1WRIA

Crystal structure of ferredoxin isoform ii from e. arvense
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
93
structure length
93
Chain Sequence
AYKVTLKTPDGDITFDVEPGERLIDIGSEKADLPLSCQAGACSTCLGKIVSGTVDQSEGSFLDDEQIEQGYVLTCIAIPESDVVIETHKEDEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ferredoxin II
publication title A structural basis of Equisetum arvense ferredoxin isoform II producing an alternative electron transfer with ferredoxin-NADP+ reductase.
pubmed doi rcsb
source organism Equisetum arvense
molecule tags Electron transport
total genus 19
structure length 93
sequence length 93
ec nomenclature
pdb deposition date 2004-10-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00111 Fer2 2Fe-2S iron-sulfur cluster binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1wriA00
1N63A 2Y5CA 2JQRB 2FBWB 3P1MA 1NYRA 3BIID 3AEFB 1R7SA 1J7CA 1NENB 1FM0D 2L83A 2PVOD 3AV8A 1JQ4A 5G5GA 2MJDA 1VLBA 3B2GA 4ITKA 3NVWA 1IUEA 3NVYA 4US8A 5MPOA 5AUKA 1JRPA 4C7ZA 3P4PB 1YJJA 1DGJA 2QIEB 4YSZB 4P6VF 1JW9D 1EWYC 1JROA 1L5PA 1V97A 2W3RA 4C7YA 1PUTA 3HVZA 5C2TB 1N60A 2H89B 1ZUD2 1OQRA 1JWBD 1NYQA 1UWMA 1FXAA 3AEGB 1FFUA 1XLNA 2WDQB 3ETRA 3KWLA 1RYJA 4YT0B 5C3JB 4HROA 2Q5WD 3SFEB 1FXIA 1YQ4B 3AEBB 4HRSA 1VJKA 1L6UA 2BS3B 3AH7A 4N59A 2N0SB 3FC4A 2CJNA 4US9A 3NVVA 4YSYB 1ZP0B 4USAA 2H88B 3HRDD 1J7BA 3AM9A 5EE9A 1YQ3B 1N5XA 4KX6B 4ZHOA 2AX5A 2LEKA 2WDRB 4IDIA 2WDVB 2WS3B 2JX5A 3AB5A 3AE4B 1FMAD 1SF0A 1TKGA 1QF6A 2EKIA 1ZOYB 1N61A 1DOXA 1RFKA 2E3TA 3NRZA 5GXGB 2WP9B 3ZYYX 1XO3A 2QJLA 2ACZB 1I7HA 1N62A 1TKYA 1WWTA 2W3SA 3AE6B 3DWGC 2KAJA 5AUIA 1L6VA 3AE1B 4YTPB 2WU2B 1XLPA 4LTUA 3WCQA 1GAQB 3AE3B 1OFFA 2MH7A 1KFYB 1T3QA 4WQMA 3HUIA 1WRIA 3AEDB 3EUB2 2CJOA 2MJ3A 1AYFA 1ZXIA 2WU5B 2K9XA 3B2FA 2OHFA 5EE0A 2HTME 1FRRA 1L0VB 3AE2B 3W5UB 1DOIA 2CU3A 1YJIA 2PVGC 3NVZA 3VRAB 4A9AA 1PFDA 1VDVA 2M56B 3VRBB 1E0ZA 1QLBB 1GPXA 4YXDB 2K5PA 3LB8C 1F0ZA 3AEAB 4YTNB 3VR9B 1SIJA 1JWAD 5H92C 1NEKB 1KRHA 1QOGA 3AE7B 1SB3C 2DBYA 3CIRB 1AWDA 3AN1A 1KF6B 1WGKA 2W54A 3ABVB 3NS1A 1E10A 3P4QB 3RPFC 3SFDB 1JALA 1OQQA 1TJEA 2MJEA 3LXFA 3VR8B 1ROEA 3AEEB 2M19A 4YTMB 1WXQA 1WYGA 1E7PB 4FXCA 3P4SB 1NI3A 3P63A 1QOBA 2BT6A 1J7AA 1A70A 4JWUC 5EE3A 4JWSC 1FFVA 4N58A 2WLBA 1XLOA 3AECB 1B9RA 3AE8B 2L52A 2WQYB 4N6EB 3CWIA 4ZOHC 1CJEA 5H8YE 4C80A 1RWSA 2PKOA 3AE5B 1PDXA 2G1EA 2B76B 2K22A 3B9JA 1QOAA 1QOFA 5G5HA 1DOYA 3W9CB 1RM6C 2KMMA 1N5WA 3DWMA 1E9MA 4WWMA 1V8CA 3FAHA 1XLQA 1FRDA 2PIAA 1CZPA 4JX1C 1TKEA 1NVID 3L4PA 4YSXB 3P4RB 1FIQA 5EE1A 2BS2B 3PO0A 1FO4A 1E6EB 2BS4B 2DWQA 3AE9B 3W5VB 3AMZA 4ZHPA 2W55A 3SR6A 1TYGB 1QT9A
chains in the Genus database with same CATH superfamily
2C7MB 3W1SC 3KVFB 2KFKB 2OJRA 1VLBA 2L7RA 4ITKA 1V86A 2L1AA 4NAWB 3E9SA 4YSZB 3U4EG 4RGNA 2W3RA 1UELA 3X0WA 2GB1A 1ZUD2 2MW5A 4PYUA 2WDQB 2MBEA 1K8RB 1LM8B 4MJSA 2YEPF 1WZ0A 2N0SB 3GZNI 3FILB 4ZRJA 3ZVVA 1C4PA 1I4RA 4FHKA 2ZW0A 4FHJA 5DCNA 1K53A 2XK5A 2JX5A 4F8CB 2WXFA 2E3TA 2YEPB 5HFYA 1WY8A 1D3ZA 3WCQA 2K8CA 2BQQA 2V1YA 1KFYB 5DPWA 2EELA 2KDMA 3VUWA 3ZNGC 2CU3A 4ANWA 5BO4B 5H92C 2KQ4X 4ZYNA 4B0MA 1Q5WB 4XGAB 1E7PB 4NPNA 1NI3A 3VQIA 4W9DA 1HEZE 4KKJA 2MBHA 2GRIA 1K50A 5BYRA 4ARCA 1ESFA 3QAQA 2KX0A 2BGFA 2IGHA 3UGBB 2FIFA 2K8HA 2FNJB 1U4AA 1H4RA 1BT0A 3VH4B 2IDYA 1I4QA 4A3OA 1JWUD 2LGDA 2IGGA 1R7SA 3QWZB 4BKTA 2DENB 4OZCA 1MI0A 1WMHB 3B2GA 2G9HD 5J18A 4M8NA 4AOFA 4AS1A 3Q8EA 2L3ZA 1OQRA 1V5OA 4RF1A 4KSKC 4BKSD 1XLNA 4TMAB 3ZDMC 2DAJA 3ZJUA 1L2NA 4RM8A 4GDKB 1ZP0B 5CX3A 1HTOA 3TJPA 4KX6B 2DZMA 1PYWD 3GB1A 3ZW3A 2JUOA 3AE4B 1TKGA 1KJTA 2D10A 4EZJA 4S0RA 1I7HA 3N1ZC 4A6QA 4JQWC 2FUHB 2L05A 3V05A 1VZ8A 2O6VA 2TSSA 3HM3A 1E0ZA 1R4MB 2WXPA 5JH5C 3A4SC 1VDVA 1WIAA 5IN7A 2UYZB 2LMCA 1R4NI 1WE7A 4QAYA 4W9LA 1UBQA 2KACA 2Z0DB 3AN1A 1FNWA 3PRPB 1SIFA 4A3PA 3RMKC 5BYQA 4HDOA 1ROEA 3AEEB 1L7YA 2R2QA 3H7PA 4PYZA 3DBRI 3VHTC 4RGOS 3TEXA 4LJOB 4JWSC 1FFVA 1DYQA 3AE8B 2IZVB 1SE3A 1TS3A 3IG3A 1V8CA 4MM3B 3NY5A 2BWES 2PPHA 2KOXA 4ZYSA 2DLBA 2BKFA 2N1VA 3WA0A 1WM2A 1VRAB 3A9JB 3NVYA 1DGJA 3VTWA 1I4HA 3M3JA 3AEGB 3MC0B 3EHVA 1WXSA 1C79A 3V60A 3R3MA 1F52A 1N5XA 3Q6BA 2LEKA 2INCC 2KQSA 2MBOA 3DHHC 4DDGD 3TMPB 3W1YA 3L16A 1FPYA 2D3AA 3VUYA 4BOZB 3EECA 2V0GA 3AE6B 2QSDA 2ZNVC 2MX2A 3DVGX 2ZJDA 3AEDB 4HKQA 2B3AA 1SXTA 4LNOA 3VRBB 1SGHA 1WSPA 3BYYB 4ICUA 2K5PA 3Q8CA 3GOEA 1KLGD 4MH0E 4K7SA 4OVVA 2C60A 2ZPNA 3NS1A 4LNIA 3BWUD 3HIZA 4NQLB 4IKGA 4FN2A 2WXJA 2LUMA 2V3NA 3DDCB 4JWUC 2CU1A 4RMAA 2L52A 1Z5SB 3RNAC 3UQAA 1I35A 2WXKA 4BBNC 3WANA 3BINA 1E7UA 1EU4A 4XX5A 3NZSA 4GIVA 2MBQA 2K1FA 1J8CA 5CHVC 2KC2A 2D07B 4KDIC 1I4XA 1TYGB 4EOYA 3SHQA 1NYRA 4ASWC 2KQ7A 4J3OD 3ZTDA 4KZCA 2HDEA 4HPMB 3QJZA 3RNCC 4FJVB 3RD2A 3PHWB 3I5JC 3IBEA 1WX9A 2MRPA 4PS3A 3RCZA 4URKA 1D6EC 2K6QA 3N30A 2Q5WD 3L54A 2KKCA 3UQBA 2IY0B 3ZTCA 3HRDD 1TZ1A 2WXRA 5EE9A 3TSSA 4UDUC 3JSVA 3U8ZA 1GG3A 4WAFA 2LZ6A 3ZXVA 1V5TA 1V1PA 1XLPA 1EM7A 1D5MC 1YN5A 4DHJB 1AYFA 5EE0A 3Q69A 1F9JA 4WJPA 3VDZA 2WDTB 4HJKA 4A9AA 2NPTA 4DWFA 3CSFA 3KLSX 3TEYA 3RZFA 4PT5A 1KRHA 1RRBA 4TKNA 4HKZE 1SE4A 1M94A 3R2IA 4W9KA 5D6JB 4A20A 1AW7A 3A9KB 4YTMB 2QDFA 3B08A 4KKIA 3PZ7A 1A5RA 3RFZB 4HEA1 1J7AA 5FR3A 1NBFC 2IY1B 2JYTA 4BZAA 1OEYA 4OZAA 4DQOC 1RWSA 3SU8X 1FNUA 2G1EA 2IO0B 3TBLD 4M02A 3CMMB 2J42A 3IT6B 3WAMA 3I57A 3ZRCA 5LNK1 2BS4B 2AQ2B 3A4RA 4RF0A 4DHJD 1PGAA 2KK8A 1NENB 2W9NA 2MJDA 1TGZB 5E6JA 3ECIA 4WWPA 2N7EA 2KWDA 2KANA 1UWMA 4YT0B 2X38A 3KWLA 3KH0A 1F2RI 1HA5A 4W9JA 2H88B 2GMIC 3ZO5B 4IDIA 2WS3B 3WAPA 4ZRIA 2EKIA 4EFOA 1C76A 4RFBA 1DOXA 2QEJC 2IJ0A 5GXGB 3ZYYX 4EE2A 3M62B 2KAJA 2LD9A 3JW0X 5G2NA 2RDHA 2D11A 3Q3MC 4O1NA 1DOIA 1YJIA 3VRAB 1XT9B 1PGBA 3R7RA 2QILA 4C4VB 2NCNA 3H1UA 3N9YC 3VR9B 1VD2A 3AI5A 1Z2MA 5CHFA 1XQQA 4WH4A 2KDBA 1UWXA 4MACA 2JSVX 3RPFC 1OQQA 2M19A 1CMXB 3W2DA 2KMCA 3Q3NC 1HXYD 2N9XA 3DBHB 4GGQA 3TL5A 2K25A 4AJWA 5T8IA 1MFWA 2N1WA 3MJ5A 2PLPA 1TBEA 1WJ6A 2O2VA 1EF1A 4OVZA 2LVOA 4NJ7A 3ML8A 3FAHA 4X57B 1FIQA 1WJNA 4HPPA 1V1OA 1MG8A 1L5PA 3URYA 1JWMD 2JQRB 2FBWB 2NBVB 4RCOA 5L95C 2WXLA 2MWSB 2J0KA 2PVOD 2JF5A 2M1MA 3PV1A 1WR6E 2LASA 1IUEA 1WYWB 1JRPA 1UGJA 3HVZA 5J2RA 3QA8A 2N7DA 3LYYA 1F2RC 3ZUNA 3GE3C 1YQ4B 1L6UA 4N59A 4HJGE 4GSWA 4OW0A 2D2QA 3DVNU 2O6VB 2WXMA 2JT4B 1YD8U 2JRIB 1YQ3B 2JYEA 4MGIE 1FD6A 1KLVA 1P9DU 1FMAD 3ZLZA 1N61A 3SDLC 1IBXA 2Y3AA 4HVBA 3V6CB 1L6VA 3AE3B 3PTFC 2MH7A 1T3QA 3GE8C 3SEBA 4FADA 1L0XB 1RAXA 2MJ3A 5AZHA 1EU3A 1IPGA 1E8ZA 1SBBB 1SJED 1HE8A 1XF5L 1ZXHA 2M56B 1MHXA 4E74A 4I6PA 4JPSA 1Q1OA 3AEAB 1SIJA 1NEKB 2LRUA 3IHPC 3AE7B 1TZOA 3B0AA 3ZDTA 3ZIMA 5TR5A 3P4QB 2PEAA 3TIXA 2Z59B 2LFIA 3PZDA 4F7ZA 4KGSA 4LCDE 1HTQA 2KWUB 4BOSC 1GNUA 1P3QU 2O6VD 1G6JA 5G5HA 2D3BA 3W9CB 4GN1A 4WWNA 4L23A 4G0NB 1UH6A 3DVGY 2G4SA 3AULA 2VH2A 2N7JA 2I1KA 1BXTA 1N63A 3P1MA 5FR6A 3BIID 2ZEQA 1YMHE 4TQ0A 1FM0D 4MELA 4RGMA 4ZRPA 1F1HA 3APCA 2RD0A 1STEA 3U52E 3P4PB 2NBUA 2GBJA 2MP2A 1V97A 4XDDA 2LGIA 1UUPA 5HHDG 3N32A 2RR9A 3Q8AA 4AQ7A 1XCQL 2JZZA 4TUUA 3PRMB 1C3TA 1SE2A 3GS2A 3IFWB 2SAKA 5JXVA 3JVZX 2I38A 1N62A 1P7FA 3DWGC 3H7SA 1OFFA 1WRIA 1IGDA 1IGCA 3ZGZA 2WHIA 3ALBA 2ZCCA 4KSLC 3AE2B 2KN4A 3ENEA 4AP4C 2LJ5A 2BW2A 5LLIA 2KTRB 3RN9C 1YX6B 2KLGA 1JWAD 4MGYE 4K3CA 2YVCA 3BZDB 3B1LX 4MEMA 2PTLA 3U2SC 1YQBA 3NOBA 4LJPB 1CQVA 3LJ3A 2CS4A 4N9F4 3P63A 2QC8A 1QOBA 1SSNA 2IPKD 1I4GA 1HZ6A 4EZLA 4MH8A 4XWTA 2WQYB 1L4DB 4GB9A 2IGDA 4C80A 1JCKB 2AL3A 2PKOA 3AE5B 1PDXA 2C7NB 2K22A 3T3OA 5DPRA 2NBWB 3NZUA 1LQBA 4W9HA 2FUG1 1XLQA 4WURA 3P4RB 4P7IA 1ENFA 1HQRD 3O65B 2BYVE 3HM6X 3DVNV 1S1QB 2W55A 2KFKA 2KZRA 4HDQA 2HJ8A 3QCAA 1QKZA 4OZBA 2KJ6A 1TTNA 4NAWA 3AXCA 4DXAB 4C7YA 1N60A 1HZ5A 5TSSA 4JL9A 2LHDA 2NR2A 4JE3B 5C3JB 4DHZE 3SFEB 2JZPA 2RPQA 1YOVB 1TT5B 2K3UA 4XDCA 2G45B 1WXVA 1KH0A 2NTTA 1L4ZB 2BB6A 1ZOYB 4P1CC 1OEYJ 2KDEB 2UWQA 5AZFA 1KTKA 5C2TB 2X8XX 3W1SA 3AE1B 2ZZPB 2MQJA 4REZA 4DDID 1F77A 3T3NA 1I4PA 1AARA 2I2YA 3EC8A 2N4FA 1JMLA 1T6BX 4B95A 5CHWA 4D2KA 3PT2B 5KHOA 3X23A 2INPE 4L2YA 3SFDB 3PLVA 3S2AA 5BMGA 4FJZA 3Q2AC 3RULA 4GLSC 4CHKA 4IM2A 4E71A 1RLFA 1E5WA 2CHXA 5IOIA 4LNKA 5AEKB 3N3KB 2DYMA 3L08A 4NQKE 3R2TA 1K52A 2L76A 2GBMA 4HCPB 3B9JA 2BPSA 1MG4A 1GOZA 3L4PA 2KTFA 2K39A 4TV3A 2A5UA 3UIPB 2KN5A 3AE9B 1OQYA 1K51A 4DXGA 3DQVA 1WRDB 1V80A 4NY0A 3AV8A 2DYOA 2RPVA 4K1RB 4CQNA 2FAZA 3NVWA 2Y5BB 3MP9A 2LHEA 2ZVOA 4J6IA 2XNAC 1OGWA 3P42A 1FXAA 4FLHA 2JPHA 1WX7A 3UI3A 4JIOU 3AH7A 2OEDA 3NVVA 5D94A 2AX5A 4DXFA 2WDRB 4GOCA 4NJCA 2IYDB 3C19A 5JHBA 5D3DA 2QJLA 4M0WA 3EGRA 2ZVNA 1FCCC 3HUIA 2WYQA 1MVKA 2K9XA 3NJTA 1YJ1A 1FNVA 2CKHB 4KGRA 1ZGUB 3IVFA 1GB1A 4HLEA 2HE7A 2WNMA 4NZLB 2DBYA 4BBNF 3ZJTA 2KVRA 2O2VB 4RGTA 1P7EA 3ABVB 2J53A 3A1QA 5J17A 3P4SB 3BK2A 3DOWA 4BAXA 3Q3OC 4M8MA 2FCQA 3WALA 4LLGM 5I4DA 1B9RA 3PS6A 2KX3A 4TSSA 4W9FA 3AU5A 5HG2A 2FIDA 3VVWB 3M63B 1XCTL 4XWWA 2XN9C 3QARA 2V4IB 2IBIB 1E6EB 2NMQA 3W5VB 4K7WA 1WFYA 3DPDA 4YWGG 5DPSA 1QZEA 3EA6A 2J7QB 3A9JA 2MBBB 1JQ4A 1TS5A 3UIOB 5G5GA 4IWPA 1WJUA 1MJDA 3QQ8B 3ZXRA 2KFJA 1N6ZA 5MPOA 1WI0A 1JW9D 1C1YB 3SD5A 1CK1A 2RGFA 1IBXB 3KW5B 1T0SC 5E6PA 3ETRA 4KDLB 3RZWC 2DHZA 3FC4A 5BMIA 4XC2A 1PGXA 4YSYB 2IO3B 4MJSB 3I63C 4ZHOA 1V6EA 4FA6A 5HKHA 2ZW1A 5DPTA 3AB5A 3VAWA 3IT4B 2XK5B 4DK5A 4WQOB 3TCAA 4LTUA 4C56C 1GAQB 1Q10A 3B2FA 2WXOA 2MEKA 2OHFA 4ICVA 4R3DA 4KZ0A 4DBGA 2VZKD 3PGEA 1X1MA 2JVCA 1NI2A 2JY6A 3Q14C 4HXDA 1J19A 1WXMA 4IW0A 4KIKA 4EKUA 2D3CA 4I6NB 4WWOA 3H9DA 1P1AA 4I6LB 2V3SA 2MJEA 3L10B 4WJOA 4K7UA 3J9CA 2PW9A 3N1YC 1WYGA 5C23A 4FXCA 3DBLB 4TQ1A 5EDSA 3K9PB 4M01A 3BVGA 2J4XA 3KUCB 3NG0A 2KJRA 2N9PC 4A8XC 2RDGA 3MC8A 2BF8B 1QOAA 3EFCA 3PREA 1RM6C 2KMMA 4AWJA 1ZE3D 1UBIA 1ZKHA 2JWUA 4MSQB 1ACCA 2LVPA 4YSXB 5JHAA 5EE1A 4ZRQA 4IUMB 3BK1A 1WH3A 2Z0EB 3PSEB 2LGYA 3K9OB 1J7BA 4G11A 5FK9C 2MLBA 2BKRB 1EF5A 5GMVA 2CR5A 2RSUA 1QILA 5IP4D 2EMTA 1Y56A 2IO2B 4P6VF 1EWYC 2ASQA 2EMSA 2GBNA 1GC6A 2AQ3B 1NYQA 4JGHB 3ML9A 1FXIA 3L17A 4EZKA 5IKCM 3N20C 4IG7B 1T0QC 3TEZA 4S17A 4ANUA 1J0GA 3M95A 3ZNID 2WP9B 1XO3A 4BKGA 3A33B 2W3SA 2XBBC 3L0WB 2V9HA 4CO7A 4LDTD 3CSTA 2CJOA 1GB4A 1SE9A 3V61A 4AJYB 4KGTA 3NVZA 4CYEA 1RFAA 1F0ZA 2FCMA 2C9WB 1WGGA 4WAAA 2D3GA 3CIRB 3A9KA 4HCNB 2ON8A 1R4MI 1XXGA 5D7GA 2N9LA 4W9EA 1ISNA 2Z8LA 1WXQA 4MSMB 4B6WA 3TEWA 1YN3A 2BT6A 3H7PB 5EE3A 3DHIC 3OG5A 3ZQ4A 2PE6B 4K81A 4N6EB 1C4AA 2WGSA 2B76B 4P1BC 2NS5A 1N5WA 1E9MA 4MDKE 2PIAA 2K8BA 1WGHA 4GMVA 2QHOA 1QT9A 2IO1B 2JXTA 2KYWA 2V4LA 1B1ZA 3QC8B 3I3TB 3IAS1 3RT3B 4A90A 2WXHA 5AUKA 3T8MA 3DHGC 1FCLA 4L1BA 4WJNA 2DYBA 2L00B 3APFA 4HRSA 2BS3B 5C1ZA 5CTRC 4ACFA 2MSED 2L0FA 4IWOA 1VR9A 1GC7A 1QF6A 4HPLB 1GUAB 3RNEC 3APDA 2ACZB 3O13A 3QK0A 2J0JA 1TIFA 3NS8A 4RH6A 1WX8A 3BY4B 1P0RA 1YX5B 2HTME 1FRRA 4KV2A 3OJ3A 4C4VA 2WXQA 2N9KA 3UF8A 2UU7A 2KDIA 2RDBC 3MTNB 1UF0A 1V2YA 2KWVB 1NDDA 2L0TA 2D5GA 4XE0A 2KWCA 2AL6A 3VUXA 4GDLA 1WGKA 4PS8A 1E8YA 1TJEA 3ZJVA 3LDZE 1WJ4A 1WF9A 2INDC 4FULA 1WM3A 1QQRA 2LGSA 3PHXB 4N58A 1JWSD 4ANXA 2WLBA 2BYFA 3WIMA 4ZOHC 3PRZA 3CF6E 1DOYA 3TUOA 1C78A 4WWMA 4G50A 1PQSA 2JZ3B 4YL8A 2WXNA 1FXTB 2LRWA 4K3BA 2KJHB 3D32A 3DBSA 4F1SA 3UINB 1J7CA 2L83A 1V9JA 2J0MA 3VFKA 1M4VA 4C7ZA 1YJJA 2GBKA 4GU2A 4M0WB 1XEEA 4W9GA 4WJQA 4BVUC 4NJ6A 4ZDVA 4PS7A 5LXHA 4IC7B 4USAA 3ZKJC 1D4BA 2LXCA 3OLMD 1WZ3A 5G55A 1LFDA 3GZNB 2MA9B 1TKYA 3JSVB 1E90A 2DAFA 5AUIA 4YTPB 4ARIA 2C5LC 3A1QB 1V1PB 1ZXIA 2KC1A 3U7DA 3KYCD 1LO5D 3FILA 2BYTA 1EWCA 2WX1A 2XEWA 4WIPA 3VH3B 4IM0A 2SEBD 1I42A 2NPTB 4ZRKA 4RM9A 1T0YA 1T5XD 1SB3C 1V49A 2LWPA 2W54A 3VTVA 1YN4A 1S3SG 1GJZA 3MHZA 5L83A 4PK1A 2OJWA 2REXA 1UNSA 5D2MB 4M00A 3QX1A 3MC9A 5IA7A 4EEWA 1A70A 2MHJA 4LNNA 4GXBA 3AECB 1ET9A 3PZ8A 3ONSA 3QHTA 5FKAC 5H8YE 4NNJB 2AEHA 4BKSA 3DWMA 2GOWA 1MPEA 1TKEA 2HD5B 1D5XC 3EFUA 2R2OA 4H2AA 2R61A 3HVDA 3V6EB 3Q3FA 2KNBA 2BBCA 4ZHPA 3NZ3A 4RNAA 2W82A 3AEFB 3WAOA 1ZW7A 2WXIA 2Y5PA 3KYDD 2ONQA 4US8A 2PE9A 2QIEB 1C9FA 2JU6X 1TS4A 1JROA 3AU4A 2KT7A 2H89B 5IAAC 2GLSA 1VCBA 4HROA 1KLUD 3Q3JA 1IYFA 1SJHD 1VJKA 4ANVA 4US9A 4II3B 1WMHA 2L32A 2E6XA 3AM9A 4XZ4A 3ZNHB 3KQ4A 1JRUA 2PJHA 2JWZA 2WDVB 1WGRA 3JYUA 1SF0A 5D3IB 3ZRFA 4KIKB 3IAM1 1WWTA 1WE6A 3BVZA 4WQMA 3N1XC 4GDKA 3EUB2 3L13A 2WU5B 2KTRA 4IWQA 1PFDA 3PLUA 4YXDB 2BVCA 3T9LA 2NVUI 3RI7C 2CHWA 3DBLI 3C8YA 2ZNVB 5KHQA 1QOGA 3P2BA 2AWTA 3ZNZB 3DCGA 3LXFA 3VR8B 1R4NB 3C0RB 4FBJB 1VZ7A 2FCNA 2BYEA 3RNGC 4E3CA 2LGXA 5IO9A 4G3XB 1YNTE 4Q2JA 1CJEA 2LUEA 5E6OA 4MT5A 2WX0A 3DBRB 3U7ZA 2PMVA 1QOFA 4W9IA 3DBHI 5AZGA 1CZPA 1TY0A 4JX1C 4II2B 1IP9A 4IM3A 4HK2A 1P98A 5JZEB 1BUIC 2BS2B 2DWQA 2I1JA 2NTSA 3H8HA 3AMZA 4W9CA 2Y5CA 2AQ1B 1EUVB 4MGZE 2BWFA 2QMTA 2KMAA 2FE8A 4MM3A 2HJ1A 2KXJA 2KLCA 3Q8FA 2LI5A 1AN8A 5E6NA 1TY2A 3AEBB 4P16A 1E7VA 4FJYA 1WGYA 2VZKB 2AYOB 2G3QB 2EKEC 1D5ZC 3BVMA 3R8BA 1OTRB 2QCZA 1MHHE 3RNFC 2M4NA 1UZXB 2MCNB 2GI9A 4JLCA 2J52A 2CHZA 1H8CA 2VRRB 2VH1A 2JRHA 1E8XA 2PVGC 3MFGA 1GPXA 3E56A 1XD3B 1QLBB 2M0XA 3NUHB 3LB8C 2RMMA 4OHJA 4KVGB 4BFRA 5HI1A 3HHMA 3RUIB 2ZCBA 2K0PA 1AWDA 3VTUA 1KF6B 3RNBC 3RYTA 1LGRA 1E10A 1JALA 3IXSA 3QIJA 4DHZB 2HTHA 1LXDA 1SEBD 3KUZA 2JXXA 1T0RC 1WGDA 2GBRA 1EO6A 2LJIA 1C4CA 2BB5A 1YIWA 4IOIE 1FRDA 4A55A 3GP7A 2KO3A 4NAMA 4MGKE 5LXIB 3BYTB 1KOTA 2G4DB 1FO4A 1BMLC 3KUDB 2FCSA 2DZJA 2K6DB 3V62A 3NHEB 2YLMA 2DZKA 3KWVA 4B0EA 2KDFB 1PUTA 3PVLA 4LDTB 1JWBD 2MP2B 1FFUA 1RYJA 1V81A 2ZPYA 2CJNA 2DX5B 1Q0WB 2M0AA 2INNE 4LK0M 1WR1A 4HWIB 1ZDXA 4XYCA 1C77A 1ZDVA 2OOBB 3MHSD 2LVQA 1RFKA 3NRZA 4LNFA 4GDLB 1WXAA 2WU2B 1ET6A 2M8SA 5BYSA 2DZIA 1L0VB 2KHWB 3W5UB 1TS2A 3PPAA 3Q8BA 3MJWA 3FKYA 3V3XA 4C00A 4YTNB 1FEHA 2WWZA 3VXWA 5BMHA 2A4ZA 3OAWA 1UGMA 4AUQC 1UD7A 3OWEB 2L8JA 1ZPSA 3I9V1 2C7HA 3OJ4B 4B9KA 3R7QA 1E8WA 3R66C 1XLOA 2N9EB 2DNFA 2V3PA 3CWIA 3H6NA 1Y8RC 2BTEA 4OVUA 1KM7A 3HK0A 3U30A 1NVID 2LXAA 4EUTA 2ICIA 1L0YB 2M17A 3PO0A 2WXGA 1VZ6A 3SR6A 2KVZA 2KD0A
chains in the Genus database with same CATH topology
1PGAA 1J7CA 1NENB 2L83A 3AV8A 2DYOA 2MJDA 2RPVA 1VLBA 4CQNA 4ITKA 3NVWA 5E6JA 3MP9A 2LHEA 1M4VA 4C7ZA 1YJJA 2L1AA 4NAWB 2KWDA 2XNAC 3E9SA 4RGNA 2W3RA 3U4EG 4YSZB 2GB1A 1ZUD2 3P42A 1XEEA 1UWMA 1FXAA 4DXGA 2WDQB 4YT0B 2X38A 3KWLA 3UI3A 3AH7A 2OEDA 1F2RI 2N0SB 1HA5A 2YEPF 3NVVA 4USAA 2H88B 3FILB 1C4PA 1I4RA 2AX5A 2ZW0A 4DXFA 2WDRB 4IDIA 1D4BA 2WS3B 1K53A 4NJCA 2JX5A 2EKIA 1C76A 4RFBA 2WXFA 2E3TA 2QEJC 2IJ0A 2YEPB 5GXGB 3ZYYX 4EE2A 5D3DA 5HFYA 2QJLA 4M0WA 1TKYA 3EGRA 5AUIA 2KAJA 4YTPB 3WCQA 1FCCC 4ARIA 1KFYB 3HUIA 2RDHA 2EELA 1V1PB 1ZXIA 1MVKA 2K9XA 2KDMA 4O1NA 1LO5D 3FILA 2BYTA 1FNVA 1EWCA 1DOIA 2CU3A 1YJIA 3VRAB 4WIPA 1PGBA 4KGRA 2QILA 1GB1A 2SEBD 3N9YC 3VR9B 5H92C 2WNMA 4NZLB 1T5XD 2KQ4X 1SB3C 2DBYA 3ZJTA 2W54A 4RGTA 1P7EA 3ABVB 4WH4A 4MACA 1UWXA 1YN4A 4B0MA 2JSVX 3MHZA 2J53A 3RPFC 1OQQA 2M19A 1E7PB 1UNSA 3P4SB 1NI3A 3BK2A 3VQIA 3W2DA 1HXYD 1A70A 1HEZE 4KKJA 4LLGM 5T8IA 5I4DA 2GRIA 3MJ5A 3AECB 1B9RA 1ET9A 1K50A 2PLPA 5BYRA 3PZ8A 4ARCA 5FKAC 5H8YE 1ESFA 4TSSA 5HG2A 4OVZA 3DWMA 2IGHA 3FAHA 1XCTL 1MPEA 4XWWA 1TKEA 1D5XC 4H2AA 2XN9C 2R61A 1FIQA 3HVDA 2V4IB 1E6EB 2NMQA 2IDYA 1V1OA 3W5VB 1I4QA 2BBCA 4ZHPA 4YWGG 3NZ3A 1L5PA 4RNAA 1JWMD 3URYA 1JWUD 2W82A 2JQRB 2FBWB 3EA6A 4RCOA 2WXLA 3AEFB 2IGGA 1R7SA 2PVOD 1JQ4A 2WXIA 1TS5A 5G5GA 4OZCA 2Y5PA 1MI0A 3B2GA 2ONQA 2G9HD 1IUEA 4US8A 5MPOA 1JRPA 2QIEB 1C9FA 2JU6X 1JW9D 1TS4A 1JROA 1CK1A 4AS1A 1UGJA 3HVZA 3Q8EA 1IBXB 2H89B 1OQRA 4RF1A 1XLNA 3ETRA 3LYYA 1F2RC 4HROA 1KLUD 4TMAB 1YQ4B 1SJHD 3ZJUA 1VJKA 1L6UA 4GDKB 4N59A 3FC4A 5BMIA 4US9A 4HJGE 1PGXA 4OW0A 1ZP0B 4YSYB 2WXMA 2L32A 2E6XA 1YQ3B 2JYEA 3AM9A 4KX6B 4ZHOA 1PYWD 1FD6A 3KQ4A 3GB1A 2ZW1A 2WDVB 3AB5A 3AE4B 1FMAD 1SF0A 1TKGA 5D3IB 1N61A 3IT4B 1IBXA 3IAM1 2Y3AA 1I7HA 1WWTA 4A6QA 1L6VA 4LTUA 4C56C 1GAQB 3AE3B 3BVZA 2MH7A 4WQMA 1T3QA 1Q10A 3SEBA 1L0XB 3V05A 3EUB2 2MJ3A 2WXOA 2MEKA 2WU5B 1EU3A 3B2FA 1VZ8A 2OHFA 1SBBB 2TSSA 4R3DA 1SJED 1E0ZA 2WXPA 1PFDA 1XF5L 1ZXHA 1VDVA 2M56B 1MHXA 4YXDB 2VZKD 2LMCA 4JPSA 3AEAB 1SIJA 3C8YA 1NEKB 1QOGA 3AE7B 1TZOA 2KACA 3AN1A 1FNWA 5BYQA 3P4QB 2MJEA 3LXFA 3VR8B 3J9CA 1ROEA 2PW9A 3AEEB 1WYGA 2LFIA 4FXCA 4TQ1A 4RGOS 3TEXA 1VZ7A 4KGSA 4JWSC 1FFVA 1DYQA 3BVGA 3AE8B 2J4XA 1YNTE 4Q2JA 1CJEA 4A8XC 2RDGA 4MT5A 3U7ZA 5G5HA 1QOAA 1QOFA 2PMVA 3W9CB 1SE3A 1RM6C 2KMMA 1TS3A 1ZE3D 4L23A 1V8CA 4MM3B 1CZPA 1TY0A 4JX1C 2JWUA 1ACCA 4YSXB 1BUIC 2N7JA 5EE1A 2BS2B 2DWQA 4ZRQA 2NTSA 3BK1A 4ZYSA 2DLBA 3H8HA 3AMZA 1BXTA 1J7BA 1N63A 2Y5CA 3P1MA 2AQ1B 3BIID 1YMHE 5FK9C 4TQ0A 1FM0D 4RGMA 2QMTA 4ZRPA 1VRAB 2FE8A 1QILA 3NVYA 3Q8FA 1STEA 3U52E 1Y56A 3P4PB 1DGJA 4P6VF 1AN8A 1EWYC 1I4HA 1V97A 4XDDA 2LGIA 2AQ3B 1UUPA 1NYQA 3AEGB 5HHDG 3MC0B 1TY2A 1FXIA 3AEBB 3Q8AA 1C79A 4P16A 2VZKB 4AQ7A 1D5ZC 3BVMA 1N5XA 3R8BA 3TEZA 2LEKA 1XCQL 1SE2A 3GS2A 5JXVA 2SAKA 2WP9B 1MHHE 1XO3A 2I38A 2V0GA 1N62A 2W3SA 1P7FA 2QSDA 3AE6B 3DWGC 1OFFA 2GI9A 1WRIA 1IGDA 1IGCA 3AEDB 2CJOA 4HKQA 2J52A 1GB4A 3ZGZA 3AE2B 4KGTA 1SXTA 2KN4A 2PVGC 3NVZA 3MFGA 1GPXA 3VRBB 3E56A 2BW2A 1QLBB 1WSPA 3BYYB 3NUHB 2K5PA 2RMMA 3LB8C 3Q8CA 4OHJA 1F0ZA 1KLGD 5HI1A 1JWAD 3BZDB 2PTLA 3U2SC 2K0PA 3CIRB 1AWDA 1KF6B 2ON8A 3NS1A 3BWUD 1E10A 1XXGA 1JALA 5D7GA 2N9LA 3IXSA 1CQVA 4IKGA 2Z8LA 1WXQA 2WXJA 3P63A 3TEWA 1QOBA 2LUMA 1SSNA 1YN3A 2IPKD 2V3NA 2BT6A 4JWUC 1I4GA 1SEBD 1HZ6A 5EE3A 4MH8A 4XWTA 3ZQ4A 2L52A 2WQYB 4N6EB 1L4DB 1C4AA 4C80A 2IGDA 1JCKB 2LJIA 2PKOA 2WXKA 3AE5B 1C4CA 1PDXA 2B76B 2K22A 3T3OA 2BB5A 1N5WA 1E9MA 2FUG1 1EU4A 1DOXA 1XLQA 1FRDA 2PIAA 4IOIE 4A55A 3GP7A 4WURA 4NAMA 3P4RB 1ENFA 3BYTB 1HQRD 2W55A 1I4XA 1TYGB 1QT9A 1FO4A 1NYRA 1BMLC 1QKZA 4OZBA 2JXTA 4J3OD 1B1ZA 2HDEA 3IAS1 4A90A 2WXHA 5AUKA 3KWVA 4B0EA 4C7YA 1PUTA 1FCLA 4L1BA 1N60A 1HZ5A 5TSSA 1JWBD 1FFUA 2LHDA 1RYJA 4JE3B 1D6EC 5C3JB 2Q5WD 3SFEB 4HRSA 2BS3B 2JZPA 2CJNA 2M0AA 3HRDD 2INNE 4LK0M 2WXRA 5EE9A 3TSSA 1VR9A 2K3UA 4XDCA 1ZDXA 4UDUC 1C77A 1KH0A 1ZDVA 2NTTA 1L4ZB 2BB6A 1QF6A 1ZOYB 4WAFA 1RFKA 3NRZA 1KTKA 2ACZB 5C2TB 3O13A 3W1SA 3AE1B 4GDLB 1V1PA 1ET6A 1XLPA 2WU2B 4RH6A 1EM7A 4REZA 5BYSA 1D5MC 1YN5A 1AYFA 5EE0A 2HTME 1FRRA 1L0VB 3Q69A 1F77A 2N9KA 2WXQA 3W5UB 4A9AA 1TS2A 3T3NA 1I4PA 3Q8BA 3V3XA 3KLSX 3TEYA 2I2YA 4YTNB 2D5GA 4PT5A 1KRHA 1FEHA 4XE0A 1JMLA 1T6BX 5BMHA 1WGKA 4HKZE 4D2KA 1SE4A 3R2IA 2INPE 4L2YA 3SFDB 1AW7A 1TJEA 3OWEB 4YTMB 3ZJVA 5BMGA 1ZPSA 3I9V1 4KKIA 3PZ7A 4GLSC 1QQRA 3RFZB 4HEA1 1J7AA 5FR3A 4N58A 1JWSD 2WLBA 1XLOA 2DYMA 2JYTA 2V3PA 3R2TA 3CWIA 4OZAA 4ZOHC 4DQOC 1RWSA 1FNUA 1K52A 2G1EA 2BTEA 3B9JA 1DOYA 3TUOA 1C78A 4WWMA 1GOZA 2J42A 3IT6B 3I57A 1NVID 3L4PA 2WXNA 2ICIA 1L0YB 3PO0A 5LNK1 2BS4B 2AQ2B 3AE9B 2WXGA 1VZ6A 4RF0A 1K51A 3SR6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1N63 A;  2Y5C A;  2JQR B;  2FBW B;  3P1M A;  1NYR A;  3BII D;  3AEF B;  1R7S A;  1J7C A;  1NEN B;  1FM0 D;  2L83 A;  2PVO D;  3AV8 A;  1JQ4 A;  5G5G A;  2MJD A;  1VLB A;  3B2G A;  4ITK A;  3NVW A;  1IUE A;  3NVY A;  4US8 A;  5MPO A;  5AUK A;  1JRP A;  4C7Z A;  3P4P B;  1YJJ A;  1DGJ A;  2QIE B;  4YSZ B;  4P6V F;  1JW9 D;  1EWY C;  1JRO A;  1L5P A;  1V97 A;  2W3R A;  4C7Y A;  1PUT A;  3HVZ A;  5C2T B;  1N60 A;  2H89 B;  1ZUD 2;  1OQR A;  1JWB D;  1NYQ A;  1UWM A;  1FXA A;  3AEG B;  1FFU A;  1XLN A;  2WDQ B;  3ETR A;  3KWL A;  1RYJ A;  4YT0 B;  5C3J B;  4HRO A;  2Q5W D;  3SFE B;  1FXI A;  1YQ4 B;  3AEB B;  4HRS A;  1VJK A;  1L6U A;  2BS3 B;  3AH7 A;  4N59 A;  2N0S B;  3FC4 A;  2CJN A;  4US9 A;  3NVV A;  4YSY B;  1ZP0 B;  4USA A;  2H88 B;  3HRD D;  1J7B A;  3AM9 A;  5EE9 A;  1YQ3 B;  1N5X A;  4KX6 B;  4ZHO A;  2AX5 A;  2LEK A;  2WDR B;  4IDI A;  2WDV B;  2WS3 B;  2JX5 A;  3AB5 A;  3AE4 B;  1FMA D;  1SF0 A;  1TKG A;  1QF6 A;  2EKI A;  1ZOY B;  1N61 A;  1DOX A;  1RFK A;  2E3T A;  3NRZ A;  5GXG B;  2WP9 B;  3ZYY X;  1XO3 A;  2QJL A;  2ACZ B;  1I7H A;  1N62 A;  1TKY A;  1WWT A;  2W3S A;  3AE6 B;  3DWG C;  2KAJ A;  5AUI A;  1L6V A;  3AE1 B;  4YTP B;  2WU2 B;  1XLP A;  4LTU A;  3WCQ A;  1GAQ B;  3AE3 B;  1OFF A;  2MH7 A;  1KFY B;  1T3Q A;  4WQM A;  3HUI A;  1WRI A;  3AED B;  3EUB 2;  2CJO A;  2MJ3 A;  1AYF A;  1ZXI A;  2WU5 B;  2K9X A;  3B2F A;  2OHF A;  5EE0 A;  2HTM E;  1FRR A;  1L0V B;  3AE2 B;  3W5U B;  1DOI A;  2CU3 A;  1YJI A;  2PVG C;  3NVZ A;  3VRA B;  4A9A A;  1PFD A;  1VDV A;  2M56 B;  3VRB B;  1E0Z A;  1QLB B;  1GPX A;  4YXD B;  2K5P A;  3LB8 C;  1F0Z A;  3AEA B;  4YTN B;  3VR9 B;  1SIJ A;  1JWA D;  5H92 C;  1NEK B;  1KRH A;  1QOG A;  3AE7 B;  1SB3 C;  2DBY A;  3CIR B;  1AWD A;  3AN1 A;  1KF6 B;  1WGK A;  2W54 A;  3ABV B;  3NS1 A;  1E10 A;  3P4Q B;  3RPF C;  3SFD B;  1JAL A;  1OQQ A;  1TJE A;  2MJE A;  3LXF A;  3VR8 B;  1ROE A;  3AEE B;  2M19 A;  4YTM B;  1WXQ A;  1WYG A;  1E7P B;  4FXC A;  3P4S B;  1NI3 A;  3P63 A;  1QOB A;  2BT6 A;  1J7A A;  1A70 A;  4JWU C;  5EE3 A;  4JWS C;  1FFV A;  4N58 A;  2WLB A;  1XLO A;  3AEC B;  1B9R A;  3AE8 B;  2L52 A;  2WQY B;  4N6E B;  3CWI A;  4ZOH C;  1CJE A;  5H8Y E;  4C80 A;  1RWS A;  2PKO A;  3AE5 B;  1PDX A;  2G1E A;  2B76 B;  2K22 A;  3B9J A;  1QOA A;  1QOF A;  5G5H A;  1DOY A;  3W9C B;  1RM6 C;  2KMM A;  1N5W A;  3DWM A;  1E9M A;  4WWM A;  1V8C A;  3FAH A;  1XLQ A;  1FRD A;  2PIA A;  1CZP A;  4JX1 C;  1TKE A;  1NVI D;  3L4P A;  4YSX B;  3P4R B;  1FIQ A;  5EE1 A;  2BS2 B;  3PO0 A;  1FO4 A;  1E6E B;  2BS4 B;  2DWQ A;  3AE9 B;  3W5V B;  3AMZ A;  4ZHP A;  2W55 A;  3SR6 A;  1TYG B;  1QT9 A; 
#chains in the Genus database with same CATH topology
 2C7M B;  3W1S C;  3KVF B;  2KFK B;  2OJR A;  1VLB A;  2L7R A;  4ITK A;  1V86 A;  2L1A A;  4NAW B;  3E9S A;  4YSZ B;  3U4E G;  4RGN A;  2W3R A;  1UEL A;  3X0W A;  2GB1 A;  1ZUD 2;  2MW5 A;  4PYU A;  2WDQ B;  2MBE A;  1K8R B;  1LM8 B;  4MJS A;  2YEP F;  1WZ0 A;  2N0S B;  3GZN I;  3FIL B;  4ZRJ A;  3ZVV A;  1C4P A;  1I4R A;  4FHK A;  2ZW0 A;  4FHJ A;  5DCN A;  1K53 A;  2XK5 A;  2JX5 A;  4F8C B;  2WXF A;  2E3T A;  2YEP B;  5HFY A;  1WY8 A;  1D3Z A;  3WCQ A;  2K8C A;  2BQQ A;  2V1Y A;  1KFY B;  5DPW A;  2EEL A;  2KDM A;  3VUW A;  3ZNG C;  2CU3 A;  4ANW A;  5BO4 B;  5H92 C;  2KQ4 X;  4ZYN A;  4B0M A;  1Q5W B;  4XGA B;  1E7P B;  4NPN A;  1NI3 A;  3VQI A;  4W9D A;  1HEZ E;  4KKJ A;  2MBH A;  2GRI A;  1K50 A;  5BYR A;  4ARC A;  1ESF A;  3QAQ A;  2KX0 A;  2BGF A;  2IGH A;  3UGB B;  2FIF A;  2K8H A;  2FNJ B;  1U4A A;  1H4R A;  1BT0 A;  3VH4 B;  2IDY A;  1I4Q A;  4A3O A;  1JWU D;  2LGD A;  2IGG A;  1R7S A;  3QWZ B;  4BKT A;  2DEN B;  4OZC A;  1MI0 A;  1WMH B;  3B2G A;  2G9H D;  5J18 A;  4M8N A;  4AOF A;  4AS1 A;  3Q8E A;  2L3Z A;  1OQR A;  1V5O A;  4RF1 A;  4KSK C;  4BKS D;  1XLN A;  4TMA B;  3ZDM C;  2DAJ A;  3ZJU A;  1L2N A;  4RM8 A;  4GDK B;  1ZP0 B;  5CX3 A;  1HTO A;  3TJP A;  4KX6 B;  2DZM A;  1PYW D;  3GB1 A;  3ZW3 A;  2JUO A;  3AE4 B;  1TKG A;  1KJT A;  2D10 A;  4EZJ A;  4S0R A;  1I7H A;  3N1Z C;  4A6Q A;  4JQW C;  2FUH B;  2L05 A;  3V05 A;  1VZ8 A;  2O6V A;  2TSS A;  3HM3 A;  1E0Z A;  1R4M B;  2WXP A;  5JH5 C;  3A4S C;  1VDV A;  1WIA A;  5IN7 A;  2UYZ B;  2LMC A;  1R4N I;  1WE7 A;  4QAY A;  4W9L A;  1UBQ A;  2KAC A;  2Z0D B;  3AN1 A;  1FNW A;  3PRP B;  1SIF A;  4A3P A;  3RMK C;  5BYQ A;  4HDO A;  1ROE A;  3AEE B;  1L7Y A;  2R2Q A;  3H7P A;  4PYZ A;  3DBR I;  3VHT C;  4RGO S;  3TEX A;  4LJO B;  4JWS C;  1FFV A;  1DYQ A;  3AE8 B;  2IZV B;  1SE3 A;  1TS3 A;  3IG3 A;  1V8C A;  4MM3 B;  3NY5 A;  2BWE S;  2PPH A;  2KOX A;  4ZYS A;  2DLB A;  2BKF A;  2N1V A;  3WA0 A;  1WM2 A;  1VRA B;  3A9J B;  3NVY A;  1DGJ A;  3VTW A;  1I4H A;  3M3J A;  3AEG B;  3MC0 B;  3EHV A;  1WXS A;  1C79 A;  3V60 A;  3R3M A;  1F52 A;  1N5X A;  3Q6B A;  2LEK A;  2INC C;  2KQS A;  2MBO A;  3DHH C;  4DDG D;  3TMP B;  3W1Y A;  3L16 A;  1FPY A;  2D3A A;  3VUY A;  4BOZ B;  3EEC A;  2V0G A;  3AE6 B;  2QSD A;  2ZNV C;  2MX2 A;  3DVG X;  2ZJD A;  3AED B;  4HKQ A;  2B3A A;  1SXT A;  4LNO A;  3VRB B;  1SGH A;  1WSP A;  3BYY B;  4ICU A;  2K5P A;  3Q8C A;  3GOE A;  1KLG D;  4MH0 E;  4K7S A;  4OVV A;  2C60 A;  2ZPN A;  3NS1 A;  4LNI A;  3BWU D;  3HIZ A;  4NQL B;  4IKG A;  4FN2 A;  2WXJ A;  2LUM A;  2V3N A;  3DDC B;  4JWU C;  2CU1 A;  4RMA A;  2L52 A;  1Z5S B;  3RNA C;  3UQA A;  1I35 A;  2WXK A;  4BBN C;  3WAN A;  3BIN A;  1E7U A;  1EU4 A;  4XX5 A;  3NZS A;  4GIV A;  2MBQ A;  2K1F A;  1J8C A;  5CHV C;  2KC2 A;  2D07 B;  4KDI C;  1I4X A;  1TYG B;  4EOY A;  3SHQ A;  1NYR A;  4ASW C;  2KQ7 A;  4J3O D;  3ZTD A;  4KZC A;  2HDE A;  4HPM B;  3QJZ A;  3RNC C;  4FJV B;  3RD2 A;  3PHW B;  3I5J C;  3IBE A;  1WX9 A;  2MRP A;  4PS3 A;  3RCZ A;  4URK A;  1D6E C;  2K6Q A;  3N30 A;  2Q5W D;  3L54 A;  2KKC A;  3UQB A;  2IY0 B;  3ZTC A;  3HRD D;  1TZ1 A;  2WXR A;  5EE9 A;  3TSS A;  4UDU C;  3JSV A;  3U8Z A;  1GG3 A;  4WAF A;  2LZ6 A;  3ZXV A;  1V5T A;  1V1P A;  1XLP A;  1EM7 A;  1D5M C;  1YN5 A;  4DHJ B;  1AYF A;  5EE0 A;  3Q69 A;  1F9J A;  4WJP A;  3VDZ A;  2WDT B;  4HJK A;  4A9A A;  2NPT A;  4DWF A;  3CSF A;  3KLS X;  3TEY A;  3RZF A;  4PT5 A;  1KRH A;  1RRB A;  4TKN A;  4HKZ E;  1SE4 A;  1M94 A;  3R2I A;  4W9K A;  5D6J B;  4A20 A;  1AW7 A;  3A9K B;  4YTM B;  2QDF A;  3B08 A;  4KKI A;  3PZ7 A;  1A5R A;  3RFZ B;  4HEA 1;  1J7A A;  5FR3 A;  1NBF C;  2IY1 B;  2JYT A;  4BZA A;  1OEY A;  4OZA A;  4DQO C;  1RWS A;  3SU8 X;  1FNU A;  2G1E A;  2IO0 B;  3TBL D;  4M02 A;  3CMM B;  2J42 A;  3IT6 B;  3WAM A;  3I57 A;  3ZRC A;  5LNK 1;  2BS4 B;  2AQ2 B;  3A4R A;  4RF0 A;  4DHJ D;  1PGA A;  2KK8 A;  1NEN B;  2W9N A;  2MJD A;  1TGZ B;  5E6J A;  3ECI A;  4WWP A;  2N7E A;  2KWD A;  2KAN A;  1UWM A;  4YT0 B;  2X38 A;  3KWL A;  3KH0 A;  1F2R I;  1HA5 A;  4W9J A;  2H88 B;  2GMI C;  3ZO5 B;  4IDI A;  2WS3 B;  3WAP A;  4ZRI A;  2EKI A;  4EFO A;  1C76 A;  4RFB A;  1DOX A;  2QEJ C;  2IJ0 A;  5GXG B;  3ZYY X;  4EE2 A;  3M62 B;  2KAJ A;  2LD9 A;  3JW0 X;  5G2N A;  2RDH A;  2D11 A;  3Q3M C;  4O1N A;  1DOI A;  1YJI A;  3VRA B;  1XT9 B;  1PGB A;  3R7R A;  2QIL A;  4C4V B;  2NCN A;  3H1U A;  3N9Y C;  3VR9 B;  1VD2 A;  3AI5 A;  1Z2M A;  5CHF A;  1XQQ A;  4WH4 A;  2KDB A;  1UWX A;  4MAC A;  2JSV X;  3RPF C;  1OQQ A;  2M19 A;  1CMX B;  3W2D A;  2KMC A;  3Q3N C;  1HXY D;  2N9X A;  3DBH B;  4GGQ A;  3TL5 A;  2K25 A;  4AJW A;  5T8I A;  1MFW A;  2N1W A;  3MJ5 A;  2PLP A;  1TBE A;  1WJ6 A;  2O2V A;  1EF1 A;  4OVZ A;  2LVO A;  4NJ7 A;  3ML8 A;  3FAH A;  4X57 B;  1FIQ A;  1WJN A;  4HPP A;  1V1O A;  1MG8 A;  1L5P A;  3URY A;  1JWM D;  2JQR B;  2FBW B;  2NBV B;  4RCO A;  5L95 C;  2WXL A;  2MWS B;  2J0K A;  2PVO D;  2JF5 A;  2M1M A;  3PV1 A;  1WR6 E;  2LAS A;  1IUE A;  1WYW B;  1JRP A;  1UGJ A;  3HVZ A;  5J2R A;  3QA8 A;  2N7D A;  3LYY A;  1F2R C;  3ZUN A;  3GE3 C;  1YQ4 B;  1L6U A;  4N59 A;  4HJG E;  4GSW A;  4OW0 A;  2D2Q A;  3DVN U;  2O6V B;  2WXM A;  2JT4 B;  1YD8 U;  2JRI B;  1YQ3 B;  2JYE A;  4MGI E;  1FD6 A;  1KLV A;  1P9D U;  1FMA D;  3ZLZ A;  1N61 A;  3SDL C;  1IBX A;  2Y3A A;  4HVB A;  3V6C B;  1L6V A;  3AE3 B;  3PTF C;  2MH7 A;  1T3Q A;  3GE8 C;  3SEB A;  4FAD A;  1L0X B;  1RAX A;  2MJ3 A;  5AZH A;  1EU3 A;  1IPG A;  1E8Z A;  1SBB B;  1SJE D;  1HE8 A;  1XF5 L;  1ZXH A;  2M56 B;  1MHX A;  4E74 A;  4I6P A;  4JPS A;  1Q1O A;  3AEA B;  1SIJ A;  1NEK B;  2LRU A;  3IHP C;  3AE7 B;  1TZO A;  3B0A A;  3ZDT A;  3ZIM A;  5TR5 A;  3P4Q B;  2PEA A;  3TIX A;  2Z59 B;  2LFI A;  3PZD A;  4F7Z A;  4KGS A;  4LCD E;  1HTQ A;  2KWU B;  4BOS C;  1GNU A;  1P3Q U;  2O6V D;  1G6J A;  5G5H A;  2D3B A;  3W9C B;  4GN1 A;  4WWN A;  4L23 A;  4G0N B;  1UH6 A;  3DVG Y;  2G4S A;  3AUL A;  2VH2 A;  2N7J A;  2I1K A;  1BXT A;  1N63 A;  3P1M A;  5FR6 A;  3BII D;  2ZEQ A;  1YMH E;  4TQ0 A;  1FM0 D;  4MEL A;  4RGM A;  4ZRP A;  1F1H A;  3APC A;  2RD0 A;  1STE A;  3U52 E;  3P4P B;  2NBU A;  2GBJ A;  2MP2 A;  1V97 A;  4XDD A;  2LGI A;  1UUP A;  5HHD G;  3N32 A;  2RR9 A;  3Q8A A;  4AQ7 A;  1XCQ L;  2JZZ A;  4TUU A;  3PRM B;  1C3T A;  1SE2 A;  3GS2 A;  3IFW B;  2SAK A;  5JXV A;  3JVZ X;  2I38 A;  1N62 A;  1P7F A;  3DWG C;  3H7S A;  1OFF A;  1WRI A;  1IGD A;  1IGC A;  3ZGZ A;  2WHI A;  3ALB A;  2ZCC A;  4KSL C;  3AE2 B;  2KN4 A;  3ENE A;  4AP4 C;  2LJ5 A;  2BW2 A;  5LLI A;  2KTR B;  3RN9 C;  1YX6 B;  2KLG A;  1JWA D;  4MGY E;  4K3C A;  2YVC A;  3BZD B;  3B1L X;  4MEM A;  2PTL A;  3U2S C;  1YQB A;  3NOB A;  4LJP B;  1CQV A;  3LJ3 A;  2CS4 A;  4N9F 4;  3P63 A;  2QC8 A;  1QOB A;  1SSN A;  2IPK D;  1I4G A;  1HZ6 A;  4EZL A;  4MH8 A;  4XWT A;  2WQY B;  1L4D B;  4GB9 A;  2IGD A;  4C80 A;  1JCK B;  2AL3 A;  2PKO A;  3AE5 B;  1PDX A;  2C7N B;  2K22 A;  3T3O A;  5DPR A;  2NBW B;  3NZU A;  1LQB A;  4W9H A;  2FUG 1;  1XLQ A;  4WUR A;  3P4R B;  4P7I A;  1ENF A;  1HQR D;  3O65 B;  2BYV E;  3HM6 X;  3DVN V;  1S1Q B;  2W55 A;  2KFK A;  2KZR A;  4HDQ A;  2HJ8 A;  3QCA A;  1QKZ A;  4OZB A;  2KJ6 A;  1TTN A;  4NAW A;  3AXC A;  4DXA B;  4C7Y A;  1N60 A;  1HZ5 A;  5TSS A;  4JL9 A;  2LHD A;  2NR2 A;  4JE3 B;  5C3J B;  4DHZ E;  3SFE B;  2JZP A;  2RPQ A;  1YOV B;  1TT5 B;  2K3U A;  4XDC A;  2G45 B;  1WXV A;  1KH0 A;  2NTT A;  1L4Z B;  2BB6 A;  1ZOY B;  4P1C C;  1OEY J;  2KDE B;  2UWQ A;  5AZF A;  1KTK A;  5C2T B;  2X8X X;  3W1S A;  3AE1 B;  2ZZP B;  2MQJ A;  4REZ A;  4DDI D;  1F77 A;  3T3N A;  1I4P A;  1AAR A;  2I2Y A;  3EC8 A;  2N4F A;  1JML A;  1T6B X;  4B95 A;  5CHW A;  4D2K A;  3PT2 B;  5KHO A;  3X23 A;  2INP E;  4L2Y A;  3SFD B;  3PLV A;  3S2A A;  5BMG A;  4FJZ A;  3Q2A C;  3RUL A;  4GLS C;  4CHK A;  4IM2 A;  4E71 A;  1RLF A;  1E5W A;  2CHX A;  5IOI A;  4LNK A;  5AEK B;  3N3K B;  2DYM A;  3L08 A;  4NQK E;  3R2T A;  1K52 A;  2L76 A;  2GBM A;  4HCP B;  3B9J A;  2BPS A;  1MG4 A;  1GOZ A;  3L4P A;  2KTF A;  2K39 A;  4TV3 A;  2A5U A;  3UIP B;  2KN5 A;  3AE9 B;  1OQY A;  1K51 A;  4DXG A;  3DQV A;  1WRD B;  1V80 A;  4NY0 A;  3AV8 A;  2DYO A;  2RPV A;  4K1R B;  4CQN A;  2FAZ A;  3NVW A;  2Y5B B;  3MP9 A;  2LHE A;  2ZVO A;  4J6I A;  2XNA C;  1OGW A;  3P42 A;  1FXA A;  4FLH A;  2JPH A;  1WX7 A;  3UI3 A;  4JIO U;  3AH7 A;  2OED A;  3NVV A;  5D94 A;  2AX5 A;  4DXF A;  2WDR B;  4GOC A;  4NJC A;  2IYD B;  3C19 A;  5JHB A;  5D3D A;  2QJL A;  4M0W A;  3EGR A;  2ZVN A;  1FCC C;  3HUI A;  2WYQ A;  1MVK A;  2K9X A;  3NJT A;  1YJ1 A;  1FNV A;  2CKH B;  4KGR A;  1ZGU B;  3IVF A;  1GB1 A;  4HLE A;  2HE7 A;  2WNM A;  4NZL B;  2DBY A;  4BBN F;  3ZJT A;  2KVR A;  2O2V B;  4RGT A;  1P7E A;  3ABV B;  2J53 A;  3A1Q A;  5J17 A;  3P4S B;  3BK2 A;  3DOW A;  4BAX A;  3Q3O C;  4M8M A;  2FCQ A;  3WAL A;  4LLG M;  5I4D A;  1B9R A;  3PS6 A;  2KX3 A;  4TSS A;  4W9F A;  3AU5 A;  5HG2 A;  2FID A;  3VVW B;  3M63 B;  1XCT L;  4XWW A;  2XN9 C;  3QAR A;  2V4I B;  2IBI B;  1E6E B;  2NMQ A;  3W5V B;  4K7W A;  1WFY A;  3DPD A;  4YWG G;  5DPS A;  1QZE A;  3EA6 A;  2J7Q B;  3A9J A;  2MBB B;  1JQ4 A;  1TS5 A;  3UIO B;  5G5G A;  4IWP A;  1WJU A;  1MJD A;  3QQ8 B;  3ZXR A;  2KFJ A;  1N6Z A;  5MPO A;  1WI0 A;  1JW9 D;  1C1Y B;  3SD5 A;  1CK1 A;  2RGF A;  1IBX B;  3KW5 B;  1T0S C;  5E6P A;  3ETR A;  4KDL B;  3RZW C;  2DHZ A;  3FC4 A;  5BMI A;  4XC2 A;  1PGX A;  4YSY B;  2IO3 B;  4MJS B;  3I63 C;  4ZHO A;  1V6E A;  4FA6 A;  5HKH A;  2ZW1 A;  5DPT A;  3AB5 A;  3VAW A;  3IT4 B;  2XK5 B;  4DK5 A;  4WQO B;  3TCA A;  4LTU A;  4C56 C;  1GAQ B;  1Q10 A;  3B2F A;  2WXO A;  2MEK A;  2OHF A;  4ICV A;  4R3D A;  4KZ0 A;  4DBG A;  2VZK D;  3PGE A;  1X1M A;  2JVC A;  1NI2 A;  2JY6 A;  3Q14 C;  4HXD A;  1J19 A;  1WXM A;  4IW0 A;  4KIK A;  4EKU A;  2D3C A;  4I6N B;  4WWO A;  3H9D A;  1P1A A;  4I6L B;  2V3S A;  2MJE A;  3L10 B;  4WJO A;  4K7U A;  3J9C A;  2PW9 A;  3N1Y C;  1WYG A;  5C23 A;  4FXC A;  3DBL B;  4TQ1 A;  5EDS A;  3K9P B;  4M01 A;  3BVG A;  2J4X A;  3KUC B;  3NG0 A;  2KJR A;  2N9P C;  4A8X C;  2RDG A;  3MC8 A;  2BF8 B;  1QOA A;  3EFC A;  3PRE A;  1RM6 C;  2KMM A;  4AWJ A;  1ZE3 D;  1UBI A;  1ZKH A;  2JWU A;  4MSQ B;  1ACC A;  2LVP A;  4YSX B;  5JHA A;  5EE1 A;  4ZRQ A;  4IUM B;  3BK1 A;  1WH3 A;  2Z0E B;  3PSE B;  2LGY A;  3K9O B;  1J7B A;  4G11 A;  5FK9 C;  2MLB A;  2BKR B;  1EF5 A;  5GMV A;  2CR5 A;  2RSU A;  1QIL A;  5IP4 D;  2EMT A;  1Y56 A;  2IO2 B;  4P6V F;  1EWY C;  2ASQ A;  2EMS A;  2GBN A;  1GC6 A;  2AQ3 B;  1NYQ A;  4JGH B;  3ML9 A;  1FXI A;  3L17 A;  4EZK A;  5IKC M;  3N20 C;  4IG7 B;  1T0Q C;  3TEZ A;  4S17 A;  4ANU A;  1J0G A;  3M95 A;  3ZNI D;  2WP9 B;  1XO3 A;  4BKG A;  3A33 B;  2W3S A;  2XBB C;  3L0W B;  2V9H A;  4CO7 A;  4LDT D;  3CST A;  2CJO A;  1GB4 A;  1SE9 A;  3V61 A;  4AJY B;  4KGT A;  3NVZ A;  4CYE A;  1RFA A;  1F0Z A;  2FCM A;  2C9W B;  1WGG A;  4WAA A;  2D3G A;  3CIR B;  3A9K A;  4HCN B;  2ON8 A;  1R4M I;  1XXG A;  5D7G A;  2N9L A;  4W9E A;  1ISN A;  2Z8L A;  1WXQ A;  4MSM B;  4B6W A;  3TEW A;  1YN3 A;  2BT6 A;  3H7P B;  5EE3 A;  3DHI C;  3OG5 A;  3ZQ4 A;  2PE6 B;  4K81 A;  4N6E B;  1C4A A;  2WGS A;  2B76 B;  4P1B C;  2NS5 A;  1N5W A;  1E9M A;  4MDK E;  2PIA A;  2K8B A;  1WGH A;  4GMV A;  2QHO A;  1QT9 A;  2IO1 B;  2JXT A;  2KYW A;  2V4L A;  1B1Z A;  3QC8 B;  3I3T B;  3IAS 1;  3RT3 B;  4A90 A;  2WXH A;  5AUK A;  3T8M A;  3DHG C;  1FCL A;  4L1B A;  4WJN A;  2DYB A;  2L00 B;  3APF A;  4HRS A;  2BS3 B;  5C1Z A;  5CTR C;  4ACF A;  2MSE D;  2L0F A;  4IWO A;  1VR9 A;  1GC7 A;  1QF6 A;  4HPL B;  1GUA B;  3RNE C;  3APD A;  2ACZ B;  3O13 A;  3QK0 A;  2J0J A;  1TIF A;  3NS8 A;  4RH6 A;  1WX8 A;  3BY4 B;  1P0R A;  1YX5 B;  2HTM E;  1FRR A;  4KV2 A;  3OJ3 A;  4C4V A;  2WXQ A;  2N9K A;  3UF8 A;  2UU7 A;  2KDI A;  2RDB C;  3MTN B;  1UF0 A;  1V2Y A;  2KWV B;  1NDD A;  2L0T A;  2D5G A;  4XE0 A;  2KWC A;  2AL6 A;  3VUX A;  4GDL A;  1WGK A;  4PS8 A;  1E8Y A;  1TJE A;  3ZJV A;  3LDZ E;  1WJ4 A;  1WF9 A;  2IND C;  4FUL A;  1WM3 A;  1QQR A;  2LGS A;  3PHX B;  4N58 A;  1JWS D;  4ANX A;  2WLB A;  2BYF A;  3WIM A;  4ZOH C;  3PRZ A;  3CF6 E;  1DOY A;  3TUO A;  1C78 A;  4WWM A;  4G50 A;  1PQS A;  2JZ3 B;  4YL8 A;  2WXN A;  1FXT B;  2LRW A;  4K3B A;  2KJH B;  3D32 A;  3DBS A;  4F1S A;  3UIN B;  1J7C A;  2L83 A;  1V9J A;  2J0M A;  3VFK A;  1M4V A;  4C7Z A;  1YJJ A;  2GBK A;  4GU2 A;  4M0W B;  1XEE A;  4W9G A;  4WJQ A;  4BVU C;  4NJ6 A;  4ZDV A;  4PS7 A;  5LXH A;  4IC7 B;  4USA A;  3ZKJ C;  1D4B A;  2LXC A;  3OLM D;  1WZ3 A;  5G55 A;  1LFD A;  3GZN B;  2MA9 B;  1TKY A;  3JSV B;  1E90 A;  2DAF A;  5AUI A;  4YTP B;  4ARI A;  2C5L C;  3A1Q B;  1V1P B;  1ZXI A;  2KC1 A;  3U7D A;  3KYC D;  1LO5 D;  3FIL A;  2BYT A;  1EWC A;  2WX1 A;  2XEW A;  4WIP A;  3VH3 B;  4IM0 A;  2SEB D;  1I42 A;  2NPT B;  4ZRK A;  4RM9 A;  1T0Y A;  1T5X D;  1SB3 C;  1V49 A;  2LWP A;  2W54 A;  3VTV A;  1YN4 A;  1S3S G;  1GJZ A;  3MHZ A;  5L83 A;  4PK1 A;  2OJW A;  2REX A;  1UNS A;  5D2M B;  4M00 A;  3QX1 A;  3MC9 A;  5IA7 A;  4EEW A;  1A70 A;  2MHJ A;  4LNN A;  4GXB A;  3AEC B;  1ET9 A;  3PZ8 A;  3ONS A;  3QHT A;  5FKA C;  5H8Y E;  4NNJ B;  2AEH A;  4BKS A;  3DWM A;  2GOW A;  1MPE A;  1TKE A;  2HD5 B;  1D5X C;  3EFU A;  2R2O A;  4H2A A;  2R61 A;  3HVD A;  3V6E B;  3Q3F A;  2KNB A;  2BBC A;  4ZHP A;  3NZ3 A;  4RNA A;  2W82 A;  3AEF B;  3WAO A;  1ZW7 A;  2WXI A;  2Y5P A;  3KYD D;  2ONQ A;  4US8 A;  2PE9 A;  2QIE B;  1C9F A;  2JU6 X;  1TS4 A;  1JRO A;  3AU4 A;  2KT7 A;  2H89 B;  5IAA C;  2GLS A;  1VCB A;  4HRO A;  1KLU D;  3Q3J A;  1IYF A;  1SJH D;  1VJK A;  4ANV A;  4US9 A;  4II3 B;  1WMH A;  2L32 A;  2E6X A;  3AM9 A;  4XZ4 A;  3ZNH B;  3KQ4 A;  1JRU A;  2PJH A;  2JWZ A;  2WDV B;  1WGR A;  3JYU A;  1SF0 A;  5D3I B;  3ZRF A;  4KIK B;  3IAM 1;  1WWT A;  1WE6 A;  3BVZ A;  4WQM A;  3N1X C;  4GDK A;  3EUB 2;  3L13 A;  2WU5 B;  2KTR A;  4IWQ A;  1PFD A;  3PLU A;  4YXD B;  2BVC A;  3T9L A;  2NVU I;  3RI7 C;  2CHW A;  3DBL I;  3C8Y A;  2ZNV B;  5KHQ A;  1QOG A;  3P2B A;  2AWT A;  3ZNZ B;  3DCG A;  3LXF A;  3VR8 B;  1R4N B;  3C0R B;  4FBJ B;  1VZ7 A;  2FCN A;  2BYE A;  3RNG C;  4E3C A;  2LGX A;  5IO9 A;  4G3X B;  1YNT E;  4Q2J A;  1CJE A;  2LUE A;  5E6O A;  4MT5 A;  2WX0 A;  3DBR B;  3U7Z A;  2PMV A;  1QOF A;  4W9I A;  3DBH I;  5AZG A;  1CZP A;  1TY0 A;  4JX1 C;  4II2 B;  1IP9 A;  4IM3 A;  4HK2 A;  1P98 A;  5JZE B;  1BUI C;  2BS2 B;  2DWQ A;  2I1J A;  2NTS A;  3H8H A;  3AMZ A;  4W9C A;  2Y5C A;  2AQ1 B;  1EUV B;  4MGZ E;  2BWF A;  2QMT A;  2KMA A;  2FE8 A;  4MM3 A;  2HJ1 A;  2KXJ A;  2KLC A;  3Q8F A;  2LI5 A;  1AN8 A;  5E6N A;  1TY2 A;  3AEB B;  4P16 A;  1E7V A;  4FJY A;  1WGY A;  2VZK B;  2AYO B;  2G3Q B;  2EKE C;  1D5Z C;  3BVM A;  3R8B A;  1OTR B;  2QCZ A;  1MHH E;  3RNF C;  2M4N A;  1UZX B;  2MCN B;  2GI9 A;  4JLC A;  2J52 A;  2CHZ A;  1H8C A;  2VRR B;  2VH1 A;  2JRH A;  1E8X A;  2PVG C;  3MFG A;  1GPX A;  3E56 A;  1XD3 B;  1QLB B;  2M0X A;  3NUH B;  3LB8 C;  2RMM A;  4OHJ A;  4KVG B;  4BFR A;  5HI1 A;  3HHM A;  3RUI B;  2ZCB A;  2K0P A;  1AWD A;  3VTU A;  1KF6 B;  3RNB C;  3RYT A;  1LGR A;  1E10 A;  1JAL A;  3IXS A;  3QIJ A;  4DHZ B;  2HTH A;  1LXD A;  1SEB D;  3KUZ A;  2JXX A;  1T0R C;  1WGD A;  2GBR A;  1EO6 A;  2LJI A;  1C4C A;  2BB5 A;  1YIW A;  4IOI E;  1FRD A;  4A55 A;  3GP7 A;  2KO3 A;  4NAM A;  4MGK E;  5LXI B;  3BYT B;  1KOT A;  2G4D B;  1FO4 A;  1BML C;  3KUD B;  2FCS A;  2DZJ A;  2K6D B;  3V62 A;  3NHE B;  2YLM A;  2DZK A;  3KWV A;  4B0E A;  2KDF B;  1PUT A;  3PVL A;  4LDT B;  1JWB D;  2MP2 B;  1FFU A;  1RYJ A;  1V81 A;  2ZPY A;  2CJN A;  2DX5 B;  1Q0W B;  2M0A A;  2INN E;  4LK0 M;  1WR1 A;  4HWI B;  1ZDX A;  4XYC A;  1C77 A;  1ZDV A;  2OOB B;  3MHS D;  2LVQ A;  1RFK A;  3NRZ A;  4LNF A;  4GDL B;  1WXA A;  2WU2 B;  1ET6 A;  2M8S A;  5BYS A;  2DZI A;  1L0V B;  2KHW B;  3W5U B;  1TS2 A;  3PPA A;  3Q8B A;  3MJW A;  3FKY A;  3V3X A;  4C00 A;  4YTN B;  1FEH A;  2WWZ A;  3VXW A;  5BMH A;  2A4Z A;  3OAW A;  1UGM A;  4AUQ C;  1UD7 A;  3OWE B;  2L8J A;  1ZPS A;  3I9V 1;  2C7H A;  3OJ4 B;  4B9K A;  3R7Q A;  1E8W A;  3R66 C;  1XLO A;  2N9E B;  2DNF A;  2V3P A;  3CWI A;  3H6N A;  1Y8R C;  2BTE A;  4OVU A;  1KM7 A;  3HK0 A;  3U30 A;  1NVI D;  2LXA A;  4EUT A;  2ICI A;  1L0Y B;  2M17 A;  3PO0 A;  2WXG A;  1VZ6 A;  3SR6 A;  2KVZ A;  2KD0 A; 
#chains in the Genus database with same CATH homology
 1PGA A;  1J7C A;  1NEN B;  2L83 A;  3AV8 A;  2DYO A;  2MJD A;  2RPV A;  1VLB A;  4CQN A;  4ITK A;  3NVW A;  5E6J A;  3MP9 A;  2LHE A;  1M4V A;  4C7Z A;  1YJJ A;  2L1A A;  4NAW B;  2KWD A;  2XNA C;  3E9S A;  4RGN A;  2W3R A;  3U4E G;  4YSZ B;  2GB1 A;  1ZUD 2;  3P42 A;  1XEE A;  1UWM A;  1FXA A;  4DXG A;  2WDQ B;  4YT0 B;  2X38 A;  3KWL A;  3UI3 A;  3AH7 A;  2OED A;  1F2R I;  2N0S B;  1HA5 A;  2YEP F;  3NVV A;  4USA A;  2H88 B;  3FIL B;  1C4P A;  1I4R A;  2AX5 A;  2ZW0 A;  4DXF A;  2WDR B;  4IDI A;  1D4B A;  2WS3 B;  1K53 A;  4NJC A;  2JX5 A;  2EKI A;  1C76 A;  4RFB A;  2WXF A;  2E3T A;  2QEJ C;  2IJ0 A;  2YEP B;  5GXG B;  3ZYY X;  4EE2 A;  5D3D A;  5HFY A;  2QJL A;  4M0W A;  1TKY A;  3EGR A;  5AUI A;  2KAJ A;  4YTP B;  3WCQ A;  1FCC C;  4ARI A;  1KFY B;  3HUI A;  2RDH A;  2EEL A;  1V1P B;  1ZXI A;  1MVK A;  2K9X A;  2KDM A;  4O1N A;  1LO5 D;  3FIL A;  2BYT A;  1FNV A;  1EWC A;  1DOI A;  2CU3 A;  1YJI A;  3VRA B;  4WIP A;  1PGB A;  4KGR A;  2QIL A;  1GB1 A;  2SEB D;  3N9Y C;  3VR9 B;  5H92 C;  2WNM A;  4NZL B;  1T5X D;  2KQ4 X;  1SB3 C;  2DBY A;  3ZJT A;  2W54 A;  4RGT A;  1P7E A;  3ABV B;  4WH4 A;  4MAC A;  1UWX A;  1YN4 A;  4B0M A;  2JSV X;  3MHZ A;  2J53 A;  3RPF C;  1OQQ A;  2M19 A;  1E7P B;  1UNS A;  3P4S B;  1NI3 A;  3BK2 A;  3VQI A;  3W2D A;  1HXY D;  1A70 A;  1HEZ E;  4KKJ A;  4LLG M;  5T8I A;  5I4D A;  2GRI A;  3MJ5 A;  3AEC B;  1B9R A;  1ET9 A;  1K50 A;  2PLP A;  5BYR A;  3PZ8 A;  4ARC A;  5FKA C;  5H8Y E;  1ESF A;  4TSS A;  5HG2 A;  4OVZ A;  3DWM A;  2IGH A;  3FAH A;  1XCT L;  1MPE A;  4XWW A;  1TKE A;  1D5X C;  4H2A A;  2XN9 C;  2R61 A;  1FIQ A;  3HVD A;  2V4I B;  1E6E B;  2NMQ A;  2IDY A;  1V1O A;  3W5V B;  1I4Q A;  2BBC A;  4ZHP A;  4YWG G;  3NZ3 A;  1L5P A;  4RNA A;  1JWM D;  3URY A;  1JWU D;  2W82 A;  2JQR B;  2FBW B;  3EA6 A;  4RCO A;  2WXL A;  3AEF B;  2IGG A;  1R7S A;  2PVO D;  1JQ4 A;  2WXI A;  1TS5 A;  5G5G A;  4OZC A;  2Y5P A;  1MI0 A;  3B2G A;  2ONQ A;  2G9H D;  1IUE A;  4US8 A;  5MPO A;  1JRP A;  2QIE B;  1C9F A;  2JU6 X;  1JW9 D;  1TS4 A;  1JRO A;  1CK1 A;  4AS1 A;  1UGJ A;  3HVZ A;  3Q8E A;  1IBX B;  2H89 B;  1OQR A;  4RF1 A;  1XLN A;  3ETR A;  3LYY A;  1F2R C;  4HRO A;  1KLU D;  4TMA B;  1YQ4 B;  1SJH D;  3ZJU A;  1VJK A;  1L6U A;  4GDK B;  4N59 A;  3FC4 A;  5BMI A;  4US9 A;  4HJG E;  1PGX A;  4OW0 A;  1ZP0 B;  4YSY B;  2WXM A;  2L32 A;  2E6X A;  1YQ3 B;  2JYE A;  3AM9 A;  4KX6 B;  4ZHO A;  1PYW D;  1FD6 A;  3KQ4 A;  3GB1 A;  2ZW1 A;  2WDV B;  3AB5 A;  3AE4 B;  1FMA D;  1SF0 A;  1TKG A;  5D3I B;  1N61 A;  3IT4 B;  1IBX A;  3IAM 1;  2Y3A A;  1I7H A;  1WWT A;  4A6Q A;  1L6V A;  4LTU A;  4C56 C;  1GAQ B;  3AE3 B;  3BVZ A;  2MH7 A;  4WQM A;  1T3Q A;  1Q10 A;  3SEB A;  1L0X B;  3V05 A;  3EUB 2;  2MJ3 A;  2WXO A;  2MEK A;  2WU5 B;  1EU3 A;  3B2F A;  1VZ8 A;  2OHF A;  1SBB B;  2TSS A;  4R3D A;  1SJE D;  1E0Z A;  2WXP A;  1PFD A;  1XF5 L;  1ZXH A;  1VDV A;  2M56 B;  1MHX A;  4YXD B;  2VZK D;  2LMC A;  4JPS A;  3AEA B;  1SIJ A;  3C8Y A;  1NEK B;  1QOG A;  3AE7 B;  1TZO A;  2KAC A;  3AN1 A;  1FNW A;  5BYQ A;  3P4Q B;  2MJE A;  3LXF A;  3VR8 B;  3J9C A;  1ROE A;  2PW9 A;  3AEE B;  1WYG A;  2LFI A;  4FXC A;  4TQ1 A;  4RGO S;  3TEX A;  1VZ7 A;  4KGS A;  4JWS C;  1FFV A;  1DYQ A;  3BVG A;  3AE8 B;  2J4X A;  1YNT E;  4Q2J A;  1CJE A;  4A8X C;  2RDG A;  4MT5 A;  3U7Z A;  5G5H A;  1QOA A;  1QOF A;  2PMV A;  3W9C B;  1SE3 A;  1RM6 C;  2KMM A;  1TS3 A;  1ZE3 D;  4L23 A;  1V8C A;  4MM3 B;  1CZP A;  1TY0 A;  4JX1 C;  2JWU A;  1ACC A;  4YSX B;  1BUI C;  2N7J A;  5EE1 A;  2BS2 B;  2DWQ A;  4ZRQ A;  2NTS A;  3BK1 A;  4ZYS A;  2DLB A;  3H8H A;  3AMZ A;  1BXT A;  1J7B A;  1N63 A;  2Y5C A;  3P1M A;  2AQ1 B;  3BII D;  1YMH E;  5FK9 C;  4TQ0 A;  1FM0 D;  4RGM A;  2QMT A;  4ZRP A;  1VRA B;  2FE8 A;  1QIL A;  3NVY A;  3Q8F A;  1STE A;  3U52 E;  1Y56 A;  3P4P B;  1DGJ A;  4P6V F;  1AN8 A;  1EWY C;  1I4H A;  1V97 A;  4XDD A;  2LGI A;  2AQ3 B;  1UUP A;  1NYQ A;  3AEG B;  5HHD G;  3MC0 B;  1TY2 A;  1FXI A;  3AEB B;  3Q8A A;  1C79 A;  4P16 A;  2VZK B;  4AQ7 A;  1D5Z C;  3BVM A;  1N5X A;  3R8B A;  3TEZ A;  2LEK A;  1XCQ L;  1SE2 A;  3GS2 A;  5JXV A;  2SAK A;  2WP9 B;  1MHH E;  1XO3 A;  2I38 A;  2V0G A;  1N62 A;  2W3S A;  1P7F A;  2QSD A;  3AE6 B;  3DWG C;  1OFF A;  2GI9 A;  1WRI A;  1IGD A;  1IGC A;  3AED B;  2CJO A;  4HKQ A;  2J52 A;  1GB4 A;  3ZGZ A;  3AE2 B;  4KGT A;  1SXT A;  2KN4 A;  2PVG C;  3NVZ A;  3MFG A;  1GPX A;  3VRB B;  3E56 A;  2BW2 A;  1QLB B;  1WSP A;  3BYY B;  3NUH B;  2K5P A;  2RMM A;  3LB8 C;  3Q8C A;  4OHJ A;  1F0Z A;  1KLG D;  5HI1 A;  1JWA D;  3BZD B;  2PTL A;  3U2S C;  2K0P A;  3CIR B;  1AWD A;  1KF6 B;  2ON8 A;  3NS1 A;  3BWU D;  1E10 A;  1XXG A;  1JAL A;  5D7G A;  2N9L A;  3IXS A;  1CQV A;  4IKG A;  2Z8L A;  1WXQ A;  2WXJ A;  3P63 A;  3TEW A;  1QOB A;  2LUM A;  1SSN A;  1YN3 A;  2IPK D;  2V3N A;  2BT6 A;  4JWU C;  1I4G A;  1SEB D;  1HZ6 A;  5EE3 A;  4MH8 A;  4XWT A;  3ZQ4 A;  2L52 A;  2WQY B;  4N6E B;  1L4D B;  1C4A A;  4C80 A;  2IGD A;  1JCK B;  2LJI A;  2PKO A;  2WXK A;  3AE5 B;  1C4C A;  1PDX A;  2B76 B;  2K22 A;  3T3O A;  2BB5 A;  1N5W A;  1E9M A;  2FUG 1;  1EU4 A;  1DOX A;  1XLQ A;  1FRD A;  2PIA A;  4IOI E;  4A55 A;  3GP7 A;  4WUR A;  4NAM A;  3P4R B;  1ENF A;  3BYT B;  1HQR D;  2W55 A;  1I4X A;  1TYG B;  1QT9 A;  1FO4 A;  1NYR A;  1BML C;  1QKZ A;  4OZB A;  2JXT A;  4J3O D;  1B1Z A;  2HDE A;  3IAS 1;  4A90 A;  2WXH A;  5AUK A;  3KWV A;  4B0E A;  4C7Y A;  1PUT A;  1FCL A;  4L1B A;  1N60 A;  1HZ5 A;  5TSS A;  1JWB D;  1FFU A;  2LHD A;  1RYJ A;  4JE3 B;  1D6E C;  5C3J B;  2Q5W D;  3SFE B;  4HRS A;  2BS3 B;  2JZP A;  2CJN A;  2M0A A;  3HRD D;  2INN E;  4LK0 M;  2WXR A;  5EE9 A;  3TSS A;  1VR9 A;  2K3U A;  4XDC A;  1ZDX A;  4UDU C;  1C77 A;  1KH0 A;  1ZDV A;  2NTT A;  1L4Z B;  2BB6 A;  1QF6 A;  1ZOY B;  4WAF A;  1RFK A;  3NRZ A;  1KTK A;  2ACZ B;  5C2T B;  3O13 A;  3W1S A;  3AE1 B;  4GDL B;  1V1P A;  1ET6 A;  1XLP A;  2WU2 B;  4RH6 A;  1EM7 A;  4REZ A;  5BYS A;  1D5M C;  1YN5 A;  1AYF A;  5EE0 A;  2HTM E;  1FRR A;  1L0V B;  3Q69 A;  1F77 A;  2N9K A;  2WXQ A;  3W5U B;  4A9A A;  1TS2 A;  3T3N A;  1I4P A;  3Q8B A;  3V3X A;  3KLS X;  3TEY A;  2I2Y A;  4YTN B;  2D5G A;  4PT5 A;  1KRH A;  1FEH A;  4XE0 A;  1JML A;  1T6B X;  5BMH A;  1WGK A;  4HKZ E;  4D2K A;  1SE4 A;  3R2I A;  2INP E;  4L2Y A;  3SFD B;  1AW7 A;  1TJE A;  3OWE B;  4YTM B;  3ZJV A;  5BMG A;  1ZPS A;  3I9V 1;  4KKI A;  3PZ7 A;  4GLS C;  1QQR A;  3RFZ B;  4HEA 1;  1J7A A;  5FR3 A;  4N58 A;  1JWS D;  2WLB A;  1XLO A;  2DYM A;  2JYT A;  2V3P A;  3R2T A;  3CWI A;  4OZA A;  4ZOH C;  4DQO C;  1RWS A;  1FNU A;  1K52 A;  2G1E A;  2BTE A;  3B9J A;  1DOY A;  3TUO A;  1C78 A;  4WWM A;  1GOZ A;  2J42 A;  3IT6 B;  3I57 A;  1NVI D;  3L4P A;  2WXN A;  2ICI A;  1L0Y B;  3PO0 A;  5LNK 1;  2BS4 B;  2AQ2 B;  3AE9 B;  2WXG A;  1VZ6 A;  4RF0 A;  1K51 A;  3SR6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...