1WRIA

Crystal structure of ferredoxin isoform ii from e. arvense
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
93
structure length
93
Chain Sequence
b'AYKVTLKTPDGDITFDVEPGERLIDIGSEKADLPLSCQAGACSTCLGKIVSGTVDQSEGSFLDDEQIEQGYVLTCIAIPESDVVIETHKEDEL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ferredoxin II
molecule tags Electron transport
source organism Equisetum arvense
publication title A structural basis of Equisetum arvense ferredoxin isoform II producing an alternative electron transfer with ferredoxin-NADP+ reductase.
pubmed doi rcsb
total genus 19
structure length 93
sequence length 93
ec nomenclature
pdb deposition date 2004-10-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00111 Fer2 2Fe-2S iron-sulfur cluster binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1wriA00
1NENB 1N62A 1V97A 2KAJA 2W3RA 2WS3B 3AE3B 3B9JA 5C2TB 1E9MA 2CJNA 2H88B 2PKOA 1L6UA 1VDVA 1SB3C 1GAQB 1IUEA 4YSYB 2W54A 3L4PA 1QT9A 1OQRA 1PUTA 2PVGC 1JALA 3AE4B 1JWBD 3ZYYX 2L83A 2MJDA 1XO3A 1NEKB 3P1MA 3NVZA 1DOYA 3P4PB 1FMAD 1OQQA 1QLBB 3NVWA 1VJKA 5EE3A 3ETRA 1KFYB 1J7BA 1XLQA 1JROA 3W9CB 4N6EB 1FXAA 2CJOA 3CIRB 1RYJA 3P4RB 4YTNB 1JQ4A 4C7ZA 3HUIA 3P4SB 5MPOA 5H92C 1DOXA 2CU3A 1JWAD 1QOFA 2BT6A 1T3QA 2BS3B 1KRHA 1I7HA 3LXFA 3AE2B 2W3SA 3RPFC 1DOIA 3HVZA 1QOAA 2JQRB 1FO4A 4YSZB 2WDQB 1RFKA 3NVVA 5AUIA 3NRZA 2Y5CA 1SF0A 1WYGA 2K22A 3HRDD 3AMZA 3VRBB 1PDXA 1YJIA 1ZP0B 4KX6B 2WDRB 1XLOA 4US8A 1JRPA 1N63A 3KWLA 4ZOHC 1TKYA 2QJLA 1R7SA 3P63A 5GXGB 1E6EB 3SFEB 1F0ZA 2HTME 4JX1C 4YT0B 1B9RA 1RWSA 2PVOD 3FAHA 2AX5A 1FFVA 2M56B 3AM9A 5G5GA 1QF6A 5EE1A 3AEBB 4P6VF 1E10A 4US9A 1XLNA 1NI3A 1E0ZA 4HROA 1ZUD2 1ZXIA 1RM6C 1N5XA 2DWQA 2KMMA 4ZHPA 2EKIA 3AEGB 1FM0D 1QOBA 1J7AA 3DWMA 3WCQA 3AEEB 3VR8B 3AE8B 1FIQA 1WGKA 2WDVB 2MH7A 3AEDB 3NS1A 1N5WA 2OHFA 2WQYB 3AEFB 2MJEA 3AV8A 1N61A 5EE9A 3AE5B 1SIJA 2WU2B 3SFDB 3BIID 3AEAB 2W55A 1CZPA 2LEKA 2N0SB 3VR9B 1TKEA 3AECB 2BS4B 1WXQA 1AYFA 1FFUA 1J7CA 4YSXB 1GPXA 2QIEB 2B76B 3EUB2 3B2GA 5G5HA 2BS2B 1XLPA 3AE6B 5C3JB 3FC4A 4JWSC 1FRRA 4N59A 2E3TA 1YQ3B 4JWUC 2K9XA 1JW9D 1CJEA 4IDIA 4ITKA 3NVYA 2K5PA 2L52A 1KF6B 2MJ3A 5H8YE 5AUKA 1L5PA 4FXCA 1E7PB 1OFFA 3LB8C 5EE0A 1A70A 2PIAA 2Q5WD 2WU5B 3ABVB 1VLBA 2WP9B 2M19A 3AB5A 2JX5A 3AE9B 1AWDA 2ACZB 4ZHOA 4LTUA 3W5UB 1V8CA 4C80A 1QOGA 1UWMA 1N60A 1NYRA 1WRIA 1L0VB 1NVID 2G1EA 3P4QB 4YTPB 3W5VB 3B2FA 1TJEA 4C7YA 3AE7B 3VRAB 1FXIA 1NYQA 1ROEA 4A9AA 2FBWB 3CWIA 4YXDB 3AE1B 1ZOYB 1FRDA 3AH7A 3PO0A 4YTMB 3AN1A 1TYGB 3SR6A 2WLBA 1DGJA 2H89B 1EWYC 3DWGC 4N58A 1WWTA 4USAA 1PFDA 4WWMA 1YJJA 1TKGA 1L6VA 4HRSA 2DBYA 4WQMA 1YQ4B
chains in the Genus database with same CATH superfamily
1EF1A 2HTHA 2NPTB 3NZUA 1OQRA 4RF1A 2L83A 1TS5A 2ZZPB 3DBLB 1VCBA 3CIRB 1PGBA 3NHEB 2JY6A 5MPOA 3N32A 5J18A 4BAXA 5FR6A 2WDQB 3RNBC 5JHBA 3Q8BA 1XLOA 2K39A 1N63A 4BKTA 5C23A 4EOYA 2DENB 1IGCA 4ANUA 3AM9A 1UF0A 2DAFA 4NAWA 2WGSA 1ZDXA 2EKIA 4HDOA 2R61A 3A9JB 4XWTA 2XK5B 3TEWA 2V0GA 3AEFB 4II3B 4RM9A 2Y5BB 5EE9A 3T8MA 2Z59B 4AOFA 1V80A 1STEA 4C4VB 2L1AA 3APFA 3QWZB 5IP4D 4CO7A 3AXCA 5IN7A 1FRRA 2KQ7A 2MX2A 2GOWA 2ZJDA 2L52A 1FNVA 2KN4A 3L17A 2WXRA 1JWMD 1N60A 1NVID 2N9LA 1TBEA 1XQQA 3A9KA 1TJEA 1FXIA 1F77A 3URYA 2N9XA 1WIAA 1EWYC 2GLSA 1TKGA 4ZRQA 1YQ4B 2RDGA 4DQOC 3FKYA 3TIXA 4A8XC 1L6UA 1VDVA 4FHJA 3D32A 2N9EB 3Q14C 3RFZB 2L0TA 4K81A 4UDUC 3WIMA 1XO3A 3R7QA 2C7HA 3PHXB 3V6EB 1JROA 4PS7A 4DHZB 1I4XA 2JZZA 3CSTA 4GN1A 2PPHA 2IBIB 4RFBA 3MHSD 3UINB 2RPQA 4L1BA 2LASA 3Q69A 2JQRB 4NY0A 1D5XC 1PDXA 4R3DA 4AUQC 3NY5A 5JHAA 3BZDB 3ZNID 5G5GA 3UIOB 2K0PA 2FAZA 5FKAC 1RM6C 1WGYA 1KOTA 2RD0A 1FIQA 2BYTA 4MT5A 3AU5A 2JSVX 1SIJA 1I4QA 2K25A 3ZXRA 2SEBD 2BS2B 3R3MA 1JW9D 2LZ6A 2K5PA 1E7PB 4MELA 2PIAA 2Q5WD 4FBJB 3AB5A 2LJIA 3JW0X 3ZNHB 3PLVA 1E7VA 3W5VB 1BXTA 3GE8C 1OTRB 1OEYJ 1V9JA 1ZOYB 2M17A 2KWUB 2LD9A 3ZIMA 4NZLB 2KFKB 2INNE 3PTFC 3PT2B 3Q3JA 1MFWA 3VH4B 2IY1B 1WRDB 2INCC 1M94A 1PUTA 2LXCA 1F52A 3P1MA 4ZYNA 3H7SA 1RLFA 1WI0A 2BBCA 1IGDA 2AL3A 3PREA 1AN8A 3BK1A 1VR9A 3IVFA 4YTNB 4A90A 1WXMA 2LGSA 3WAPA 3H1UA 2WXMA 4XWWA 1GB1A 1QOAA 2EKEC 3NRZA 3JSVA 2WDRB 2WNMA 3R7RA 2LRUA 1YIWA 1T5XD 1Y8RC 4TMAB 2LMCA 1WJ4A 1XCTL 3AEBB 2CHWA 1L0YB 3EFCA 4DHJB 4XDDA 3VFKA 2QILA 3QHTA 3WAMA 2DZIA 3NS1A 3W1SA 4ICVA 3QJZA 2MJEA 4RMAA 2WU2B 5BYSA 3V05A 3E56A 1K51A 4OW0A 4DXGA 1AYFA 5E6NA 4G0NB 4KDIC 5BMHA 3PPAA 2E3TA 2K9XA 3E9SA 1RFAA 3DDCB 2GBNA 3NUHB 4ANXA 2LGXA 2BQQA 4F7ZA 1TS3A 4PT5A 3DHGC 1AWDA 2ACZB 3EA6A 4AJWA 3P4QB 3U52E 2QMTA 4OZAA 1FCCC 2JXXA 1SE3A 4DHZE 1T0YA 3AH7A 4P7IA 2E6XA 2DZKA 1UNSA 3SR6A 5J17A 1J0GA 1CQVA 4KGRA 1WWTA 4WWMA 5C2TB 2CJNA 3RMKC 4WH4A 3U2SC 1GAQB 1IUEA 4KSKC 3RNAC 3H6NA 4XX5A 2IDYA 1QLBB 1VJKA 4KVGB 1J8CA 1SJED 3DBSA 1GJZA 1YX5B 2RMMA 1EU4A 2BS3B 1SXTA 3M95A 1UBQA 4HPLB 1C4AA 4JPSA 4RF0A 2M0AA 1Z2MA 1AW7A 1WGRA 4KIKB 4WWPA 2V3NA 3ML8A 4JLCA 4M8MA 2MP2B 3N20C 4CHKA 5GXGB 4ANWA 4ARIA 4XE0A 2IO2B 1RRBA 3RNEC 4JIOU 4H2AA 1WZ0A 2V3PA 3BY4B 4GDKA 4JQWC 5EE1A 3MFGA 4LNNA 1CK1A 2FCMA 1WE7A 2JYTA 2KT7A 1I35A 2L76A 2OHFA 3QIJA 3V60A 5GMVA 3AV8A 2RDBC 2KJ6A 2L00B 3VR9B 4I6LB 2PE9A 1YOVB 2FNJB 3QK0A 1JCKB 5C3JB 4N59A 1YQ3B 4F8CB 1SSNA 1MVKA 4MM3B 3KYCD 3N1YC 1A70A 1Y56A 3EECA 4FJVB 5CHVC 2K8HA 4EZLA 2CHXA 1UELA 3BYYB 1TZ1A 4YTMB 1SGHA 2N7DA 3PRPB 2QEJC 1FD6A 4USAA 4EUTA 5D94A 3TCAA 5HHDG 4RNAA 3QQ8B 3MC0B 3RNGC 4BKSA 2HJ8A 1L7YA 4HJKA 2VZKD 5C1ZA 2M1MA 2L8JA 4PYUA 3H7PA 3NVZA 4TKNA 3Q3OC 2MBHA 1PYWD 2KYWA 1IBXA 4JGHB 1FXAA 1K8RB 2ZPNA 3P4SB 5H92C 3SD5A 3H9DA 3U7DA 5JH5C 2G4DB 4YSZB 3W2DA 1EU3A 2BYFA 2DYBA 3ZDTA 1MJDA 3ZUNA 2QJLA 3P63A 2UWQA 1A5RA 2MBEA 2JZ3B 2Y5PA 1F0ZA 1WGDA 2PVOD 2MLBA 4HK2A 3DBRI 1KLGD 3FAHA 1FFVA 3B08A 3DCGA 4HXDA 2CR5A 3VTVA 1V5OA 2EMSA 4AWJA 1C78A 5LXHA 1I4HA 3I3TB 1GC7A 1QOBA 3DWMA 3WAOA 2G4SA 2TSSA 2MH7A 4PS3A 2FCNA 1VZ6A 4M0WB 2WXJA 2J0MA 2RPVA 3UF8A 3SFDB 2I1KA 2BWFA 4K1RB 2N7EA 4ASWC 3VUYA 3DBHB 2KO3A 3EUB2 5G5HA 4LK0M 2GI9A 4XYCA 4EKUA 1WJ6A 2NBUA 1V81A 4IDIA 1KF6B 3IAS1 1H4RA 2RSUA 2HE7A 2KDIA 4IM3A 3CSFA 4RGOS 2ZNVC 3HIZA 2IGDA 2BPSA 4C56C 2HDEA 1NYQA 4A9AA 2BWES 4AQ7A 3QX1A 2GMIC 1GUAB 4J3OD 4I6PA 5E6JA 5FK9C 4BFRA 4GXBA 3L54A 2ZCCA 2KZRA 5KHQA 2H88B 2DX5B 3ZYYX 2MJDA 3ZKJC 2LUMA 2LHDA 4OZBA 3M63B 3DOWA 2R2OA 2CJOA 4IWQA 2ASQA 3HUIA 1DOXA 1JWAD 1KRHA 3I5JC 4P16A 5L95C 3RZWC 2KTRB 2M8SA 2WXNA 3AMZA 3N3KB 3VRBB 1YJIA 3K9OB 2BF8B 4KX6B 4DXAB 4ZOHC 4MEMA 2JXTA 3VVWB 1GOZA 4JX1C 2MWSB 4N9F4 4K3CA 2CHZA 3TUOA 2AX5A 2CS4A 4LJPB 3TMPB 2MCNB 2UU7A 3PZ8A 5E6PA 3AE8B 1SEBD 2DZMA 3NOBA 1YD8U 2AWTA 2DYOA 4GLSC 3H8HA 3NZ3A 3O13A 4NJ7A 5AZGA 3BINA 1FXTB 4X57B 4WAFA 4ZYSA 2ONQA 3LYYA 1WXVA 4GOCA 4E71A 2DHZA 2IZVB 2MSED 4HJGE 5KHOA 3CMMB 3R2TA 2A4ZA 5H8YE 5AUKA 1T0SC 4IWOA 5FR3A 2KWVB 4MACA 2WXHA 3IHPC 2BTEA 3AE7B 5HI1A 2REXA 1OGWA 4NJCA 4ZRPA 4WQOB 2NTTA 2O2VA 3U30A 1FEHA 3C8YA 4XDCA 1V97A 2KAJA 3PHWB 3HM6X 2JU6X 1YN3A 2WX1A 1XF5L 3KUZA 1LM8B 4II2B 1WXAA 3P4PB 3UIPB 3L08A 2PLPA 1DYQA 2MW5A 4S0RA 4NNJB 2BT6A 1T3QA 2KTFA 5TSSA 4YWGG 2LXAA 2K1FA 4LLGM 4GIVA 1Q10A 2KDFB 4US8A 4MGKE 2N1VA 4W9DA 4NJ6A 2D2QA 1E10A 1UUPA 1MHHE 2KMMA 1J7AA 1OQYA 3AEEB 5D2MB 4HWIB 2K6DB 4M8NA 3KVFB 2KN5A 3AU4A 2N0SB 1WE6A 1ET9A 2BS4B 1L4ZB 1C76A 2IYDB 2NS5A 3B2GA 3NZSA 1QILA 3NVYA 2SAKA 1E8ZA 1EWCA 1QZEA 4ICUA 1FNWA 3BVMA 1M4VA 2M19A 2WWZA 1ESFA 2IO1B 4AJYB 1I4GA 2JT4B 4FADA 2ZW0A 4YXDB 3I63C 1LFDA 2WLBA 1WMHA 2W9NA 1PFDA 2O6VA 3ALBA 3V6CB 4HVBA 2W3RA 1PQSA 2MRPA 3AE3B 1V6EA 2UYZB 3B9JA 4FA6A 2NCNA 5LLIA 1SB3C 2WX0A 1WM2A 4EE2A 3GP7A 2OOBB 1V49A 2BB6A 2RDHA 3ZRFA 2INDC 1K53A 3ZRCA 4DBGA 1OQQA 1LO5D 3NVWA 1XLQA 2WXIA 3A1QA 2DNFA 4N6EB 1GB4A 2KFKA 2DZJA 1WH3A 5DPWA 3LXFA 2HJ1A 3K9PB 4WJOA 4TQ0A 3NVVA 1RFKA 3KW5B 3SHQA 1ZP0B 3IXSA 4MGZE 1H8CA 3R8BA 1P3QU 1WGHA 2KX0A 4W9HA 2K6QA 4MJSB 1QF6A 2XN9C 1L0XB 3Q6BA 4M01A 1ZXIA 3P2BA 3IT4B 1I4PA 5DCNA 2YVCA 2XEWA 3AEGB 1JMLA 5DPSA 1Z5SB 5AZHA 1YN5A 4L2YA 3BWUD 1MPEA 2VZKB 3PV1A 5CHWA 4A3OA 1SIFA 4KDLB 3N1ZC 3FC4A 1KM7A 4RGMA 3Q8AA 3RUIB 4LDTD 5HFYA 3LB8C 3A1QB 1XXGA 3RCZA 2EELA 4ZHOA 2WYQA 3PS6A 4C80A 1WRIA 1WYWB 3RT3B 1T6BX 4B9KA 2FE8A 4IG7B 2JUOA 1MG8A 3AE1B 3PO0A 4HCNB 2G45B 1SE2A 1DGJA 3U8ZA 1NDDA 2KANA 2PJHA 4JE3B 2N7JA 1T0QC 4HDQA 3NG0A 3DPDA 1TIFA 4J6IA 4NQLB 3L4PA 3OJ3A 3P42A 1FCLA 4AP4C 2AQ2B 1E8YA 2JVCA 4W9GA 2KC2A 2KNBA 2LGDA 2X8XX 3UI3A 1TTNA 1ZXHA 2IO3B 3P4RB 4GGQA 3DBHI 3AE2B 3IFWB 1CMXB 1NBFC 1P98A 2MBBB 2CKHB 3T3OA 1WR6E 2LVOA 3PLUA 2JPHA 3HHMA 1HZ6A 1TS4A 5D7GA 1TZOA 1E8XA 4LDTB 2M4NA 3BK2A 1UBIA 5AEKB 1WGGA 2M56B 2X38A 2D10A 3VTWA 3MJWA 1ZUD2 2J4XA 2LI5A 4ZRKA 3VR8B 3DVNU 1N5WA 2K8BA 2KWCA 2YLMA 2FUHB 2W55A 4W9LA 4XGAB 4RM8A 4YSXB 3A4RA 1D5ZC 3ZNGC 3VUXA 4G50A 4LNFA 4EEWA 1WM3A 4ITKA 3RNCC 3A9JA 5BYQA 1KH0A 1ZW7A 5I4DA 4MGYE 2C9WB 1F9JA 3UQBA 1WY8A 4WJQA 1KJTA 4LTUA 2OJRA 2ZW1A 3LJ3A 4FJYA 3EFUA 3CWIA 2D3GA 3L10B 2KD0A 1TYGB 3QAQA 2PEAA 2BB5A 4PK1A 1L6VA 4HRSA 2DBYA 4FHKA 2KDBA 4OHJA 3N30A 3PRMB 4GDLB 2BW2A 1QT9A 4IC7B 2LGIA 2Z0EB 4OVZA 2L7RA 1DOYA 5D3IB 4WJPA 5IO9A 4W9IA 3A9KB 2FCQA 4K7SA 3ZW3A 1GNUA 2MA9B 1ZKHA 3RNFC 4CYEA 2W3SA 4W9JA 1JWUD 1VD2A 3U7ZA 5LNK1 3ZJUA 1F2RI 2IO0B 5HKHA 2KK8A 3SDLC 2MP2A 3ML9A 1IBXB 1C4CA 4FN2A 1FM0D 4G3XB 2IJ0A 3GS2A 2KWDA 2K3UA 5L83A 2BVCA 3MC8A 1IYFA 3QA8A 2FIDA 2KHWB 5BO4B 3HVDA 4BKGA 2L05A 1TKEA 1X1MA 1YJ1A 1FFUA 2WXKA 3A33B 4WWNA 2N1WA 4BOZB 3IT6B 2G3QB 2CU1A 2RGFA 5EE0A 3UQAA 4C4VA 5D3DA 3AE9B 2N9KA 2QC8A 4DK5A 3OWEB 1R4MB 2V3SA 2MBOA 4OZCA 4BBNF 1ROEA 4ZRIA 3GE3C 3VDZA 3DWGC 2NPTA 1XT9B 2J42A 5T8IA 1ISNA 1N62A 3J9CA 1UWXA 1P1AA 2DLBA 2ZNVB 1R4MI 4TUUA 1U4AA 2K8CA 2KOXA 1UH6A 3RYTA 4KV2A 5IAAC 1E8WA 3C19A 3T9LA 4K7WA 3VH3B 1JRUA 2GBMA 2QDFA 4RH6A 4YL8A 3H7PB 1TY0A 5HG2A 2FIFA 1BUIC 1ZE3D 1C9FA 1KLVA 1JWSD 3JYUA 5CHFA 2D3AA 2KFJA 2N4FA 2KJHB 4OVVA 3B0AA 4P1CC 2JRHA 4P6VF 3ECIA 4US9A 1FNUA 2KC1A 1D4BA 2GBRA 1GG3A 4ZHPA 5D6JB 3W1YA 1SE9A 1WGKA 4EZKA 3AEDB 1N6ZA 4NAMA 4D2KA 2QHOA 3ZO5B 1N61A 2ZEQA 4EFOA 1SBBB 5EDSA 3JSVB 5BMIA 3RULA 2Y3AA 4M02A 4G11A 1R4NI 3AE6B 1WMHB 4JWUC 4RCOA 2IGHA 1HA5A 2BYVE 1L5PA 2WU5B 3WA0A 2DAJA 2OJWA 1QOGA 3FILA 2G1EA 3BVGA 4IWPA 3GOEA 3ZTDA 3GB1A 3N1XC 2AEHA 4A55A 1B1ZA 4IM2A 3ZTCA 2FUG1 5DPTA 3EGRA 1BT0A 3BVZA 2J7QB 1WR1A 4WURA 1E90A 3ZGZA 3T3NA 4YSYB 3KUCB 2L0FA 3TSSA 4REZA 1S3SG 3DBLI 4AS1A 4PS8A 2HD5B 3M62B 1KFYB 2C60A 3BYTB 1TY2A 3W9CB 1RYJA 4C7ZA 4K7UA 3Q2AC 5IOIA 4NAWB 4W9EA 5AZFA 1L4DB 1FO4A 4W9KA 1LGRA 1SF0A 2ZVNA 3HRDD 4W9CA 1R7SA 1WJUA 2VH2A 1E5WA 1KTKA 1WF9A 3GZNI 4IW0A 2JWUA 1VZ7A 4MDKE 2PW9A 3LDZE 4DWFA 1E0ZA 4HROA 4LNOA 2DWQA 2M0XA 3PVLA 2WXPA 4MSQB 2D07B 5BYRA 1C3TA 4MM3A 3DBRB 2GB1A 5TR5A 2KMAA 2JYEA 3ZDMC 3AEAB 2XNAC 2WXOA 4KIKA 3AI5A 1J7CA 2QIEB 2B76B 4QAYA 3VTUA 3KWVA 1CJEA 2MJ3A 1XEEA 4FLHA 3EC8A 3ABVB 3CF6E 4URKA 2BYEA 2AL6A 3W5UB 1NYRA 2JRIB 1WFYA 2KVZA 4A6QA 5JZEB 3DHHC 3TEZA 1LQBA 2D3CA 4KSLC 4L23A 1ZDVA 3TJPA 3UGBB 2NVUI 3AN1A 2GRIA 2L3ZA 1HEZE 1HXYD 2V4LA 4PYZA 1K50A 3V62A 2KTRA 1YN4A 2W54A 4LJOB 5G55A 3IG3A 2KACA 2PVGC 1MG4A 4K3BA 3NS8A 4GDLA 2J0KA 1WX8A 4DXFA 5EE3A 3ZQ4A 1J7BA 3N9YC 2C5LC 1T0RC 3ZVVA 3TBLD 3OG5A 2WXGA 3JVZX 2LGYA 4B95A 1UGJA 2Y5CA 2Z8LA 1WYGA 2K22A 2INPE 2D5GA 1P7EA 2KQSA 2V4IB 4WWOA 4E3CA 1HQRD 2KLGA 3KQ4A 1SJHD 2ZVOA 3M3JA 3VUWA 1V1PA 4ZDVA 3IBEA 1P7FA 2V1YA 3VQIA 2JZPA 4YT0B 1B9RA 3I57A 2GBJA 1BMLC 3DQVA 1EUVB 4OVUA 1F2RC 1C77A 2J0JA 2BKFA 4B0EA 4IKGA 1Q0WB 4KKJA 3IAM1 3AE5B 5J2RA 1MHXA 2MBQA 3Q3MC 1C1YB 3O65B 1D3ZA 3AECB 4MH0E 5G2NA 4HKZE 1YMHE 5IA7A 4S17A 1VZ8A 1I4RA 3RN9C 2JX5A 1V8CA 2XBBC 2I2YA 1Q5WB 2BGFA 4ANVA 1D6EC 1WZ3A 3VRAB 2J53A 2FBWB 4KZCA 3MJ5A 4HEA1 1V1PB 1L0VB 3EHVA 1QKZA 2C7MB 1NENB 3APDA 2WS3B 3ZLZA 4NPNA 3MTNB 2PKOA 3GZNB 2IGGA 2WHIA 2R2QA 1JALA 2OEDA 2MHJA 4IM0A 1RAXA 2A5UA 4LNKA 2RR9A 2KJRA 1JQ4A 2LFIA 1V5TA 1V86A 1YX6B 1I7HA 2I38A 3HVZA 2ON8A 1IPGA 2AQ3B 4MGIE 1YNTE 3L16A 4I6NB 3KWLA 2D3BA 1TKYA 1WX9A 4GMVA 4XC2A 3V61A 2HTME 4FJZA 4HPPA 3VXWA 2AYOB 3RI7C 1E7UA 2O6VD 2NR2A 4MSMB 3QCAA 2DYMA 4BBNC 2WDVB 1WSPA 2WQYB 3C0RB 2KQ4X 2IY0B 3KUDB 2PMVA 4TSSA 3TEXA 1CZPA 4HPMB 4WIPA 1WXQA 1C79A 4BVUC 3L0WB 1XLPA 4ACFA 4FULA 2KMCA 2O2VB 3HM3A 4P1BC 1OFFA 1Q1OA 3QARA 3RZFA 2PTLA 2WP9B 3A4SC 1UWMA 1V2YA 4XZ4A 3PSEB 1FPYA 2EMTA 3ZXVA 5E6OA 4BZAA 3U4EG 2NBVB 1FRDA 1P0RA 4LNIA 2PE6B 2H89B 1IP9A 4N58A 4BKSD 1PGAA 3X0WA 4C00A 4M00A 1L2NA 4WQMA 3KYDD 1ZPSA 2KXJA 2KX3A 4GB9A 1TGZB 5IKCM 3AE4B 4JL9A 1NEKB 3X23A 3ETRA 5CX3A 1EM7A 4WJNA 1UD7A 2LJ5A 3PRZA 2QCZA 1QQRA 4HKQA 3DVGY 1YQBA 2CU3A 2LVPA 2LWPA 4MJSA 2YEPF 3PZDA 3MP9A 1ZGUB 3VHTC 1WJNA 5DPRA 2LUEA 2WXQA 3ONSA 4GSWA 1TS2A 2NBWB 1E6EB 1S1QB 3OAWA 3DHIC 1XCQL 3SFEB 4RGTA 2XK5A 2BKRB 2KVRA 4KGTA 3ENEA 3FILB 1XLNA 1NI3A 4E74A 2B3AA 1N5XA 3QC8B 2WDTB 1C4PA 2NTSA 1AARA 3SEBA 3BIID 3HK0A 4KZ0A 2IPKD 3ZNZB 1GPXA 4TV3A 1KLUD 2O6VB 2Z0DB 3ZJTA 2L32A 3SU8X 4KGSA 1PGXA 3KLSX 5LXIB 2MQJA 3V3XA 2I1JA 4EZJA 4Q2JA 2JF5A 1J19A 3Q3NC 2VRRB 1VLBA 3OJ4B 1WX7A 1OEYA 1F1HA 4A20A 3PGEA 3B2FA 4TQ1A 1ACCA 4CQNA 1I42A 2W82A 1XD3B 3WALA 4NQKE 5BMGA 2KLCA 2ICIA 3DVNV 1LXDA 4ARCA 3WANA 3DVGX 1E9MA 4IOIE 2FCSA 3Q8CA 1GC6A 3RD2A 4W9FA 2MEKA 1HTQA 1K52A 1JWBD 1VRAB 3OLMD 4WAAA 2N9PC 4DHJD 1FMAD 5CTRC 4ZRJA 1HTOA 2QSDA 1D5MC 3NJTA 1ENFA 2WXLA 3AULA 3KH0A 1QOFA 3MC9A 4DDID 4MH8A 3RPFC 1DOIA 3TEYA 3L13A 5AUIA 3ZJVA 1NI2A 2KKCA 2NMQA 4LCDE 2VH1A 1UGMA 2V9HA 1WXSA 1JRPA 3W1SC 2ZPYA 4DDGD 4O1NA 2ZCBA 1EF5A 1HZ5A 1RWSA 2C7NB 2YEPB 4KKIA 3Q8EA 4B6WA 4A3PA 2KDMA 3MHZA 3WCQA 4BOSC 3R66C 1V1OA 1UZXB 2LEKA 4F1SA 3B1LX 2LHEA 2JWZA 1G6JA 3S2AA 3R2IA 3TL5A 3VAWA 2LVQA 4JWSC 3APCA 2GBKA 1TT5B 1P9DU 4HLEA 1SE4A 1ET6A 4GU2A 4FXCA 2J52A 3PZ7A 4B0MA 3Q3FA 2KDEB 4GDKB 1HE8A 4YTPB 4IUMB 4C7YA 3Q8FA 1EO6A 2LRWA 5JXVA 2D11A 2G9HD 2AQ1B 3I9V1 1MI0A 2WXFA 1R4NB 4RGNA 4HCPB 1YJJA 4M0WA
chains in the Genus database with same CATH topology
1YN4A 2W54A 3L4PA 2KACA 2VZKD 1OQRA 2PVGC 4RF1A 3P42A 1FCLA 2AQ2B 2L83A 1TS5A 3NVZA 4DXFA 5EE3A 3ZQ4A 1J7BA 1PYWD 3UI3A 3N9YC 1IBXA 1ZXHA 1FXAA 3CIRB 1PGBA 3P4RB 5MPOA 3P4SB 5H92C 3AE2B 2WXGA 4YSZB 2WDQB 1UGJA 2Y5CA 2Z8LA 1WYGA 2K22A 3W2DA 3T3OA 2INPE 1EU3A 1P7EA 2D5GA 2V4IB 1HQRD 3Q8BA 3KQ4A 1SJHD 1XLOA 1N63A 1V1PA 5D7GA 1HZ6A 1TS4A 2QJLA 1TZOA 3P63A 1P7FA 1F0ZA 2Y5PA 3VQIA 2JZPA 3BK2A 4YT0B 1B9RA 2PVOD 3I57A 1BMLC 1KLGD 1IGCA 3FAHA 1FFVA 2M56B 3AM9A 1F2RC 2X38A 1C77A 1ZUD2 1C78A 2J4XA 1ZDXA 1I4HA 2EKIA 4B0EA 1QOBA 3DWMA 4IKGA 2R61A 2TSSA 3VR8B 4XWTA 2MH7A 3TEWA 2V0GA 1N5WA 3AEFB 4KKJA 1VZ6A 3IAM1 5EE9A 2WXJA 3AE5B 2RPVA 1MHXA 3SFDB 1STEA 2W55A 2L1AA 3AECB 4YSXB 1D5ZC 3EUB2 4HKZE 5G5HA 1YMHE 4LK0M 2GI9A 4JE3B 1FRRA 4IDIA 1VZ8A 4ITKA 2L52A 1I4RA 1KF6B 3IAS1 1FNVA 5BYQA 1KH0A 2KN4A 5I4DA 2JX5A 4RGOS 2WXRA 1JWMD 4LTUA 1V8CA 2IGDA 1N60A 2ZW1A 1NVID 2N9LA 2I2YA 1TJEA 1D6EC 4C56C 3VRAB 1FXIA 2HDEA 1NYQA 1F77A 2J53A 2FBWB 3CWIA 4A9AA 4AQ7A 3MJ5A 4HEA1 3URYA 4M0WA 1TYGB 4J3OD 1EWYC 2BB5A 1V1PB 5E6JA 5FK9C 1TKGA 1L6VA 1L0VB 4HRSA 2DBYA 1QKZA 4ZRQA 1YQ4B 2RDGA 4DQOC 1NENB 2WS3B 2H88B 4OHJA 4A8XC 2PKOA 1L6UA 1VDVA 4GDLB 2IGGA 2BW2A 1QT9A 3RFZB 1JALA 2OEDA 4UDUC 3ZYYX 2MJDA 1XO3A 2LGIA 4OVZA 1DOYA 5D3IB 2LUMA 2LHDA 4OZBA 1JROA 2CJOA 1I4XA 1JQ4A 2LFIA 3HUIA 4RFBA 1DOXA 1JWAD 1KRHA 1I7HA 4L1BA 2W3SA 2I38A 3HVZA 1JWUD 2JQRB 3Q69A 4P16A 2ON8A 3U7ZA 2AQ3B 5LNK1 2WXNA 1D5XC 3AMZA 1YNTE 1PDXA 3VRBB 1YJIA 4KX6B 4R3DA 3ZJUA 1F2RI 3KWLA 4ZOHC 1TKYA 3BZDB 2JXTA 1GOZA 2HTME 4JX1C 3TUOA 2AX5A 5G5GA 2K0PA 1IBXB 1C4CA 1RM6C 5FKAC 1FM0D 2DYMA 2IJ0A 3GS2A 3PZ8A 2KWDA 3AE8B 1FIQA 2K3UA 1SEBD 2WDVB 1WSPA 2BYTA 2WQYB 2KQ4X 4MT5A 2DYOA 3HVDA 4GLSC 2JSVX 1SIJA 2PMVA 4TSSA 3TEXA 4RNAA 3H8HA 1I4QA 1CZPA 3NZ3A 3O13A 1TKEA 4WIPA 2SEBD 1WXQA 4WAFA 1FFUA 2WXKA 4ZYSA 1C79A 2ONQA 3LYYA 2BS2B 1XLPA 3IT6B 1JW9D 4HJGE 3R2TA 2K5PA 5H8YE 5AUKA 1E7PB 1OFFA 5EE0A 2PIAA 2Q5WD 2PTLA 5FR3A 5D3DA 2WP9B 3AB5A 2LJIA 3AE9B 4MACA 2N9KA 1UWMA 3W5VB 1BXTA 2WXHA 2BTEA 3OWEB 3AE7B 5HI1A 4OZCA 4NJCA 1ROEA 4ZRPA 3U4EG 1ZOYB 1FRDA 2H89B 2NTTA 4NZLB 3DWGC 4N58A 1PGAA 2INNE 1FEHA 3C8YA 2J42A 4WQMA 5T8IA 4XDCA 1ZPSA 1N62A 1V97A 2KAJA 3J9CA 1UWXA 2JU6X 2DLBA 1YN3A 1PUTA 1XF5L 3AE4B 3P1MA 1NEKB 3P4PB 2BBCA 1IGDA 3ETRA 2PLPA 1DYQA 1AN8A 3BK1A 1EM7A 1VR9A 4YTNB 4A90A 1QQRA 4HKQA 2CU3A 2BT6A 1T3QA 2WXMA 5TSSA 4YWGG 2YEPF 1QOAA 4XWWA 1GB1A 4LLGM 3MP9A 3NRZA 4RH6A 1TY0A 5HG2A 2WXQA 1BUIC 1ZE3D 2WDRB 1C9FA 1Q10A 2WNMA 4US8A 1JWSD 1TS2A 1T5XD 1E6EB 3SFEB 1XCQL 4TMAB 4RGTA 2LMCA 4KGTA 1XCTL 3AEBB 4P6VF 1E10A 3FILB 4US9A 1XLNA 1NI3A 1L0YB 1FNUA 1UUPA 1D4BA 1MHHE 1N5XA 2KMMA 4XDDA 4ZHPA 1J7AA 2QILA 3AEEB 1C4PA 2NTSA 1WGKA 3AEDB 3NS1A 4NAMA 3SEBA 3W1SA 4D2KA 2MJEA 1N61A 1SBBB 2WU2B 5BYSA 3V05A 3BIID 3E56A 1K51A 2N0SB 5BMIA 2IPKD 4OW0A 1ET9A 4DXGA 2BS4B 1AYFA 2Y3AA 1GPXA 1L4ZB 1C76A 1KLUD 3B2GA 5BMHA 3ZJTA 2L32A 3AE6B 2E3TA 4KGSA 1PGXA 3KLSX 2K9XA 3E9SA 4JWUC 4RCOA 2IGHA 1HA5A 1QILA 3V3XA 3NVYA 3NUHB 2SAKA 1L5PA 1EWCA 4Q2JA 1TS3A 1FNWA 2WU5B 3BVMA 1M4VA 4PT5A 1VLBA 2M19A 1AWDA 2ACZB 3EA6A 1ESFA 1QOGA 3FILA 2G1EA 3BVGA 3P4QB 3U52E 3B2FA 2QMTA 4OZAA 1FCCC 3GB1A 4TQ1A 1ACCA 1I4GA 4CQNA 4A55A 1B1ZA 1SE3A 2FUG1 2ZW0A 2W82A 4YXDB 3AH7A 3EGRA 2E6XA 3BVZA 1UNSA 3SR6A 2WLBA 1CQVA 4KGRA 5BMGA 1WWTA 1PFDA 4WWMA 5C2TB 2ICIA 2W3RA 3AE3B 4WURA 3B9JA 4ARCA 3ZGZA 1E9MA 2CJNA 4WH4A 4IOIE 3U2SC 3T3NA 4YSYB 1SB3C 1GAQB 1IUEA 3Q8CA 3TSSA 2MEKA 4REZA 4EE2A 3GP7A 1K52A 1JWBD 1VRAB 2IDYA 2BB6A 2RDHA 4AS1A 1K53A 1FMAD 1OQQA 1LO5D 1QLBB 3NVWA 1VJKA 1KFYB 1XLQA 2WXIA 3BYTB 1TY2A 1SJED 3W9CB 2QSDA 4N6EB 1GB4A 1D5MC 1RYJA 1ENFA 4C7ZA 2RMMA 2WXLA 1EU4A 2BS3B 1QOFA 1SXTA 3LXFA 4NAWB 4MH8A 3RPFC 1L4DB 1DOIA 4TQ0A 1FO4A 3TEYA 3NVVA 1RFKA 5AUIA 1C4AA 1SF0A 3HRDD 4JPSA 4RF0A 3ZJVA 2M0AA 2NMQA 1AW7A 1ZP0B 2V3NA 3IXSA 1JRPA 1R7SA 5GXGB 1KTKA 4O1NA 3R8BA 4ARIA 4XE0A 1HZ5A 1RWSA 2JWUA 1VZ7A 4H2AA 2PW9A 2YEPB 4KKIA 2V3PA 3Q8EA 1QF6A 2XN9C 5EE1A 1L0XB 3MFGA 1E0ZA 4HROA 1ZXIA 3IT4B 1I4PA 2DWQA 3AEGB 2KDMA 2WXPA 3MHZA 1CK1A 3WCQA 1JMLA 5BYRA 1V1OA 2GB1A 2JYTA 2OHFA 3AV8A 2JYEA 1YN5A 4L2YA 3BWUD 1MPEA 2VZKB 3AEAB 2LEKA 2XNAC 2WXOA 3VR9B 2LHEA 1J7CA 2QIEB 2B76B 3R2IA 1JCKB 5C3JB 3FC4A 4JWSC 4N59A 1YQ3B 3KWVA 4RGMA 3Q8AA 1CJEA 1SSNA 1MVKA 2MJ3A 1XEEA 4MM3B 1SE4A 1ET6A 4FXCA 5HFYA 3LB8C 1A70A 1Y56A 2J52A 1XXGA 3ABVB 2EELA 4ZHOA 3PZ7A 4B0MA 4GDKB 3W5UB 4C80A 1WRIA 4YTPB 1NYRA 1T6BX 2FE8A 3BYYB 4A6QA 4C7YA 3Q8FA 5JXVA 3TEZA 2G9HD 4L23A 2AQ1B 1ZDVA 3AE1B 3I9V1 1MI0A 3PO0A 4YTMB 1SE2A 3AN1A 2GRIA 2WXFA 1DGJA 4RGNA 1HEZE 1HXYD 2QEJC 1FD6A 4USAA 1YJJA 2N7JA 5HHDG 1K50A 3MC0B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NEN B;  1N62 A;  1V97 A;  2KAJ A;  2W3R A;  2WS3 B;  3AE3 B;  3B9J A;  5C2T B;  1E9M A;  2CJN A;  2H88 B;  2PKO A;  1L6U A;  1VDV A;  1SB3 C;  1GAQ B;  1IUE A;  4YSY B;  2W54 A;  3L4P A;  1QT9 A;  1OQR A;  1PUT A;  2PVG C;  1JAL A;  3AE4 B;  1JWB D;  3ZYY X;  2L83 A;  2MJD A;  1XO3 A;  1NEK B;  3P1M A;  3NVZ A;  1DOY A;  3P4P B;  1FMA D;  1OQQ A;  1QLB B;  3NVW A;  1VJK A;  5EE3 A;  3ETR A;  1KFY B;  1J7B A;  1XLQ A;  1JRO A;  3W9C B;  4N6E B;  1FXA A;  2CJO A;  3CIR B;  1RYJ A;  3P4R B;  4YTN B;  1JQ4 A;  4C7Z A;  3HUI A;  3P4S B;  5MPO A;  5H92 C;  1DOX A;  2CU3 A;  1JWA D;  1QOF A;  2BT6 A;  1T3Q A;  2BS3 B;  1KRH A;  1I7H A;  3LXF A;  3AE2 B;  2W3S A;  3RPF C;  1DOI A;  3HVZ A;  1QOA A;  2JQR B;  1FO4 A;  4YSZ B;  2WDQ B;  1RFK A;  3NVV A;  5AUI A;  3NRZ A;  2Y5C A;  1SF0 A;  1WYG A;  2K22 A;  3HRD D;  3AMZ A;  3VRB B;  1PDX A;  1YJI A;  1ZP0 B;  4KX6 B;  2WDR B;  1XLO A;  4US8 A;  1JRP A;  1N63 A;  3KWL A;  4ZOH C;  1TKY A;  2QJL A;  1R7S A;  3P63 A;  5GXG B;  1E6E B;  3SFE B;  1F0Z A;  2HTM E;  4JX1 C;  4YT0 B;  1B9R A;  1RWS A;  2PVO D;  3FAH A;  2AX5 A;  1FFV A;  2M56 B;  3AM9 A;  5G5G A;  1QF6 A;  5EE1 A;  3AEB B;  4P6V F;  1E10 A;  4US9 A;  1XLN A;  1NI3 A;  1E0Z A;  4HRO A;  1ZUD 2;  1ZXI A;  1RM6 C;  1N5X A;  2DWQ A;  2KMM A;  4ZHP A;  2EKI A;  3AEG B;  1FM0 D;  1QOB A;  1J7A A;  3DWM A;  3WCQ A;  3AEE B;  3VR8 B;  3AE8 B;  1FIQ A;  1WGK A;  2WDV B;  2MH7 A;  3AED B;  3NS1 A;  1N5W A;  2OHF A;  2WQY B;  3AEF B;  2MJE A;  3AV8 A;  1N61 A;  5EE9 A;  3AE5 B;  1SIJ A;  2WU2 B;  3SFD B;  3BII D;  3AEA B;  2W55 A;  1CZP A;  2LEK A;  2N0S B;  3VR9 B;  1TKE A;  3AEC B;  2BS4 B;  1WXQ A;  1AYF A;  1FFU A;  1J7C A;  4YSX B;  1GPX A;  2QIE B;  2B76 B;  3EUB 2;  3B2G A;  5G5H A;  2BS2 B;  1XLP A;  3AE6 B;  5C3J B;  3FC4 A;  4JWS C;  1FRR A;  4N59 A;  2E3T A;  1YQ3 B;  4JWU C;  2K9X A;  1JW9 D;  1CJE A;  4IDI A;  4ITK A;  3NVY A;  2K5P A;  2L52 A;  1KF6 B;  2MJ3 A;  5H8Y E;  5AUK A;  1L5P A;  4FXC A;  1E7P B;  1OFF A;  3LB8 C;  5EE0 A;  1A70 A;  2PIA A;  2Q5W D;  2WU5 B;  3ABV B;  1VLB A;  2WP9 B;  2M19 A;  3AB5 A;  2JX5 A;  3AE9 B;  1AWD A;  2ACZ B;  4ZHO A;  4LTU A;  3W5U B;  1V8C A;  4C80 A;  1QOG A;  1UWM A;  1N60 A;  1NYR A;  1WRI A;  1L0V B;  1NVI D;  2G1E A;  3P4Q B;  4YTP B;  3W5V B;  3B2F A;  1TJE A;  4C7Y A;  3AE7 B;  3VRA B;  1FXI A;  1NYQ A;  1ROE A;  4A9A A;  2FBW B;  3CWI A;  4YXD B;  3AE1 B;  1ZOY B;  1FRD A;  3AH7 A;  3PO0 A;  4YTM B;  3AN1 A;  1TYG B;  3SR6 A;  2WLB A;  1DGJ A;  2H89 B;  1EWY C;  3DWG C;  4N58 A;  1WWT A;  4USA A;  1PFD A;  4WWM A;  1YJJ A;  1TKG A;  1L6V A;  4HRS A;  2DBY A;  4WQM A;  1YQ4 B; 
#chains in the Genus database with same CATH topology
 1EF1 A;  2HTH A;  2NPT B;  3NZU A;  1OQR A;  4RF1 A;  2L83 A;  1TS5 A;  2ZZP B;  3DBL B;  1VCB A;  3CIR B;  1PGB A;  3NHE B;  2JY6 A;  5MPO A;  3N32 A;  5J18 A;  4BAX A;  5FR6 A;  2WDQ B;  3RNB C;  5JHB A;  3Q8B A;  1XLO A;  2K39 A;  1N63 A;  4BKT A;  5C23 A;  4EOY A;  2DEN B;  1IGC A;  4ANU A;  3AM9 A;  1UF0 A;  2DAF A;  4NAW A;  2WGS A;  1ZDX A;  2EKI A;  4HDO A;  2R61 A;  3A9J B;  4XWT A;  2XK5 B;  3TEW A;  2V0G A;  3AEF B;  4II3 B;  4RM9 A;  2Y5B B;  5EE9 A;  3T8M A;  2Z59 B;  4AOF A;  1V80 A;  1STE A;  4C4V B;  2L1A A;  3APF A;  3QWZ B;  5IP4 D;  4CO7 A;  3AXC A;  5IN7 A;  1FRR A;  2KQ7 A;  2MX2 A;  2GOW A;  2ZJD A;  2L52 A;  1FNV A;  2KN4 A;  3L17 A;  2WXR A;  1JWM D;  1N60 A;  1NVI D;  2N9L A;  1TBE A;  1XQQ A;  3A9K A;  1TJE A;  1FXI A;  1F77 A;  3URY A;  2N9X A;  1WIA A;  1EWY C;  2GLS A;  1TKG A;  4ZRQ A;  1YQ4 B;  2RDG A;  4DQO C;  3FKY A;  3TIX A;  4A8X C;  1L6U A;  1VDV A;  4FHJ A;  3D32 A;  2N9E B;  3Q14 C;  3RFZ B;  2L0T A;  4K81 A;  4UDU C;  3WIM A;  1XO3 A;  3R7Q A;  2C7H A;  3PHX B;  3V6E B;  1JRO A;  4PS7 A;  4DHZ B;  1I4X A;  2JZZ A;  3CST A;  4GN1 A;  2PPH A;  2IBI B;  4RFB A;  3MHS D;  3UIN B;  2RPQ A;  4L1B A;  2LAS A;  3Q69 A;  2JQR B;  4NY0 A;  1D5X C;  1PDX A;  4R3D A;  4AUQ C;  3NY5 A;  5JHA A;  3BZD B;  3ZNI D;  5G5G A;  3UIO B;  2K0P A;  2FAZ A;  5FKA C;  1RM6 C;  1WGY A;  1KOT A;  2RD0 A;  1FIQ A;  2BYT A;  4MT5 A;  3AU5 A;  2JSV X;  1SIJ A;  1I4Q A;  2K25 A;  3ZXR A;  2SEB D;  2BS2 B;  3R3M A;  1JW9 D;  2LZ6 A;  2K5P A;  1E7P B;  4MEL A;  2PIA A;  2Q5W D;  4FBJ B;  3AB5 A;  2LJI A;  3JW0 X;  3ZNH B;  3PLV A;  1E7V A;  3W5V B;  1BXT A;  3GE8 C;  1OTR B;  1OEY J;  1V9J A;  1ZOY B;  2M17 A;  2KWU B;  2LD9 A;  3ZIM A;  4NZL B;  2KFK B;  2INN E;  3PTF C;  3PT2 B;  3Q3J A;  1MFW A;  3VH4 B;  2IY1 B;  1WRD B;  2INC C;  1M94 A;  1PUT A;  2LXC A;  1F52 A;  3P1M A;  4ZYN A;  3H7S A;  1RLF A;  1WI0 A;  2BBC A;  1IGD A;  2AL3 A;  3PRE A;  1AN8 A;  3BK1 A;  1VR9 A;  3IVF A;  4YTN B;  4A90 A;  1WXM A;  2LGS A;  3WAP A;  3H1U A;  2WXM A;  4XWW A;  1GB1 A;  1QOA A;  2EKE C;  3NRZ A;  3JSV A;  2WDR B;  2WNM A;  3R7R A;  2LRU A;  1YIW A;  1T5X D;  1Y8R C;  4TMA B;  2LMC A;  1WJ4 A;  1XCT L;  3AEB B;  2CHW A;  1L0Y B;  3EFC A;  4DHJ B;  4XDD A;  3VFK A;  2QIL A;  3QHT A;  3WAM A;  2DZI A;  3NS1 A;  3W1S A;  4ICV A;  3QJZ A;  2MJE A;  4RMA A;  2WU2 B;  5BYS A;  3V05 A;  3E56 A;  1K51 A;  4OW0 A;  4DXG A;  1AYF A;  5E6N A;  4G0N B;  4KDI C;  5BMH A;  3PPA A;  2E3T A;  2K9X A;  3E9S A;  1RFA A;  3DDC B;  2GBN A;  3NUH B;  4ANX A;  2LGX A;  2BQQ A;  4F7Z A;  1TS3 A;  4PT5 A;  3DHG C;  1AWD A;  2ACZ B;  3EA6 A;  4AJW A;  3P4Q B;  3U52 E;  2QMT A;  4OZA A;  1FCC C;  2JXX A;  1SE3 A;  4DHZ E;  1T0Y A;  3AH7 A;  4P7I A;  2E6X A;  2DZK A;  1UNS A;  3SR6 A;  5J17 A;  1J0G A;  1CQV A;  4KGR A;  1WWT A;  4WWM A;  5C2T B;  2CJN A;  3RMK C;  4WH4 A;  3U2S C;  1GAQ B;  1IUE A;  4KSK C;  3RNA C;  3H6N A;  4XX5 A;  2IDY A;  1QLB B;  1VJK A;  4KVG B;  1J8C A;  1SJE D;  3DBS A;  1GJZ A;  1YX5 B;  2RMM A;  1EU4 A;  2BS3 B;  1SXT A;  3M95 A;  1UBQ A;  4HPL B;  1C4A A;  4JPS A;  4RF0 A;  2M0A A;  1Z2M A;  1AW7 A;  1WGR A;  4KIK B;  4WWP A;  2V3N A;  3ML8 A;  4JLC A;  4M8M A;  2MP2 B;  3N20 C;  4CHK A;  5GXG B;  4ANW A;  4ARI A;  4XE0 A;  2IO2 B;  1RRB A;  3RNE C;  4JIO U;  4H2A A;  1WZ0 A;  2V3P A;  3BY4 B;  4GDK A;  4JQW C;  5EE1 A;  3MFG A;  4LNN A;  1CK1 A;  2FCM A;  1WE7 A;  2JYT A;  2KT7 A;  1I35 A;  2L76 A;  2OHF A;  3QIJ A;  3V60 A;  5GMV A;  3AV8 A;  2RDB C;  2KJ6 A;  2L00 B;  3VR9 B;  4I6L B;  2PE9 A;  1YOV B;  2FNJ B;  3QK0 A;  1JCK B;  5C3J B;  4N59 A;  1YQ3 B;  4F8C B;  1SSN A;  1MVK A;  4MM3 B;  3KYC D;  3N1Y C;  1A70 A;  1Y56 A;  3EEC A;  4FJV B;  5CHV C;  2K8H A;  4EZL A;  2CHX A;  1UEL A;  3BYY B;  1TZ1 A;  4YTM B;  1SGH A;  2N7D A;  3PRP B;  2QEJ C;  1FD6 A;  4USA A;  4EUT A;  5D94 A;  3TCA A;  5HHD G;  4RNA A;  3QQ8 B;  3MC0 B;  3RNG C;  4BKS A;  2HJ8 A;  1L7Y A;  4HJK A;  2VZK D;  5C1Z A;  2M1M A;  2L8J A;  4PYU A;  3H7P A;  3NVZ A;  4TKN A;  3Q3O C;  2MBH A;  1PYW D;  2KYW A;  1IBX A;  4JGH B;  1FXA A;  1K8R B;  2ZPN A;  3P4S B;  5H92 C;  3SD5 A;  3H9D A;  3U7D A;  5JH5 C;  2G4D B;  4YSZ B;  3W2D A;  1EU3 A;  2BYF A;  2DYB A;  3ZDT A;  1MJD A;  3ZUN A;  2QJL A;  3P63 A;  2UWQ A;  1A5R A;  2MBE A;  2JZ3 B;  2Y5P A;  1F0Z A;  1WGD A;  2PVO D;  2MLB A;  4HK2 A;  3DBR I;  1KLG D;  3FAH A;  1FFV A;  3B08 A;  3DCG A;  4HXD A;  2CR5 A;  3VTV A;  1V5O A;  2EMS A;  4AWJ A;  1C78 A;  5LXH A;  1I4H A;  3I3T B;  1GC7 A;  1QOB A;  3DWM A;  3WAO A;  2G4S A;  2TSS A;  2MH7 A;  4PS3 A;  2FCN A;  1VZ6 A;  4M0W B;  2WXJ A;  2J0M A;  2RPV A;  3UF8 A;  3SFD B;  2I1K A;  2BWF A;  4K1R B;  2N7E A;  4ASW C;  3VUY A;  3DBH B;  2KO3 A;  3EUB 2;  5G5H A;  4LK0 M;  2GI9 A;  4XYC A;  4EKU A;  1WJ6 A;  2NBU A;  1V81 A;  4IDI A;  1KF6 B;  3IAS 1;  1H4R A;  2RSU A;  2HE7 A;  2KDI A;  4IM3 A;  3CSF A;  4RGO S;  2ZNV C;  3HIZ A;  2IGD A;  2BPS A;  4C56 C;  2HDE A;  1NYQ A;  4A9A A;  2BWE S;  4AQ7 A;  3QX1 A;  2GMI C;  1GUA B;  4J3O D;  4I6P A;  5E6J A;  5FK9 C;  4BFR A;  4GXB A;  3L54 A;  2ZCC A;  2KZR A;  5KHQ A;  2H88 B;  2DX5 B;  3ZYY X;  2MJD A;  3ZKJ C;  2LUM A;  2LHD A;  4OZB A;  3M63 B;  3DOW A;  2R2O A;  2CJO A;  4IWQ A;  2ASQ A;  3HUI A;  1DOX A;  1JWA D;  1KRH A;  3I5J C;  4P16 A;  5L95 C;  3RZW C;  2KTR B;  2M8S A;  2WXN A;  3AMZ A;  3N3K B;  3VRB B;  1YJI A;  3K9O B;  2BF8 B;  4KX6 B;  4DXA B;  4ZOH C;  4MEM A;  2JXT A;  3VVW B;  1GOZ A;  4JX1 C;  2MWS B;  4N9F 4;  4K3C A;  2CHZ A;  3TUO A;  2AX5 A;  2CS4 A;  4LJP B;  3TMP B;  2MCN B;  2UU7 A;  3PZ8 A;  5E6P A;  3AE8 B;  1SEB D;  2DZM A;  3NOB A;  1YD8 U;  2AWT A;  2DYO A;  4GLS C;  3H8H A;  3NZ3 A;  3O13 A;  4NJ7 A;  5AZG A;  3BIN A;  1FXT B;  4X57 B;  4WAF A;  4ZYS A;  2ONQ A;  3LYY A;  1WXV A;  4GOC A;  4E71 A;  2DHZ A;  2IZV B;  2MSE D;  4HJG E;  5KHO A;  3CMM B;  3R2T A;  2A4Z A;  5H8Y E;  5AUK A;  1T0S C;  4IWO A;  5FR3 A;  2KWV B;  4MAC A;  2WXH A;  3IHP C;  2BTE A;  3AE7 B;  5HI1 A;  2REX A;  1OGW A;  4NJC A;  4ZRP A;  4WQO B;  2NTT A;  2O2V A;  3U30 A;  1FEH A;  3C8Y A;  4XDC A;  1V97 A;  2KAJ A;  3PHW B;  3HM6 X;  2JU6 X;  1YN3 A;  2WX1 A;  1XF5 L;  3KUZ A;  1LM8 B;  4II2 B;  1WXA A;  3P4P B;  3UIP B;  3L08 A;  2PLP A;  1DYQ A;  2MW5 A;  4S0R A;  4NNJ B;  2BT6 A;  1T3Q A;  2KTF A;  5TSS A;  4YWG G;  2LXA A;  2K1F A;  4LLG M;  4GIV A;  1Q10 A;  2KDF B;  4US8 A;  4MGK E;  2N1V A;  4W9D A;  4NJ6 A;  2D2Q A;  1E10 A;  1UUP A;  1MHH E;  2KMM A;  1J7A A;  1OQY A;  3AEE B;  5D2M B;  4HWI B;  2K6D B;  4M8N A;  3KVF B;  2KN5 A;  3AU4 A;  2N0S B;  1WE6 A;  1ET9 A;  2BS4 B;  1L4Z B;  1C76 A;  2IYD B;  2NS5 A;  3B2G A;  3NZS A;  1QIL A;  3NVY A;  2SAK A;  1E8Z A;  1EWC A;  1QZE A;  4ICU A;  1FNW A;  3BVM A;  1M4V A;  2M19 A;  2WWZ A;  1ESF A;  2IO1 B;  4AJY B;  1I4G A;  2JT4 B;  4FAD A;  2ZW0 A;  4YXD B;  3I63 C;  1LFD A;  2WLB A;  1WMH A;  2W9N A;  1PFD A;  2O6V A;  3ALB A;  3V6C B;  4HVB A;  2W3R A;  1PQS A;  2MRP A;  3AE3 B;  1V6E A;  2UYZ B;  3B9J A;  4FA6 A;  2NCN A;  5LLI A;  1SB3 C;  2WX0 A;  1WM2 A;  4EE2 A;  3GP7 A;  2OOB B;  1V49 A;  2BB6 A;  2RDH A;  3ZRF A;  2IND C;  1K53 A;  3ZRC A;  4DBG A;  1OQQ A;  1LO5 D;  3NVW A;  1XLQ A;  2WXI A;  3A1Q A;  2DNF A;  4N6E B;  1GB4 A;  2KFK A;  2DZJ A;  1WH3 A;  5DPW A;  3LXF A;  2HJ1 A;  3K9P B;  4WJO A;  4TQ0 A;  3NVV A;  1RFK A;  3KW5 B;  3SHQ A;  1ZP0 B;  3IXS A;  4MGZ E;  1H8C A;  3R8B A;  1P3Q U;  1WGH A;  2KX0 A;  4W9H A;  2K6Q A;  4MJS B;  1QF6 A;  2XN9 C;  1L0X B;  3Q6B A;  4M01 A;  1ZXI A;  3P2B A;  3IT4 B;  1I4P A;  5DCN A;  2YVC A;  2XEW A;  3AEG B;  1JML A;  5DPS A;  1Z5S B;  5AZH A;  1YN5 A;  4L2Y A;  3BWU D;  1MPE A;  2VZK B;  3PV1 A;  5CHW A;  4A3O A;  1SIF A;  4KDL B;  3N1Z C;  3FC4 A;  1KM7 A;  4RGM A;  3Q8A A;  3RUI B;  4LDT D;  5HFY A;  3LB8 C;  3A1Q B;  1XXG A;  3RCZ A;  2EEL A;  4ZHO A;  2WYQ A;  3PS6 A;  4C80 A;  1WRI A;  1WYW B;  3RT3 B;  1T6B X;  4B9K A;  2FE8 A;  4IG7 B;  2JUO A;  1MG8 A;  3AE1 B;  3PO0 A;  4HCN B;  2G45 B;  1SE2 A;  1DGJ A;  3U8Z A;  1NDD A;  2KAN A;  2PJH A;  4JE3 B;  2N7J A;  1T0Q C;  4HDQ A;  3NG0 A;  3DPD A;  1TIF A;  4J6I A;  4NQL B;  3L4P A;  3OJ3 A;  3P42 A;  1FCL A;  4AP4 C;  2AQ2 B;  1E8Y A;  2JVC A;  4W9G A;  2KC2 A;  2KNB A;  2LGD A;  2X8X X;  3UI3 A;  1TTN A;  1ZXH A;  2IO3 B;  3P4R B;  4GGQ A;  3DBH I;  3AE2 B;  3IFW B;  1CMX B;  1NBF C;  1P98 A;  2MBB B;  2CKH B;  3T3O A;  1WR6 E;  2LVO A;  3PLU A;  2JPH A;  3HHM A;  1HZ6 A;  1TS4 A;  5D7G A;  1TZO A;  1E8X A;  4LDT B;  2M4N A;  3BK2 A;  1UBI A;  5AEK B;  1WGG A;  2M56 B;  2X38 A;  2D10 A;  3VTW A;  3MJW A;  1ZUD 2;  2J4X A;  2LI5 A;  4ZRK A;  3VR8 B;  3DVN U;  1N5W A;  2K8B A;  2KWC A;  2YLM A;  2FUH B;  2W55 A;  4W9L A;  4XGA B;  4RM8 A;  4YSX B;  3A4R A;  1D5Z C;  3ZNG C;  3VUX A;  4G50 A;  4LNF A;  4EEW A;  1WM3 A;  4ITK A;  3RNC C;  3A9J A;  5BYQ A;  1KH0 A;  1ZW7 A;  5I4D A;  4MGY E;  2C9W B;  1F9J A;  3UQB A;  1WY8 A;  4WJQ A;  1KJT A;  4LTU A;  2OJR A;  2ZW1 A;  3LJ3 A;  4FJY A;  3EFU A;  3CWI A;  2D3G A;  3L10 B;  2KD0 A;  1TYG B;  3QAQ A;  2PEA A;  2BB5 A;  4PK1 A;  1L6V A;  4HRS A;  2DBY A;  4FHK A;  2KDB A;  4OHJ A;  3N30 A;  3PRM B;  4GDL B;  2BW2 A;  1QT9 A;  4IC7 B;  2LGI A;  2Z0E B;  4OVZ A;  2L7R A;  1DOY A;  5D3I B;  4WJP A;  5IO9 A;  4W9I A;  3A9K B;  2FCQ A;  4K7S A;  3ZW3 A;  1GNU A;  2MA9 B;  1ZKH A;  3RNF C;  4CYE A;  2W3S A;  4W9J A;  1JWU D;  1VD2 A;  3U7Z A;  5LNK 1;  3ZJU A;  1F2R I;  2IO0 B;  5HKH A;  2KK8 A;  3SDL C;  2MP2 A;  3ML9 A;  1IBX B;  1C4C A;  4FN2 A;  1FM0 D;  4G3X B;  2IJ0 A;  3GS2 A;  2KWD A;  2K3U A;  5L83 A;  2BVC A;  3MC8 A;  1IYF A;  3QA8 A;  2FID A;  2KHW B;  5BO4 B;  3HVD A;  4BKG A;  2L05 A;  1TKE A;  1X1M A;  1YJ1 A;  1FFU A;  2WXK A;  3A33 B;  4WWN A;  2N1W A;  4BOZ B;  3IT6 B;  2G3Q B;  2CU1 A;  2RGF A;  5EE0 A;  3UQA A;  4C4V A;  5D3D A;  3AE9 B;  2N9K A;  2QC8 A;  4DK5 A;  3OWE B;  1R4M B;  2V3S A;  2MBO A;  4OZC A;  4BBN F;  1ROE A;  4ZRI A;  3GE3 C;  3VDZ A;  3DWG C;  2NPT A;  1XT9 B;  2J42 A;  5T8I A;  1ISN A;  1N62 A;  3J9C A;  1UWX A;  1P1A A;  2DLB A;  2ZNV B;  1R4M I;  4TUU A;  1U4A A;  2K8C A;  2KOX A;  1UH6 A;  3RYT A;  4KV2 A;  5IAA C;  1E8W A;  3C19 A;  3T9L A;  4K7W A;  3VH3 B;  1JRU A;  2GBM A;  2QDF A;  4RH6 A;  4YL8 A;  3H7P B;  1TY0 A;  5HG2 A;  2FIF A;  1BUI C;  1ZE3 D;  1C9F A;  1KLV A;  1JWS D;  3JYU A;  5CHF A;  2D3A A;  2KFJ A;  2N4F A;  2KJH B;  4OVV A;  3B0A A;  4P1C C;  2JRH A;  4P6V F;  3ECI A;  4US9 A;  1FNU A;  2KC1 A;  1D4B A;  2GBR A;  1GG3 A;  4ZHP A;  5D6J B;  3W1Y A;  1SE9 A;  1WGK A;  4EZK A;  3AED B;  1N6Z A;  4NAM A;  4D2K A;  2QHO A;  3ZO5 B;  1N61 A;  2ZEQ A;  4EFO A;  1SBB B;  5EDS A;  3JSV B;  5BMI A;  3RUL A;  2Y3A A;  4M02 A;  4G11 A;  1R4N I;  3AE6 B;  1WMH B;  4JWU C;  4RCO A;  2IGH A;  1HA5 A;  2BYV E;  1L5P A;  2WU5 B;  3WA0 A;  2DAJ A;  2OJW A;  1QOG A;  3FIL A;  2G1E A;  3BVG A;  4IWP A;  3GOE A;  3ZTD A;  3GB1 A;  3N1X C;  2AEH A;  4A55 A;  1B1Z A;  4IM2 A;  3ZTC A;  2FUG 1;  5DPT A;  3EGR A;  1BT0 A;  3BVZ A;  2J7Q B;  1WR1 A;  4WUR A;  1E90 A;  3ZGZ A;  3T3N A;  4YSY B;  3KUC B;  2L0F A;  3TSS A;  4REZ A;  1S3S G;  3DBL I;  4AS1 A;  4PS8 A;  2HD5 B;  3M62 B;  1KFY B;  2C60 A;  3BYT B;  1TY2 A;  3W9C B;  1RYJ A;  4C7Z A;  4K7U A;  3Q2A C;  5IOI A;  4NAW B;  4W9E A;  5AZF A;  1L4D B;  1FO4 A;  4W9K A;  1LGR A;  1SF0 A;  2ZVN A;  3HRD D;  4W9C A;  1R7S A;  1WJU A;  2VH2 A;  1E5W A;  1KTK A;  1WF9 A;  3GZN I;  4IW0 A;  2JWU A;  1VZ7 A;  4MDK E;  2PW9 A;  3LDZ E;  4DWF A;  1E0Z A;  4HRO A;  4LNO A;  2DWQ A;  2M0X A;  3PVL A;  2WXP A;  4MSQ B;  2D07 B;  5BYR A;  1C3T A;  4MM3 A;  3DBR B;  2GB1 A;  5TR5 A;  2KMA A;  2JYE A;  3ZDM C;  3AEA B;  2XNA C;  2WXO A;  4KIK A;  3AI5 A;  1J7C A;  2QIE B;  2B76 B;  4QAY A;  3VTU A;  3KWV A;  1CJE A;  2MJ3 A;  1XEE A;  4FLH A;  3EC8 A;  3ABV B;  3CF6 E;  4URK A;  2BYE A;  2AL6 A;  3W5U B;  1NYR A;  2JRI B;  1WFY A;  2KVZ A;  4A6Q A;  5JZE B;  3DHH C;  3TEZ A;  1LQB A;  2D3C A;  4KSL C;  4L23 A;  1ZDV A;  3TJP A;  3UGB B;  2NVU I;  3AN1 A;  2GRI A;  2L3Z A;  1HEZ E;  1HXY D;  2V4L A;  4PYZ A;  1K50 A;  3V62 A;  2KTR A;  1YN4 A;  2W54 A;  4LJO B;  5G55 A;  3IG3 A;  2KAC A;  2PVG C;  1MG4 A;  4K3B A;  3NS8 A;  4GDL A;  2J0K A;  1WX8 A;  4DXF A;  5EE3 A;  3ZQ4 A;  1J7B A;  3N9Y C;  2C5L C;  1T0R C;  3ZVV A;  3TBL D;  3OG5 A;  2WXG A;  3JVZ X;  2LGY A;  4B95 A;  1UGJ A;  2Y5C A;  2Z8L A;  1WYG A;  2K22 A;  2INP E;  2D5G A;  1P7E A;  2KQS A;  2V4I B;  4WWO A;  4E3C A;  1HQR D;  2KLG A;  3KQ4 A;  1SJH D;  2ZVO A;  3M3J A;  3VUW A;  1V1P A;  4ZDV A;  3IBE A;  1P7F A;  2V1Y A;  3VQI A;  2JZP A;  4YT0 B;  1B9R A;  3I57 A;  2GBJ A;  1BML C;  3DQV A;  1EUV B;  4OVU A;  1F2R C;  1C77 A;  2J0J A;  2BKF A;  4B0E A;  4IKG A;  1Q0W B;  4KKJ A;  3IAM 1;  3AE5 B;  5J2R A;  1MHX A;  2MBQ A;  3Q3M C;  1C1Y B;  3O65 B;  1D3Z A;  3AEC B;  4MH0 E;  5G2N A;  4HKZ E;  1YMH E;  5IA7 A;  4S17 A;  1VZ8 A;  1I4R A;  3RN9 C;  2JX5 A;  1V8C A;  2XBB C;  2I2Y A;  1Q5W B;  2BGF A;  4ANV A;  1D6E C;  1WZ3 A;  3VRA B;  2J53 A;  2FBW B;  4KZC A;  3MJ5 A;  4HEA 1;  1V1P B;  1L0V B;  3EHV A;  1QKZ A;  2C7M B;  1NEN B;  3APD A;  2WS3 B;  3ZLZ A;  4NPN A;  3MTN B;  2PKO A;  3GZN B;  2IGG A;  2WHI A;  2R2Q A;  1JAL A;  2OED A;  2MHJ A;  4IM0 A;  1RAX A;  2A5U A;  4LNK A;  2RR9 A;  2KJR A;  1JQ4 A;  2LFI A;  1V5T A;  1V86 A;  1YX6 B;  1I7H A;  2I38 A;  3HVZ A;  2ON8 A;  1IPG A;  2AQ3 B;  4MGI E;  1YNT E;  3L16 A;  4I6N B;  3KWL A;  2D3B A;  1TKY A;  1WX9 A;  4GMV A;  4XC2 A;  3V61 A;  2HTM E;  4FJZ A;  4HPP A;  3VXW A;  2AYO B;  3RI7 C;  1E7U A;  2O6V D;  2NR2 A;  4MSM B;  3QCA A;  2DYM A;  4BBN C;  2WDV B;  1WSP A;  2WQY B;  3C0R B;  2KQ4 X;  2IY0 B;  3KUD B;  2PMV A;  4TSS A;  3TEX A;  1CZP A;  4HPM B;  4WIP A;  1WXQ A;  1C79 A;  4BVU C;  3L0W B;  1XLP A;  4ACF A;  4FUL A;  2KMC A;  2O2V B;  3HM3 A;  4P1B C;  1OFF A;  1Q1O A;  3QAR A;  3RZF A;  2PTL A;  2WP9 B;  3A4S C;  1UWM A;  1V2Y A;  4XZ4 A;  3PSE B;  1FPY A;  2EMT A;  3ZXV A;  5E6O A;  4BZA A;  3U4E G;  2NBV B;  1FRD A;  1P0R A;  4LNI A;  2PE6 B;  2H89 B;  1IP9 A;  4N58 A;  4BKS D;  1PGA A;  3X0W A;  4C00 A;  4M00 A;  1L2N A;  4WQM A;  3KYD D;  1ZPS A;  2KXJ A;  2KX3 A;  4GB9 A;  1TGZ B;  5IKC M;  3AE4 B;  4JL9 A;  1NEK B;  3X23 A;  3ETR A;  5CX3 A;  1EM7 A;  4WJN A;  1UD7 A;  2LJ5 A;  3PRZ A;  2QCZ A;  1QQR A;  4HKQ A;  3DVG Y;  1YQB A;  2CU3 A;  2LVP A;  2LWP A;  4MJS A;  2YEP F;  3PZD A;  3MP9 A;  1ZGU B;  3VHT C;  1WJN A;  5DPR A;  2LUE A;  2WXQ A;  3ONS A;  4GSW A;  1TS2 A;  2NBW B;  1E6E B;  1S1Q B;  3OAW A;  3DHI C;  1XCQ L;  3SFE B;  4RGT A;  2XK5 A;  2BKR B;  2KVR A;  4KGT A;  3ENE A;  3FIL B;  1XLN A;  1NI3 A;  4E74 A;  2B3A A;  1N5X A;  3QC8 B;  2WDT B;  1C4P A;  2NTS A;  1AAR A;  3SEB A;  3BII D;  3HK0 A;  4KZ0 A;  2IPK D;  3ZNZ B;  1GPX A;  4TV3 A;  1KLU D;  2O6V B;  2Z0D B;  3ZJT A;  2L32 A;  3SU8 X;  4KGS A;  1PGX A;  3KLS X;  5LXI B;  2MQJ A;  3V3X A;  2I1J A;  4EZJ A;  4Q2J A;  2JF5 A;  1J19 A;  3Q3N C;  2VRR B;  1VLB A;  3OJ4 B;  1WX7 A;  1OEY A;  1F1H A;  4A20 A;  3PGE A;  3B2F A;  4TQ1 A;  1ACC A;  4CQN A;  1I42 A;  2W82 A;  1XD3 B;  3WAL A;  4NQK E;  5BMG A;  2KLC A;  2ICI A;  3DVN V;  1LXD A;  4ARC A;  3WAN A;  3DVG X;  1E9M A;  4IOI E;  2FCS A;  3Q8C A;  1GC6 A;  3RD2 A;  4W9F A;  2MEK A;  1HTQ A;  1K52 A;  1JWB D;  1VRA B;  3OLM D;  4WAA A;  2N9P C;  4DHJ D;  1FMA D;  5CTR C;  4ZRJ A;  1HTO A;  2QSD A;  1D5M C;  3NJT A;  1ENF A;  2WXL A;  3AUL A;  3KH0 A;  1QOF A;  3MC9 A;  4DDI D;  4MH8 A;  3RPF C;  1DOI A;  3TEY A;  3L13 A;  5AUI A;  3ZJV A;  1NI2 A;  2KKC A;  2NMQ A;  4LCD E;  2VH1 A;  1UGM A;  2V9H A;  1WXS A;  1JRP A;  3W1S C;  2ZPY A;  4DDG D;  4O1N A;  2ZCB A;  1EF5 A;  1HZ5 A;  1RWS A;  2C7N B;  2YEP B;  4KKI A;  3Q8E A;  4B6W A;  4A3P A;  2KDM A;  3MHZ A;  3WCQ A;  4BOS C;  3R66 C;  1V1O A;  1UZX B;  2LEK A;  4F1S A;  3B1L X;  2LHE A;  2JWZ A;  1G6J A;  3S2A A;  3R2I A;  3TL5 A;  3VAW A;  2LVQ A;  4JWS C;  3APC A;  2GBK A;  1TT5 B;  1P9D U;  4HLE A;  1SE4 A;  1ET6 A;  4GU2 A;  4FXC A;  2J52 A;  3PZ7 A;  4B0M A;  3Q3F A;  2KDE B;  4GDK B;  1HE8 A;  4YTP B;  4IUM B;  4C7Y A;  3Q8F A;  1EO6 A;  2LRW A;  5JXV A;  2D11 A;  2G9H D;  2AQ1 B;  3I9V 1;  1MI0 A;  2WXF A;  1R4N B;  4RGN A;  4HCP B;  1YJJ A;  4M0W A; 
#chains in the Genus database with same CATH homology
 1YN4 A;  2W54 A;  3L4P A;  2KAC A;  2VZK D;  1OQR A;  2PVG C;  4RF1 A;  3P42 A;  1FCL A;  2AQ2 B;  2L83 A;  1TS5 A;  3NVZ A;  4DXF A;  5EE3 A;  3ZQ4 A;  1J7B A;  1PYW D;  3UI3 A;  3N9Y C;  1IBX A;  1ZXH A;  1FXA A;  3CIR B;  1PGB A;  3P4R B;  5MPO A;  3P4S B;  5H92 C;  3AE2 B;  2WXG A;  4YSZ B;  2WDQ B;  1UGJ A;  2Y5C A;  2Z8L A;  1WYG A;  2K22 A;  3W2D A;  3T3O A;  2INP E;  1EU3 A;  1P7E A;  2D5G A;  2V4I B;  1HQR D;  3Q8B A;  3KQ4 A;  1SJH D;  1XLO A;  1N63 A;  1V1P A;  5D7G A;  1HZ6 A;  1TS4 A;  2QJL A;  1TZO A;  3P63 A;  1P7F A;  1F0Z A;  2Y5P A;  3VQI A;  2JZP A;  3BK2 A;  4YT0 B;  1B9R A;  2PVO D;  3I57 A;  1BML C;  1KLG D;  1IGC A;  3FAH A;  1FFV A;  2M56 B;  3AM9 A;  1F2R C;  2X38 A;  1C77 A;  1ZUD 2;  1C78 A;  2J4X A;  1ZDX A;  1I4H A;  2EKI A;  4B0E A;  1QOB A;  3DWM A;  4IKG A;  2R61 A;  2TSS A;  3VR8 B;  4XWT A;  2MH7 A;  3TEW A;  2V0G A;  1N5W A;  3AEF B;  4KKJ A;  1VZ6 A;  3IAM 1;  5EE9 A;  2WXJ A;  3AE5 B;  2RPV A;  1MHX A;  3SFD B;  1STE A;  2W55 A;  2L1A A;  3AEC B;  4YSX B;  1D5Z C;  3EUB 2;  4HKZ E;  5G5H A;  1YMH E;  4LK0 M;  2GI9 A;  4JE3 B;  1FRR A;  4IDI A;  1VZ8 A;  4ITK A;  2L52 A;  1I4R A;  1KF6 B;  3IAS 1;  1FNV A;  5BYQ A;  1KH0 A;  2KN4 A;  5I4D A;  2JX5 A;  4RGO S;  2WXR A;  1JWM D;  4LTU A;  1V8C A;  2IGD A;  1N60 A;  2ZW1 A;  1NVI D;  2N9L A;  2I2Y A;  1TJE A;  1D6E C;  4C56 C;  3VRA B;  1FXI A;  2HDE A;  1NYQ A;  1F77 A;  2J53 A;  2FBW B;  3CWI A;  4A9A A;  4AQ7 A;  3MJ5 A;  4HEA 1;  3URY A;  4M0W A;  1TYG B;  4J3O D;  1EWY C;  2BB5 A;  1V1P B;  5E6J A;  5FK9 C;  1TKG A;  1L6V A;  1L0V B;  4HRS A;  2DBY A;  1QKZ A;  4ZRQ A;  1YQ4 B;  2RDG A;  4DQO C;  1NEN B;  2WS3 B;  2H88 B;  4OHJ A;  4A8X C;  2PKO A;  1L6U A;  1VDV A;  4GDL B;  2IGG A;  2BW2 A;  1QT9 A;  3RFZ B;  1JAL A;  2OED A;  4UDU C;  3ZYY X;  2MJD A;  1XO3 A;  2LGI A;  4OVZ A;  1DOY A;  5D3I B;  2LUM A;  2LHD A;  4OZB A;  1JRO A;  2CJO A;  1I4X A;  1JQ4 A;  2LFI A;  3HUI A;  4RFB A;  1DOX A;  1JWA D;  1KRH A;  1I7H A;  4L1B A;  2W3S A;  2I38 A;  3HVZ A;  1JWU D;  2JQR B;  3Q69 A;  4P16 A;  2ON8 A;  3U7Z A;  2AQ3 B;  5LNK 1;  2WXN A;  1D5X C;  3AMZ A;  1YNT E;  1PDX A;  3VRB B;  1YJI A;  4KX6 B;  4R3D A;  3ZJU A;  1F2R I;  3KWL A;  4ZOH C;  1TKY A;  3BZD B;  2JXT A;  1GOZ A;  2HTM E;  4JX1 C;  3TUO A;  2AX5 A;  5G5G A;  2K0P A;  1IBX B;  1C4C A;  1RM6 C;  5FKA C;  1FM0 D;  2DYM A;  2IJ0 A;  3GS2 A;  3PZ8 A;  2KWD A;  3AE8 B;  1FIQ A;  2K3U A;  1SEB D;  2WDV B;  1WSP A;  2BYT A;  2WQY B;  2KQ4 X;  4MT5 A;  2DYO A;  3HVD A;  4GLS C;  2JSV X;  1SIJ A;  2PMV A;  4TSS A;  3TEX A;  4RNA A;  3H8H A;  1I4Q A;  1CZP A;  3NZ3 A;  3O13 A;  1TKE A;  4WIP A;  2SEB D;  1WXQ A;  4WAF A;  1FFU A;  2WXK A;  4ZYS A;  1C79 A;  2ONQ A;  3LYY A;  2BS2 B;  1XLP A;  3IT6 B;  1JW9 D;  4HJG E;  3R2T A;  2K5P A;  5H8Y E;  5AUK A;  1E7P B;  1OFF A;  5EE0 A;  2PIA A;  2Q5W D;  2PTL A;  5FR3 A;  5D3D A;  2WP9 B;  3AB5 A;  2LJI A;  3AE9 B;  4MAC A;  2N9K A;  1UWM A;  3W5V B;  1BXT A;  2WXH A;  2BTE A;  3OWE B;  3AE7 B;  5HI1 A;  4OZC A;  4NJC A;  1ROE A;  4ZRP A;  3U4E G;  1ZOY B;  1FRD A;  2H89 B;  2NTT A;  4NZL B;  3DWG C;  4N58 A;  1PGA A;  2INN E;  1FEH A;  3C8Y A;  2J42 A;  4WQM A;  5T8I A;  4XDC A;  1ZPS A;  1N62 A;  1V97 A;  2KAJ A;  3J9C A;  1UWX A;  2JU6 X;  2DLB A;  1YN3 A;  1PUT A;  1XF5 L;  3AE4 B;  3P1M A;  1NEK B;  3P4P B;  2BBC A;  1IGD A;  3ETR A;  2PLP A;  1DYQ A;  1AN8 A;  3BK1 A;  1EM7 A;  1VR9 A;  4YTN B;  4A90 A;  1QQR A;  4HKQ A;  2CU3 A;  2BT6 A;  1T3Q A;  2WXM A;  5TSS A;  4YWG G;  2YEP F;  1QOA A;  4XWW A;  1GB1 A;  4LLG M;  3MP9 A;  3NRZ A;  4RH6 A;  1TY0 A;  5HG2 A;  2WXQ A;  1BUI C;  1ZE3 D;  2WDR B;  1C9F A;  1Q10 A;  2WNM A;  4US8 A;  1JWS D;  1TS2 A;  1T5X D;  1E6E B;  3SFE B;  1XCQ L;  4TMA B;  4RGT A;  2LMC A;  4KGT A;  1XCT L;  3AEB B;  4P6V F;  1E10 A;  3FIL B;  4US9 A;  1XLN A;  1NI3 A;  1L0Y B;  1FNU A;  1UUP A;  1D4B A;  1MHH E;  1N5X A;  2KMM A;  4XDD A;  4ZHP A;  1J7A A;  2QIL A;  3AEE B;  1C4P A;  2NTS A;  1WGK A;  3AED B;  3NS1 A;  4NAM A;  3SEB A;  3W1S A;  4D2K A;  2MJE A;  1N61 A;  1SBB B;  2WU2 B;  5BYS A;  3V05 A;  3BII D;  3E56 A;  1K51 A;  2N0S B;  5BMI A;  2IPK D;  4OW0 A;  1ET9 A;  4DXG A;  2BS4 B;  1AYF A;  2Y3A A;  1GPX A;  1L4Z B;  1C76 A;  1KLU D;  3B2G A;  5BMH A;  3ZJT A;  2L32 A;  3AE6 B;  2E3T A;  4KGS A;  1PGX A;  3KLS X;  2K9X A;  3E9S A;  4JWU C;  4RCO A;  2IGH A;  1HA5 A;  1QIL A;  3V3X A;  3NVY A;  3NUH B;  2SAK A;  1L5P A;  1EWC A;  4Q2J A;  1TS3 A;  1FNW A;  2WU5 B;  3BVM A;  1M4V A;  4PT5 A;  1VLB A;  2M19 A;  1AWD A;  2ACZ B;  3EA6 A;  1ESF A;  1QOG A;  3FIL A;  2G1E A;  3BVG A;  3P4Q B;  3U52 E;  3B2F A;  2QMT A;  4OZA A;  1FCC C;  3GB1 A;  4TQ1 A;  1ACC A;  1I4G A;  4CQN A;  4A55 A;  1B1Z A;  1SE3 A;  2FUG 1;  2ZW0 A;  2W82 A;  4YXD B;  3AH7 A;  3EGR A;  2E6X A;  3BVZ A;  1UNS A;  3SR6 A;  2WLB A;  1CQV A;  4KGR A;  5BMG A;  1WWT A;  1PFD A;  4WWM A;  5C2T B;  2ICI A;  2W3R A;  3AE3 B;  4WUR A;  3B9J A;  4ARC A;  3ZGZ A;  1E9M A;  2CJN A;  4WH4 A;  4IOI E;  3U2S C;  3T3N A;  4YSY B;  1SB3 C;  1GAQ B;  1IUE A;  3Q8C A;  3TSS A;  2MEK A;  4REZ A;  4EE2 A;  3GP7 A;  1K52 A;  1JWB D;  1VRA B;  2IDY A;  2BB6 A;  2RDH A;  4AS1 A;  1K53 A;  1FMA D;  1OQQ A;  1LO5 D;  1QLB B;  3NVW A;  1VJK A;  1KFY B;  1XLQ A;  2WXI A;  3BYT B;  1TY2 A;  1SJE D;  3W9C B;  2QSD A;  4N6E B;  1GB4 A;  1D5M C;  1RYJ A;  1ENF A;  4C7Z A;  2RMM A;  2WXL A;  1EU4 A;  2BS3 B;  1QOF A;  1SXT A;  3LXF A;  4NAW B;  4MH8 A;  3RPF C;  1L4D B;  1DOI A;  4TQ0 A;  1FO4 A;  3TEY A;  3NVV A;  1RFK A;  5AUI A;  1C4A A;  1SF0 A;  3HRD D;  4JPS A;  4RF0 A;  3ZJV A;  2M0A A;  2NMQ A;  1AW7 A;  1ZP0 B;  2V3N A;  3IXS A;  1JRP A;  1R7S A;  5GXG B;  1KTK A;  4O1N A;  3R8B A;  4ARI A;  4XE0 A;  1HZ5 A;  1RWS A;  2JWU A;  1VZ7 A;  4H2A A;  2PW9 A;  2YEP B;  4KKI A;  2V3P A;  3Q8E A;  1QF6 A;  2XN9 C;  5EE1 A;  1L0X B;  3MFG A;  1E0Z A;  4HRO A;  1ZXI A;  3IT4 B;  1I4P A;  2DWQ A;  3AEG B;  2KDM A;  2WXP A;  3MHZ A;  1CK1 A;  3WCQ A;  1JML A;  5BYR A;  1V1O A;  2GB1 A;  2JYT A;  2OHF A;  3AV8 A;  2JYE A;  1YN5 A;  4L2Y A;  3BWU D;  1MPE A;  2VZK B;  3AEA B;  2LEK A;  2XNA C;  2WXO A;  3VR9 B;  2LHE A;  1J7C A;  2QIE B;  2B76 B;  3R2I A;  1JCK B;  5C3J B;  3FC4 A;  4JWS C;  4N59 A;  1YQ3 B;  3KWV A;  4RGM A;  3Q8A A;  1CJE A;  1SSN A;  1MVK A;  2MJ3 A;  1XEE A;  4MM3 B;  1SE4 A;  1ET6 A;  4FXC A;  5HFY A;  3LB8 C;  1A70 A;  1Y56 A;  2J52 A;  1XXG A;  3ABV B;  2EEL A;  4ZHO A;  3PZ7 A;  4B0M A;  4GDK B;  3W5U B;  4C80 A;  1WRI A;  4YTP B;  1NYR A;  1T6B X;  2FE8 A;  3BYY B;  4A6Q A;  4C7Y A;  3Q8F A;  5JXV A;  3TEZ A;  2G9H D;  4L23 A;  2AQ1 B;  1ZDV A;  3AE1 B;  3I9V 1;  1MI0 A;  3PO0 A;  4YTM B;  1SE2 A;  3AN1 A;  2GRI A;  2WXF A;  1DGJ A;  4RGN A;  1HEZ E;  1HXY D;  2QEJ C;  1FD6 A;  4USA A;  1YJJ A;  2N7J A;  5HHD G;  1K50 A;  3MC0 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...