6A 3P4RA 3WAKA 2IC6A 4DR3T 4ZZCA 2DCFA 2YEVC 5CB4E 3QOFA 5AQPB 3A8YC 3HKCE 4I4TE 2LSKA 2XAJB 2XM2A 4KHZF 3OVUA 2UU9T 4PJMA 2EHOD 5J1GA 5LP6E 4ZOLE 3SRZA 3EI0A 2D9DA 4HWHA 4H9RC 4FI5A 2WWVA 2VKOA 3F57A 1MIYA 2W00A 3AB3B 3JCFA 4CI3B 4IDNA 4DMWA 5CGMA 2UUBT 1NWMX 2I6HA 3K3OA 4HWDA 3ABVA 1YQ4A 4IL4A 2H88A 2LOPA 1LRZA 5HEHA 4ILAA 1Y01A 2NWBA 5FL1A 2WS3A 5C2TA 3EDUA 2X0YA 3HKBE 2XSAA 2IAKA 1OEDC 3AAIA 5C8YE 3C51A 4YSXA 4O4IE 3ZMZB 3ZC0A 4DV7T 4ISSA 2E2AA 2K24A 2QGSA 3E22E 3C98B 2AXDS 2WWUA 4HFDA 4QXCB 4JI0T 2XHEB 3RX6A 4U2ZA 3UU5A 1HNXT 4H63H 5GONE 3P50A 3AE2A 1J5ET 3WAJA 2D5UA 2XPKA 5L3EB 5L3FB 2NW7A 3QUJA 4IT4A 3J9X1 3ZCIA 1ZV4X 3LBXA 4UVBB 3FXEB 3CPZA 4P0BA 1BR1A 5JDNA 3T8OA 5EK2A 5ABGA 2OV9A 1MIWA 2CHNA 3SFDA 5HXEA 3AA0B 3I1AA 1IBLT 3GN5B 4HN9A 5AQLB 3L8RA 2MBGA 3PU8A 2Z6EA 3PDYA 4BA9A 4I43B 2CM0A 4HTEA
chains in the Genus database with same CATH topology
1QSDA 3GMIA 3KFWX 4YFSA 2L3LA 2VASA 3JC6C 2NW9A 4EYUA 2BVLA 2E8IA 5FNVE 1MMAA 4CXYA 4X1KE 4YHJA 2LEHA 2CCQA 5JDMA 5JR9C 3RPUA 4A56A 3BK9A 2VL8A 3PTRB 4ERRA 2BZBA 4E7SA 3NRYA 4OYJA 4G2AA 4PK4A 2KXPB 3KVAA 3ZJ1A 2VKJA 2KWIB 3FBZA 4X20E 2LSYA 3PUGA 1US7B 2XAFB 3KVBA 2X66A 1MNDA 2XUEA 4YJ2E 3RC8A 1HCIA 3B57A 3F31A 4AQFC 4P0AA 1KNZA 1AJ3A 3P8CD 5DQVA 1B7TA 4OYKA 2BVMA 3KBTA 4CI1B 5HXRA 2PFVA 2V26A 3L3PA 3ZMVB 2N2NA 3VKGA 3Q2MA 5BMVE 3BQIA 4IE7A 1D0XA 2M67A 2CMRA 1ZEEA 3DTOA 3C4WA 2VK9A 4DNDA 1S35A 1X79A 5JDHA 4QWNB 4X1YE 4AKRB 2XAGB 3RH3A 5KDMC 4O4HE 2D0TA 5JDFA 3ZCJA 3RYIE 1BR4A 2V7LA 3R84B 5HWYA 3PURA 1LKXA 5H6QB 2WM9A 3V5SA 1V9DA 4MALA 2W63A 2H7OA 1UX4A 2Q9QC 1T98A 3A5XA 3EUHA 4GK5E 5LNKA 4C91A 3ANWA 3KINB 5LG4A 3CWZB 3HR0A 2NW8A 2CXDA 3LG7A 3UFEA 5M4YA 3KV5A 2VKDA 1D1CA 4QXHB 3O1IA 3EDVA 1E1HB 4EIWA 3NRXA 5HXSA 3FXDB 4HE8A 5LGNB 2X9XA 3RYFE 4HFVA 5DABA 3RC3A 5CA0E 3AA7B 4AXPA 1EZ3A 1LVFA 2P9BA 3OYXA 2PJQA 3CQGB 2C5KT 5LBMA 2VWAA 3HI2A 2CE7A 1CUNA 3QK6A 2Y8DA 1IJ6A 4TZ4C 3ANWB 1FIOA 2DWGA 4PNIA 2CWOA 2IC9A 2D2SA 3CQXC 3CQCB 5DQWA 1UCUA 3GA8A 4L9IA 4M1PA 1Y64B 5FMNA 3CMLA 2RP4A 4TN7B 5DJQC 2VB6A 3UUXB 3F2EA 4EOZB 4ZS3A 2MYSA 3ZPOA 2D0UA 2E9XA 3AVRA 3N9QA 2V7IA 4GYRA 5HXCA 3PUAA 1NAFA 2XAQB 5L3BB 4L0RA 5TAOA 2ZM0A 1OWAA 2DNXA 4QX7B 2LSGA 4N78D 1BR2A 4IE4A 3LK2B 4GOUA 5LJNA 3FB2A 4H9SE 3V5UA 5JQGE 1HTJF 1VRBA 1WYBA 3Q9DA 2C5JA 3BQKA 2WAUA 3LBXB 5LHHB 3LJCA 3RRCA 2K48A 3SOLA 2NTXA 4WBOA 5LXTE 4PJNA 2LSIA 5KMGP 4JEUB 1SHZC 3O9XA 2X68A 3P7IA 4HKAA 5J2TE 3GWHA 2V7JA 3LFMA 4V1Av 4EAHA 3MACA 4OFZA 2NP9A 5H6RB 2DWKA 5FY1A 2HH7A 2JMHA 3LK42 2LE8A 3D0TA 1D0ZA 4JEHB 2PBIA 2QA7A 4Z8XA 2KINB 2ZM8A 4C90A 4XZCA 3UULA 2K5BB 2KWHA 3C50A 4DO0A 2CA5A 5L3CB 4KUMB 2JPFA 1IAPA 4CXWA 4OHFA 4UVCB 4UV9B 4F6RC 2J1DG 1S94A 2ODUA 4GYSA 2L8KA 3N2GE 4UXNB 1YW0A 5EK4A 1WLXA 2OA5A 5FY0A 5LA6E 4DVDA 2JJ9A 5LJMA 3ZMUB 3KV9A 2WMNA 3N9NA 4B6XA 4L5GA 2LT3A 3HKDE 2EHOA 4QXBB 1OXZA 2CXFA 1YD8G 4IE0A 4EYYR 3NBXX 4ZI3C 4ZI2C 4QX8B 3ZMTB 3OYZA 1HS7A 4IIJE 2CLYB 4CXXA 3AA1B 4PK6A 5LCYA 4J2CA 5JH7E 3VU7H 2V7KA 3UTKA 1WYCA 4DBRA 5JR9A 4PW8A 1HG2A 1HF8A 4UVAB 5LGUB 2LHNA 2Y6XA 1MNEA 5LHGB 2JQQA 3ZN1B 2MOZA 4UEMA 3L09A 4TX5A 3OJAA 3AAEB 4NUUA 5FXVA 1HFAA 4H63V 4WNKA 3VKHA 5L2LA 4AQFA 2KZ7B 3CX7B 4O4JE 4ISTA 2E9XD 1MMNA 4H9PC 1VOMA 5HWXA 1IJ5A 3U78A 3LK3B 3MXZA 2YINA 5IYZE 3K8PC 3NZQA 2RA1A 5LGTB 4UV8B 3R6NA 4YJ3E 3SS1A 2XQYA 3AA6B 4HGAA 4CI2B 2WBLA 4UF0A 5EK3A 5FXZA 4JUYA 2ZLYA 2WSSV 4K0UA 3N5LA 3I9YA 5JVDE 1IZNB 3I9WA 3H37A 3ZMSB 4MHCA 5F8PA 2ODVA 4U72A 5FXWA 2X9YA 4IE6A 3C4XA 5LBQB 3KV6A 2LOSA 3ESLA 3WAKA 3I0OA 4I50E 5LOVE 3PUQA 2IC6A 4PAGA 5EZYE 2X67A 3TKLB 2DCFA 2YEVC 5CB4E 5LYJE 2B1EA 4WW0A 3HA4A 4O8SA 3U3IA 4P09A 4AKIA 4JLEA 4BJMA 2C0SA 5HAXA 3HKCE 5AFUL 3ZJ2A 4EXTA 4I4TE 1MMDA 4KBMB 1D0YA 3QC9A 1YKHB 2LSKA 1ZKEA 2XAJB 4G63A 5E0OA 4NUVA 3UUNA 5JREA 4AKLA 4PFPA 3CX6B 3O4XE 1D1BA 4PJMA 3C64A 3NZPA 3S4UA 4GK0E 2EHOD 5J1GA 1LVKA 2CLYC 5KX5E 1SA0E 2CEAA 2A2FX 2ZM2A 4H9NC 4DBQA 5LP6E 2MTQA 3KDSE 3ETUA 4ZOLE 3SRZA 2SPCA 1MIVA 4UELA 5FXXA 1O3XA 4ZI7E 5ADXL 2LSJA 1FEWA 4IE5A 3WI3A 5HXHA 1ZHCA 3JC6D 2YU2A 5L3GB 2CXLA 3DP7A 3E08A 4PJJA 2E9XB 4H9RC 2NTYA 4FI5A 2VKOA 3F57A 2LM9A 3FBLA 5L3DB 3HKEE 1MIYA 4IDZA 2W00A 4PFOA 2X51A 2N1GA 2KT9A 3RKOA 3AB3B 4CI3B 4BJNA 4DMWA 3N9MA 4O2AE 2KNDA 1Z0PA 5IHYA 1NWMX 2UXNB 1FMWA 3K3OA 2N9DA 3ZYLA 3IEEA 5HYAA 4EB6E 2JMKA 3MJXA 3PE0A 3AVSA 3M65A 4ZS2A 2K9AA 1G73A 4KMCA 3K3NA 3N2OA 2LOPA 1BR0A 1LRZA 3K3QC 4H9QC 3OKQA 2W62A 4TUYE 4ZI3D 4ZI2D 3VHLA 4PJLA 3B13A 1KK7A 4ZHQE 1U4QA 3ZYKA 2NWBA 3EDUA 2Y48B 4DMVA 1UX5A 4XAXB 4OK0A 3N9LA 5J2UE 2DI4A 3N9PA 3IBPA 3HKBE 3RRWA 3Q5XA 3W15B 3J7Yq 2X9HA 2IAKA 5JDGA 2YU1A 3AAIA 3N2KE 5FY7A 5C8YE 3RYHE 5JRCA 2H7VC 2Q9QD 3C51A 4YLHA 2HPLA 4O4IE 3ZMZB 3ZC0A 2WMOA 5JDLA 2XTLA 4ISSA 4ADZA 1QUUA 2EHOB 3AAAB 3ZLIA 3MA9A 4KP3C 2K24A 4H9OC 2QGSA 3E22E 3C98B 3DJBA 5F3JA 3ZC1A 2WWUA 2A3DA 2ES0A 2X0LB 4QXCB 4TV8E 2XHEB 3PU3A 3HL6A 4IHJE 4GIWA 3RX6A 2UXXB 3PUSA 4AI6A 2LHRA 2DHRA 2V1DB 3CKDA 5FP3A 5JR9B 4H63H 5GONE 4QKNA 3OBVE 3RYCE 1G8XA 3ONXA 3BQLA 2E9XC 4O4LE 5JRCB 5JDQA 3C4ZA 2IW5B 2L9QA 4PK5A 3H3AA 2PG8A 2LJLA 5FYMA 4MBQA 4QHOA 3WAJA 2X9WA 4EZ4A 2D5UA 1D1AA 2Q9QA 2KLQA 3UT5E 4ANJA 2NOXA 5L3EB 3ETVA 1U5PA 5L3FB 5LHIB 3ZEFB 2NW7A 2KMFA 3O1JA 3QUJA 4AQGA 4U74A 4UIGA 1MMGA 2C5IT 3J9X1 3ZCIA 3GN5A 4AKGA 4I55E 1HX8A 4UF0B 2W61A 2XASB 3UUMA 4CQIA 3CVRA 1ZV4X 2YK0A 3LBXA 3MKDA 4UVBB 3FXEB 4CZZB 3KV4A 3Q5WA 3CPZA 3ZN0B 2ZMAA 4E7ZA 3IF8B 1WRDA 4P0BA 2HPJA 4HEAA 2V7MA 1BR1A 3E0ZA 2GK9A 2H3RA 3SWHA 5JDNA 3T8OA 2CWYA 5EK2A 1HG5A 1WR6A 3I0QA 3KBUA 2Q9QB 3FHNA 4AKHA 1FMVA 1YKEB 4FJOA 2G0UA 3CX8B 2VKHA 1MIWA 2ACXA 1H7CA 5HXEA 3AA0B 4WBNE 4XBFB 2JRKA 2DLRA 3I1AA 4ILUA 5ETWA 4TV9E 3ZYMA 3MZKB 2XAHB 3N9OA 3GN5B 4HN9A 2EHOC 4MLKA 3IHRA 3EVYA 2MBGA 2BDEA 3O1HA 4EZHA 3PU8A 4MFRA 3MK7C 5CA1E 2Z6EA 2I59A 3PDYA 4BA9A 4IGUA 4O2BE 2W0GA 4ASKA 2A72A 4X1IE 4I43B 2CM0A 5A1LA 4BAYB 4HTEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NWM X;  1WR6 A;  1YD8 G;  2N2N A;  1OXZ A;  2N9D A;  1WRD A;  1X79 A;  1NAF A;  1O3X A; 
#chains in the Genus database with same CATH topology
 1QSD A;  2BVL A;  4CXY A;  2LM2 A;  5JR9 C;  4A56 A;  2VL8 A;  4ERR A;  4G2A A;  4PK4 A;  2KWI B;  2WQY A;  4U2Y A;  4B3R T;  1AJ3 A;  3P8C D;  3RF1 A;  1UUS A;  3PUV F;  2V26 A;  3ZMV B;  2FJE A;  5BMV E;  3BQI A;  4EED A;  3AE7 A;  5JDH A;  4KX6 A;  2XAG B;  2D0T A;  5JDF A;  1ZP0 A;  1N34 T;  1BR4 A;  3PV0 F;  5HWY A;  3AE3 A;  3PUR A;  4YXD A;  4MAL A;  1WFD A;  1UX4 A;  2Q9Q C;  1T98 A;  2BKP A;  3EUH A;  3HR0 A;  4HFE A;  5M4Y A;  3ZT5 A;  3KV5 A;  3O1I A;  2HN2 A;  5HXS A;  1KEY A;  3RYF E;  3PUY F;  5CA0 E;  3AXJ A;  3AE9 A;  3AA7 B;  4DV1 T;  1T7S A;  3HI2 A;  4HFB A;  4TZ4 C;  4PNI A;  3CQC B;  5DQW A;  1UCU A;  2AE9 A;  2KSR A;  1Y64 B;  3UU6 A;  5FL0 A;  4ZZB A;  3VRB A;  2MYS A;  3ZPO A;  3AVR A;  1UGO A;  4CN1 A;  3PUA A;  4CN6 A;  4TNV A;  5AQM B;  2H89 A;  1BR2 A;  3LK2 B;  3JAF A;  1WYB A;  2C5J A;  3PUW F;  2NR4 A;  3LJC A;  3SOL A;  4JEU B;  3AE1 A;  4HKA A;  3LFM A;  2V7J A;  2BG9 C;  3MAC A;  5FY1 A;  5LB7 B;  4JEH B;  2QA7 A;  5AQH B;  4DO0 A;  3C50 A;  2CA5 A;  4B3S T;  5L3C B;  2VQE T;  3T1H T;  4CXW A;  4OHF A;  4UV9 B;  2W67 A;  2J1D G;  3N2G E;  5EK4 A;  5FY0 A;  2OA5 A;  5LA6 E;  4B6X A;  4L5G A;  2LT3 A;  3HKD E;  2CXF A;  1Z8U A;  3ZSS A;  3NBX X;  2IDO B;  5AQT B;  3OYZ A;  2HN1 A;  3AA1 B;  4QH4 A;  3VRA A;  5LG3 A;  4CN4 A;  1HG2 A;  1L0V A;  5LHG B;  4COF A;  3QB5 A;  1HFA A;  4H63 V;  4F8H A;  3VR8 A;  5L4E A;  4H9P C;  5HWX A;  1IJ5 A;  3LK3 B;  3NZQ A;  2RA1 A;  1M62 A;  5LGT B;  5J0Z A;  3R6N A;  2XQY A;  2BBJ A;  1W09 A;  5EK3 A;  4LML A;  2XY8 B;  3N5L A;  2YN6 A;  5JVD E;  3ZMS B;  4U72 A;  4YTM A;  5FXW A;  3ESL A;  3JAE A;  4JI5 T;  5LOV E;  3PUQ A;  4DUY T;  2X67 A;  3HA4 A;  4O8S A;  2XSB A;  4AKI A;  2BKO A;  1OED B;  3H3M A;  5HAX A;  4EXT A;  2OLT A;  3X1D A;  5E0O A;  4NUV A;  3UUN A;  5JRE A;  4YY3 T;  4GKJ T;  1E2A A;  4AKL A;  4PFP A;  3S4U A;  1LVK A;  2CLY C;  2ZM2 A;  4H9N C;  3KDS E;  5HCM A;  3ETU A;  4U31 A;  1MIV A;  3WI3 A;  1FEW A;  5HXH A;  2VUR A;  1ZHC A;  3JC6 D;  2YU2 A;  5L3G B;  1XNQ T;  1XMQ T;  3DP7 A;  1OED E;  4TWH A;  2NTY A;  5L3D B;  4IDZ A;  5ABH A;  2N1G A;  4BJN A;  2KND A;  3AEE A;  2UXD T;  2N9D A;  3ZYL A;  4DR5 T;  4EB6 E;  3MJX A;  3M65 A;  4ZS2 A;  3K3N A;  1BR0 A;  4DR6 T;  3B13 A;  1W0B A;  1U4Q A;  5HEU A;  3AE5 A;  3N9P A;  3RRW A;  3P4S A;  3J7Y q;  3N2K E;  3ZT6 A;  2HPL A;  4IRE A;  1CHU A;  3MA9 A;  2BS2 A;  3VR9 A;  2ES0 A;  2X0L B;  2V6Y B;  1N33 T;  4GIW A;  4DR2 T;  4AI6 A;  1KNP A;  5JR9 B;  2DHR A;  3CKD A;  3NVO A;  3RYC E;  2XQ4 A;  4O4L E;  5JRC B;  5JDQ A;  3C4Z A;  4TWD A;  1KFY A;  4PK5 A;  1SE7 A;  2LJL A;  4EZ4 A;  5LMU T;  4ANJ A;  2NOX A;  3ETV A;  1U5P A;  2C5I T;  4AKG A;  1HX8 A;  1X9B A;  2XAS B;  3SFE A;  3CVR A;  2YK0 A;  4WYV A;  3EAB A;  3ZN0 B;  2ZMA A;  1WRD A;  4HEA A;  2V7M A;  5F5W A;  5AQK B;  2CWY A;  1WR6 A;  3KBU A;  2Q9Q B;  3FHN A;  1YKE B;  3CX8 B;  4HFI A;  1IBK T;  2DLR A;  5ETW A;  4MLK A;  5LMN T;  4EZH A;  4AIU A;  4O2B E;  4ZXL A;  4ASK A;  4KHP T;  4BAY B;  3GMI A;  2NW9 A;  4EYU A;  2IML A;  2E8I A;  3TLT A;  3FZH B;  3RPU A;  2ZM6 T;  3LSV A;  3PTR B;  4OYJ A;  2VKJ A;  3B5M A;  4X20 E;  4YSY A;  2X66 A;  1MND A;  2XUE A;  3RC8 A;  3B57 A;  3F31 A;  4AQF C;  4P0A A;  3TLS A;  2LRK A;  3ONJ A;  3AEB A;  1B7T A;  5C3J A;  3L3P A;  1ZOY A;  2WU2 A;  2N2N A;  3VKG A;  3Q2M A;  4IE7 A;  3ZKR A;  1ZEE A;  2FUP A;  4DND A;  1X79 A;  3RH3 A;  3RKG A;  3QB5 K;  2V5C A;  1LKX A;  2BG9 B;  2W63 A;  2E5V A;  4DV2 T;  3A5X A;  3RI5 A;  4GK5 E;  5AQO B;  4A97 A;  3ANW A;  4C91 A;  2DL1 A;  5IWA T;  2NW8 A;  2CXD A;  3UFE A;  4QXH B;  4DUZ T;  5CFB A;  2MAW A;  4EIW A;  3FZL B;  1OED A;  2XQ5 A;  2X9X A;  2BG9 E;  1EZ3 A;  2PJQ A;  4LFC T;  4NIQ A;  4WZX A;  2MPK A;  2Y8D A;  3FZF B;  3GA8 A;  4L9I A;  5FMN A;  2RP4 A;  3AEA A;  5DJQ C;  4EOZ B;  4ZS3 A;  5TAO A;  3UU3 A;  4QX7 B;  5JTG A;  4IE4 A;  4Q25 A;  4YHH T;  5JQG E;  1VRB A;  3Q9D A;  5FVK A;  2WAU A;  5LHH B;  2K48 A;  2NTX A;  4WBO A;  4PJN A;  3O9X A;  2X68 A;  2BKN A;  4EAH A;  4U7I A;  5H6R B;  2DWK A;  2HH7 A;  3D0T A;  1UK5 A;  4JI7 T;  3AEF A;  3T1Y T;  4B3M T;  1S94 A;  4GYS A;  1J1J A;  3P4W A;  1W9R A;  2UUA T;  1I94 T;  2JJ9 A;  2K3W A;  3ZMU B;  4AQY T;  2A9U A;  3N9N A;  4LMJ A;  1YD8 G;  4ZI3 C;  4ZI2 C;  4QX8 B;  3ZMT B;  4IIJ E;  2CLY B;  4CXX A;  4PK6 A;  5JH7 E;  2V7K A;  2QVA A;  1WYC A;  4DV3 T;  2W4X A;  5JR9 A;  4PW8 A;  3NKZ A;  2LHN A;  2Y6X A;  4DID B;  3ONL C;  3L09 A;  4TX5 A;  4LFB T;  3RLF F;  3CX7 B;  4X5T A;  1I6Z A;  1VOM A;  4DV6 T;  2IUB A;  4JI2 T;  2YIN A;  1XWM A;  4YJ3 E;  1WR0 A;  4CI2 B;  2WBL A;  5FXZ A;  2ZLY A;  2FJA A;  5F8P A;  2LOS A;  3I0O A;  4I50 E;  3FZK B;  4PAG A;  1M7K A;  5EZY E;  2B1E A;  4WW0 A;  3U3I A;  4P09 A;  1HR0 T;  2WP9 A;  1QLB A;  4BJM A;  3UUB A;  2WY2 A;  5L4H A;  3ZJ2 A;  2IHR 1;  1MMD A;  1D0Y A;  1ZKE A;  4G63 A;  2VVS A;  2XQ7 A;  3O4X E;  1D1B A;  3NZP A;  4GK0 E;  5KX5 E;  4DBQ A;  2MTQ A;  2XZE A;  2SPC A;  1O3X A;  2QYW A;  4IE5 A;  1HNW T;  2CBI A;  2YDQ A;  3HKE E;  3N9M A;  1Z0P A;  5IHY A;  2JQK A;  2IIU A;  3IEE A;  5HYA A;  2JMK A;  3PUZ F;  3PE0 A;  3RQW A;  4IDP A;  4KMC A;  3N2O A;  3K3Q C;  4H9Q C;  3OKQ A;  2W62 A;  4TUY E;  3RQU A;  4ZI3 D;  4ZI2 D;  1JNZ A;  4ZHQ E;  3IA3 A;  1VCS A;  2BG9 A;  4X66 T;  2Y48 B;  2X0H A;  5AQF B;  1UX5 A;  3N9L A;  5J2U E;  2DI4 A;  4DR4 T;  3CK6 A;  3Q5X A;  3W15 B;  4LF8 T;  2YU1 A;  5FY7 A;  3RYH E;  2H7V C;  2Q9Q D;  2XTL A;  5AQS B;  4ADZ A;  2XJ7 A;  1QUU A;  2BS4 A;  3AAA B;  3ZLI A;  4H9O C;  5HEJ A;  3DJB A;  5F3J A;  3ZC1 A;  4TV8 E;  5FVL A;  3PU3 A;  3HL6 A;  5AQJ B;  5FP3 A;  4QKN A;  3OBV E;  5AQN B;  1W0A A;  1G8X A;  3BQL A;  2E9X C;  4U7Y A;  1T72 A;  3H3A A;  2PG8 A;  4MBQ A;  3RIF A;  1D1A A;  5LHI B;  2KMF A;  3O1J A;  4UIG A;  4LFA T;  3GN5 A;  4JI8 T;  4I55 E;  2W61 A;  3UUM A;  3MKD A;  2XQ8 A;  4E7Z A;  2CHO A;  2HPJ A;  2GK9 A;  2H3R A;  3SWH A;  2M6I A;  1E7P A;  5HEO A;  1NEN A;  1FMV A;  3K1S A;  2G0U A;  2CBJ A;  2ACX A;  3UQ7 A;  1H7C A;  4JI4 T;  4ILU A;  4TV9 E;  3ZYM A;  3MZK B;  2JQ9 A;  2EHO C;  2VL0 A;  3EVY A;  2BDE A;  3O1H A;  4MFR A;  3MK7 C;  5ABE A;  5CA1 E;  1JNR A;  2J62 A;  3UU4 A;  4YT0 A;  3KFW X;  3PJA A;  4YFS A;  1XMO T;  3AE6 A;  1MMA A;  1WCR A;  4X1K E;  4YHJ A;  2LEH A;  2CCQ A;  5JDM A;  3BK9 A;  3ZST A;  1N36 T;  3NRY A;  3KVA A;  3ZJ1 A;  4LF6 T;  3PUG A;  3KVB A;  1HCI A;  3UQ4 A;  5DQV A;  4OYK A;  1HX1 B;  2PFV A;  5KXJ A;  2YDS A;  3RIU C;  4A98 A;  3L39 A;  3DTO A;  2VVN A;  4IL9 A;  2CRB A;  4X1Y E;  4AKR B;  1XZY A;  5KDM C;  3CIR A;  3ZCJ A;  3OTO T;  4HWF A;  5H6Q B;  3V5S A;  1V9D A;  2RPA A;  3P4Q A;  2H7O A;  5LNK A;  3CWZ B;  3LG7 A;  1D1C A;  5AQR B;  4A5X A;  1E1H B;  4ILB A;  3FXD B;  4HE8 A;  5LGN B;  4HFV A;  4JI3 T;  4AXP A;  1LVF A;  3OYX A;  3CQG B;  1N32 T;  2VWA A;  1IJ6 A;  1FIO A;  3CQX C;  4M1P A;  1XDP A;  2VB6 A;  3AEG A;  4P1N A;  2F4V T;  3N9Q A;  2V7I A;  4GYR A;  4ILC A;  5HXC A;  2WCA A;  2XAQ B;  4L0R A;  2ZM0 A;  2DNX A;  3AXJ B;  2LSG A;  5LJN A;  2XQ3 A;  1HTJ F;  1UUR A;  3RRC A;  3Q5E A;  5LXT E;  2LSI A;  4TWF A;  3A7M A;  3GWH A;  4TNW A;  2JMH A;  3LK4 2;  4QH5 A;  2PBI A;  2KIN B;  4DV4 T;  2ZM8 A;  4XZC A;  4KUM B;  4DV0 T;  3TLV A;  1IAP A;  2UXC T;  4UVC B;  4JV5 T;  2L8K A;  4DVD A;  4UXN B;  1YW0 A;  2WDQ A;  3KV9 A;  2WMN A;  2E5L T;  1OXZ A;  4IE0 A;  4EYY R;  3M3Z B;  4IDQ A;  4J2C A;  4JI1 T;  3UTK A;  3ZT7 A;  5LGU B;  1MNE A;  2JQQ A;  3ZN1 B;  4UEM A;  4NUU A;  4X64 T;  5FXV A;  3VKH A;  5L2L A;  4AQF A;  2KZ7 B;  4IST A;  1MMN A;  2PTF A;  4YTN A;  3K8P C;  4HWC A;  4UV8 B;  4NPP A;  2LKH A;  3AA6 B;  2XQ6 A;  2WSS V;  4YTP A;  4K0U A;  4DR7 T;  2WDR A;  3EHZ A;  3H37 A;  2X9Y A;  3C4X A;  5LBQ B;  2JQH A;  2XQ9 A;  2ACZ A;  2LLY A;  2QRX A;  4UR9 A;  3TKL B;  4EGW A;  5LYJ E;  1HNZ T;  3AE4 A;  4JLE A;  2C0S A;  1XDO A;  4JI6 T;  5AFU L;  4KBM B;  3QC9 A;  1YKH B;  2BBH A;  1NEK A;  3Q5D A;  3CX6 B;  3C64 A;  2W2U A;  1SA0 E;  2CEA A;  2A2F X;  2FJD A;  4UEL A;  5FXX A;  4ZI7 E;  5ADX L;  1R8I A;  2LSJ A;  1KF6 A;  3RGL A;  2CXL A;  4X62 T;  3E08 A;  4PJJ A;  2E9X B;  1GQE A;  4LF9 T;  2LM9 A;  3FBL A;  5ABF B;  5AQV B;  2WZH A;  4PFO A;  2X51 A;  2KT9 A;  3OPC A;  3RKO A;  4HWI B;  4O2A E;  2LRL A;  2UXN B;  4EEB A;  1FMW A;  4NXM T;  3AVS A;  2K9A A;  1G73 A;  1YXR A;  4LF7 T;  3UU8 A;  2I0M A;  3VHL A;  4PJL A;  4YSZ A;  1KK7 A;  2V6Y A;  1YQ3 A;  3ZYK A;  3JAD A;  2M6B A;  4DMV A;  4XAX B;  4OK0 A;  3IBP A;  2X9H A;  5JDG A;  4LMK A;  4QH1 A;  5JRC A;  4YLH A;  2VQF T;  2WMO A;  3NWI A;  5JDL A;  2EHO B;  2WU5 A;  4KP3 C;  5AQG B;  2YDR A;  5L47 A;  2A3D A;  4IHJ E;  2UXX B;  3PUS A;  2LHR A;  2V1D B;  3G06 A;  2V8S V;  3ONX A;  5BR8 T;  3RHW A;  4OX9 T;  2IW5 B;  3AED A;  2L9Q A;  2W66 A;  4X65 T;  1VCT A;  5FYM A;  4QHO A;  2X9W A;  2Q9Q A;  2KLQ A;  3UT5 E;  1IBM T;  3ZEF B;  2LKG A;  4AQG A;  4U74 A;  1J5W A;  1MMG A;  4U33 A;  4UF0 B;  4CQI A;  3EAM A;  4CZZ B;  3KV4 A;  3Q5W A;  3IF8 B;  4HFC A;  2BS3 A;  5IUX A;  3E0Z A;  3LDQ B;  1HG5 A;  3I0Q A;  2UXB T;  4AKH A;  4FJO A;  2VKH A;  4AIS A;  4WBN E;  1XNR T;  3TLU A;  2JRK A;  4XBF B;  3P4P A;  2XAH B;  3N9O A;  3IHR A;  3PJA J;  2I59 A;  4IGU A;  2W0G A;  2A72 A;  4X1I E;  5A1L A;  1T8B A;  2JIW A;  2L3L A;  2VAS A;  3JC6 C;  5HEG A;  5FNV E;  2BZB A;  4E7S A;  2KXP B;  3FBZ A;  2J4G A;  2LSY A;  1US7 B;  2XAF B;  4YJ2 E;  1KNZ A;  3AEC A;  4KI0 F;  2B76 A;  1FJG T;  4I0U A;  2BVM A;  3KBT A;  4CI1 B;  5HXR A;  3UFG A;  4EV6 A;  4LF4 T;  1D0X A;  2M67 A;  5FKY A;  2CMR A;  3C4W A;  2VK9 A;  1S35 A;  4QWN B;  4O4H E;  4JYA T;  3RYI E;  2V7L A;  3R84 B;  3TLW A;  3QNU A;  2WM9 A;  2J47 A;  3KIN B;  5LG4 A;  2YOE A;  2VKD A;  3EDV A;  2XM1 A;  4JBW F;  3NRX A;  5DAB A;  2V6X A;  4Z90 A;  3RC3 A;  2P9B A;  1DU2 A;  2C5K T;  5LBM A;  2CE7 A;  1CUN A;  3QK6 A;  3ANW B;  2DWG A;  2CWO A;  2IC9 A;  2D2S A;  3AE8 A;  3CML A;  4TN7 B;  2YKS A;  3UUX B;  3F2E A;  2D0U A;  2E9X A;  4DR1 T;  1NAF A;  5L3B B;  2FJB A;  2UUC T;  5ABF A;  4IDO A;  1OWA A;  4N78 D;  4GOU A;  3FB2 A;  4H9S E;  3V5U A;  5AQI B;  3BQK A;  3LBX B;  4K0K T;  2FBW A;  5KMG P;  1SHZ C;  3P7I A;  5J2T E;  4V1A v;  3RIA A;  4OFZ A;  2NP9 A;  2LE8 A;  1D0Z A;  4Z8X A;  4C90 A;  3UUL A;  4LF5 T;  2K5B B;  2KWH A;  2JPF A;  2CPT A;  2R6G F;  4F6R C;  2ODU A;  1WLX A;  5LJM A;  2HHH T;  2EHO A;  4QXB B;  4Z91 A;  2WB5 A;  5CJ5 A;  1HS7 A;  5LCY A;  3VU7 H;  5AQQ B;  4NXN T;  3PUX F;  4DBR A;  1HF8 A;  4UVA B;  2MOZ A;  3OJA A;  3AAE B;  5HCJ A;  4WNK A;  4B3T T;  4O4J E;  2E9X D;  2WDV A;  3U78 A;  2XQA A;  3FZM B;  3MXZ A;  5IYZ E;  4ZEY A;  4U3C A;  3SS1 A;  4DV5 T;  4HGA A;  1KNR A;  3RIU A;  4UF0 A;  4JUY A;  4GKK T;  2V5D A;  5AQU B;  3I9Y A;  1IZN B;  3I9W A;  4MHC A;  1SUM B;  2ODV A;  2WZI A;  4HFH A;  4IE6 A;  3KV6 A;  3P4R A;  3WAK A;  2IC6 A;  4DR3 T;  4ZZC A;  2DCF A;  2YEV C;  5CB4 E;  3QOF A;  5AQP B;  3A8Y C;  3HKC E;  4I4T E;  2LSK A;  2XAJ B;  2XM2 A;  4KHZ F;  3OVU A;  2UU9 T;  4PJM A;  2EHO D;  5J1G A;  5LP6 E;  4ZOL E;  3SRZ A;  3EI0 A;  2D9D A;  4HWH A;  4H9R C;  4FI5 A;  2WWV A;  2VKO A;  3F57 A;  1MIY A;  2W00 A;  3AB3 B;  3JCF A;  4CI3 B;  4IDN A;  4DMW A;  5CGM A;  2UUB T;  1NWM X;  2I6H A;  3K3O A;  4HWD A;  3ABV A;  1YQ4 A;  4IL4 A;  2H88 A;  2LOP A;  1LRZ A;  5HEH A;  4ILA A;  1Y01 A;  2NWB A;  5FL1 A;  2WS3 A;  5C2T A;  3EDU A;  2X0Y A;  3HKB E;  2XSA A;  2IAK A;  1OED C;  3AAI A;  5C8Y E;  3C51 A;  4YSX A;  4O4I E;  3ZMZ B;  3ZC0 A;  4DV7 T;  4ISS A;  2E2A A;  2K24 A;  2QGS A;  3E22 E;  3C98 B;  2AXD S;  2WWU A;  4HFD A;  4QXC B;  4JI0 T;  2XHE B;  3RX6 A;  4U2Z A;  3UU5 A;  1HNX T;  4H63 H;  5GON E;  3P50 A;  3AE2 A;  1J5E T;  3WAJ A;  2D5U A;  2XPK A;  5L3E B;  5L3F B;  2NW7 A;  3QUJ A;  4IT4 A;  3J9X 1;  3ZCI A;  1ZV4 X;  3LBX A;  4UVB B;  3FXE B;  3CPZ A;  4P0B A;  1BR1 A;  5JDN A;  3T8O A;  5EK2 A;  5ABG A;  2OV9 A;  1MIW A;  2CHN A;  3SFD A;  5HXE A;  3AA0 B;  3I1A A;  1IBL T;  3GN5 B;  4HN9 A;  5AQL B;  3L8R A;  2MBG A;  3PU8 A;  2Z6E A;  3PDY A;  4BA9 A;  4I43 B;  2CM0 A;  4HTE A; 
#chains in the Genus database with same CATH homology
 1QSD A;  3GMI A;  3KFW X;  4YFS A;  2L3L A;  2VAS A;  3JC6 C;  2NW9 A;  4EYU A;  2BVL A;  2E8I A;  5FNV E;  1MMA A;  4CXY A;  4X1K E;  4YHJ A;  2LEH A;  2CCQ A;  5JDM A;  5JR9 C;  3RPU A;  4A56 A;  3BK9 A;  2VL8 A;  3PTR B;  4ERR A;  2BZB A;  4E7S A;  3NRY A;  4OYJ A;  4G2A A;  4PK4 A;  2KXP B;  3KVA A;  3ZJ1 A;  2VKJ A;  2KWI B;  3FBZ A;  4X20 E;  2LSY A;  3PUG A;  1US7 B;  2XAF B;  3KVB A;  2X66 A;  1MND A;  2XUE A;  4YJ2 E;  3RC8 A;  1HCI A;  3B57 A;  3F31 A;  4AQF C;  4P0A A;  1KNZ A;  1AJ3 A;  3P8C D;  5DQV A;  1B7T A;  4OYK A;  2BVM A;  3KBT A;  4CI1 B;  5HXR A;  2PFV A;  2V26 A;  3L3P A;  3ZMV B;  2N2N A;  3VKG A;  3Q2M A;  5BMV E;  3BQI A;  4IE7 A;  1D0X A;  2M67 A;  2CMR A;  1ZEE A;  3DTO A;  3C4W A;  2VK9 A;  4DND A;  1S35 A;  1X79 A;  5JDH A;  4QWN B;  4X1Y E;  4AKR B;  2XAG B;  3RH3 A;  5KDM C;  4O4H E;  2D0T A;  5JDF A;  3ZCJ A;  3RYI E;  1BR4 A;  2V7L A;  3R84 B;  5HWY A;  3PUR A;  1LKX A;  5H6Q B;  2WM9 A;  3V5S A;  1V9D A;  4MAL A;  2W63 A;  2H7O A;  1UX4 A;  2Q9Q C;  1T98 A;  3A5X A;  3EUH A;  4GK5 E;  5LNK A;  4C91 A;  3ANW A;  3KIN B;  5LG4 A;  3CWZ B;  3HR0 A;  2NW8 A;  2CXD A;  3LG7 A;  3UFE A;  5M4Y A;  3KV5 A;  2VKD A;  1D1C A;  4QXH B;  3O1I A;  3EDV A;  1E1H B;  4EIW A;  3NRX A;  5HXS A;  3FXD B;  4HE8 A;  5LGN B;  2X9X A;  3RYF E;  4HFV A;  5DAB A;  3RC3 A;  5CA0 E;  3AA7 B;  4AXP A;  1EZ3 A;  1LVF A;  2P9B A;  3OYX A;  2PJQ A;  3CQG B;  2C5K T;  5LBM A;  2VWA A;  3HI2 A;  2CE7 A;  1CUN A;  3QK6 A;  2Y8D A;  1IJ6 A;  4TZ4 C;  3ANW B;  1FIO A;  2DWG A;  4PNI A;  2CWO A;  2IC9 A;  2D2S A;  3CQX C;  3CQC B;  5DQW A;  1UCU A;  3GA8 A;  4L9I A;  4M1P A;  1Y64 B;  5FMN A;  3CML A;  2RP4 A;  4TN7 B;  5DJQ C;  2VB6 A;  3UUX B;  3F2E A;  4EOZ B;  4ZS3 A;  2MYS A;  3ZPO A;  2D0U A;  2E9X A;  3AVR A;  3N9Q A;  2V7I A;  4GYR A;  5HXC A;  3PUA A;  1NAF A;  2XAQ B;  5L3B B;  4L0R A;  5TAO A;  2ZM0 A;  1OWA A;  2DNX A;  4QX7 B;  2LSG A;  4N78 D;  1BR2 A;  4IE4 A;  3LK2 B;  4GOU A;  5LJN A;  3FB2 A;  4H9S E;  3V5U A;  5JQG E;  1HTJ F;  1VRB A;  1WYB A;  3Q9D A;  2C5J A;  3BQK A;  2WAU A;  3LBX B;  5LHH B;  3LJC A;  3RRC A;  2K48 A;  3SOL A;  2NTX A;  4WBO A;  5LXT E;  4PJN A;  2LSI A;  5KMG P;  4JEU B;  1SHZ C;  3O9X A;  2X68 A;  3P7I A;  4HKA A;  5J2T E;  3GWH A;  2V7J A;  3LFM A;  4V1A v;  4EAH A;  3MAC A;  4OFZ A;  2NP9 A;  5H6R B;  2DWK A;  5FY1 A;  2HH7 A;  2JMH A;  3LK4 2;  2LE8 A;  3D0T A;  1D0Z A;  4JEH B;  2PBI A;  2QA7 A;  4Z8X A;  2KIN B;  2ZM8 A;  4C90 A;  4XZC A;  3UUL A;  2K5B B;  2KWH A;  3C50 A;  4DO0 A;  2CA5 A;  5L3C B;  4KUM B;  2JPF A;  1IAP A;  4CXW A;  4OHF A;  4UVC B;  4UV9 B;  4F6R C;  2J1D G;  1S94 A;  2ODU A;  4GYS A;  2L8K A;  3N2G E;  4UXN B;  1YW0 A;  5EK4 A;  1WLX A;  2OA5 A;  5FY0 A;  5LA6 E;  4DVD A;  2JJ9 A;  5LJM A;  3ZMU B;  3KV9 A;  2WMN A;  3N9N A;  4B6X A;  4L5G A;  2LT3 A;  3HKD E;  2EHO A;  4QXB B;  1OXZ A;  2CXF A;  1YD8 G;  4IE0 A;  4EYY R;  3NBX X;  4ZI3 C;  4ZI2 C;  4QX8 B;  3ZMT B;  3OYZ A;  1HS7 A;  4IIJ E;  2CLY B;  4CXX A;  3AA1 B;  4PK6 A;  5LCY A;  4J2C A;  5JH7 E;  3VU7 H;  2V7K A;  3UTK A;  1WYC A;  4DBR A;  5JR9 A;  4PW8 A;  1HG2 A;  1HF8 A;  4UVA B;  5LGU B;  2LHN A;  2Y6X A;  1MNE A;  5LHG B;  2JQQ A;  3ZN1 B;  2MOZ A;  4UEM A;  3L09 A;  4TX5 A;  3OJA A;  3AAE B;  4NUU A;  5FXV A;  1HFA A;  4H63 V;  4WNK A;  3VKH A;  5L2L A;  4AQF A;  2KZ7 B;  3CX7 B;  4O4J E;  4IST A;  2E9X D;  1MMN A;  4H9P C;  1VOM A;  5HWX A;  1IJ5 A;  3U78 A;  3LK3 B;  3MXZ A;  2YIN A;  5IYZ E;  3K8P C;  3NZQ A;  2RA1 A;  5LGT B;  4UV8 B;  3R6N A;  4YJ3 E;  3SS1 A;  2XQY A;  3AA6 B;  4HGA A;  4CI2 B;  2WBL A;  4UF0 A;  5EK3 A;  5FXZ A;  4JUY A;  2ZLY A;  2WSS V;  4K0U A;  3N5L A;  3I9Y A;  5JVD E;  1IZN B;  3I9W A;  3H37 A;  3ZMS B;  4MHC A;  5F8P A;  2ODV A;  4U72 A;  5FXW A;  2X9Y A;  4IE6 A;  3C4X A;  5LBQ B;  3KV6 A;  2LOS A;  3ESL A;  3WAK A;  3I0O A;  4I50 E;  5LOV E;  3PUQ A;  2IC6 A;  4PAG A;  5EZY E;  2X67 A;  3TKL B;  2DCF A;  2YEV C;  5CB4 E;  5LYJ E;  2B1E A;  4WW0 A;  3HA4 A;  4O8S A;  3U3I A;  4P09 A;  4AKI A;  4JLE A;  4BJM A;  2C0S A;  5HAX A;  3HKC E;  5AFU L;  3ZJ2 A;  4EXT A;  4I4T E;  1MMD A;  4KBM B;  1D0Y A;  3QC9 A;  1YKH B;  2LSK A;  1ZKE A;  2XAJ B;  4G63 A;  5E0O A;  4NUV A;  3UUN A;  5JRE A;  4AKL A;  4PFP A;  3CX6 B;  3O4X E;  1D1B A;  4PJM A;  3C64 A;  3NZP A;  3S4U A;  4GK0 E;  2EHO D;  5J1G A;  1LVK A;  2CLY C;  5KX5 E;  1SA0 E;  2CEA A;  2A2F X;  2ZM2 A;  4H9N C;  4DBQ A;  5LP6 E;  2MTQ A;  3KDS E;  3ETU A;  4ZOL E;  3SRZ A;  2SPC A;  1MIV A;  4UEL A;  5FXX A;  1O3X A;  4ZI7 E;  5ADX L;  2LSJ A;  1FEW A;  4IE5 A;  3WI3 A;  5HXH A;  1ZHC A;  3JC6 D;  2YU2 A;  5L3G B;  2CXL A;  3DP7 A;  3E08 A;  4PJJ A;  2E9X B;  4H9R C;  2NTY A;  4FI5 A;  2VKO A;  3F57 A;  2LM9 A;  3FBL A;  5L3D B;  3HKE E;  1MIY A;  4IDZ A;  2W00 A;  4PFO A;  2X51 A;  2N1G A;  2KT9 A;  3RKO A;  3AB3 B;  4CI3 B;  4BJN A;  4DMW A;  3N9M A;  4O2A E;  2KND A;  1Z0P A;  5IHY A;  1NWM X;  2UXN B;  1FMW A;  3K3O A;  2N9D A;  3ZYL A;  3IEE A;  5HYA A;  4EB6 E;  2JMK A;  3MJX A;  3PE0 A;  3AVS A;  3M65 A;  4ZS2 A;  2K9A A;  1G73 A;  4KMC A;  3K3N A;  3N2O A;  2LOP A;  1BR0 A;  1LRZ A;  3K3Q C;  4H9Q C;  3OKQ A;  2W62 A;  4TUY E;  4ZI3 D;  4ZI2 D;  3VHL A;  4PJL A;  3B13 A;  1KK7 A;  4ZHQ E;  1U4Q A;  3ZYK A;  2NWB A;  3EDU A;  2Y48 B;  4DMV A;  1UX5 A;  4XAX B;  4OK0 A;  3N9L A;  5J2U E;  2DI4 A;  3N9P A;  3IBP A;  3HKB E;  3RRW A;  3Q5X A;  3W15 B;  3J7Y q;  2X9H A;  2IAK A;  5JDG A;  2YU1 A;  3AAI A;  3N2K E;  5FY7 A;  5C8Y E;  3RYH E;  5JRC A;  2H7V C;  2Q9Q D;  3C51 A;  4YLH A;  2HPL A;  4O4I E;  3ZMZ B;  3ZC0 A;  2WMO A;  5JDL A;  2XTL A;  4ISS A;  4ADZ A;  1QUU A;  2EHO B;  3AAA B;  3ZLI A;  3MA9 A;  4KP3 C;  2K24 A;  4H9O C;  2QGS A;  3E22 E;  3C98 B;  3DJB A;  5F3J A;  3ZC1 A;  2WWU A;  2A3D A;  2ES0 A;  2X0L B;  4QXC B;  4TV8 E;  2XHE B;  3PU3 A;  3HL6 A;  4IHJ E;  4GIW A;  3RX6 A;  2UXX B;  3PUS A;  4AI6 A;  2LHR A;  2DHR A;  2V1D B;  3CKD A;  5FP3 A;  5JR9 B;  4H63 H;  5GON E;  4QKN A;  3OBV E;  3RYC E;  1G8X A;  3ONX A;  3BQL A;  2E9X C;  4O4L E;  5JRC B;  5JDQ A;  3C4Z A;  2IW5 B;  2L9Q A;  4PK5 A;  3H3A A;  2PG8 A;  2LJL A;  5FYM A;  4MBQ A;  4QHO A;  3WAJ A;  2X9W A;  4EZ4 A;  2D5U A;  1D1A A;  2Q9Q A;  2KLQ A;  3UT5 E;  4ANJ A;  2NOX A;  5L3E B;  3ETV A;  1U5P A;  5L3F B;  5LHI B;  3ZEF B;  2NW7 A;  2KMF A;  3O1J A;  3QUJ A;  4AQG A;  4U74 A;  4UIG A;  1MMG A;  2C5I T;  3J9X 1;  3ZCI A;  3GN5 A;  4AKG A;  4I55 E;  1HX8 A;  4UF0 B;  2W61 A;  2XAS B;  3UUM A;  4CQI A;  3CVR A;  1ZV4 X;  2YK0 A;  3LBX A;  3MKD A;  4UVB B;  3FXE B;  4CZZ B;  3KV4 A;  3Q5W A;  3CPZ A;  3ZN0 B;  2ZMA A;  4E7Z A;  3IF8 B;  1WRD A;  4P0B A;  2HPJ A;  4HEA A;  2V7M A;  1BR1 A;  3E0Z A;  2GK9 A;  2H3R A;  3SWH A;  5JDN A;  3T8O A;  2CWY A;  5EK2 A;  1HG5 A;  1WR6 A;  3I0Q A;  3KBU A;  2Q9Q B;  3FHN A;  4AKH A;  1FMV A;  1YKE B;  4FJO A;  2G0U A;  3CX8 B;  2VKH A;  1MIW A;  2ACX A;  1H7C A;  5HXE A;  3AA0 B;  4WBN E;  4XBF B;  2JRK A;  2DLR A;  3I1A A;  4ILU A;  5ETW A;  4TV9 E;  3ZYM A;  3MZK B;  2XAH B;  3N9O A;  3GN5 B;  4HN9 A;  2EHO C;  4MLK A;  3IHR A;  3EVY A;  2MBG A;  2BDE A;  3O1H A;  4EZH A;  3PU8 A;  4MFR A;  3MK7 C;  5CA1 E;  2Z6E A;  2I59 A;  3PDY A;  4BA9 A;  4IGU A;  4O2B E;  2W0G A;  4ASK A;  2A72 A;  4X1I E;  4I43 B;  2CM0 A;  5A1L A;  4BAY B;  4HTE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...