1WRDA

Crystal structure of tom1 gat domain in complex with ubiquitin
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
98
structure length
98
Chain Sequence
GPLGSEQIGKLRSELEMVSGNVRVMSEMLTELVPTQAEPADLELLQELNRTCRAMQQRVLELIPQIANEQLTEELLIVNDNLNNVFLRHERFERFRTG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural basis for recognition of ubiquitinated cargo by Tom1-GAT domain.
pubmed doi rcsb
molecule keywords Target of Myb protein 1
source organism Homo sapiens
molecule tags Protein transport/signaling protein
total genus 39
structure length 98
sequence length 98
ec nomenclature
pdb deposition date 2004-10-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03127 GAT GAT domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.160 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 1wrdA00
1YD8G 1WRDA 1O3XA 2N9DA 2N2NA 1NAFA 1WR6A 1NWMX 1X79A 1OXZA
chains in the Genus database with same CATH superfamily
5FL0A 2OV9A 3LK3B 3HI2A 3PUZF 4ZI2C 4DV2T 4HWFA 3OPCA 4YTPA 5F3JA 2QRXA 3A7MA 1YQ3A 4UV8B 4JYAT 3DTOA 2R6GF 2UUCT 1IAPA 2V1DB 4IE7A 2X0HA 4HTEA 3TLUA 4I55E 2RP4A 3K3OA 2LSKA 2CLYC 4DMVA 5L3GB 4BJMA 2WZIA 5AQLB 1XNRT 4V1Av 1WRDA 3U3IA 4CZZB 4U33A 1N33T 3GA8A 2JIWA 4ILCA 3RHWA 2CBJA 2J1DG 2N9DA 4O2AE 4HFBA 3FZFB 1X9BA 2V5CA 5EK2A 1J1JA 5HCJA 1MMAA 2LRLA 2QYWA 3OBVE 4EV6A 3AEBA 3ONXA 5JDHA 1WYBA 2WU5A 5AQIB 3S4UA 2XQ8A 4DO0A 1W0AA 2DWGA 3SFDA 3PUGA 4EEDA 3TLSA 2XQ4A 5LMNT 4MALA 3RQUA 4QWNB 2V7LA 4IDPA 1X79A 2JRKA 3O1IA 5HWXA 3MA9A 5JREA 1OEDB 4KUMB 2A2FX 3CWZB 3K8PC 1QLBA 2UXCT 4H9QC 3UTKA 3EDVA 4X1KE 3ZMZB 5AQSB 2EHOA 4KX6A 1BR2A 5FXVA 3RQWA 5JDQA 1DU2A 2LHNA 4A5XA 2X66A 2BKNA 3IF8B 1D0ZA 2BVMA 1UURA 4OFZA 2CWYA 2BKPA 3CQGB 3AAEB 4CXWA 3RYIE 3FXEB 2CCQA 2KZ7B 3WI3A 2IC9A 5JDGA 5L4HA 3PUAA 4L9IA 5TAOA 3ANWA 5LOVE 3R6NA 1U5PA 3CK6A 1WCRA 4H9RC 2RPAA 2BBHA 5LBMA 4ADZA 5LXTE 3JCFA 5HEOA 2DCFA 2C5IT 3SWHA 3AE2A 2XQ3A 2A9UA 3UU6A 4YSYA 2WWUA 3N2OA 4IDNA 1IBMT 4EB6E 1LRZA 2NTYA 4QH1A 3AECA 2M6IA 1LKXA 2J4GA 3NWIA 1OEDE 4GIWA 3RKGA 4IE4A 3AVRA 2XJ7A 3H37A 4HGAA 4CN1A 3D0TA 4DBQA 2FJDA 3RYCE 3FB2A 2ZMAA 3OJAA 5IUXA 2XHEB 1MMDA 4U74A 2YDQA 5ABGA 2WAUA 2LSYA 2LSIA 3UQ4A 1HG5A 4YJ2E 2UXXB 4MLKA 4A98A 2LJLA 5JVDE 4UF0B 3ZT6A 4PJJA 2LT3A 4TWHA 3TLVA 5J2UE 4LFCT 4QX8B 3UUBA 4BJNA 2G0UA 2W66A 4DUZT 4XBFB 2M6BA 3K3NA 3PUQA 5JDNA 3PE0A 4B6XA 5HYAA 2IUBA 4GYSA 3JADA 4UVBB 4PJMA 1HCIA 4F6RC 1HG2A 3BQKA 1HNWT 4ISTA 3B13A 4AKIA 4U31A 1GQEA 3BQIA 3F31A 4PK5A 3UUXB 4C90A 2A72A 4EIWA 3CPZA 3F2EA 5IWAT 5CGMA 2Y8DA 2H3RA 1HNZT 5HXRA 4O8SA 3BK9A 3J7Yq 3C4ZA 3CKDA 4JI4T 2JJ9A 5CA1E 4LMKA 1T98A 4ISSA 2C0SA 3P4WA 1XDOA 5HXHA 3RRCA 2ES0A 3N9LA 3PV0F 3H3MA 3HKDE 2E9XA 3LJCA 2BKOA 5LGNB 5ABFB 3GWHA 2K3WA 1I6ZA 3N9QA 5AQHB 4DUYT 2K24A 3EABA 3PUSA 2ZM2A 3X1DA 4E7ZA 4WYVA 3QB5K 3O1HA 4TNVA 4FJOA 3DP7A 1HNXT 2W0GA 4EYUA 3I0QA 2ZLYA 4DV6T 4DR7T 3CX6B 3EAMA 2IW5B 1J5WA 1R8IA 5E0OA 2LKHA 4CI3B 4EZHA 4X65T 3P4PA 4HFVA 3LK42 2Q9QA 4IDZA 2NWBA 4X66T 5HXSA 4DV3T 4O4HE 4QX7B 4GK0E 1SA0E 3AE3A 4EEBA 4KHPT 2PG8A 3FBLA 2XPKA 2BG9C 2DWKA 3JAFA 2H7VC 4HWDA 2VURA 2E8IA 1D0YA 2CRBA 4EZ4A 2WDQA 1IJ6A 2B76A 5FVKA 3AEFA 2MOZA 2Y48B 3RIUC 1YW0A 2GK9A 2WBLA 2XQ9A 1JNRA 2CBIA 1FJGT 5AQKB 2XAFB 4H9OC 5CB4E 4EGWA 2CWOA 4OHFA 2I0MA 4YFSA 4BAYB 4I0UA 5FYMA 3PJAJ 1KNPA 3PURA 4JI7T 3PDYA 2IAKA 3AA1B 2V7KA 5JR9C 3FZLB 4AKLA 2V7MA 3RIAA 1FMVA 4EAHA 2X51A 4QHOA 1I94T 2YN6A 3VRBA 4JI6T 5A1LA 3RIUA 3AEAA 5AQJB 4PAGA 4LMJA 3RX6A 2N2NA 4Q25A 3MZKB 3RYHE 4OK0A 5LP6E 4ZZCA 3IEEA 4ERRA 4LF7T 3M3ZB 2BS4A 2LEHA 1UCUA 4X1YE 4LMLA 4TUYE 2N1GA 2VASA 2EHOB 2KXPB 3C98B 3AB3B 3Q9DA 3P4SA 4JEUB 5JR9A 4AKGA 1KNRA 2JQKA 3AE7A 4DR5T 4ANJA 3I9YA 4J2CA 5LHHB 4IGUA 5AFUL 2H89A 4PW8A 4TV9E 2WMNA 1VRBA 1FEWA 3AAIA 2CXDA 3ZC0A 2M67A 2V8SV 5KMGP 1YKHB 2PFVA 1NWMX 4P0BA 3PU3A 5DJQC 2MYSA 2WDVA 4WW0A 3ANWB 4U2ZA 5FXXA 4CI2B 3AE4A 4KI0F 3N9MA 3ZSSA 2WS3A 3JC6D 3QNUA 3RKOA 1QSDA 3Q5XA 2VWAA 3C4XA 3MXZA 4XZCA 3RRWA 2D0UA 2XSAA 3IA3A 1SHZC 4GYRA 4PK4A 5LA6E 4JLEA 3GN5A 3SRZA 1ZKEA 2XAQB 4X62T 2E5LT 2C5JA 5AQVB 1VCSA 3VHLA 2KWHA 3B57A 5LHIB 5JDFA 4DR2T 5LB7B 2X0LB 4TX5A 4H63H 4A56A 4UV9B 2XQ6A 2W67A 4TNWA 4DV5T 2CHOA 3QB5A 1XZYA 4YLHA 2VQFT 3KVBA 3A5XA 1L0VA 3UFGA 3PUWF 3FBZA 3VR8A 5HEGA 4ILBA 2LOSA 4IIJE 4ILAA 3KV9A 5KX5E 3N2KE 2WDRA 3E0ZA 1MIWA 2I59A 4QXHB 4NIQA 1IZNB 5L47A 2W62A 3U78A 4OX9T 4CN6A 3UU5A 3AA6B 2HHHT 2ZM6T 5GONE 4N78D 4U7IA 2VK9A 4CXYA 2UU9T 2V26A 2EHOD 2YDRA 4DV1T 3K3QC 4KMCA 2DHRA 3N9OA 4C91A 3VKGA 4HFIA 2UXDT 1W9RA 4LF8T 4YXDA 5EZYE 1MIYA 4ZEYA 4PJLA 1M62A 4AQYT 3MKDA 2VL8A 3OVUA 4BA9A 2HH7A 4JI0T 1CUNA 2HPLA 2V6YA 2MBGA 5F8PA 2WMOA 1MIVA 3F57A 5AQMB 1E7PA 3HKBE 2MPKA 5H6QB 2E9XB 5JQGE 2YU1A 4DIDB 3CQCB 4PFPA 4AKHA 3AVSA 2FJAA 4IL9A 4CN4A 1UUSA 1SE7A 4JI2T 3LG7A 3UU3A 3R84B 3MJXA 3ZLIA 3RPUA 3J9X1 5AQOB 1KNZA 4DR1T 5AQUB 1YD8G 5L3DB 1XNQT 2UUBT 5FNVE 5J1GA 1Z0PA 1FMWA 3OKQA 2VVNA 4GOUA 1CHUA 2Y6XA 4YHHT 2HN1A 2JQQA 5L2LA 3OYZA 2WB5A 4YTMA 4Z8XA 4IE6A 2LOPA 2Q9QB 5CFBA 1OWAA 2BZBA 3HL6A 1WR6A 4IE5A 3PUYF 4QKNA 3B5MA 5HXCA 2WU2A 3TLWA 4X1IE 4UXNB 3HKCE 4DBRA 4AI6A 3N2GE 3OYXA 5FXZA 3ZN0B 4LF6T 4DR6T 3E08A 4TN7B 3QUJA 4ZZBA 5HXEA 3IHRA 3LK2B 3L3PA 4KHZF 4IDQA 2XM1A 2VL0A 1B7TA 3WAKA 3ONJA 5IHYA 3EHZA 5DQWA 5ADXL 2FBWA 1U4QA 3FZKB 2LKGA 2XTLA 2LLYA 2LSGA 3CX7B 3AXJA 2H88A 2SPCA 5C2TA 3FXDB 3FZHB 2NW7A 2WM9A 1HF8A 4I4TE 2KT9A 3ZT5A 3O4XE 2CEAA 4NUUA 4B3MT 2X9WA 1MNDA 4ZI3D 2YDSA 4P0AA 2XQ5A 5LG4A 4O4IE 2XQYA 3LDQB 5HEHA 5LJMA 2JQHA 2ZM8A 5CJ5A 1ZEEA 4PFOA 2CXFA 3HKEE 3P4RA 4TWDA 1QUUA 3NVOA 3VKHA 2WSSV 4HFEA 4PK6A 3V5UA 4HWIB 3ETUA 5BR8T 3UU8A 1YKEB 5JRCA 3VU7H 1S94A 3I9WA 5JR9B 4JI5T 5FY7A 4ASKA 3CQXC 2L8KA 3KFWX 2V6XA 5LBQB 3ZCJA 1WFDA 2X9YA 5F5WA 3A8YC 4U7YA 2E5VA 3DJBA 3L39A 2JQ9A 1Y64B 2W4XA 2X9HA 3ZC1A 4HN9A 4AKRB 4MHCA 1V9DA 2MAWA 3VR9A 1NEKA 4G63A 1HFAA 3QC9A 5EK4A 2MTQA 3LSVA 3C50A 3AAAB 3KV6A 2W00A 5LNKA 5L3BB 1N36T 5DABA 5J0ZA 2CA5A 4X20E 1W0BA 3C4WA 5LGUB 2X67A 3RLFF 4GK5E 3BQLA 1SUMB 4JUYA 2K5BB 2BG9A 5EK3A 5LMUT 3GN5B 4PJNA 5L4EA 1ZHCA 4JI1T 4H9NC 4IE0A 4JBWF 4PNIA 4KBMB 5KXJA 3FZMB 2IIUA 2CLYB 3KINB 4DNDA 4UR9A 1KF6A 1W09A 1VCTA 3ESLA 4AQFC 3N9NA 3ZYKA 2L9QA 3JC6C 5C3JA 1Y01A 2LSJA 2E2AA 3PU8A 3L8RA 4KP3C 2P9BA 4HFDA 4ZHQE 3ZEFB 4WBNE 2AE9A 1E1HB 1NENA 5AQRB 3V5SA 2VKJA 2BS2A 2ODVA 4CXXA 3HR0A 2C5KT 1IJ5A 2X0YA 3ETVA 4P1NA 3TLTA 4YSZA 5DQVA 2LHRA 4EOZB 3RYFE 4AQGA 4COFA 3CIRA 1ZOYA 1MMNA 4UIGA 3P7IA 5HWYA 3ZMTB 3EUHA 1ZV4X 1LVKA 3ZJ1A 2DI4A 2CPTA 2KNDA 4UVCB 5LJNA 3JAEA 4DV0T 4L5GA 3PTRB 3TKLB 2WP9A 3ZPOA 4U3CA 2V6YB 2OA5A 4OYKA 5HCMA 3LBXA 5ETWA 3PUXF 4U72A 5HAXA 2KINB 4IREA 4CQIA 1D1BA 5KDMC 1J5ET 3AE8A 2JMHA 2LM9A 2YKSA 2J47A 3UUNA 2BBJA 2KMFA 3QOFA 2EHOC 3P8CD 2YOEA 4O2BE 2VB6A 5JTGA 3PUVF 2XUEA 2KSRA 2YU2A 2QA7A 4LFBT 5L3EB 4P09A 2PBIA 4NUVA 4ZI2D 4YSXA 1N34T 3UT5E 4M1PA 5L3CB 3L09A 1HR0T 2HN2A 2Z6EA 3NRYA 2D0TA 5AQNB 1HX8A 1KFYA 4UELA 5J2TE 3CMLA 4MFRA 2JMKA 1M7KA 2VKOA 2NP9A 3ZMVB 4TZ4C 4WNKA 4ZOLE 3FHNA 5AQGB 4U2YA 2WQYA 5LYJE 5LGTB 2YEVC 3I1AA 4B3ST 1HTJF 2J62A 1VOMA 5JDLA 2IC6A 1BR4A 4DR3T 3EI0A 3M65A 3NZQA 2VVSA 2V5DA 3RC8A 3QK6A 1T8BA 5IYZE 5HEUA 1S35A 4DMWA 2CHNA 2XQAA 2YINA 3KBUA 1G8XA 2JPFA 3AXJB 2YK0A 4X5TA 4I43B 5FP3A 2WCAA 1OEDC 2NR4A 4EYYR 5AQPB 1AJ3A 3WAJA 2ODUA 3ONLC 2NW9A 4WZXA 3CVRA 4QXCB 3NZPA 4HFHA 1IBLT 1UGOA 4A97A 3RIFA 2WY2A 3RH3A 5JH7E 2KLQA 4WBOA 3ZJ2A 3AE6A 2CM0A 1KEYA 3GMIA 2IDOB 1Z8UA 4FI5A 2ACXA 3MACA 5FY0A 1YXRA 1XDPA 2XAHB 1OEDA 5JRCB 2DNXA 2W61A 3P50A 1UK5A 1EZ3A 4L0RA 1N32T 2VKDA 4ZI3C 2A3DA 3T1HT 1G73A 4AXPA 2AXDS 5M4YA 4LF5T 1H7CA 3KBTA 2D9DA 2V7IA 2DL1A 2UUAT 2LM2A 2XAJB 4AIUA 2L3LA 3LFMA 5AQFB 2IMLA 3OTOT 3K1SA 4Z90A 1LVFA 2VKHA 4F8HA 4YY3T 4QH4A 1T72A 3NRXA 3E22E 4JV5T 5FMNA 2NTXA 5LG3A 4QH5A 4B3TT 3RI5A 5LCYA 5HEJA 2KWIB 1UX5A 4H63V 4B3RT 3IBPA 2K9AA 2E9XC 5L3FB 4O4LE 2RA1A 1FIOA 1UX4A 2OLTA 4HE8A 2XAGB 3Q2MA 1NAFA 2W63A 3ZT7A 4ZI7E 3ZKRA 2UXBT 3KV5A 2XM2A 2XY8B 4DVDA 5C8YE 3ZCIA 2QVAA 2X9XA 2BG9B 5AQTB 2XQ7A 5FVLA 4LF9T 4HWHA 4ILUA 2H7OA 4H9SE 4IT4A 3Q5EA 4QXBB 4O4JE 3T1YT 1MNEA 1WLXA 2D5UA 2Q9QC 4IDOA 3AA0B 2DLRA 2IHR1 2XSBA 2UXNB 3Q5DA 4IL4A 3SS1A 1D1AA 3SFEA 3EDUA 1IBKT 3ZMUB 3ZSTA 1WR0A 3N9PA 4K0KT 4I50E 4ZS2A 2X68A 2FJEA 3RC3A 4OYJA 2NW8A 2E9XD 3AE1A 5FY1A 1D0XA 4DV4T 2BVLA 3P4QA 4YTNA 2CE7A 2PTFA 4UVAB 3O1JA 4HFCA 4ZS3A 3ZYLA 5FL1A 1MMGA 1XMQT 1O3XA 1D1CA 4DV7T 1KK7A 4E7SA 4UF0A 4YJ3E 1HX1B 3KV4A 4NXNT 2F4VT 3VRAA 5H6RB 4HKAA 3O9XA 4TV8E 4TWFA 5AQQB 1BR0A 3NBXX 4EXTA 4K0UA 4YT0A 2W2UA 4UEMA 3RGLA 2V7JA 5FXWA 2Q9QD 4JEHB 3C51A 4IHJE 2FUPA 2XZEA 4AISA 3UU4A 3AEEA 5BMVE 2BG9E 5LHGB 2ACZA 5JDMA 2LE8A 1WYCA 5ABEA 2ZM0A 3KVAA 4CI1B 2BDEA 4H9PC 2D2SA 4GKJT 4HWCA 3LBXB 3SOLA 4GKKT 2B1EA 3PJAA 2I6HA 4Z91A 4NXMT 3RF1A 4G2AA 4DR4T 1US7B 3AEGA 2CXLA 1BR1A 5ABHA 2HPJA 3CX8B 1XWMA 3UULA 2WWVA 4MBQA 1E2AA 3HA4A 3ZMSB 3UQ7A 5FKYA 4LF4T 3AE9A 4JI8T 4ZXLA 3T8OA 2VQET 2LRKA 3N5LA 2PJQA 4LFAT 2K48A 3MK7C 2NOXA 4X64T 2QGSA 2WZHA 3AE5A 3I0OA 5ABFA 2XASB 1HS7A 4YHJA 3AEDA 3NKZA 3ZN1B 3EVYA 1ZP0A 3UFEA 1JNZA 1T7SA 3Q5WA 2BS3A 4HEAA 4XAXB 4NPPA 2CMRA 3ABVA 1OXZA 1YQ4A 3UUMA 3C64A 3W15B 3AA7B 1XMOT 3KDSE 5CA0E 2FJBA 4AQFA 3H3AA 4JI3T 3ZYMA 3G06A
chains in the Genus database with same CATH topology
2DWKA 5JDLA 2H7VC 3LK3B 3HI2A 2IC6A 3E08A 4ZI2C 4TN7B 3QUJA 1BR4A 5F3JA 4UV8B 5HXEA 3M65A 3IHRA 3NZQA 2E8IA 1D0YA 4EZ4A 1IJ6A 3RC8A 3LK2B 3DTOA 3L3PA 2MOZA 3QK6A 5IYZE 1IAPA 1B7TA 3WAKA 2V1DB 1S35A 2Y48B 4IE7A 4DMWA 4HTEA 5IHYA 4I55E 2RP4A 1YW0A 2YINA 3K3OA 2GK9A 2LSKA 3KBUA 5DQWA 1G8XA 2CLYC 4DMVA 5L3GB 5ADXL 2WBLA 4BJMA 1U4QA 2JPFA 2XTLA 4V1Av 1WRDA 3U3IA 2XAFB 2LSGA 4CZZB 3CX7B 4H9OC 5CB4E 3GA8A 2YK0A 4I43B 2CWOA 2SPCA 4OHFA 5FP3A 4YFSA 2J1DG 4BAYB 2N9DA 3FXDB 2NW7A 2WM9A 1HF8A 4O2AE 4I4TE 2KT9A 4EYYR 3O4XE 2CEAA 4NUUA 5FYMA 5EK2A 1MMAA 2X9WA 3OBVE 1MNDA 1AJ3A 3PURA 3ONXA 5JDHA 1WYBA 4ZI3D 3PDYA 3WAJA 2ODUA 2IAKA 2NW9A 4P0AA 3CVRA 3AA1B 4QXCB 2V7KA 5JR9C 3NZPA 5LG4A 4AKLA 4O4IE 2V7MA 2XQYA 3S4UA 5LJMA 1FMVA 4DO0A 3RH3A 4EAHA 5JH7E 2DWGA 2X51A 2KLQA 2ZM8A 4WBOA 3ZJ2A 4QHOA 3PUGA 1ZEEA 4PFOA 2CM0A 3GMIA 2CXFA 3HKEE 4MALA 5A1LA 4PAGA 4QWNB 2V7LA 3RX6A 1X79A 2JRKA 2N2NA 3O1IA 1QUUA 2ACXA 4FI5A 3VKHA 3MACA 2WSSV 5FY0A 3MZKB 4PK6A 3RYHE 5HWXA 4OK0A 5LP6E 3MA9A 5JREA 3IEEA 2XAHB 4KUMB 2A2FX 3V5UA 4ERRA 3CWZB 3ETUA 5JRCB 3K8PC 2DNXA 2LEHA 2W61A 4H9QC 3UTKA 1UCUA 1YKEB 3EDVA 5JRCA 4X1KE 1EZ3A 4L0RA 4X1YE 3VU7H 1S94A 3ZMZB 3I9WA 4TUYE 2N1GA 2VKDA 2VASA 4ZI3C 2A3DA 2EHOB 5JR9B 2KXPB 3C98B 5FY7A 4ASKA 3AB3B 3Q9DA 1G73A 3CQXC 4AXPA 2L8KA 2EHOA 4JEUB 5JR9A 4AKGA 3KFWX 5LBQB 1BR2A 4ANJA 5M4YA 3ZCJA 5FXVA 1H7CA 2X9YA 3I9YA 4J2CA 3KBTA 5JDQA 2V7IA 5LHHB 4IGUA 2LHNA 5AFUL 2XAJB 3DJBA 4PW8A 2L3LA 4TV9E 2WMNA 1VRBA 3LFMA 2X66A 1FEWA 3IF8B 1D0ZA 2BVMA 3AAIA 2CXDA 4OFZA 3ZC0A 2M67A 1LVFA 2VKHA 2CWYA 3CQGB 1YKHB 2PFVA 5KMGP 3NRXA 3AAEB 3E22E 1Y64B 1NWMX 5FMNA 2NTXA 2X9HA 3ZC1A 4CXWA 4P0BA 3RYIE 4HN9A 3FXEB 5LCYA 4AKRB 2CCQA 3PU3A 1V9DA 4MHCA 2KWIB 1UX5A 5DJQC 4H63V 4G63A 1HFAA 2KZ7B 2MYSA 3IBPA 3QC9A 5EK4A 2MTQA 2K9AA 3WI3A 2E9XC 2IC9A 4WW0A 5JDGA 3ANWB 5L3FB 4O4LE 2RA1A 3C50A 5FXXA 4CI2B 1FIOA 3AAAB 3PUAA 4L9IA 1UX4A 5TAOA 3ANWA 4HE8A 3N9MA 2XAGB 3Q2MA 3KV6A 5LOVE 2W00A 1NAFA 3R6NA 2W63A 5LNKA 1U5PA 4ZI7E 4H9RC 5L3BB 5LBMA 4ADZA 5DABA 3KV5A 3JC6D 5LXTE 3RKOA 2CA5A 4DVDA 1QSDA 4X20E 2DCFA 2C5IT 5C8YE 3SWHA 3C4WA 5LGUB 3ZCIA 2X67A 3Q5XA 2X9XA 2VWAA 3C4XA 3MXZA 4GK5E 4XZCA 3RRWA 3BQLA 2D0UA 4JUYA 1SHZC 2K5BB 4GYRA 4ILUA 4PK4A 5LA6E 5EK3A 3GN5B 2WWUA 4PJNA 2H7OA 4H9SE 3N2OA 4JLEA 3GN5A 4EB6E 1ZHCA 4QXBB 4O4JE 1ZKEA 3SRZA 1MNEA 4H9NC 2XAQB 1LRZA 2NTYA 1LKXA 4IE0A 2C5JA 3VHLA 1WLXA 2KWHA 4PNIA 2D5UA 3B57A 5LHIB 4KBMB 2Q9QC 5JDFA 3AA0B 4GIWA 2DLRA 4IE4A 2CLYB 3AVRA 3H37A 4HGAA 2UXNB 3KINB 4DNDA 2X0LB 4TX5A 4H63H 3SS1A 4A56A 1D1AA 4UV9B 3ESLA 3EDUA 3ZMUB 3N9PA 4AQFC 3D0TA 4DBQA 4I50E 4ZS2A 2X68A 3N9NA 3RYCE 3RC3A 3FB2A 2ZMAA 3OJAA 3ZYKA 2L9QA 3JC6C 4OYJA 2NW8A 2XHEB 4YLHA 2E9XD 3KVBA 1MMDA 2LSJA 3PU8A 5FY1A 4KP3C 1D0XA 3A5XA 4U74A 2P9BA 2BVLA 2WAUA 2LSYA 2LSIA 3FBZA 2CE7A 4UVAB 4ZHQE 1HG5A 3O1JA 4YJ2E 4ZS3A 2LOSA 2UXXB 3ZYLA 4IIJE 1MMGA 4MLKA 3ZEFB 4WBNE 1E1HB 2LJLA 5JVDE 4UF0B 3V5SA 2VKJA 3KV9A 5KX5E 2ODVA 1D1CA 1O3XA 1KK7A 4PJJA 3N2KE 2LT3A 4UF0A 3E0ZA 4YJ3E 4E7SA 1MIWA 4CXXA 2I59A 2C5KT 3HR0A 5J2UE 3KV4A 4QXHB 1IZNB 5H6RB 4HKAA 1IJ5A 2W62A 3U78A 3O9XA 4QX8B 4BJNA 2G0UA 4TV8E 4XBFB 3AA6B 1BR0A 3NBXX 4EXTA 4K0UA 3ETVA 5GONE 3K3NA 4N78D 3PUQA 5JDNA 4UEMA 3PE0A 2V7JA 5FXWA 2Q9QD 2VK9A 5DQVA 2LHRA 4JEHB 4CXYA 4B6XA 4EOZB 3C51A 3RYFE 5HYAA 2V26A 4AQGA 4GYSA 2EHOD 4UVBB 4IHJE 1MMNA 4UIGA 4PJMA 3K3QC 3P7IA 5HWYA 4KMCA 3ZMTB 1HCIA 3EUHA 4F6RC 1ZV4X 2DHRA 5BMVE 1HG2A 1LVKA 3BQKA 3ZJ1A 5LHGB 2DI4A 3N9OA 4C91A 2KNDA 3VKGA 5JDMA 2LE8A 4ISTA 3B13A 4AKIA 4UVCB 5LJNA 1WYCA 3BQIA 2ZM0A 4L5GA 3PTRB 3F31A 1MIYA 4PK5A 5EZYE 3TKLB 4PJLA 3UUXB 3KVAA 4C90A 2A72A 4CI1B 2BDEA 3MKDA 4H9PC 3ZPOA 4EIWA 2VL8A 2D2SA 4BA9A 3LBXB 3CPZA 2HH7A 3SOLA 2B1EA 2OA5A 3F2EA 4OYKA 1CUNA 2HPLA 3LBXA 2Y8DA 2H3RA 2MBGA 5ETWA 4U72A 5HXRA 5F8PA 4G2AA 4O8SA 5HAXA 2WMOA 3BK9A 1MIVA 2KINB 3J7Yq 3C4ZA 1D1BA 4CQIA 3CKDA 3F57A 5KDMC 2JJ9A 1US7B 2JMHA 2LM9A 2CXLA 5CA1E 1BR1A 2HPJA 1T98A 3CX8B 3HKBE 3UUNA 4ISSA 2C0SA 3UULA 5H6QB 4MBQA 5HXHA 2E9XB 3RRCA 3HA4A 2ES0A 5JQGE 2YU1A 3N9LA 3CQCB 2KMFA 4PFPA 3ZMSB 2EHOC 3HKDE 2E9XA 3P8CD 4AKHA 3LJCA 3AVSA 3T8OA 4O2BE 5LGNB 3N5LA 2VB6A 2PJQA 2K48A 2XUEA 3MK7C 2YU2A 2NOXA 2QA7A 3LG7A 3GWHA 3R84B 2QGSA 3MJXA 5L3EB 4P09A 3ZLIA 2PBIA 3J9X1 3I0OA 3RPUA 3N9QA 2XASB 1KNZA 4NUVA 4ZI2D 2K24A 3PUSA 2ZM2A 4E7ZA 3UT5E 4M1PA 1YD8G 1HS7A 5L3DB 3O1HA 4FJOA 5L3CB 3DP7A 4YHJA 3L09A 2W0GA 4EYUA 5FNVE 3I0QA 5J1GA 1Z0PA 2ZLYA 1FMWA 2Z6EA 3NRYA 3OKQA 2D0TA 4GOUA 3ZN1B 1HX8A 2Y6XA 3EVYA 2JQQA 3CX6B 5L2LA 2IW5B 3OYZA 4UELA 5J2TE 3UFEA 5E0OA 4Z8XA 3CMLA 4IE6A 2LOPA 4CI3B 3Q5WA 4MFRA 2JMKA 2Q9QB 4EZHA 4HEAA 4XAXB 1OWAA 2BZBA 2VKOA 2NP9A 3HL6A 1WR6A 3ZMVB 4HFVA 2CMRA 3LK42 4TZ4C 2Q9QA 4WNKA 4ZOLE 3FHNA 4IE5A 1OXZA 4IDZA 3UUMA 4QKNA 3C64A 2NWBA 5HXCA 3W15B 5HXSA 3AA7B 3KDSE 5CA0E 4O4HE 4X1IE 4QX7B 4GK0E 1SA0E 4UXNB 3HKCE 4AQFA 5LYJE 4DBRA 5LGTB 2YEVC 3I1AA 4AI6A 2PG8A 3H3AA 3FBLA 1HTJF 3N2GE 3OYXA 5FXZA 3ZYMA 1VOMA 3ZN0B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YD8 G;  1WRD A;  1O3X A;  2N9D A;  2N2N A;  1NAF A;  1WR6 A;  1NWM X;  1X79 A;  1OXZ A; 
#chains in the Genus database with same CATH topology
 5FL0 A;  2OV9 A;  3LK3 B;  3HI2 A;  3PUZ F;  4ZI2 C;  4DV2 T;  4HWF A;  3OPC A;  4YTP A;  5F3J A;  2QRX A;  3A7M A;  1YQ3 A;  4UV8 B;  4JYA T;  3DTO A;  2R6G F;  2UUC T;  1IAP A;  2V1D B;  4IE7 A;  2X0H A;  4HTE A;  3TLU A;  4I55 E;  2RP4 A;  3K3O A;  2LSK A;  2CLY C;  4DMV A;  5L3G B;  4BJM A;  2WZI A;  5AQL B;  1XNR T;  4V1A v;  1WRD A;  3U3I A;  4CZZ B;  4U33 A;  1N33 T;  3GA8 A;  2JIW A;  4ILC A;  3RHW A;  2CBJ A;  2J1D G;  2N9D A;  4O2A E;  4HFB A;  3FZF B;  1X9B A;  2V5C A;  5EK2 A;  1J1J A;  5HCJ A;  1MMA A;  2LRL A;  2QYW A;  3OBV E;  4EV6 A;  3AEB A;  3ONX A;  5JDH A;  1WYB A;  2WU5 A;  5AQI B;  3S4U A;  2XQ8 A;  4DO0 A;  1W0A A;  2DWG A;  3SFD A;  3PUG A;  4EED A;  3TLS A;  2XQ4 A;  5LMN T;  4MAL A;  3RQU A;  4QWN B;  2V7L A;  4IDP A;  1X79 A;  2JRK A;  3O1I A;  5HWX A;  3MA9 A;  5JRE A;  1OED B;  4KUM B;  2A2F X;  3CWZ B;  3K8P C;  1QLB A;  2UXC T;  4H9Q C;  3UTK A;  3EDV A;  4X1K E;  3ZMZ B;  5AQS B;  2EHO A;  4KX6 A;  1BR2 A;  5FXV A;  3RQW A;  5JDQ A;  1DU2 A;  2LHN A;  4A5X A;  2X66 A;  2BKN A;  3IF8 B;  1D0Z A;  2BVM A;  1UUR A;  4OFZ A;  2CWY A;  2BKP A;  3CQG B;  3AAE B;  4CXW A;  3RYI E;  3FXE B;  2CCQ A;  2KZ7 B;  3WI3 A;  2IC9 A;  5JDG A;  5L4H A;  3PUA A;  4L9I A;  5TAO A;  3ANW A;  5LOV E;  3R6N A;  1U5P A;  3CK6 A;  1WCR A;  4H9R C;  2RPA A;  2BBH A;  5LBM A;  4ADZ A;  5LXT E;  3JCF A;  5HEO A;  2DCF A;  2C5I T;  3SWH A;  3AE2 A;  2XQ3 A;  2A9U A;  3UU6 A;  4YSY A;  2WWU A;  3N2O A;  4IDN A;  1IBM T;  4EB6 E;  1LRZ A;  2NTY A;  4QH1 A;  3AEC A;  2M6I A;  1LKX A;  2J4G A;  3NWI A;  1OED E;  4GIW A;  3RKG A;  4IE4 A;  3AVR A;  2XJ7 A;  3H37 A;  4HGA A;  4CN1 A;  3D0T A;  4DBQ A;  2FJD A;  3RYC E;  3FB2 A;  2ZMA A;  3OJA A;  5IUX A;  2XHE B;  1MMD A;  4U74 A;  2YDQ A;  5ABG A;  2WAU A;  2LSY A;  2LSI A;  3UQ4 A;  1HG5 A;  4YJ2 E;  2UXX B;  4MLK A;  4A98 A;  2LJL A;  5JVD E;  4UF0 B;  3ZT6 A;  4PJJ A;  2LT3 A;  4TWH A;  3TLV A;  5J2U E;  4LFC T;  4QX8 B;  3UUB A;  4BJN A;  2G0U A;  2W66 A;  4DUZ T;  4XBF B;  2M6B A;  3K3N A;  3PUQ A;  5JDN A;  3PE0 A;  4B6X A;  5HYA A;  2IUB A;  4GYS A;  3JAD A;  4UVB B;  4PJM A;  1HCI A;  4F6R C;  1HG2 A;  3BQK A;  1HNW T;  4IST A;  3B13 A;  4AKI A;  4U31 A;  1GQE A;  3BQI A;  3F31 A;  4PK5 A;  3UUX B;  4C90 A;  2A72 A;  4EIW A;  3CPZ A;  3F2E A;  5IWA T;  5CGM A;  2Y8D A;  2H3R A;  1HNZ T;  5HXR A;  4O8S A;  3BK9 A;  3J7Y q;  3C4Z A;  3CKD A;  4JI4 T;  2JJ9 A;  5CA1 E;  4LMK A;  1T98 A;  4ISS A;  2C0S A;  3P4W A;  1XDO A;  5HXH A;  3RRC A;  2ES0 A;  3N9L A;  3PV0 F;  3H3M A;  3HKD E;  2E9X A;  3LJC A;  2BKO A;  5LGN B;  5ABF B;  3GWH A;  2K3W A;  1I6Z A;  3N9Q A;  5AQH B;  4DUY T;  2K24 A;  3EAB A;  3PUS A;  2ZM2 A;  3X1D A;  4E7Z A;  4WYV A;  3QB5 K;  3O1H A;  4TNV A;  4FJO A;  3DP7 A;  1HNX T;  2W0G A;  4EYU A;  3I0Q A;  2ZLY A;  4DV6 T;  4DR7 T;  3CX6 B;  3EAM A;  2IW5 B;  1J5W A;  1R8I A;  5E0O A;  2LKH A;  4CI3 B;  4EZH A;  4X65 T;  3P4P A;  4HFV A;  3LK4 2;  2Q9Q A;  4IDZ A;  2NWB A;  4X66 T;  5HXS A;  4DV3 T;  4O4H E;  4QX7 B;  4GK0 E;  1SA0 E;  3AE3 A;  4EEB A;  4KHP T;  2PG8 A;  3FBL A;  2XPK A;  2BG9 C;  2DWK A;  3JAF A;  2H7V C;  4HWD A;  2VUR A;  2E8I A;  1D0Y A;  2CRB A;  4EZ4 A;  2WDQ A;  1IJ6 A;  2B76 A;  5FVK A;  3AEF A;  2MOZ A;  2Y48 B;  3RIU C;  1YW0 A;  2GK9 A;  2WBL A;  2XQ9 A;  1JNR A;  2CBI A;  1FJG T;  5AQK B;  2XAF B;  4H9O C;  5CB4 E;  4EGW A;  2CWO A;  4OHF A;  2I0M A;  4YFS A;  4BAY B;  4I0U A;  5FYM A;  3PJA J;  1KNP A;  3PUR A;  4JI7 T;  3PDY A;  2IAK A;  3AA1 B;  2V7K A;  5JR9 C;  3FZL B;  4AKL A;  2V7M A;  3RIA A;  1FMV A;  4EAH A;  2X51 A;  4QHO A;  1I94 T;  2YN6 A;  3VRB A;  4JI6 T;  5A1L A;  3RIU A;  3AEA A;  5AQJ B;  4PAG A;  4LMJ A;  3RX6 A;  2N2N A;  4Q25 A;  3MZK B;  3RYH E;  4OK0 A;  5LP6 E;  4ZZC A;  3IEE A;  4ERR A;  4LF7 T;  3M3Z B;  2BS4 A;  2LEH A;  1UCU A;  4X1Y E;  4LML A;  4TUY E;  2N1G A;  2VAS A;  2EHO B;  2KXP B;  3C98 B;  3AB3 B;  3Q9D A;  3P4S A;  4JEU B;  5JR9 A;  4AKG A;  1KNR A;  2JQK A;  3AE7 A;  4DR5 T;  4ANJ A;  3I9Y A;  4J2C A;  5LHH B;  4IGU A;  5AFU L;  2H89 A;  4PW8 A;  4TV9 E;  2WMN A;  1VRB A;  1FEW A;  3AAI A;  2CXD A;  3ZC0 A;  2M67 A;  2V8S V;  5KMG P;  1YKH B;  2PFV A;  1NWM X;  4P0B A;  3PU3 A;  5DJQ C;  2MYS A;  2WDV A;  4WW0 A;  3ANW B;  4U2Z A;  5FXX A;  4CI2 B;  3AE4 A;  4KI0 F;  3N9M A;  3ZSS A;  2WS3 A;  3JC6 D;  3QNU A;  3RKO A;  1QSD A;  3Q5X A;  2VWA A;  3C4X A;  3MXZ A;  4XZC A;  3RRW A;  2D0U A;  2XSA A;  3IA3 A;  1SHZ C;  4GYR A;  4PK4 A;  5LA6 E;  4JLE A;  3GN5 A;  3SRZ A;  1ZKE A;  2XAQ B;  4X62 T;  2E5L T;  2C5J A;  5AQV B;  1VCS A;  3VHL A;  2KWH A;  3B57 A;  5LHI B;  5JDF A;  4DR2 T;  5LB7 B;  2X0L B;  4TX5 A;  4H63 H;  4A56 A;  4UV9 B;  2XQ6 A;  2W67 A;  4TNW A;  4DV5 T;  2CHO A;  3QB5 A;  1XZY A;  4YLH A;  2VQF T;  3KVB A;  3A5X A;  1L0V A;  3UFG A;  3PUW F;  3FBZ A;  3VR8 A;  5HEG A;  4ILB A;  2LOS A;  4IIJ E;  4ILA A;  3KV9 A;  5KX5 E;  3N2K E;  2WDR A;  3E0Z A;  1MIW A;  2I59 A;  4QXH B;  4NIQ A;  1IZN B;  5L47 A;  2W62 A;  3U78 A;  4OX9 T;  4CN6 A;  3UU5 A;  3AA6 B;  2HHH T;  2ZM6 T;  5GON E;  4N78 D;  4U7I A;  2VK9 A;  4CXY A;  2UU9 T;  2V26 A;  2EHO D;  2YDR A;  4DV1 T;  3K3Q C;  4KMC A;  2DHR A;  3N9O A;  4C91 A;  3VKG A;  4HFI A;  2UXD T;  1W9R A;  4LF8 T;  4YXD A;  5EZY E;  1MIY A;  4ZEY A;  4PJL A;  1M62 A;  4AQY T;  3MKD A;  2VL8 A;  3OVU A;  4BA9 A;  2HH7 A;  4JI0 T;  1CUN A;  2HPL A;  2V6Y A;  2MBG A;  5F8P A;  2WMO A;  1MIV A;  3F57 A;  5AQM B;  1E7P A;  3HKB E;  2MPK A;  5H6Q B;  2E9X B;  5JQG E;  2YU1 A;  4DID B;  3CQC B;  4PFP A;  4AKH A;  3AVS A;  2FJA A;  4IL9 A;  4CN4 A;  1UUS A;  1SE7 A;  4JI2 T;  3LG7 A;  3UU3 A;  3R84 B;  3MJX A;  3ZLI A;  3RPU A;  3J9X 1;  5AQO B;  1KNZ A;  4DR1 T;  5AQU B;  1YD8 G;  5L3D B;  1XNQ T;  2UUB T;  5FNV E;  5J1G A;  1Z0P A;  1FMW A;  3OKQ A;  2VVN A;  4GOU A;  1CHU A;  2Y6X A;  4YHH T;  2HN1 A;  2JQQ A;  5L2L A;  3OYZ A;  2WB5 A;  4YTM A;  4Z8X A;  4IE6 A;  2LOP A;  2Q9Q B;  5CFB A;  1OWA A;  2BZB A;  3HL6 A;  1WR6 A;  4IE5 A;  3PUY F;  4QKN A;  3B5M A;  5HXC A;  2WU2 A;  3TLW A;  4X1I E;  4UXN B;  3HKC E;  4DBR A;  4AI6 A;  3N2G E;  3OYX A;  5FXZ A;  3ZN0 B;  4LF6 T;  4DR6 T;  3E08 A;  4TN7 B;  3QUJ A;  4ZZB A;  5HXE A;  3IHR A;  3LK2 B;  3L3P A;  4KHZ F;  4IDQ A;  2XM1 A;  2VL0 A;  1B7T A;  3WAK A;  3ONJ A;  5IHY A;  3EHZ A;  5DQW A;  5ADX L;  2FBW A;  1U4Q A;  3FZK B;  2LKG A;  2XTL A;  2LLY A;  2LSG A;  3CX7 B;  3AXJ A;  2H88 A;  2SPC A;  5C2T A;  3FXD B;  3FZH B;  2NW7 A;  2WM9 A;  1HF8 A;  4I4T E;  2KT9 A;  3ZT5 A;  3O4X E;  2CEA A;  4NUU A;  4B3M T;  2X9W A;  1MND A;  4ZI3 D;  2YDS A;  4P0A A;  2XQ5 A;  5LG4 A;  4O4I E;  2XQY A;  3LDQ B;  5HEH A;  5LJM A;  2JQH A;  2ZM8 A;  5CJ5 A;  1ZEE A;  4PFO A;  2CXF A;  3HKE E;  3P4R A;  4TWD A;  1QUU A;  3NVO A;  3VKH A;  2WSS V;  4HFE A;  4PK6 A;  3V5U A;  4HWI B;  3ETU A;  5BR8 T;  3UU8 A;  1YKE B;  5JRC A;  3VU7 H;  1S94 A;  3I9W A;  5JR9 B;  4JI5 T;  5FY7 A;  4ASK A;  3CQX C;  2L8K A;  3KFW X;  2V6X A;  5LBQ B;  3ZCJ A;  1WFD A;  2X9Y A;  5F5W A;  3A8Y C;  4U7Y A;  2E5V A;  3DJB A;  3L39 A;  2JQ9 A;  1Y64 B;  2W4X A;  2X9H A;  3ZC1 A;  4HN9 A;  4AKR B;  4MHC A;  1V9D A;  2MAW A;  3VR9 A;  1NEK A;  4G63 A;  1HFA A;  3QC9 A;  5EK4 A;  2MTQ A;  3LSV A;  3C50 A;  3AAA B;  3KV6 A;  2W00 A;  5LNK A;  5L3B B;  1N36 T;  5DAB A;  5J0Z A;  2CA5 A;  4X20 E;  1W0B A;  3C4W A;  5LGU B;  2X67 A;  3RLF F;  4GK5 E;  3BQL A;  1SUM B;  4JUY A;  2K5B B;  2BG9 A;  5EK3 A;  5LMU T;  3GN5 B;  4PJN A;  5L4E A;  1ZHC A;  4JI1 T;  4H9N C;  4IE0 A;  4JBW F;  4PNI A;  4KBM B;  5KXJ A;  3FZM B;  2IIU A;  2CLY B;  3KIN B;  4DND A;  4UR9 A;  1KF6 A;  1W09 A;  1VCT A;  3ESL A;  4AQF C;  3N9N A;  3ZYK A;  2L9Q A;  3JC6 C;  5C3J A;  1Y01 A;  2LSJ A;  2E2A A;  3PU8 A;  3L8R A;  4KP3 C;  2P9B A;  4HFD A;  4ZHQ E;  3ZEF B;  4WBN E;  2AE9 A;  1E1H B;  1NEN A;  5AQR B;  3V5S A;  2VKJ A;  2BS2 A;  2ODV A;  4CXX A;  3HR0 A;  2C5K T;  1IJ5 A;  2X0Y A;  3ETV A;  4P1N A;  3TLT A;  4YSZ A;  5DQV A;  2LHR A;  4EOZ B;  3RYF E;  4AQG A;  4COF A;  3CIR A;  1ZOY A;  1MMN A;  4UIG A;  3P7I A;  5HWY A;  3ZMT B;  3EUH A;  1ZV4 X;  1LVK A;  3ZJ1 A;  2DI4 A;  2CPT A;  2KND A;  4UVC B;  5LJN A;  3JAE A;  4DV0 T;  4L5G A;  3PTR B;  3TKL B;  2WP9 A;  3ZPO A;  4U3C A;  2V6Y B;  2OA5 A;  4OYK A;  5HCM A;  3LBX A;  5ETW A;  3PUX F;  4U72 A;  5HAX A;  2KIN B;  4IRE A;  4CQI A;  1D1B A;  5KDM C;  1J5E T;  3AE8 A;  2JMH A;  2LM9 A;  2YKS A;  2J47 A;  3UUN A;  2BBJ A;  2KMF A;  3QOF A;  2EHO C;  3P8C D;  2YOE A;  4O2B E;  2VB6 A;  5JTG A;  3PUV F;  2XUE A;  2KSR A;  2YU2 A;  2QA7 A;  4LFB T;  5L3E B;  4P09 A;  2PBI A;  4NUV A;  4ZI2 D;  4YSX A;  1N34 T;  3UT5 E;  4M1P A;  5L3C B;  3L09 A;  1HR0 T;  2HN2 A;  2Z6E A;  3NRY A;  2D0T A;  5AQN B;  1HX8 A;  1KFY A;  4UEL A;  5J2T E;  3CML A;  4MFR A;  2JMK A;  1M7K A;  2VKO A;  2NP9 A;  3ZMV B;  4TZ4 C;  4WNK A;  4ZOL E;  3FHN A;  5AQG B;  4U2Y A;  2WQY A;  5LYJ E;  5LGT B;  2YEV C;  3I1A A;  4B3S T;  1HTJ F;  2J62 A;  1VOM A;  5JDL A;  2IC6 A;  1BR4 A;  4DR3 T;  3EI0 A;  3M65 A;  3NZQ A;  2VVS A;  2V5D A;  3RC8 A;  3QK6 A;  1T8B A;  5IYZ E;  5HEU A;  1S35 A;  4DMW A;  2CHN A;  2XQA A;  2YIN A;  3KBU A;  1G8X A;  2JPF A;  3AXJ B;  2YK0 A;  4X5T A;  4I43 B;  5FP3 A;  2WCA A;  1OED C;  2NR4 A;  4EYY R;  5AQP B;  1AJ3 A;  3WAJ A;  2ODU A;  3ONL C;  2NW9 A;  4WZX A;  3CVR A;  4QXC B;  3NZP A;  4HFH A;  1IBL T;  1UGO A;  4A97 A;  3RIF A;  2WY2 A;  3RH3 A;  5JH7 E;  2KLQ A;  4WBO A;  3ZJ2 A;  3AE6 A;  2CM0 A;  1KEY A;  3GMI A;  2IDO B;  1Z8U A;  4FI5 A;  2ACX A;  3MAC A;  5FY0 A;  1YXR A;  1XDP A;  2XAH B;  1OED A;  5JRC B;  2DNX A;  2W61 A;  3P50 A;  1UK5 A;  1EZ3 A;  4L0R A;  1N32 T;  2VKD A;  4ZI3 C;  2A3D A;  3T1H T;  1G73 A;  4AXP A;  2AXD S;  5M4Y A;  4LF5 T;  1H7C A;  3KBT A;  2D9D A;  2V7I A;  2DL1 A;  2UUA T;  2LM2 A;  2XAJ B;  4AIU A;  2L3L A;  3LFM A;  5AQF B;  2IML A;  3OTO T;  3K1S A;  4Z90 A;  1LVF A;  2VKH A;  4F8H A;  4YY3 T;  4QH4 A;  1T72 A;  3NRX A;  3E22 E;  4JV5 T;  5FMN A;  2NTX A;  5LG3 A;  4QH5 A;  4B3T T;  3RI5 A;  5LCY A;  5HEJ A;  2KWI B;  1UX5 A;  4H63 V;  4B3R T;  3IBP A;  2K9A A;  2E9X C;  5L3F B;  4O4L E;  2RA1 A;  1FIO A;  1UX4 A;  2OLT A;  4HE8 A;  2XAG B;  3Q2M A;  1NAF A;  2W63 A;  3ZT7 A;  4ZI7 E;  3ZKR A;  2UXB T;  3KV5 A;  2XM2 A;  2XY8 B;  4DVD A;  5C8Y E;  3ZCI A;  2QVA A;  2X9X A;  2BG9 B;  5AQT B;  2XQ7 A;  5FVL A;  4LF9 T;  4HWH A;  4ILU A;  2H7O A;  4H9S E;  4IT4 A;  3Q5E A;  4QXB B;  4O4J E;  3T1Y T;  1MNE A;  1WLX A;  2D5U A;  2Q9Q C;  4IDO A;  3AA0 B;  2DLR A;  2IHR 1;  2XSB A;  2UXN B;  3Q5D A;  4IL4 A;  3SS1 A;  1D1A A;  3SFE A;  3EDU A;  1IBK T;  3ZMU B;  3ZST A;  1WR0 A;  3N9P A;  4K0K T;  4I50 E;  4ZS2 A;  2X68 A;  2FJE A;  3RC3 A;  4OYJ A;  2NW8 A;  2E9X D;  3AE1 A;  5FY1 A;  1D0X A;  4DV4 T;  2BVL A;  3P4Q A;  4YTN A;  2CE7 A;  2PTF A;  4UVA B;  3O1J A;  4HFC A;  4ZS3 A;  3ZYL A;  5FL1 A;  1MMG A;  1XMQ T;  1O3X A;  1D1C A;  4DV7 T;  1KK7 A;  4E7S A;  4UF0 A;  4YJ3 E;  1HX1 B;  3KV4 A;  4NXN T;  2F4V T;  3VRA A;  5H6R B;  4HKA A;  3O9X A;  4TV8 E;  4TWF A;  5AQQ B;  1BR0 A;  3NBX X;  4EXT A;  4K0U A;  4YT0 A;  2W2U A;  4UEM A;  3RGL A;  2V7J A;  5FXW A;  2Q9Q D;  4JEH B;  3C51 A;  4IHJ E;  2FUP A;  2XZE A;  4AIS A;  3UU4 A;  3AEE A;  5BMV E;  2BG9 E;  5LHG B;  2ACZ A;  5JDM A;  2LE8 A;  1WYC A;  5ABE A;  2ZM0 A;  3KVA A;  4CI1 B;  2BDE A;  4H9P C;  2D2S A;  4GKJ T;  4HWC A;  3LBX B;  3SOL A;  4GKK T;  2B1E A;  3PJA A;  2I6H A;  4Z91 A;  4NXM T;  3RF1 A;  4G2A A;  4DR4 T;  1US7 B;  3AEG A;  2CXL A;  1BR1 A;  5ABH A;  2HPJ A;  3CX8 B;  1XWM A;  3UUL A;  2WWV A;  4MBQ A;  1E2A A;  3HA4 A;  3ZMS B;  3UQ7 A;  5FKY A;  4LF4 T;  3AE9 A;  4JI8 T;  4ZXL A;  3T8O A;  2VQE T;  2LRK A;  3N5L A;  2PJQ A;  4LFA T;  2K48 A;  3MK7 C;  2NOX A;  4X64 T;  2QGS A;  2WZH A;  3AE5 A;  3I0O A;  5ABF A;  2XAS B;  1HS7 A;  4YHJ A;  3AED A;  3NKZ A;  3ZN1 B;  3EVY A;  1ZP0 A;  3UFE A;  1JNZ A;  1T7S A;  3Q5W A;  2BS3 A;  4HEA A;  4XAX B;  4NPP A;  2CMR A;  3ABV A;  1OXZ A;  1YQ4 A;  3UUM A;  3C64 A;  3W15 B;  3AA7 B;  1XMO T;  3KDS E;  5CA0 E;  2FJB A;  4AQF A;  3H3A A;  4JI3 T;  3ZYM A;  3G06 A; 
#chains in the Genus database with same CATH homology
 2DWK A;  5JDL A;  2H7V C;  3LK3 B;  3HI2 A;  2IC6 A;  3E08 A;  4ZI2 C;  4TN7 B;  3QUJ A;  1BR4 A;  5F3J A;  4UV8 B;  5HXE A;  3M65 A;  3IHR A;  3NZQ A;  2E8I A;  1D0Y A;  4EZ4 A;  1IJ6 A;  3RC8 A;  3LK2 B;  3DTO A;  3L3P A;  2MOZ A;  3QK6 A;  5IYZ E;  1IAP A;  1B7T A;  3WAK A;  2V1D B;  1S35 A;  2Y48 B;  4IE7 A;  4DMW A;  4HTE A;  5IHY A;  4I55 E;  2RP4 A;  1YW0 A;  2YIN A;  3K3O A;  2GK9 A;  2LSK A;  3KBU A;  5DQW A;  1G8X A;  2CLY C;  4DMV A;  5L3G B;  5ADX L;  2WBL A;  4BJM A;  1U4Q A;  2JPF A;  2XTL A;  4V1A v;  1WRD A;  3U3I A;  2XAF B;  2LSG A;  4CZZ B;  3CX7 B;  4H9O C;  5CB4 E;  3GA8 A;  2YK0 A;  4I43 B;  2CWO A;  2SPC A;  4OHF A;  5FP3 A;  4YFS A;  2J1D G;  4BAY B;  2N9D A;  3FXD B;  2NW7 A;  2WM9 A;  1HF8 A;  4O2A E;  4I4T E;  2KT9 A;  4EYY R;  3O4X E;  2CEA A;  4NUU A;  5FYM A;  5EK2 A;  1MMA A;  2X9W A;  3OBV E;  1MND A;  1AJ3 A;  3PUR A;  3ONX A;  5JDH A;  1WYB A;  4ZI3 D;  3PDY A;  3WAJ A;  2ODU A;  2IAK A;  2NW9 A;  4P0A A;  3CVR A;  3AA1 B;  4QXC B;  2V7K A;  5JR9 C;  3NZP A;  5LG4 A;  4AKL A;  4O4I E;  2V7M A;  2XQY A;  3S4U A;  5LJM A;  1FMV A;  4DO0 A;  3RH3 A;  4EAH A;  5JH7 E;  2DWG A;  2X51 A;  2KLQ A;  2ZM8 A;  4WBO A;  3ZJ2 A;  4QHO A;  3PUG A;  1ZEE A;  4PFO A;  2CM0 A;  3GMI A;  2CXF A;  3HKE E;  4MAL A;  5A1L A;  4PAG A;  4QWN B;  2V7L A;  3RX6 A;  1X79 A;  2JRK A;  2N2N A;  3O1I A;  1QUU A;  2ACX A;  4FI5 A;  3VKH A;  3MAC A;  2WSS V;  5FY0 A;  3MZK B;  4PK6 A;  3RYH E;  5HWX A;  4OK0 A;  5LP6 E;  3MA9 A;  5JRE A;  3IEE A;  2XAH B;  4KUM B;  2A2F X;  3V5U A;  4ERR A;  3CWZ B;  3ETU A;  5JRC B;  3K8P C;  2DNX A;  2LEH A;  2W61 A;  4H9Q C;  3UTK A;  1UCU A;  1YKE B;  3EDV A;  5JRC A;  4X1K E;  1EZ3 A;  4L0R A;  4X1Y E;  3VU7 H;  1S94 A;  3ZMZ B;  3I9W A;  4TUY E;  2N1G A;  2VKD A;  2VAS A;  4ZI3 C;  2A3D A;  2EHO B;  5JR9 B;  2KXP B;  3C98 B;  5FY7 A;  4ASK A;  3AB3 B;  3Q9D A;  1G73 A;  3CQX C;  4AXP A;  2L8K A;  2EHO A;  4JEU B;  5JR9 A;  4AKG A;  3KFW X;  5LBQ B;  1BR2 A;  4ANJ A;  5M4Y A;  3ZCJ A;  5FXV A;  1H7C A;  2X9Y A;  3I9Y A;  4J2C A;  3KBT A;  5JDQ A;  2V7I A;  5LHH B;  4IGU A;  2LHN A;  5AFU L;  2XAJ B;  3DJB A;  4PW8 A;  2L3L A;  4TV9 E;  2WMN A;  1VRB A;  3LFM A;  2X66 A;  1FEW A;  3IF8 B;  1D0Z A;  2BVM A;  3AAI A;  2CXD A;  4OFZ A;  3ZC0 A;  2M67 A;  1LVF A;  2VKH A;  2CWY A;  3CQG B;  1YKH B;  2PFV A;  5KMG P;  3NRX A;  3AAE B;  3E22 E;  1Y64 B;  1NWM X;  5FMN A;  2NTX A;  2X9H A;  3ZC1 A;  4CXW A;  4P0B A;  3RYI E;  4HN9 A;  3FXE B;  5LCY A;  4AKR B;  2CCQ A;  3PU3 A;  1V9D A;  4MHC A;  2KWI B;  1UX5 A;  5DJQ C;  4H63 V;  4G63 A;  1HFA A;  2KZ7 B;  2MYS A;  3IBP A;  3QC9 A;  5EK4 A;  2MTQ A;  2K9A A;  3WI3 A;  2E9X C;  2IC9 A;  4WW0 A;  5JDG A;  3ANW B;  5L3F B;  4O4L E;  2RA1 A;  3C50 A;  5FXX A;  4CI2 B;  1FIO A;  3AAA B;  3PUA A;  4L9I A;  1UX4 A;  5TAO A;  3ANW A;  4HE8 A;  3N9M A;  2XAG B;  3Q2M A;  3KV6 A;  5LOV E;  2W00 A;  1NAF A;  3R6N A;  2W63 A;  5LNK A;  1U5P A;  4ZI7 E;  4H9R C;  5L3B B;  5LBM A;  4ADZ A;  5DAB A;  3KV5 A;  3JC6 D;  5LXT E;  3RKO A;  2CA5 A;  4DVD A;  1QSD A;  4X20 E;  2DCF A;  2C5I T;  5C8Y E;  3SWH A;  3C4W A;  5LGU B;  3ZCI A;  2X67 A;  3Q5X A;  2X9X A;  2VWA A;  3C4X A;  3MXZ A;  4GK5 E;  4XZC A;  3RRW A;  3BQL A;  2D0U A;  4JUY A;  1SHZ C;  2K5B B;  4GYR A;  4ILU A;  4PK4 A;  5LA6 E;  5EK3 A;  3GN5 B;  2WWU A;  4PJN A;  2H7O A;  4H9S E;  3N2O A;  4JLE A;  3GN5 A;  4EB6 E;  1ZHC A;  4QXB B;  4O4J E;  1ZKE A;  3SRZ A;  1MNE A;  4H9N C;  2XAQ B;  1LRZ A;  2NTY A;  1LKX A;  4IE0 A;  2C5J A;  3VHL A;  1WLX A;  2KWH A;  4PNI A;  2D5U A;  3B57 A;  5LHI B;  4KBM B;  2Q9Q C;  5JDF A;  3AA0 B;  4GIW A;  2DLR A;  4IE4 A;  2CLY B;  3AVR A;  3H37 A;  4HGA A;  2UXN B;  3KIN B;  4DND A;  2X0L B;  4TX5 A;  4H63 H;  3SS1 A;  4A56 A;  1D1A A;  4UV9 B;  3ESL A;  3EDU A;  3ZMU B;  3N9P A;  4AQF C;  3D0T A;  4DBQ A;  4I50 E;  4ZS2 A;  2X68 A;  3N9N A;  3RYC E;  3RC3 A;  3FB2 A;  2ZMA A;  3OJA A;  3ZYK A;  2L9Q A;  3JC6 C;  4OYJ A;  2NW8 A;  2XHE B;  4YLH A;  2E9X D;  3KVB A;  1MMD A;  2LSJ A;  3PU8 A;  5FY1 A;  4KP3 C;  1D0X A;  3A5X A;  4U74 A;  2P9B A;  2BVL A;  2WAU A;  2LSY A;  2LSI A;  3FBZ A;  2CE7 A;  4UVA B;  4ZHQ E;  1HG5 A;  3O1J A;  4YJ2 E;  4ZS3 A;  2LOS A;  2UXX B;  3ZYL A;  4IIJ E;  1MMG A;  4MLK A;  3ZEF B;  4WBN E;  1E1H B;  2LJL A;  5JVD E;  4UF0 B;  3V5S A;  2VKJ A;  3KV9 A;  5KX5 E;  2ODV A;  1D1C A;  1O3X A;  1KK7 A;  4PJJ A;  3N2K E;  2LT3 A;  4UF0 A;  3E0Z A;  4YJ3 E;  4E7S A;  1MIW A;  4CXX A;  2I59 A;  2C5K T;  3HR0 A;  5J2U E;  3KV4 A;  4QXH B;  1IZN B;  5H6R B;  4HKA A;  1IJ5 A;  2W62 A;  3U78 A;  3O9X A;  4QX8 B;  4BJN A;  2G0U A;  4TV8 E;  4XBF B;  3AA6 B;  1BR0 A;  3NBX X;  4EXT A;  4K0U A;  3ETV A;  5GON E;  3K3N A;  4N78 D;  3PUQ A;  5JDN A;  4UEM A;  3PE0 A;  2V7J A;  5FXW A;  2Q9Q D;  2VK9 A;  5DQV A;  2LHR A;  4JEH B;  4CXY A;  4B6X A;  4EOZ B;  3C51 A;  3RYF E;  5HYA A;  2V26 A;  4AQG A;  4GYS A;  2EHO D;  4UVB B;  4IHJ E;  1MMN A;  4UIG A;  4PJM A;  3K3Q C;  3P7I A;  5HWY A;  4KMC A;  3ZMT B;  1HCI A;  3EUH A;  4F6R C;  1ZV4 X;  2DHR A;  5BMV E;  1HG2 A;  1LVK A;  3BQK A;  3ZJ1 A;  5LHG B;  2DI4 A;  3N9O A;  4C91 A;  2KND A;  3VKG A;  5JDM A;  2LE8 A;  4IST A;  3B13 A;  4AKI A;  4UVC B;  5LJN A;  1WYC A;  3BQI A;  2ZM0 A;  4L5G A;  3PTR B;  3F31 A;  1MIY A;  4PK5 A;  5EZY E;  3TKL B;  4PJL A;  3UUX B;  3KVA A;  4C90 A;  2A72 A;  4CI1 B;  2BDE A;  3MKD A;  4H9P C;  3ZPO A;  4EIW A;  2VL8 A;  2D2S A;  4BA9 A;  3LBX B;  3CPZ A;  2HH7 A;  3SOL A;  2B1E A;  2OA5 A;  3F2E A;  4OYK A;  1CUN A;  2HPL A;  3LBX A;  2Y8D A;  2H3R A;  2MBG A;  5ETW A;  4U72 A;  5HXR A;  5F8P A;  4G2A A;  4O8S A;  5HAX A;  2WMO A;  3BK9 A;  1MIV A;  2KIN B;  3J7Y q;  3C4Z A;  1D1B A;  4CQI A;  3CKD A;  3F57 A;  5KDM C;  2JJ9 A;  1US7 B;  2JMH A;  2LM9 A;  2CXL A;  5CA1 E;  1BR1 A;  2HPJ A;  1T98 A;  3CX8 B;  3HKB E;  3UUN A;  4ISS A;  2C0S A;  3UUL A;  5H6Q B;  4MBQ A;  5HXH A;  2E9X B;  3RRC A;  3HA4 A;  2ES0 A;  5JQG E;  2YU1 A;  3N9L A;  3CQC B;  2KMF A;  4PFP A;  3ZMS B;  2EHO C;  3HKD E;  2E9X A;  3P8C D;  4AKH A;  3LJC A;  3AVS A;  3T8O A;  4O2B E;  5LGN B;  3N5L A;  2VB6 A;  2PJQ A;  2K48 A;  2XUE A;  3MK7 C;  2YU2 A;  2NOX A;  2QA7 A;  3LG7 A;  3GWH A;  3R84 B;  2QGS A;  3MJX A;  5L3E B;  4P09 A;  3ZLI A;  2PBI A;  3J9X 1;  3I0O A;  3RPU A;  3N9Q A;  2XAS B;  1KNZ A;  4NUV A;  4ZI2 D;  2K24 A;  3PUS A;  2ZM2 A;  4E7Z A;  3UT5 E;  4M1P A;  1YD8 G;  1HS7 A;  5L3D B;  3O1H A;  4FJO A;  5L3C B;  3DP7 A;  4YHJ A;  3L09 A;  2W0G A;  4EYU A;  5FNV E;  3I0Q A;  5J1G A;  1Z0P A;  2ZLY A;  1FMW A;  2Z6E A;  3NRY A;  3OKQ A;  2D0T A;  4GOU A;  3ZN1 B;  1HX8 A;  2Y6X A;  3EVY A;  2JQQ A;  3CX6 B;  5L2L A;  2IW5 B;  3OYZ A;  4UEL A;  5J2T E;  3UFE A;  5E0O A;  4Z8X A;  3CML A;  4IE6 A;  2LOP A;  4CI3 B;  3Q5W A;  4MFR A;  2JMK A;  2Q9Q B;  4EZH A;  4HEA A;  4XAX B;  1OWA A;  2BZB A;  2VKO A;  2NP9 A;  3HL6 A;  1WR6 A;  3ZMV B;  4HFV A;  2CMR A;  3LK4 2;  4TZ4 C;  2Q9Q A;  4WNK A;  4ZOL E;  3FHN A;  4IE5 A;  1OXZ A;  4IDZ A;  3UUM A;  4QKN A;  3C64 A;  2NWB A;  5HXC A;  3W15 B;  5HXS A;  3AA7 B;  3KDS E;  5CA0 E;  4O4H E;  4X1I E;  4QX7 B;  4GK0 E;  1SA0 E;  4UXN B;  3HKC E;  4AQF A;  5LYJ E;  4DBR A;  5LGT B;  2YEV C;  3I1A A;  4AI6 A;  2PG8 A;  3H3A A;  3FBL A;  1HTJ F;  3N2G E;  3OYX A;  5FXZ A;  3ZYM A;  1VOM A;  3ZN0 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...