1WRIA

Crystal structure of ferredoxin isoform ii from e. arvense
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
93
structure length
93
Chain Sequence
b'AYKVTLKTPDGDITFDVEPGERLIDIGSEKADLPLSCQAGACSTCLGKIVSGTVDQSEGSFLDDEQIEQGYVLTCIAIPESDVVIETHKEDEL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ferredoxin II
publication title A structural basis of Equisetum arvense ferredoxin isoform II producing an alternative electron transfer with ferredoxin-NADP+ reductase.
pubmed doi rcsb
source organism Equisetum arvense
molecule tags Electron transport
total genus 19
structure length 93
sequence length 93
ec nomenclature
pdb deposition date 2004-10-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00111 Fer2 2Fe-2S iron-sulfur cluster binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1wriA00
3B9JA 4JX1C 2N0SB 1ZP0B 1AWDA 3KWLA 1WXQA 1E0ZA 2K5PA 2WDQB 2L52A 1ZXIA 5H8YE 1TYGB 4HRSA 3AB5A 3AE3B 4ZHOA 1JQ4A 2AX5A 3AMZA 1L0VB 3AE7B 3B2GA 2LEKA 1NENB 4A9AA 1ZUD2 2B76B 5H92C 1NI3A 1RM6C 2G1EA 2PIAA 5AUIA 3AE2B 3AEAB 1IUEA 1N5XA 1JRPA 1GPXA 1N62A 1TKEA 1XO3A 5EE9A 1JROA 4FXCA 1FO4A 4YXDB 3AE8B 5GXGB 4C7ZA 1KFYB 3AE1B 3FAHA 1AYFA 1N60A 1R7SA 1YQ3B 3AEGB 3DWGC 4LTUA 1J7BA 1CJEA 2JX5A 1PDXA 2WP9B 1FFVA 2K22A 2Q5WD 3EUB2 3ZYYX 3NVYA 2DBYA 1J7CA 3P4SB 3P4QB 3P63A 1FIQA 1JWBD 3AN1A 4C80A 5C3JB 1NEKB 3VRAB 1WYGA 2PKOA 1TKGA 1B9RA 4N58A 4KX6B 5MPOA 2WDVB 3NVWA 4ZHPA 4JWUC 3AEDB 4N59A 3NS1A 1E9MA 3AEBB 1UWMA 3LB8C 2W55A 1YQ4B 3AE6B 1JWAD 1QOBA 2W3SA 3BIID 3AEFB 5C2TB 3WCQA 1VLBA 2W3RA 3AE4B 4ITKA 5EE3A 3VR9B 3AE9B 5EE0A 2WU2B 2CU3A 4C7YA 1FXIA 1YJIA 4N6EB 4YSXB 3P1MA 1JALA 1NVID 2CJNA 2JQRB 1EWYC 1N63A 4WQMA 1DOYA 2QIEB 3AE5B 1RFKA 3NVVA 1QLBB 1V97A 1E7PB 3P4PB 1F0ZA 2HTME 2ACZB 2W54A 1DOXA 2FBWB 1ZOYB 2WS3B 3AH7A 1FRDA 1XLQA 3AECB 1SB3C 1QOFA 1QOAA 1XLOA 3NVZA 3PO0A 1KRHA 3LXFA 1L6UA 2OHFA 2WQYB 4P6VF 3W5VB 5G5GA 1I7HA 1OQRA 1PFDA 1RYJA 1XLPA 2KMMA 3CWIA 2MJDA 4JWSC 1OQQA 3HVZA 3AEEB 2M56B 1FM0D 2Y5CA 1TJEA 2H88B 2MJ3A 1PUTA 5EE1A 1N5WA 3W9CB 2MH7A 3SFDB 1A70A 3NRZA 1DOIA 2M19A 2KAJA 3VRBB 1T3QA 1QOGA 1DGJA 1YJJA 4IDIA 1E10A 2PVGC 1E6EB 2K9XA 3SFEB 2BS3B 2BS4B 4ZOHC 4US8A 2PVOD 2WU5B 1CZPA 1RWSA 1WGKA 2WDRB 1L5PA 4YTNB 1VJKA 2WLBA 3ABVB 3HUIA 3L4PA 4YTPB 1TKYA 4YSYB 1KF6B 1SF0A 1WWTA 2L83A 1SIJA 3AM9A 4US9A 3SR6A 2EKIA 4WWMA 1QT9A 5G5HA 3W5UB 3B2FA 3CIRB 1JW9D 2BT6A 2QJLA 3DWMA 1OFFA 1FMAD 1VDVA 2MJEA 3AV8A 3HRDD 4HROA 3RPFC 3VR8B 4YT0B 1XLNA 2H89B 2DWQA 3ETRA 4YSZB 4USAA 4YTMB 1QF6A 1FFUA 1V8CA 1J7AA 1FXAA 5AUKA 1N61A 3P4RB 1ROEA 1FRRA 1L6VA 2BS2B 2E3TA 1GAQB 3FC4A 2CJOA 1NYQA 1WRIA 1NYRA
chains in the Genus database with same CATH superfamily
4X57B 2YLMA 2GRIA 5CHWA 2WDQB 5AZHA 3ZVVA 2GMIC 1PYWD 3RZFA 2AX5A 1L0VB 3AE7B 3B2GA 1WI0A 2WWZA 2UYZB 3AEAB 4DXGA 1EO6A 2KHWB 4E71A 4JE3B 2OJRA 1GC7A 2GOWA 2K8CA 2WGSA 3B08A 3GZNI 1Q5WB 2WP9B 2IO0B 4PYUA 4MACA 3BYYB 4NJCA 4BBNC 2KWDA 3IT4B 3VRAB 5JH5C 1ISNA 2AQ3B 4OW0A 3NVWA 4JWUC 2J4XA 2IY0B 4GIVA 1XCTL 3VQIA 2KDFB 3IXSA 1VLBA 4W9GA 5IA7A 3UF8A 3PPAA 1D5XC 1MVKA 4F7ZA 2WXFA 2ACZB 3ZDTA 3MTNB 2KC2A 4KVGB 3RNGC 3NZUA 2N7JA 3TIXA 4AJYB 1GC6A 4PS8A 1KLUD 4W9IA 3P42A 3DQVA 2MX2A 4TV3A 3B1LX 3QC8B 1DOIA 4FJVB 2J53A 3WAMA 4IDIA 4BAXA 3L08A 2IZVB 5DPWA 1RWSA 1L4DB 1WXAA 1IBXA 1XCQL 1SIJA 5C1ZA 4RM9A 2X38A 3A9JA 2W9NA 2D11A 3DHGC 1XLNA 4RFBA 1YNTE 3UQAA 3APCA 3S2AA 3IAS1 4NJ7A 1WJ6A 3U52E 1IPGA 1C4CA 1MJDA 2UWQA 1YN3A 1F9JA 2OJWA 4HRSA 4TQ1A 3U2SC 4GXBA 2QCZA 5HFYA 2FCSA 5AUIA 1I42A 3IAM1 2QEJC 1GOZA 4HCNB 3Q3FA 4MEMA 4W9FA 1P1AA 2WXLA 3VUYA 1V5TA 4L23A 5FKAC 2MP2A 1UD7A 1KFYB 3AE1B 2RSUA 1AYFA 3T3OA 2JYEA 2WXNA 3APFA 1EU4A 1JMLA 1M94A 4WWNA 3RD2A 2PW9A 2L1AA 3EUB2 1H8CA 2M0XA 1WR6E 2KYWA 3Q69A 3URYA 3R7QA 4ZHPA 4KSLC 1QOBA 3N1YC 2N7EA 1HTQA 2CU3A 1FXIA 2LGIA 4K7UA 1FD6A 3AI5A 3ZO5B 2IO2B 1V2YA 2JZPA 2N9KA 3NG0A 1NBFC 1VCBA 1OEYJ 1AN8A 2BB5A 5DCNA 2KDMA 2PMVA 3VHTC 4JLCA 2N1WA 3K9PB 3AEEB 1N5WA 2J0MA 4BKTA 2KK8A 2KLGA 2N4FA 5CHFA 2LRWA 2RGFA 3OLMD 1GG3A 4TQ0A 2BS4B 2WU5B 2C7HA 3BINA 4J3OD 4W9LA 1TKYA 2J42A 1QT9A 2RDGA 5L95C 3I9V1 2LHEA 3W1YA 1GAQB 2V3NA 4YL8A 2KT7A 1K50A 4XWWA 4FULA 1V49A 2INDC 3AMZA 3ZXRA 4A3OA 3H7SA 5H92C 2D2QA 2L0TA 1TZ1A 2KTFA 3ZIMA 1JRPA 4DK5A 2WXRA 5D94A 3ECIA 2DZIA 2LJ5A 4RM8A 1C9FA 1CJEA 3KUZA 3EGRA 3C19A 2K22A 2Q5WD 3ZYYX 5C3JB 1NEKB 2AQ1B 3ONSA 1KH0A 1WXSA 2ZPYA 2L8JA 1KLGD 2DYOA 2O6VD 1YQ4B 2G4SA 2IY1B 3DVGX 2KWCA 4LNNA 3JSVA 4IM0A 2BQQA 2BF8B 2FIDA 1N63A 2L32A 4L2YA 3KVFB 2J0KA 2RR9A 4GOCA 4II3B 4XYCA 1WYWB 2IGGA 1FNUA 3A1QA 5D3DA 2L05A 1F2RI 2JZ3B 2MJDA 5CX3A 1P98A 1I4QA 3A4RA 3ZUNA 1YJJA 1EF1A 4KGTA 1R4MB 4G3XB 1C4PA 4US8A 1WJUA 3OJ4B 3R3MA 1FNVA 3OG5A 3ABVB 3UIOB 5IO9A 3DVNV 3SR6A 2QSDA 2W82A 3VTVA 3ZJUA 3DWMA 3BWUD 3ZRFA 3ZNID 3WAPA 1H4RA 1V8CA 1FRRA 2JRHA 2E3TA 2KWVB 2IO1B 1XT9B 2I38A 2XK5A 4WJQA 2Z0DB 1ZXIA 4E3CA 2LXAA 2G1EA 3AE2B 1MPEA 2C5LC 2JSVX 2CKHB 3EC8A 1I4RA 4ZYNA 2KN5A 4B0EA 4HK2A 4HWIB 3DBHI 3SD5A 3AEGB 4M0WB 2ZVNA 2WXOA 2HJ1A 1OEYA 3HVDA 3W1SC 5D2MB 3HK0A 4LJOB 2BVCA 2K6DB 4C80A 2B3AA 2IPKD 4MELA 2JF5A 3L0WB 2KC1A 1DYQA 3PZDA 3QX1A 1JWAD 1WE6A 3BIID 4DHZE 2ZCCA 4RCOA 2LXCA 4IC7B 1CQVA 2K8HA 4RGOS 3WALA 4PS3A 3ZGZA 4W9DA 2O6VB 1SE3A 4K1RB 2WXIA 4ICVA 4AOFA 3RI7C 2RPVA 4YWGG 2BKFA 1QOAA 1SE2A 4ANVA 4EFOA 4LNFA 3UGBB 3W5VB 2G4DB 2DENB 2GBMA 2KQ4X 2G45B 2CS4A 3QK0A 2G9HD 1ZGUB 3PLUA 2K9XA 2NCNA 3EFCA 3H7PB 2MBBB 2GI9A 2UU7A 3QIJA 4RMAA 1WSPA 3DOWA 3MHSD 1KF6B 5T8IA 1WY8A 3GE3C 3UIPB 3KUDB 1JW9D 3HRDD 4CHKA 1WMHB 1WGDA 2M0AA 4WAAA 2KACA 1FXAA 4GDKB 5LNK1 4P1BC 2CHXA 2LJIA 1E0ZA 2GBNA 3EFUA 1R4NI 1C1YB 2IGHA 3VTUA 4FJZA 4ZRKA 3EHVA 2ZCBA 4A9AA 2B76B 2N9PC 2HE7A 1WX8A 3R2TA 3QCAA 3NUHB 1MFWA 1U4AA 1WGYA 2JU6X 1C4AA 1P3QU 2K8BA 3BVMA 1AW7A 4FLHA 2M4NA 4IKGA 4KIKB 5E6OA 1WYGA 3PREA 1B9RA 1L0XB 1GNUA 3AEDB 2VH1A 3DVNU 3ZDMC 3AE6B 1FPYA 3PVLA 3TCAA 4ITKA 3UINB 1P0RA 3MC0B 4NAWB 1E8YA 4WQMA 5D3IB 3PS6A 2DYMA 2FNJB 3AH7A 4GN1A 2SAKA 3GB1A 1NI2A 1PGXA 4IUMB 1TJEA 2MJ3A 5EE1A 2FIFA 5E6PA 4AP4C 1NDDA 2PLPA 3VXWA 3QA8A 4GB9A 2MW5A 4MM3A 4CQNA 2CHWA 3V3XA 3TEYA 1RLFA 1UGJA 2DZKA 4HROA 2QJLA 1UGMA 3X0WA 2LFIA 2DWQA 3ETRA 1QF6A 3FKYA 3ZTCA 3QJZA 4WJPA 1V1PB 1VR9A 1WXMA 1NYQA 2V4LA 1TS4A 3VH4B 3KWLA 4IOIE 4ZRIA 2KFKA 1FXTB 1XD3B 2I1KA 1ZDVA 2AEHA 2GBKA 1YX5B 1TTNA 3A9KB 1L7YA 1T0YA 1WJ4A 3JYUA 1ACCA 4C7ZA 2WYQA 2JX5A 1G6JA 2K39A 1J7CA 3P63A 3RNFC 2NTTA 1E8WA 2Z59B 2WXGA 1SGHA 1PGAA 2FCNA 2I2YA 2V1YA 3DBRI 3WA0A 4EEWA 3DCGA 1DOYA 4TSSA 3CSTA 4IM2A 4XZ4A 2FBWB 1WX7A 1ET6A 3V60A 4MGIE 3HM3A 3NVZA 3R8BA 4BVUC 2REXA 3CWIA 4ZRJA 3DHHC 2KXJA 3AXCA 3RMKC 4URKA 1T0SC 2WX1A 3NRZA 5IKCM 2EMSA 4ARCA 4WJNA 3QAQA 3SFEB 4ACFA 4OHJA 2PTLA 4I6PA 3A4SC 1CMXB 3L13A 3RNCC 1EWCA 5G5HA 3B2FA 1KTKA 3BVGA 1TS2A 4YTMB 2ON8A 1MG4A 2JPHA 1C79A 2ZPNA 4P16A 1WGHA 4OZBA 2K25A 3V61A 2LI5A 2ZZPB 4NQKE 2VH2A 2D5GA 1TYGB 3T8MA 1KJTA 4M8MA 3ML9A 4EE2A 1N5XA 4AQ7A 4S17A 1JROA 1T0RC 3C0RB 1JWSD 2QMTA 2DNFA 4BKGA 2KX0A 5FR6A 1C77A 3P4SB 5BYRA 4W9CA 4M01A 4K3BA 3RNAC 4WH4A 4N58A 2KOXA 2WDVB 1WF9A 3N30A 2LVOA 5D7GA 1I4XA 3L10B 4N6EB 2BYVE 1KM7A 1JALA 2CJNA 4ASWC 5JXVA 1QLBB 1V97A 2BW2A 2WX0A 2WS3B 4OZCA 5J18A 3V6EB 1R4MI 2ONQA 5G5GA 1PFDA 4OVZA 1C76A 2M56B 3VAWA 2BYEA 4BZAA 3SFDB 4C4VB 2CHZA 3RYTA 1QOGA 3RULA 2K0PA 3IHPC 4C4VA 1I4PA 3GOEA 2KFJA 2RD0A 1WZ0A 3R66C 4L1BA 2TSSA 2L83A 3AM9A 3DBLB 1P7FA 4ZYSA 4YT0B 1N61A 3P4RB 2MBOA 4MDKE 3KYCD 4B0MA 3PSEB 3WIMA 2INPE 4IWOA 4DHJD 3TMPB 4O1NA 1NI3A 1RM6C 1X1MA 2YVCA 3GZNB 4PYZA 3TBLD 3NS8A 4B6WA 1ZE3D 5C23A 4WIPA 2HTHA 5FR3A 2GBJA 3U7DA 2KVRA 4DHZB 4KDIC 4BBNF 4KGSA 1VD2A 4WQOB 2DBYA 3AN1A 2PKOA 2L7RA 5FK9C 3Q3JA 2I1JA 1KOTA 4NAMA 4I6NB 3PRZA 1LQBA 2W3SA 3L54A 2BWFA 4JIOU 1UBQA 2LMCA 1UWXA 3O65B 2JQRB 4RH6A 1RFKA 3N9YC 3H6NA 5BYQA 4XE0A 3P4PB 3IT6B 3VVWB 1JRUA 3Q6BA 1XLQA 1YMHE 1RFAA 1TGZB 1ZKHA 2MSED 1L6UA 1LXDA 2N1VA 3OJ3A 1RYJA 4XGAB 3IFWB 5AZFA 1BUIC 3NZ3A 5AEKB 3TJPA 1PUTA 2MH7A 4KSKC 1A70A 4LK0M 2Z0EB 3VH3B 3V62A 2BS3B 1CZPA 2WXHA 1VJKA 1TY2A 1UZXB 1TT5B 3NZSA 5JZEB 2O2VB 3TSSA 1FMAD 1P7EA 2M1MA 2MQJA 2DAFA 2BS2B 4KZCA 2CJOA 3RUIB 2IDYA 2J0JA 1C3TA 1L4ZB 2L52A 1K8RB 3AE3B 1HEZE 2LGDA 4MGYE 1ZPSA 1CK1A 2J52A 1XO3A 3NJTA 1I4HA 3W1SA 3Q3MC 2ZW0A 1TS5A 5GXGB 5D6JB 4GMVA 1JWMD 3DWGC 4LJPB 1FFVA 2LZ6A 1SE4A 3TEWA 2JXXA 5MPOA 3P2BA 3NS1A 2NBWB 4EKUA 2GLSA 2W55A 4D2KA 4JL9A 2W3RA 2LRUA 3AE9B 2HDEA 3D32A 3C8YA 2K1FA 2JZZA 3V6CB 4GSWA 3ZJVA 2JY6A 2ZVOA 1WX9A 4HVBA 4EOYA 3KYDD 3Q8CA 1S3SG 1ZOYB 1WJNA 1YX6B 3VTWA 4LDTD 1UH6A 2RDBC 1SB3C 3QWZB 3IBEA 4MT5A 1YOVB 1I7HA 3UQBA 2IBIB 4JQWC 4M0WA 1E8XA 3Q3OC 1PQSA 2H88B 2M19A 3N20C 1GJZA 2AL3A 1BT0A 1E10A 1B1ZA 3MJ5A 2NR2A 3PV1A 2JVCA 2KTRB 2VRRB 4YTPB 2O6VA 5BMGA 2N9LA 3W5UB 2BT6A 1VDVA 2IGDA 3RNBC 3TEZA 1FFUA 1MG8A 2WNMA 1K51A 3MJWA 4WURA 3FC4A 3NOBA 4C56C 3RCZA 1WGGA 2WXJA 1V6EA 2K5PA 1F77A 2KJHB 4ZHOA 5BMHA 3APDA 2LEKA 4MH0E 4TKNA 4C00A 3H7PA 1XEEA 2LVPA 4CO7A 3BY4B 2DZJA 3L17A 4W9JA 4GGQA 4HJGE 1YIWA 1I4GA 4DWFA 1J7BA 3FILB 1YD8U 1WMHA 2FUHB 2MLBA 5BMIA 4ZRPA 2MWSB 4NQLB 2WXKA 3O13A 4GDKA 4HPPA 3AU4A 4HDQA 3PRMB 4LNOA 4N59A 4LNKA 3BK1A 5DPRA 1J19A 3WCQA 3N1XC 3AE4B 5EE0A 3QHTA 4YSXB 1IGDA 2DAJA 3SU8X 4EUTA 4K3CA 3JW0X 5E6JA 1V81A 2JT4B 3NVVA 2QHOA 1V9JA 5IOIA 2HTME 4BKSD 1STEA 5LLIA 2V0GA 2HD5B 2ZJDA 1A5RA 2D3CA 5BO4B 3PO0A 2RPQA 3LXFA 4ICUA 4IW0A 2KZRA 1F1HA 4A6QA 2C9WB 3CSFA 3HVZA 4Q2JA 3SDLC 4KIKA 1P9DU 2NBVB 1RRBA 5AZGA 4G11A 1RAXA 2KLCA 4HEA1 2LGYA 1WGKA 2KANA 4NAWA 5HG2A 5KHQA 3Q8EA 4S0RA 1L0YB 3CIRB 2MJEA 2Y5PA 1WZ3A 4YSZB 2WXPA 1K52A 4W9EA 1L2NA 2NBUA 1F2RC 2J7QB 4JX1C 2NMQA 1AWDA 2MBHA 5GMVA 2N9XA 2DYBA 1MI0A 3X23A 2PIAA 3DBHB 4M8NA 1IP9A 4HPMB 4QAYA 1HXYD 1N62A 1Q10A 1UBIA 4A3PA 1PGBA 3AE8B 4KKIA 2BKRB 1GB4A 2KQSA 1QZEA 3FAHA 4FBJB 1R7SA 4RF1A 3GS2A 3CMMB 2DLBA 1JWBD 2Y3AA 1Q0WB 2RMMA 2VZKD 4LNIA 1V1PA 2BTEA 3DHIC 5G2NA 4EZJA 3VUWA 4ZRQA 1D6EC 4DQOC 5BYSA 4ANUA 1TZOA 1YJ1A 2FAZA 1TS3A 4JPSA 2KVZA 1T5XD 4RGMA 4A20A 1YJIA 4MJSB 2MEKA 2YEPB 4FADA 3AE5B 3ZXVA 3NHEB 3A9KA 2KDIA 2JWUA 2MRPA 2PJHA 2EKEC 3WANA 1QOFA 1OQYA 5IAAC 2OHFA 2WQYB 2IJ0A 4P6VF 4AS1A 5LXHA 3GP7A 2DX5B 5IN7A 3Q2AC 3W9CB 4HLEA 5CTRC 3WAOA 1E6EB 2XEWA 4ZOHC 2LASA 1T0QC 1MHXA 3QARA 2BPSA 2WLBA 3HUIA 2KQ7A 3BYTB 2ZEQA 3AV8A 2KMAA 2V9HA 3H9DA 2M17A 2OOBB 2D10A 1R4NB 2WXMA 4H2AA 3U30A 4XWTA 2N0SB 3W2DA 1WXQA 4JGHB 4GDLB 2AYOB 1FCLA 2N7DA 3IG3A 5EDSA 1XXGA 4GDLA 4XX5A 3RT3B 2DHZA 2V3SA 2V3PA 5G55A 5EE9A 3VFKA 4FXCA 1FO4A 4HCPB 4LLGM 4PK1A 4RGTA 3MHZA 2HJ8A 2V4IB 5IP4D 3DVGY 3P4QB 1FIQA 1Y56A 1EF5A 2LD9A 1KLVA 4A8XC 2WXQA 1V80A 4RF0A 2EELA 3M62B 3LB8C 1OTRB 3T3NA 3AEFB 2BGFA 5C2TB 2D07B 2VZKB 3DPDA 3VR9B 4DDID 1J0GA 5J2RA 3DBSA 3ALBA 2NPTB 1IBXB 1WM3A 3KWVA 1HA5A 3ML8A 2LWPA 1E7PB 1VZ8A 3BK2A 3A9JB 2LGXA 1WXVA 3ZJTA 2NPTA 1QQRA 1XLOA 5L83A 3LJ3A 1OQRA 2KMMA 3LDZE 3EA6A 4WWOA 4A55A 2Y5CA 1LFDA 3NY5A 3ZNHB 1IGCA 2BYTA 2IYDB 2KAJA 1I35A 3B0AA 1TY0A 2EMTA 4IG7B 3RFZB 4KKJA 4ZDVA 4MSMB 2L0FA 2MP2B 3L4PA 3PT2B 4M02A 1E8ZA 5HI1A 3RPFC 1HE8A 2MBEA 1UELA 3MFGA 2JRIB 4OVUA 2K6QA 2PE6B 4B9KA 5HHDG 4FA6A 2R2OA 4BFRA 3RNEC 4ANXA 1EU3A 1JQ4A 2ZW1A 4WJOA 4WAFA 2KN4A 1NENB 4K81A 2NS5A 3UI3A 4FHKA 1ESFA 4ANWA 1WFYA 4AJWA 1TKEA 2C60A 2NTSA 1E5WA 1N60A 3KUCB 4LTUA 1JWUD 3ZLZA 2WHIA 4TUUA 1D3ZA 3U7ZA 3DBRB 3KW5B 1D4BA 4MH8A 4OZAA 3SHQA 1OGWA 4XDCA 3OAWA 3BZDB 2KDBA 2SEBD 3P1MA 2LVQA 4WWPA 2QIEB 3J9CA 3E9SA 1ENFA 3U4EG 2W54A 1V1OA 1FRDA 2A4ZA 3ZRCA 4AWJA 4II2B 3ZTDA 4AUQC 1XLPA 1OQQA 4B95A 4DXAB 2YEPF 2ZNVB 1V86A 1E90A 3VRBB 3M63B 2MCNB 2PVGC 3HHMA 3RN9C 2PVOD 3ZNGC 2D3BA 1WGRA 1HTOA 2INNE 1WWTA 4US9A 2FCQA 1FEHA 2KX3A 4RGNA 1J7AA 2E6XA 4OVVA 3PHXB 1VZ6A 2RDHA 2R61A 3B9JA 2QILA 3I5JC 1M4VA 3JSVB 4E74A 4REZA 3LYYA 4NZLB 2X8XX 4NY0A 2FCMA 2ZNVC 3E56A 1IUEA 3PZ7A 4TMAB 1LO5D 1TIFA 4YXDB 4MGZE 4ARIA 1WIAA 4HKZE 3A1QB 4F1SA 2O2VA 1S1QB 1PDXA 3M95A 3L16A 3ZKJC 1E7UA 4KZ0A 3CF6E 2KJRA 1GB1A 3BVZA 3MC8A 1E9MA 2WDTB 3PLVA 1Z2MA 2D3AA 2BB6A 3N3KB 2KWUB 3R2IA 3R7RA 4C7YA 3TL5A 1SJHD 1UNSA 3AU5A 4DHJB 5TR5A 2XNAC 2JWZA 3EECA 3T9LA 4LCDE 4BOZB 4MSQB 2L76A 4P1CC 1HQRD 1KRHA 1ET9A 1QKZA 2LUMA 3VUXA 3GE8C 1SE9A 3Q14C 1FM0D 3Q3NC 2XK5B 4DBGA 3Q8AA 1FCCC 1LM8B 1AARA 3IVFA 4DXFA 3AULA 3MC9A 4KDLB 3Q8BA 2PE9A 2MA9B 3OWEB 4HJKA 1HZ6A 1XF5L 2XN9C 3HM6X 2QC8A 4YTNB 5E6NA 2EKIA 1FNWA 1HZ5A 1Q1OA 1C78A 2LHDA 2H89B 3PGEA 4USAA 3I57A 2PEAA 1L6VA 1WRIA 4PT5A 4HKQA 5H8YE 1JCKB 3Q8FA 4G50A 3AB5A 3I3TB 1GUAB 2IO3B 3H8HA 4IM3A 1GPXA 1WE7A 3V05A 2KTRA 1BMLC 2KKCA 1WM2A 4BOSC 2JYTA 4J6IA 1YQ3B 4F8CB 2ICIA 1SBBB 2N9EB 4FJYA 4GU2A 4M00A 2AWTA 3NVYA 4MGKE 3U8ZA 4I6LB 2BBCA 1TKGA 4W9HA 3PHWB 2AL6A 1EUVB 1Y8RC 1VRAB 1YN4A 4PS7A 1D5ZC 2BYFA 1UUPA 1NVID 1EWYC 2MHJA 3RZWC 1DOXA 2KDEB 3AECB 2L00B 1N6ZA 3FILA 4JWSC 4W9KA 1SEBD 1ZDXA 2C7MB 2OEDA 1F52A 4HXDA 4G0NB 2C7NB 2DZMA 3KLSX 1LGRA 1DGJA 3KQ4A 4NJ6A 1UF0A 2KO3A 4FHJA 2Y5BB 2JUOA 1SSNA 4A90A 4DDGD 2KMCA 3KH0A 2XBBC 2AQ2B 2WDRB 4K7WA 3ZNZB 5KHOA 2MBQA 1SF0A 3PTFC 1WR1A 2JXTA 4P7IA 4WWMA 1T6BX 3VR8B 1OFFA 2INCC 4GLSC 4LDTB 4HDOA 3MP9A 2KNBA 4CYEA 2BWES 3DDCB 3ZQ4A 1ZP0B 2QDFA 4R3DA 3TUOA 1XQQA 3PZ8A 5TSSA 3N32A 1SJED 5HKHA 4EZLA 1ZUD2 2Z8LA 4K7SA 4XC2A 4FN2A 4UDUC 3SEBA 2K3UA 3A33B 3I63C 2CU1A 2GB1A 5I4DA 3JVZX 1BXTA 1E7VA 1J8CA 2LUEA 2CR5A 3K9OB 5DPTA 4KX6B 5DPSA 3QQ8B 3AEBB 1UWMA 1IYFA 5J17A 4NNJB 1YQBA 5EE3A 4NPNA 2WU2B 3N1ZC 4MM3B 1EM7A 4KV2A 3VDZA 5JHBA 1F0ZA 2R2QA 2A5UA 2LGSA 2FE8A 4IWQA 1ZXHA 3HIZA 4RNAA 1TBEA 1K53A 2ASQA 1MHHE 5CHVC 2KD0A 2PPHA 3ZW3A 5LXIB 1SXTA 4XDDA 1WH3A 2G3QB 1QILA 1Z5SB 3ENEA 2FUG1 3H1UA 2KFKB 4EZKA 1T3QA 1V5OA 2D3GA 2NVUI 2L3ZA 2KJ6A 3TEXA 4IWPA 1VZ7A 4MJSA 1L5PA 1D5MC 4YSYB 3PRPB 2M8SA 4HPLB 4KGRA 4N9F4 3M3JA 2GBRA 1SIFA 1YN5A 5AUKA 1ROEA 5JHAA 3DBLI 1ZW7A 1WRDB 4BKSA 1NYRA
chains in the Genus database with same CATH topology
2IDYA 2GRIA 2LJIA 1L4ZB 1E0ZA 2WDQB 2L52A 1EU3A 3AE3B 1PYWD 1JQ4A 2IGHA 2ZW1A 2AX5A 1HEZE 1L0VB 4WAFA 2KN4A 3AE7B 3B2GA 1NENB 4A9AA 2B76B 3UI3A 1ZPSA 3AEAB 4DXGA 1CK1A 1ESFA 3R2TA 2J52A 1TKEA 1XO3A 3NUHB 1I4HA 3W1SA 4JE3B 2JU6X 1C4AA 2ZW0A 1TS5A 2NTSA 5GXGB 3BVMA 1N60A 1AW7A 1JWMD 3DWGC 4LTUA 2WP9B 1FFVA 1JWUD 1SE4A 4MACA 3BYYB 4NJCA 3TEWA 4IKGA 2KWDA 3IT4B 3VRAB 1WYGA 3U7ZA 2AQ3B 4OW0A 1B9RA 5MPOA 1L0XB 3NVWA 4JWUC 3AEDB 1D4BA 4MH8A 2J4XA 3NS1A 4OZAA 2W55A 4XDCA 3AE6B 1XCTL 3VQIA 4D2KA 3IXSA 1VLBA 2W3RA 4ITKA 3BZDB 3AE9B 2HDEA 2SEBD 3MC0B 3C8YA 3P1MA 4NAWB 3ZJVA 4WQMA 2QIEB 3J9CA 1D5XC 1MVKA 3E9SA 1ENFA 2WXFA 5D3IB 3U4EG 2ACZB 1V1OA 2W54A 3Q8CA 2DYMA 1ZOYB 3AH7A 1FRDA 2SAKA 1SB3C 2N7JA 3GB1A 4MT5A 1I7HA 1XLPA 4M0WA 1KLUD 1PGXA 1OQQA 3P42A 2YEPF 1TJEA 2H88B 2MJ3A 5EE1A 1DOIA 2M19A 3VRBB 2J53A 4IDIA 1E10A 1B1ZA 2PVGC 2PLPA 3MJ5A 2PVOD 1RWSA 1L4DB 4CQNA 4YTPB 1IBXA 1XCQL 3V3XA 3TEYA 1UGJA 2INNE 1WWTA 2N9LA 4US9A 1SIJA 5BMGA 2X38A 1FEHA 3W5UB 2BT6A 2QJLA 4HROA 1VDVA 2IGDA 1XLNA 2LFIA 4RFBA 2DWQA 3ETRA 3TEZA 1QF6A 1YNTE 4RGNA 1FFUA 1J7AA 1V1PB 2E6XA 1VR9A 2WNMA 1K51A 3IAS1 4WURA 3U52E 3FC4A 4C56C 1VZ6A 1NYQA 2RDHA 2R61A 1C4CA 1TS4A 3B9JA 2QILA 2WXJA 3KWLA 1YN3A 2K5PA 1F77A 4IOIE 1M4VA 4HRSA 4REZA 4ZHOA 4TQ1A 3U2SC 5BMHA 3LYYA 4NZLB 1ZDVA 2LEKA 5HFYA 5AUIA 3IAM1 3E56A 1IUEA 2QEJC 1XEEA 1GOZA 3PZ7A 4TMAB 1LO5D 2WXLA 4L23A 5FKAC 4YXDB 1ACCA 4HJGE 4ARIA 4C7ZA 4HKZE 1KFYB 3AE1B 1AYFA 1I4GA 3T3OA 2JYEA 1J7BA 2WXNA 2JX5A 1PDXA 3FILB 1EU4A 1JMLA 2PW9A 2L1AA 3EUB2 1J7CA 3P63A 4ZRPA 5BMIA 2WXKA 2NTTA 3Q69A 3O13A 1GB1A 3URYA 3BVZA 2WXGA 4ZHPA 1PGAA 4N59A 1E9MA 3BK1A 2I2YA 1QOBA 3WCQA 2BB6A 3AE4B 5EE0A 2CU3A 3R2IA 1FXIA 1IGDA 4C7YA 1SJHD 4YSXB 2LGIA 1UNSA 1FD6A 5E6JA 1DOYA 2XNAC 3NVVA 2N9KA 2JZPA 4TSSA 2HTME 1STEA 2FBWB 1AN8A 2BB5A 2KDMA 2V0GA 2PMVA 1ET6A 1HQRD 3NVZA 1KRHA 3LXFA 3PO0A 1ET9A 1QKZA 3R8BA 2LUMA 3CWIA 4A6QA 3HVZA 4Q2JA 3AEEB 1FM0D 3Q8AA 1N5WA 1FCCC 3NRZA 4ARCA 4HEA1 4DXFA 4TQ0A 3SFEB 2BS4B 3Q8BA 4OHJA 2WU5B 2PTLA 1WGKA 3OWEB 1HZ6A 1XF5L 2XN9C 4J3OD 4YTNB 5HG2A 1TKYA 2J42A 1EWCA 2EKIA 1QT9A 3Q8EA 2RDGA 1FNWA 5G5HA 1L0YB 3B2FA 1HZ5A 3CIRB 1KTKA 1C78A 2MJEA 3BVGA 2LHDA 2Y5PA 1TS2A 2H89B 4YSZB 4USAA 4YTMB 2WXPA 3I57A 3I9V1 2LHEA 2ON8A 1K52A 1C79A 1L6VA 4P16A 1GAQB 2V3NA 1F2RC 1WRIA 4OZBA 4PT5A 4HKQA 4JX1C 2NMQA 1AWDA 2D5GA 1K50A 4XWWA 5H8YE 1JCKB 1TYGB 3Q8FA 3AB5A 3AMZA 1MI0A 3H8HA 5H92C 2PIAA 4EE2A 1N5XA 1JRPA 4AQ7A 1GPXA 1HXYD 1N62A 1Q10A 2WXRA 3V05A 1JROA 1BMLC 1PGBA 3AE8B 4KKIA 2JYTA 1GB4A 1JWSD 3FAHA 1C9FA 1R7SA 1YQ3B 1CJEA 1SBBB 2ICIA 3EGRA 4RF1A 2QMTA 2K22A 2Q5WD 3GS2A 3ZYYX 3NVYA 5BYRA 1C77A 3P4SB 2DLBA 1JWBD 2Y3AA 5C3JB 2RMMA 1NEKB 2AQ1B 2VZKD 1V1PA 2BBCA 1TKGA 2BTEA 4WH4A 1KH0A 4N58A 2WDVB 4ZRQA 1D6EC 1KLGD 4DQOC 5BYSA 2DYOA 1TZOA 1YQ4B 5D7GA 1I4XA 1TS3A 1VRAB 4JPSA 1YN4A 1T5XD 4RGMA 1D5ZC 4N6EB 1YJIA 1UUPA 1JALA 1NVID 2CJNA 2MEKA 2YEPB 1EWYC 1N63A 2L32A 4L2YA 5JXVA 3AE5B 1QLBB 1V97A 2BW2A 1DOXA 2JWUA 2WS3B 3AECB 4OZCA 2IGGA 1QOFA 1FNUA 2OHFA 2WQYB 2IJ0A 2ONQA 4P6VF 5D3DA 5G5GA 4AS1A 1PFDA 1F2RI 3FILA 4JWSC 2MJDA 4OVZA 3GP7A 1C76A 1SEBD 1ZDXA 2M56B 2OEDA 3W9CB 1I4QA 3SFDB 3KLSX 1QOGA 1DGJA 1YJJA 3KQ4A 4KGTA 2K0PA 1C4PA 1E6EB 1SSNA 4A90A 4ZOHC 4US8A 1I4PA 4L1BA 2AQ2B 1MHXA 2WDRB 1FNVA 2WLBA 3ABVB 3HUIA 2TSSA 1SF0A 2L83A 2QSDA 2W82A 3BYTB 2JXTA 3AM9A 3SR6A 4WWMA 3ZJUA 1P7FA 1T6BX 3DWMA 3VR8B 1OFFA 3BWUD 4ZYSA 3AV8A 4GLSC 4YT0B 1V8CA 2WXMA 1N61A 3MP9A 3P4RB 1FRRA 2E3TA 4H2AA 3ZQ4A 4XWTA 2N0SB 1ZP0B 3W2DA 4R3DA 1WXQA 2I38A 4B0MA 3TUOA 1ZXIA 4GDLB 3PZ8A 2INPE 5TSSA 1FCLA 1SJED 4O1NA 1ZUD2 2Z8LA 1NI3A 1RM6C 2G1EA 3AE2B 1MPEA 1XXGA 1ZE3D 2JSVX 2V3PA 4UDUC 5EE9A 1I4RA 4WIPA 4FXCA 3SEBA 2K3UA 4B0EA 1FO4A 5FR3A 4LLGM 4RGTA 3MHZA 2GB1A 3AEGB 5I4DA 2V4IB 2WXOA 3HVDA 4KGSA 2DBYA 3P4QB 1FIQA 1BXTA 3AN1A 4C80A 1Y56A 2IPKD 2PKOA 5FK9C 4KX6B 4A8XC 2WXQA 1DYQA 3AEBB 4RF0A 4NAMA 2EELA 1UWMA 3LB8C 3T3NA 1JWAD 2W3SA 3BIID 3AEFB 5C2TB 4RCOA 5EE3A 2VZKB 3VR9B 2WU2B 2LMCA 1UWXA 4MM3B 1CQVA 4RGOS 3ZGZA 2JQRB 4RH6A 1IBXB 1EM7A 3KWVA 1HA5A 1RFKA 3N9YC 1SE3A 5BYQA 4XE0A 1E7PB 1VZ8A 3IT6B 3P4PB 1F0ZA 3BK2A 2WXIA 3ZJTA 1XLQA 1YMHE 2FE8A 2RPVA 4YWGG 1QQRA 1ZXHA 1XLOA 1QOAA 4RNAA 1SE2A 1K53A 1L6UA 1MHHE 3W5VB 1OQRA 1RYJA 2KMMA 3EA6A 1SXTA 4XDDA 4A55A 2Y5CA 1BUIC 3NZ3A 2KQ4X 1PUTA 1QILA 2MH7A 1A70A 1IGCA 2FUG1 2BYTA 4LK0M 2KAJA 1T3QA 2G9HD 1TY0A 3RFZB 4KKJA 2K9XA 2BS3B 2GI9A 1CZPA 3TEXA 1VZ7A 2WXHA 1L5PA 1VJKA 1WSPA 3L4PA 1D5MC 4YSYB 1KF6B 1TY2A 5T8IA 5HI1A 1JW9D 3HRDD 3TSSA 1FMAD 1P7EA 3RPFC 4KGRA 2M0AA 3MFGA 1YN5A 2KACA 1FXAA 5AUKA 4GDKB 5LNK1 1ROEA 2BS2B 5HHDG 2CJOA 1NYRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3B9J A;  4JX1 C;  2N0S B;  1ZP0 B;  1AWD A;  3KWL A;  1WXQ A;  1E0Z A;  2K5P A;  2WDQ B;  2L52 A;  1ZXI A;  5H8Y E;  1TYG B;  4HRS A;  3AB5 A;  3AE3 B;  4ZHO A;  1JQ4 A;  2AX5 A;  3AMZ A;  1L0V B;  3AE7 B;  3B2G A;  2LEK A;  1NEN B;  4A9A A;  1ZUD 2;  2B76 B;  5H92 C;  1NI3 A;  1RM6 C;  2G1E A;  2PIA A;  5AUI A;  3AE2 B;  3AEA B;  1IUE A;  1N5X A;  1JRP A;  1GPX A;  1N62 A;  1TKE A;  1XO3 A;  5EE9 A;  1JRO A;  4FXC A;  1FO4 A;  4YXD B;  3AE8 B;  5GXG B;  4C7Z A;  1KFY B;  3AE1 B;  3FAH A;  1AYF A;  1N60 A;  1R7S A;  1YQ3 B;  3AEG B;  3DWG C;  4LTU A;  1J7B A;  1CJE A;  2JX5 A;  1PDX A;  2WP9 B;  1FFV A;  2K22 A;  2Q5W D;  3EUB 2;  3ZYY X;  3NVY A;  2DBY A;  1J7C A;  3P4S B;  3P4Q B;  3P63 A;  1FIQ A;  1JWB D;  3AN1 A;  4C80 A;  5C3J B;  1NEK B;  3VRA B;  1WYG A;  2PKO A;  1TKG A;  1B9R A;  4N58 A;  4KX6 B;  5MPO A;  2WDV B;  3NVW A;  4ZHP A;  4JWU C;  3AED B;  4N59 A;  3NS1 A;  1E9M A;  3AEB B;  1UWM A;  3LB8 C;  2W55 A;  1YQ4 B;  3AE6 B;  1JWA D;  1QOB A;  2W3S A;  3BII D;  3AEF B;  5C2T B;  3WCQ A;  1VLB A;  2W3R A;  3AE4 B;  4ITK A;  5EE3 A;  3VR9 B;  3AE9 B;  5EE0 A;  2WU2 B;  2CU3 A;  4C7Y A;  1FXI A;  1YJI A;  4N6E B;  4YSX B;  3P1M A;  1JAL A;  1NVI D;  2CJN A;  2JQR B;  1EWY C;  1N63 A;  4WQM A;  1DOY A;  2QIE B;  3AE5 B;  1RFK A;  3NVV A;  1QLB B;  1V97 A;  1E7P B;  3P4P B;  1F0Z A;  2HTM E;  2ACZ B;  2W54 A;  1DOX A;  2FBW B;  1ZOY B;  2WS3 B;  3AH7 A;  1FRD A;  1XLQ A;  3AEC B;  1SB3 C;  1QOF A;  1QOA A;  1XLO A;  3NVZ A;  3PO0 A;  1KRH A;  3LXF A;  1L6U A;  2OHF A;  2WQY B;  4P6V F;  3W5V B;  5G5G A;  1I7H A;  1OQR A;  1PFD A;  1RYJ A;  1XLP A;  2KMM A;  3CWI A;  2MJD A;  4JWS C;  1OQQ A;  3HVZ A;  3AEE B;  2M56 B;  1FM0 D;  2Y5C A;  1TJE A;  2H88 B;  2MJ3 A;  1PUT A;  5EE1 A;  1N5W A;  3W9C B;  2MH7 A;  3SFD B;  1A70 A;  3NRZ A;  1DOI A;  2M19 A;  2KAJ A;  3VRB B;  1T3Q A;  1QOG A;  1DGJ A;  1YJJ A;  4IDI A;  1E10 A;  2PVG C;  1E6E B;  2K9X A;  3SFE B;  2BS3 B;  2BS4 B;  4ZOH C;  4US8 A;  2PVO D;  2WU5 B;  1CZP A;  1RWS A;  1WGK A;  2WDR B;  1L5P A;  4YTN B;  1VJK A;  2WLB A;  3ABV B;  3HUI A;  3L4P A;  4YTP B;  1TKY A;  4YSY B;  1KF6 B;  1SF0 A;  1WWT A;  2L83 A;  1SIJ A;  3AM9 A;  4US9 A;  3SR6 A;  2EKI A;  4WWM A;  1QT9 A;  5G5H A;  3W5U B;  3B2F A;  3CIR B;  1JW9 D;  2BT6 A;  2QJL A;  3DWM A;  1OFF A;  1FMA D;  1VDV A;  2MJE A;  3AV8 A;  3HRD D;  4HRO A;  3RPF C;  3VR8 B;  4YT0 B;  1XLN A;  2H89 B;  2DWQ A;  3ETR A;  4YSZ B;  4USA A;  4YTM B;  1QF6 A;  1FFU A;  1V8C A;  1J7A A;  1FXA A;  5AUK A;  1N61 A;  3P4R B;  1ROE A;  1FRR A;  1L6V A;  2BS2 B;  2E3T A;  1GAQ B;  3FC4 A;  2CJO A;  1NYQ A;  1WRI A;  1NYR A; 
#chains in the Genus database with same CATH topology
 4X57 B;  2YLM A;  2GRI A;  5CHW A;  2WDQ B;  5AZH A;  3ZVV A;  2GMI C;  1PYW D;  3RZF A;  2AX5 A;  1L0V B;  3AE7 B;  3B2G A;  1WI0 A;  2WWZ A;  2UYZ B;  3AEA B;  4DXG A;  1EO6 A;  2KHW B;  4E71 A;  4JE3 B;  2OJR A;  1GC7 A;  2GOW A;  2K8C A;  2WGS A;  3B08 A;  3GZN I;  1Q5W B;  2WP9 B;  2IO0 B;  4PYU A;  4MAC A;  3BYY B;  4NJC A;  4BBN C;  2KWD A;  3IT4 B;  3VRA B;  5JH5 C;  1ISN A;  2AQ3 B;  4OW0 A;  3NVW A;  4JWU C;  2J4X A;  2IY0 B;  4GIV A;  1XCT L;  3VQI A;  2KDF B;  3IXS A;  1VLB A;  4W9G A;  5IA7 A;  3UF8 A;  3PPA A;  1D5X C;  1MVK A;  4F7Z A;  2WXF A;  2ACZ B;  3ZDT A;  3MTN B;  2KC2 A;  4KVG B;  3RNG C;  3NZU A;  2N7J A;  3TIX A;  4AJY B;  1GC6 A;  4PS8 A;  1KLU D;  4W9I A;  3P42 A;  3DQV A;  2MX2 A;  4TV3 A;  3B1L X;  3QC8 B;  1DOI A;  4FJV B;  2J53 A;  3WAM A;  4IDI A;  4BAX A;  3L08 A;  2IZV B;  5DPW A;  1RWS A;  1L4D B;  1WXA A;  1IBX A;  1XCQ L;  1SIJ A;  5C1Z A;  4RM9 A;  2X38 A;  3A9J A;  2W9N A;  2D11 A;  3DHG C;  1XLN A;  4RFB A;  1YNT E;  3UQA A;  3APC A;  3S2A A;  3IAS 1;  4NJ7 A;  1WJ6 A;  3U52 E;  1IPG A;  1C4C A;  1MJD A;  2UWQ A;  1YN3 A;  1F9J A;  2OJW A;  4HRS A;  4TQ1 A;  3U2S C;  4GXB A;  2QCZ A;  5HFY A;  2FCS A;  5AUI A;  1I42 A;  3IAM 1;  2QEJ C;  1GOZ A;  4HCN B;  3Q3F A;  4MEM A;  4W9F A;  1P1A A;  2WXL A;  3VUY A;  1V5T A;  4L23 A;  5FKA C;  2MP2 A;  1UD7 A;  1KFY B;  3AE1 B;  2RSU A;  1AYF A;  3T3O A;  2JYE A;  2WXN A;  3APF A;  1EU4 A;  1JML A;  1M94 A;  4WWN A;  3RD2 A;  2PW9 A;  2L1A A;  3EUB 2;  1H8C A;  2M0X A;  1WR6 E;  2KYW A;  3Q69 A;  3URY A;  3R7Q A;  4ZHP A;  4KSL C;  1QOB A;  3N1Y C;  2N7E A;  1HTQ A;  2CU3 A;  1FXI A;  2LGI A;  4K7U A;  1FD6 A;  3AI5 A;  3ZO5 B;  2IO2 B;  1V2Y A;  2JZP A;  2N9K A;  3NG0 A;  1NBF C;  1VCB A;  1OEY J;  1AN8 A;  2BB5 A;  5DCN A;  2KDM A;  2PMV A;  3VHT C;  4JLC A;  2N1W A;  3K9P B;  3AEE B;  1N5W A;  2J0M A;  4BKT A;  2KK8 A;  2KLG A;  2N4F A;  5CHF A;  2LRW A;  2RGF A;  3OLM D;  1GG3 A;  4TQ0 A;  2BS4 B;  2WU5 B;  2C7H A;  3BIN A;  4J3O D;  4W9L A;  1TKY A;  2J42 A;  1QT9 A;  2RDG A;  5L95 C;  3I9V 1;  2LHE A;  3W1Y A;  1GAQ B;  2V3N A;  4YL8 A;  2KT7 A;  1K50 A;  4XWW A;  4FUL A;  1V49 A;  2IND C;  3AMZ A;  3ZXR A;  4A3O A;  3H7S A;  5H92 C;  2D2Q A;  2L0T A;  1TZ1 A;  2KTF A;  3ZIM A;  1JRP A;  4DK5 A;  2WXR A;  5D94 A;  3ECI A;  2DZI A;  2LJ5 A;  4RM8 A;  1C9F A;  1CJE A;  3KUZ A;  3EGR A;  3C19 A;  2K22 A;  2Q5W D;  3ZYY X;  5C3J B;  1NEK B;  2AQ1 B;  3ONS A;  1KH0 A;  1WXS A;  2ZPY A;  2L8J A;  1KLG D;  2DYO A;  2O6V D;  1YQ4 B;  2G4S A;  2IY1 B;  3DVG X;  2KWC A;  4LNN A;  3JSV A;  4IM0 A;  2BQQ A;  2BF8 B;  2FID A;  1N63 A;  2L32 A;  4L2Y A;  3KVF B;  2J0K A;  2RR9 A;  4GOC A;  4II3 B;  4XYC A;  1WYW B;  2IGG A;  1FNU A;  3A1Q A;  5D3D A;  2L05 A;  1F2R I;  2JZ3 B;  2MJD A;  5CX3 A;  1P98 A;  1I4Q A;  3A4R A;  3ZUN A;  1YJJ A;  1EF1 A;  4KGT A;  1R4M B;  4G3X B;  1C4P A;  4US8 A;  1WJU A;  3OJ4 B;  3R3M A;  1FNV A;  3OG5 A;  3ABV B;  3UIO B;  5IO9 A;  3DVN V;  3SR6 A;  2QSD A;  2W82 A;  3VTV A;  3ZJU A;  3DWM A;  3BWU D;  3ZRF A;  3ZNI D;  3WAP A;  1H4R A;  1V8C A;  1FRR A;  2JRH A;  2E3T A;  2KWV B;  2IO1 B;  1XT9 B;  2I38 A;  2XK5 A;  4WJQ A;  2Z0D B;  1ZXI A;  4E3C A;  2LXA A;  2G1E A;  3AE2 B;  1MPE A;  2C5L C;  2JSV X;  2CKH B;  3EC8 A;  1I4R A;  4ZYN A;  2KN5 A;  4B0E A;  4HK2 A;  4HWI B;  3DBH I;  3SD5 A;  3AEG B;  4M0W B;  2ZVN A;  2WXO A;  2HJ1 A;  1OEY A;  3HVD A;  3W1S C;  5D2M B;  3HK0 A;  4LJO B;  2BVC A;  2K6D B;  4C80 A;  2B3A A;  2IPK D;  4MEL A;  2JF5 A;  3L0W B;  2KC1 A;  1DYQ A;  3PZD A;  3QX1 A;  1JWA D;  1WE6 A;  3BII D;  4DHZ E;  2ZCC A;  4RCO A;  2LXC A;  4IC7 B;  1CQV A;  2K8H A;  4RGO S;  3WAL A;  4PS3 A;  3ZGZ A;  4W9D A;  2O6V B;  1SE3 A;  4K1R B;  2WXI A;  4ICV A;  4AOF A;  3RI7 C;  2RPV A;  4YWG G;  2BKF A;  1QOA A;  1SE2 A;  4ANV A;  4EFO A;  4LNF A;  3UGB B;  3W5V B;  2G4D B;  2DEN B;  2GBM A;  2KQ4 X;  2G45 B;  2CS4 A;  3QK0 A;  2G9H D;  1ZGU B;  3PLU A;  2K9X A;  2NCN A;  3EFC A;  3H7P B;  2MBB B;  2GI9 A;  2UU7 A;  3QIJ A;  4RMA A;  1WSP A;  3DOW A;  3MHS D;  1KF6 B;  5T8I A;  1WY8 A;  3GE3 C;  3UIP B;  3KUD B;  1JW9 D;  3HRD D;  4CHK A;  1WMH B;  1WGD A;  2M0A A;  4WAA A;  2KAC A;  1FXA A;  4GDK B;  5LNK 1;  4P1B C;  2CHX A;  2LJI A;  1E0Z A;  2GBN A;  3EFU A;  1R4N I;  1C1Y B;  2IGH A;  3VTU A;  4FJZ A;  4ZRK A;  3EHV A;  2ZCB A;  4A9A A;  2B76 B;  2N9P C;  2HE7 A;  1WX8 A;  3R2T A;  3QCA A;  3NUH B;  1MFW A;  1U4A A;  1WGY A;  2JU6 X;  1C4A A;  1P3Q U;  2K8B A;  3BVM A;  1AW7 A;  4FLH A;  2M4N A;  4IKG A;  4KIK B;  5E6O A;  1WYG A;  3PRE A;  1B9R A;  1L0X B;  1GNU A;  3AED B;  2VH1 A;  3DVN U;  3ZDM C;  3AE6 B;  1FPY A;  3PVL A;  3TCA A;  4ITK A;  3UIN B;  1P0R A;  3MC0 B;  4NAW B;  1E8Y A;  4WQM A;  5D3I B;  3PS6 A;  2DYM A;  2FNJ B;  3AH7 A;  4GN1 A;  2SAK A;  3GB1 A;  1NI2 A;  1PGX A;  4IUM B;  1TJE A;  2MJ3 A;  5EE1 A;  2FIF A;  5E6P A;  4AP4 C;  1NDD A;  2PLP A;  3VXW A;  3QA8 A;  4GB9 A;  2MW5 A;  4MM3 A;  4CQN A;  2CHW A;  3V3X A;  3TEY A;  1RLF A;  1UGJ A;  2DZK A;  4HRO A;  2QJL A;  1UGM A;  3X0W A;  2LFI A;  2DWQ A;  3ETR A;  1QF6 A;  3FKY A;  3ZTC A;  3QJZ A;  4WJP A;  1V1P B;  1VR9 A;  1WXM A;  1NYQ A;  2V4L A;  1TS4 A;  3VH4 B;  3KWL A;  4IOI E;  4ZRI A;  2KFK A;  1FXT B;  1XD3 B;  2I1K A;  1ZDV A;  2AEH A;  2GBK A;  1YX5 B;  1TTN A;  3A9K B;  1L7Y A;  1T0Y A;  1WJ4 A;  3JYU A;  1ACC A;  4C7Z A;  2WYQ A;  2JX5 A;  1G6J A;  2K39 A;  1J7C A;  3P63 A;  3RNF C;  2NTT A;  1E8W A;  2Z59 B;  2WXG A;  1SGH A;  1PGA A;  2FCN A;  2I2Y A;  2V1Y A;  3DBR I;  3WA0 A;  4EEW A;  3DCG A;  1DOY A;  4TSS A;  3CST A;  4IM2 A;  4XZ4 A;  2FBW B;  1WX7 A;  1ET6 A;  3V60 A;  4MGI E;  3HM3 A;  3NVZ A;  3R8B A;  4BVU C;  2REX A;  3CWI A;  4ZRJ A;  3DHH C;  2KXJ A;  3AXC A;  3RMK C;  4URK A;  1T0S C;  2WX1 A;  3NRZ A;  5IKC M;  2EMS A;  4ARC A;  4WJN A;  3QAQ A;  3SFE B;  4ACF A;  4OHJ A;  2PTL A;  4I6P A;  3A4S C;  1CMX B;  3L13 A;  3RNC C;  1EWC A;  5G5H A;  3B2F A;  1KTK A;  3BVG A;  1TS2 A;  4YTM B;  2ON8 A;  1MG4 A;  2JPH A;  1C79 A;  2ZPN A;  4P16 A;  1WGH A;  4OZB A;  2K25 A;  3V61 A;  2LI5 A;  2ZZP B;  4NQK E;  2VH2 A;  2D5G A;  1TYG B;  3T8M A;  1KJT A;  4M8M A;  3ML9 A;  4EE2 A;  1N5X A;  4AQ7 A;  4S17 A;  1JRO A;  1T0R C;  3C0R B;  1JWS D;  2QMT A;  2DNF A;  4BKG A;  2KX0 A;  5FR6 A;  1C77 A;  3P4S B;  5BYR A;  4W9C A;  4M01 A;  4K3B A;  3RNA C;  4WH4 A;  4N58 A;  2KOX A;  2WDV B;  1WF9 A;  3N30 A;  2LVO A;  5D7G A;  1I4X A;  3L10 B;  4N6E B;  2BYV E;  1KM7 A;  1JAL A;  2CJN A;  4ASW C;  5JXV A;  1QLB B;  1V97 A;  2BW2 A;  2WX0 A;  2WS3 B;  4OZC A;  5J18 A;  3V6E B;  1R4M I;  2ONQ A;  5G5G A;  1PFD A;  4OVZ A;  1C76 A;  2M56 B;  3VAW A;  2BYE A;  4BZA A;  3SFD B;  4C4V B;  2CHZ A;  3RYT A;  1QOG A;  3RUL A;  2K0P A;  3IHP C;  4C4V A;  1I4P A;  3GOE A;  2KFJ A;  2RD0 A;  1WZ0 A;  3R66 C;  4L1B A;  2TSS A;  2L83 A;  3AM9 A;  3DBL B;  1P7F A;  4ZYS A;  4YT0 B;  1N61 A;  3P4R B;  2MBO A;  4MDK E;  3KYC D;  4B0M A;  3PSE B;  3WIM A;  2INP E;  4IWO A;  4DHJ D;  3TMP B;  4O1N A;  1NI3 A;  1RM6 C;  1X1M A;  2YVC A;  3GZN B;  4PYZ A;  3TBL D;  3NS8 A;  4B6W A;  1ZE3 D;  5C23 A;  4WIP A;  2HTH A;  5FR3 A;  2GBJ A;  3U7D A;  2KVR A;  4DHZ B;  4KDI C;  4BBN F;  4KGS A;  1VD2 A;  4WQO B;  2DBY A;  3AN1 A;  2PKO A;  2L7R A;  5FK9 C;  3Q3J A;  2I1J A;  1KOT A;  4NAM A;  4I6N B;  3PRZ A;  1LQB A;  2W3S A;  3L54 A;  2BWF A;  4JIO U;  1UBQ A;  2LMC A;  1UWX A;  3O65 B;  2JQR B;  4RH6 A;  1RFK A;  3N9Y C;  3H6N A;  5BYQ A;  4XE0 A;  3P4P B;  3IT6 B;  3VVW B;  1JRU A;  3Q6B A;  1XLQ A;  1YMH E;  1RFA A;  1TGZ B;  1ZKH A;  2MSE D;  1L6U A;  1LXD A;  2N1V A;  3OJ3 A;  1RYJ A;  4XGA B;  3IFW B;  5AZF A;  1BUI C;  3NZ3 A;  5AEK B;  3TJP A;  1PUT A;  2MH7 A;  4KSK C;  1A70 A;  4LK0 M;  2Z0E B;  3VH3 B;  3V62 A;  2BS3 B;  1CZP A;  2WXH A;  1VJK A;  1TY2 A;  1UZX B;  1TT5 B;  3NZS A;  5JZE B;  2O2V B;  3TSS A;  1FMA D;  1P7E A;  2M1M A;  2MQJ A;  2DAF A;  2BS2 B;  4KZC A;  2CJO A;  3RUI B;  2IDY A;  2J0J A;  1C3T A;  1L4Z B;  2L52 A;  1K8R B;  3AE3 B;  1HEZ E;  2LGD A;  4MGY E;  1ZPS A;  1CK1 A;  2J52 A;  1XO3 A;  3NJT A;  1I4H A;  3W1S A;  3Q3M C;  2ZW0 A;  1TS5 A;  5GXG B;  5D6J B;  4GMV A;  1JWM D;  3DWG C;  4LJP B;  1FFV A;  2LZ6 A;  1SE4 A;  3TEW A;  2JXX A;  5MPO A;  3P2B A;  3NS1 A;  2NBW B;  4EKU A;  2GLS A;  2W55 A;  4D2K A;  4JL9 A;  2W3R A;  2LRU A;  3AE9 B;  2HDE A;  3D32 A;  3C8Y A;  2K1F A;  2JZZ A;  3V6C B;  4GSW A;  3ZJV A;  2JY6 A;  2ZVO A;  1WX9 A;  4HVB A;  4EOY A;  3KYD D;  3Q8C A;  1S3S G;  1ZOY B;  1WJN A;  1YX6 B;  3VTW A;  4LDT D;  1UH6 A;  2RDB C;  1SB3 C;  3QWZ B;  3IBE A;  4MT5 A;  1YOV B;  1I7H A;  3UQB A;  2IBI B;  4JQW C;  4M0W A;  1E8X A;  3Q3O C;  1PQS A;  2H88 B;  2M19 A;  3N20 C;  1GJZ A;  2AL3 A;  1BT0 A;  1E10 A;  1B1Z A;  3MJ5 A;  2NR2 A;  3PV1 A;  2JVC A;  2KTR B;  2VRR B;  4YTP B;  2O6V A;  5BMG A;  2N9L A;  3W5U B;  2BT6 A;  1VDV A;  2IGD A;  3RNB C;  3TEZ A;  1FFU A;  1MG8 A;  2WNM A;  1K51 A;  3MJW A;  4WUR A;  3FC4 A;  3NOB A;  4C56 C;  3RCZ A;  1WGG A;  2WXJ A;  1V6E A;  2K5P A;  1F77 A;  2KJH B;  4ZHO A;  5BMH A;  3APD A;  2LEK A;  4MH0 E;  4TKN A;  4C00 A;  3H7P A;  1XEE A;  2LVP A;  4CO7 A;  3BY4 B;  2DZJ A;  3L17 A;  4W9J A;  4GGQ A;  4HJG E;  1YIW A;  1I4G A;  4DWF A;  1J7B A;  3FIL B;  1YD8 U;  1WMH A;  2FUH B;  2MLB A;  5BMI A;  4ZRP A;  2MWS B;  4NQL B;  2WXK A;  3O13 A;  4GDK A;  4HPP A;  3AU4 A;  4HDQ A;  3PRM B;  4LNO A;  4N59 A;  4LNK A;  3BK1 A;  5DPR A;  1J19 A;  3WCQ A;  3N1X C;  3AE4 B;  5EE0 A;  3QHT A;  4YSX B;  1IGD A;  2DAJ A;  3SU8 X;  4EUT A;  4K3C A;  3JW0 X;  5E6J A;  1V81 A;  2JT4 B;  3NVV A;  2QHO A;  1V9J A;  5IOI A;  2HTM E;  4BKS D;  1STE A;  5LLI A;  2V0G A;  2HD5 B;  2ZJD A;  1A5R A;  2D3C A;  5BO4 B;  3PO0 A;  2RPQ A;  3LXF A;  4ICU A;  4IW0 A;  2KZR A;  1F1H A;  4A6Q A;  2C9W B;  3CSF A;  3HVZ A;  4Q2J A;  3SDL C;  4KIK A;  1P9D U;  2NBV B;  1RRB A;  5AZG A;  4G11 A;  1RAX A;  2KLC A;  4HEA 1;  2LGY A;  1WGK A;  2KAN A;  4NAW A;  5HG2 A;  5KHQ A;  3Q8E A;  4S0R A;  1L0Y B;  3CIR B;  2MJE A;  2Y5P A;  1WZ3 A;  4YSZ B;  2WXP A;  1K52 A;  4W9E A;  1L2N A;  2NBU A;  1F2R C;  2J7Q B;  4JX1 C;  2NMQ A;  1AWD A;  2MBH A;  5GMV A;  2N9X A;  2DYB A;  1MI0 A;  3X23 A;  2PIA A;  3DBH B;  4M8N A;  1IP9 A;  4HPM B;  4QAY A;  1HXY D;  1N62 A;  1Q10 A;  1UBI A;  4A3P A;  1PGB A;  3AE8 B;  4KKI A;  2BKR B;  1GB4 A;  2KQS A;  1QZE A;  3FAH A;  4FBJ B;  1R7S A;  4RF1 A;  3GS2 A;  3CMM B;  2DLB A;  1JWB D;  2Y3A A;  1Q0W B;  2RMM A;  2VZK D;  4LNI A;  1V1P A;  2BTE A;  3DHI C;  5G2N A;  4EZJ A;  3VUW A;  4ZRQ A;  1D6E C;  4DQO C;  5BYS A;  4ANU A;  1TZO A;  1YJ1 A;  2FAZ A;  1TS3 A;  4JPS A;  2KVZ A;  1T5X D;  4RGM A;  4A20 A;  1YJI A;  4MJS B;  2MEK A;  2YEP B;  4FAD A;  3AE5 B;  3ZXV A;  3NHE B;  3A9K A;  2KDI A;  2JWU A;  2MRP A;  2PJH A;  2EKE C;  3WAN A;  1QOF A;  1OQY A;  5IAA C;  2OHF A;  2WQY B;  2IJ0 A;  4P6V F;  4AS1 A;  5LXH A;  3GP7 A;  2DX5 B;  5IN7 A;  3Q2A C;  3W9C B;  4HLE A;  5CTR C;  3WAO A;  1E6E B;  2XEW A;  4ZOH C;  2LAS A;  1T0Q C;  1MHX A;  3QAR A;  2BPS A;  2WLB A;  3HUI A;  2KQ7 A;  3BYT B;  2ZEQ A;  3AV8 A;  2KMA A;  2V9H A;  3H9D A;  2M17 A;  2OOB B;  2D10 A;  1R4N B;  2WXM A;  4H2A A;  3U30 A;  4XWT A;  2N0S B;  3W2D A;  1WXQ A;  4JGH B;  4GDL B;  2AYO B;  1FCL A;  2N7D A;  3IG3 A;  5EDS A;  1XXG A;  4GDL A;  4XX5 A;  3RT3 B;  2DHZ A;  2V3S A;  2V3P A;  5G55 A;  5EE9 A;  3VFK A;  4FXC A;  1FO4 A;  4HCP B;  4LLG M;  4PK1 A;  4RGT A;  3MHZ A;  2HJ8 A;  2V4I B;  5IP4 D;  3DVG Y;  3P4Q B;  1FIQ A;  1Y56 A;  1EF5 A;  2LD9 A;  1KLV A;  4A8X C;  2WXQ A;  1V80 A;  4RF0 A;  2EEL A;  3M62 B;  3LB8 C;  1OTR B;  3T3N A;  3AEF B;  2BGF A;  5C2T B;  2D07 B;  2VZK B;  3DPD A;  3VR9 B;  4DDI D;  1J0G A;  5J2R A;  3DBS A;  3ALB A;  2NPT B;  1IBX B;  1WM3 A;  3KWV A;  1HA5 A;  3ML8 A;  2LWP A;  1E7P B;  1VZ8 A;  3BK2 A;  3A9J B;  2LGX A;  1WXV A;  3ZJT A;  2NPT A;  1QQR A;  1XLO A;  5L83 A;  3LJ3 A;  1OQR A;  2KMM A;  3LDZ E;  3EA6 A;  4WWO A;  4A55 A;  2Y5C A;  1LFD A;  3NY5 A;  3ZNH B;  1IGC A;  2BYT A;  2IYD B;  2KAJ A;  1I35 A;  3B0A A;  1TY0 A;  2EMT A;  4IG7 B;  3RFZ B;  4KKJ A;  4ZDV A;  4MSM B;  2L0F A;  2MP2 B;  3L4P A;  3PT2 B;  4M02 A;  1E8Z A;  5HI1 A;  3RPF C;  1HE8 A;  2MBE A;  1UEL A;  3MFG A;  2JRI B;  4OVU A;  2K6Q A;  2PE6 B;  4B9K A;  5HHD G;  4FA6 A;  2R2O A;  4BFR A;  3RNE C;  4ANX A;  1EU3 A;  1JQ4 A;  2ZW1 A;  4WJO A;  4WAF A;  2KN4 A;  1NEN B;  4K81 A;  2NS5 A;  3UI3 A;  4FHK A;  1ESF A;  4ANW A;  1WFY A;  4AJW A;  1TKE A;  2C60 A;  2NTS A;  1E5W A;  1N60 A;  3KUC B;  4LTU A;  1JWU D;  3ZLZ A;  2WHI A;  4TUU A;  1D3Z A;  3U7Z A;  3DBR B;  3KW5 B;  1D4B A;  4MH8 A;  4OZA A;  3SHQ A;  1OGW A;  4XDC A;  3OAW A;  3BZD B;  2KDB A;  2SEB D;  3P1M A;  2LVQ A;  4WWP A;  2QIE B;  3J9C A;  3E9S A;  1ENF A;  3U4E G;  2W54 A;  1V1O A;  1FRD A;  2A4Z A;  3ZRC A;  4AWJ A;  4II2 B;  3ZTD A;  4AUQ C;  1XLP A;  1OQQ A;  4B95 A;  4DXA B;  2YEP F;  2ZNV B;  1V86 A;  1E90 A;  3VRB B;  3M63 B;  2MCN B;  2PVG C;  3HHM A;  3RN9 C;  2PVO D;  3ZNG C;  2D3B A;  1WGR A;  1HTO A;  2INN E;  1WWT A;  4US9 A;  2FCQ A;  1FEH A;  2KX3 A;  4RGN A;  1J7A A;  2E6X A;  4OVV A;  3PHX B;  1VZ6 A;  2RDH A;  2R61 A;  3B9J A;  2QIL A;  3I5J C;  1M4V A;  3JSV B;  4E74 A;  4REZ A;  3LYY A;  4NZL B;  2X8X X;  4NY0 A;  2FCM A;  2ZNV C;  3E56 A;  1IUE A;  3PZ7 A;  4TMA B;  1LO5 D;  1TIF A;  4YXD B;  4MGZ E;  4ARI A;  1WIA A;  4HKZ E;  3A1Q B;  4F1S A;  2O2V A;  1S1Q B;  1PDX A;  3M95 A;  3L16 A;  3ZKJ C;  1E7U A;  4KZ0 A;  3CF6 E;  2KJR A;  1GB1 A;  3BVZ A;  3MC8 A;  1E9M A;  2WDT B;  3PLV A;  1Z2M A;  2D3A A;  2BB6 A;  3N3K B;  2KWU B;  3R2I A;  3R7R A;  4C7Y A;  3TL5 A;  1SJH D;  1UNS A;  3AU5 A;  4DHJ B;  5TR5 A;  2XNA C;  2JWZ A;  3EEC A;  3T9L A;  4LCD E;  4BOZ B;  4MSQ B;  2L76 A;  4P1C C;  1HQR D;  1KRH A;  1ET9 A;  1QKZ A;  2LUM A;  3VUX A;  3GE8 C;  1SE9 A;  3Q14 C;  1FM0 D;  3Q3N C;  2XK5 B;  4DBG A;  3Q8A A;  1FCC C;  1LM8 B;  1AAR A;  3IVF A;  4DXF A;  3AUL A;  3MC9 A;  4KDL B;  3Q8B A;  2PE9 A;  2MA9 B;  3OWE B;  4HJK A;  1HZ6 A;  1XF5 L;  2XN9 C;  3HM6 X;  2QC8 A;  4YTN B;  5E6N A;  2EKI A;  1FNW A;  1HZ5 A;  1Q1O A;  1C78 A;  2LHD A;  2H89 B;  3PGE A;  4USA A;  3I57 A;  2PEA A;  1L6V A;  1WRI A;  4PT5 A;  4HKQ A;  5H8Y E;  1JCK B;  3Q8F A;  4G50 A;  3AB5 A;  3I3T B;  1GUA B;  2IO3 B;  3H8H A;  4IM3 A;  1GPX A;  1WE7 A;  3V05 A;  2KTR A;  1BML C;  2KKC A;  1WM2 A;  4BOS C;  2JYT A;  4J6I A;  1YQ3 B;  4F8C B;  2ICI A;  1SBB B;  2N9E B;  4FJY A;  4GU2 A;  4M00 A;  2AWT A;  3NVY A;  4MGK E;  3U8Z A;  4I6L B;  2BBC A;  1TKG A;  4W9H A;  3PHW B;  2AL6 A;  1EUV B;  1Y8R C;  1VRA B;  1YN4 A;  4PS7 A;  1D5Z C;  2BYF A;  1UUP A;  1NVI D;  1EWY C;  2MHJ A;  3RZW C;  1DOX A;  2KDE B;  3AEC B;  2L00 B;  1N6Z A;  3FIL A;  4JWS C;  4W9K A;  1SEB D;  1ZDX A;  2C7M B;  2OED A;  1F52 A;  4HXD A;  4G0N B;  2C7N B;  2DZM A;  3KLS X;  1LGR A;  1DGJ A;  3KQ4 A;  4NJ6 A;  1UF0 A;  2KO3 A;  4FHJ A;  2Y5B B;  2JUO A;  1SSN A;  4A90 A;  4DDG D;  2KMC A;  3KH0 A;  2XBB C;  2AQ2 B;  2WDR B;  4K7W A;  3ZNZ B;  5KHO A;  2MBQ A;  1SF0 A;  3PTF C;  1WR1 A;  2JXT A;  4P7I A;  4WWM A;  1T6B X;  3VR8 B;  1OFF A;  2INC C;  4GLS C;  4LDT B;  4HDO A;  3MP9 A;  2KNB A;  4CYE A;  2BWE S;  3DDC B;  3ZQ4 A;  1ZP0 B;  2QDF A;  4R3D A;  3TUO A;  1XQQ A;  3PZ8 A;  5TSS A;  3N32 A;  1SJE D;  5HKH A;  4EZL A;  1ZUD 2;  2Z8L A;  4K7S A;  4XC2 A;  4FN2 A;  4UDU C;  3SEB A;  2K3U A;  3A33 B;  3I63 C;  2CU1 A;  2GB1 A;  5I4D A;  3JVZ X;  1BXT A;  1E7V A;  1J8C A;  2LUE A;  2CR5 A;  3K9O B;  5DPT A;  4KX6 B;  5DPS A;  3QQ8 B;  3AEB B;  1UWM A;  1IYF A;  5J17 A;  4NNJ B;  1YQB A;  5EE3 A;  4NPN A;  2WU2 B;  3N1Z C;  4MM3 B;  1EM7 A;  4KV2 A;  3VDZ A;  5JHB A;  1F0Z A;  2R2Q A;  2A5U A;  2LGS A;  2FE8 A;  4IWQ A;  1ZXH A;  3HIZ A;  4RNA A;  1TBE A;  1K53 A;  2ASQ A;  1MHH E;  5CHV C;  2KD0 A;  2PPH A;  3ZW3 A;  5LXI B;  1SXT A;  4XDD A;  1WH3 A;  2G3Q B;  1QIL A;  1Z5S B;  3ENE A;  2FUG 1;  3H1U A;  2KFK B;  4EZK A;  1T3Q A;  1V5O A;  2D3G A;  2NVU I;  2L3Z A;  2KJ6 A;  3TEX A;  4IWP A;  1VZ7 A;  4MJS A;  1L5P A;  1D5M C;  4YSY B;  3PRP B;  2M8S A;  4HPL B;  4KGR A;  4N9F 4;  3M3J A;  2GBR A;  1SIF A;  1YN5 A;  5AUK A;  1ROE A;  5JHA A;  3DBL I;  1ZW7 A;  1WRD B;  4BKS A;  1NYR A; 
#chains in the Genus database with same CATH homology
 2IDY A;  2GRI A;  2LJI A;  1L4Z B;  1E0Z A;  2WDQ B;  2L52 A;  1EU3 A;  3AE3 B;  1PYW D;  1JQ4 A;  2IGH A;  2ZW1 A;  2AX5 A;  1HEZ E;  1L0V B;  4WAF A;  2KN4 A;  3AE7 B;  3B2G A;  1NEN B;  4A9A A;  2B76 B;  3UI3 A;  1ZPS A;  3AEA B;  4DXG A;  1CK1 A;  1ESF A;  3R2T A;  2J52 A;  1TKE A;  1XO3 A;  3NUH B;  1I4H A;  3W1S A;  4JE3 B;  2JU6 X;  1C4A A;  2ZW0 A;  1TS5 A;  2NTS A;  5GXG B;  3BVM A;  1N60 A;  1AW7 A;  1JWM D;  3DWG C;  4LTU A;  2WP9 B;  1FFV A;  1JWU D;  1SE4 A;  4MAC A;  3BYY B;  4NJC A;  3TEW A;  4IKG A;  2KWD A;  3IT4 B;  3VRA B;  1WYG A;  3U7Z A;  2AQ3 B;  4OW0 A;  1B9R A;  5MPO A;  1L0X B;  3NVW A;  4JWU C;  3AED B;  1D4B A;  4MH8 A;  2J4X A;  3NS1 A;  4OZA A;  2W55 A;  4XDC A;  3AE6 B;  1XCT L;  3VQI A;  4D2K A;  3IXS A;  1VLB A;  2W3R A;  4ITK A;  3BZD B;  3AE9 B;  2HDE A;  2SEB D;  3MC0 B;  3C8Y A;  3P1M A;  4NAW B;  3ZJV A;  4WQM A;  2QIE B;  3J9C A;  1D5X C;  1MVK A;  3E9S A;  1ENF A;  2WXF A;  5D3I B;  3U4E G;  2ACZ B;  1V1O A;  2W54 A;  3Q8C A;  2DYM A;  1ZOY B;  3AH7 A;  1FRD A;  2SAK A;  1SB3 C;  2N7J A;  3GB1 A;  4MT5 A;  1I7H A;  1XLP A;  4M0W A;  1KLU D;  1PGX A;  1OQQ A;  3P42 A;  2YEP F;  1TJE A;  2H88 B;  2MJ3 A;  5EE1 A;  1DOI A;  2M19 A;  3VRB B;  2J53 A;  4IDI A;  1E10 A;  1B1Z A;  2PVG C;  2PLP A;  3MJ5 A;  2PVO D;  1RWS A;  1L4D B;  4CQN A;  4YTP B;  1IBX A;  1XCQ L;  3V3X A;  3TEY A;  1UGJ A;  2INN E;  1WWT A;  2N9L A;  4US9 A;  1SIJ A;  5BMG A;  2X38 A;  1FEH A;  3W5U B;  2BT6 A;  2QJL A;  4HRO A;  1VDV A;  2IGD A;  1XLN A;  2LFI A;  4RFB A;  2DWQ A;  3ETR A;  3TEZ A;  1QF6 A;  1YNT E;  4RGN A;  1FFU A;  1J7A A;  1V1P B;  2E6X A;  1VR9 A;  2WNM A;  1K51 A;  3IAS 1;  4WUR A;  3U52 E;  3FC4 A;  4C56 C;  1VZ6 A;  1NYQ A;  2RDH A;  2R61 A;  1C4C A;  1TS4 A;  3B9J A;  2QIL A;  2WXJ A;  3KWL A;  1YN3 A;  2K5P A;  1F77 A;  4IOI E;  1M4V A;  4HRS A;  4REZ A;  4ZHO A;  4TQ1 A;  3U2S C;  5BMH A;  3LYY A;  4NZL B;  1ZDV A;  2LEK A;  5HFY A;  5AUI A;  3IAM 1;  3E56 A;  1IUE A;  2QEJ C;  1XEE A;  1GOZ A;  3PZ7 A;  4TMA B;  1LO5 D;  2WXL A;  4L23 A;  5FKA C;  4YXD B;  1ACC A;  4HJG E;  4ARI A;  4C7Z A;  4HKZ E;  1KFY B;  3AE1 B;  1AYF A;  1I4G A;  3T3O A;  2JYE A;  1J7B A;  2WXN A;  2JX5 A;  1PDX A;  3FIL B;  1EU4 A;  1JML A;  2PW9 A;  2L1A A;  3EUB 2;  1J7C A;  3P63 A;  4ZRP A;  5BMI A;  2WXK A;  2NTT A;  3Q69 A;  3O13 A;  1GB1 A;  3URY A;  3BVZ A;  2WXG A;  4ZHP A;  1PGA A;  4N59 A;  1E9M A;  3BK1 A;  2I2Y A;  1QOB A;  3WCQ A;  2BB6 A;  3AE4 B;  5EE0 A;  2CU3 A;  3R2I A;  1FXI A;  1IGD A;  4C7Y A;  1SJH D;  4YSX B;  2LGI A;  1UNS A;  1FD6 A;  5E6J A;  1DOY A;  2XNA C;  3NVV A;  2N9K A;  2JZP A;  4TSS A;  2HTM E;  1STE A;  2FBW B;  1AN8 A;  2BB5 A;  2KDM A;  2V0G A;  2PMV A;  1ET6 A;  1HQR D;  3NVZ A;  1KRH A;  3LXF A;  3PO0 A;  1ET9 A;  1QKZ A;  3R8B A;  2LUM A;  3CWI A;  4A6Q A;  3HVZ A;  4Q2J A;  3AEE B;  1FM0 D;  3Q8A A;  1N5W A;  1FCC C;  3NRZ A;  4ARC A;  4HEA 1;  4DXF A;  4TQ0 A;  3SFE B;  2BS4 B;  3Q8B A;  4OHJ A;  2WU5 B;  2PTL A;  1WGK A;  3OWE B;  1HZ6 A;  1XF5 L;  2XN9 C;  4J3O D;  4YTN B;  5HG2 A;  1TKY A;  2J42 A;  1EWC A;  2EKI A;  1QT9 A;  3Q8E A;  2RDG A;  1FNW A;  5G5H A;  1L0Y B;  3B2F A;  1HZ5 A;  3CIR B;  1KTK A;  1C78 A;  2MJE A;  3BVG A;  2LHD A;  2Y5P A;  1TS2 A;  2H89 B;  4YSZ B;  4USA A;  4YTM B;  2WXP A;  3I57 A;  3I9V 1;  2LHE A;  2ON8 A;  1K52 A;  1C79 A;  1L6V A;  4P16 A;  1GAQ B;  2V3N A;  1F2R C;  1WRI A;  4OZB A;  4PT5 A;  4HKQ A;  4JX1 C;  2NMQ A;  1AWD A;  2D5G A;  1K50 A;  4XWW A;  5H8Y E;  1JCK B;  1TYG B;  3Q8F A;  3AB5 A;  3AMZ A;  1MI0 A;  3H8H A;  5H92 C;  2PIA A;  4EE2 A;  1N5X A;  1JRP A;  4AQ7 A;  1GPX A;  1HXY D;  1N62 A;  1Q10 A;  2WXR A;  3V05 A;  1JRO A;  1BML C;  1PGB A;  3AE8 B;  4KKI A;  2JYT A;  1GB4 A;  1JWS D;  3FAH A;  1C9F A;  1R7S A;  1YQ3 B;  1CJE A;  1SBB B;  2ICI A;  3EGR A;  4RF1 A;  2QMT A;  2K22 A;  2Q5W D;  3GS2 A;  3ZYY X;  3NVY A;  5BYR A;  1C77 A;  3P4S B;  2DLB A;  1JWB D;  2Y3A A;  5C3J B;  2RMM A;  1NEK B;  2AQ1 B;  2VZK D;  1V1P A;  2BBC A;  1TKG A;  2BTE A;  4WH4 A;  1KH0 A;  4N58 A;  2WDV B;  4ZRQ A;  1D6E C;  1KLG D;  4DQO C;  5BYS A;  2DYO A;  1TZO A;  1YQ4 B;  5D7G A;  1I4X A;  1TS3 A;  1VRA B;  4JPS A;  1YN4 A;  1T5X D;  4RGM A;  1D5Z C;  4N6E B;  1YJI A;  1UUP A;  1JAL A;  1NVI D;  2CJN A;  2MEK A;  2YEP B;  1EWY C;  1N63 A;  2L32 A;  4L2Y A;  5JXV A;  3AE5 B;  1QLB B;  1V97 A;  2BW2 A;  1DOX A;  2JWU A;  2WS3 B;  3AEC B;  4OZC A;  2IGG A;  1QOF A;  1FNU A;  2OHF A;  2WQY B;  2IJ0 A;  2ONQ A;  4P6V F;  5D3D A;  5G5G A;  4AS1 A;  1PFD A;  1F2R I;  3FIL A;  4JWS C;  2MJD A;  4OVZ A;  3GP7 A;  1C76 A;  1SEB D;  1ZDX A;  2M56 B;  2OED A;  3W9C B;  1I4Q A;  3SFD B;  3KLS X;  1QOG A;  1DGJ A;  1YJJ A;  3KQ4 A;  4KGT A;  2K0P A;  1C4P A;  1E6E B;  1SSN A;  4A90 A;  4ZOH C;  4US8 A;  1I4P A;  4L1B A;  2AQ2 B;  1MHX A;  2WDR B;  1FNV A;  2WLB A;  3ABV B;  3HUI A;  2TSS A;  1SF0 A;  2L83 A;  2QSD A;  2W82 A;  3BYT B;  2JXT A;  3AM9 A;  3SR6 A;  4WWM A;  3ZJU A;  1P7F A;  1T6B X;  3DWM A;  3VR8 B;  1OFF A;  3BWU D;  4ZYS A;  3AV8 A;  4GLS C;  4YT0 B;  1V8C A;  2WXM A;  1N61 A;  3MP9 A;  3P4R B;  1FRR A;  2E3T A;  4H2A A;  3ZQ4 A;  4XWT A;  2N0S B;  1ZP0 B;  3W2D A;  4R3D A;  1WXQ A;  2I38 A;  4B0M A;  3TUO A;  1ZXI A;  4GDL B;  3PZ8 A;  2INP E;  5TSS A;  1FCL A;  1SJE D;  4O1N A;  1ZUD 2;  2Z8L A;  1NI3 A;  1RM6 C;  2G1E A;  3AE2 B;  1MPE A;  1XXG A;  1ZE3 D;  2JSV X;  2V3P A;  4UDU C;  5EE9 A;  1I4R A;  4WIP A;  4FXC A;  3SEB A;  2K3U A;  4B0E A;  1FO4 A;  5FR3 A;  4LLG M;  4RGT A;  3MHZ A;  2GB1 A;  3AEG B;  5I4D A;  2V4I B;  2WXO A;  3HVD A;  4KGS A;  2DBY A;  3P4Q B;  1FIQ A;  1BXT A;  3AN1 A;  4C80 A;  1Y56 A;  2IPK D;  2PKO A;  5FK9 C;  4KX6 B;  4A8X C;  2WXQ A;  1DYQ A;  3AEB B;  4RF0 A;  4NAM A;  2EEL A;  1UWM A;  3LB8 C;  3T3N A;  1JWA D;  2W3S A;  3BII D;  3AEF B;  5C2T B;  4RCO A;  5EE3 A;  2VZK B;  3VR9 B;  2WU2 B;  2LMC A;  1UWX A;  4MM3 B;  1CQV A;  4RGO S;  3ZGZ A;  2JQR B;  4RH6 A;  1IBX B;  1EM7 A;  3KWV A;  1HA5 A;  1RFK A;  3N9Y C;  1SE3 A;  5BYQ A;  4XE0 A;  1E7P B;  1VZ8 A;  3IT6 B;  3P4P B;  1F0Z A;  3BK2 A;  2WXI A;  3ZJT A;  1XLQ A;  1YMH E;  2FE8 A;  2RPV A;  4YWG G;  1QQR A;  1ZXH A;  1XLO A;  1QOA A;  4RNA A;  1SE2 A;  1K53 A;  1L6U A;  1MHH E;  3W5V B;  1OQR A;  1RYJ A;  2KMM A;  3EA6 A;  1SXT A;  4XDD A;  4A55 A;  2Y5C A;  1BUI C;  3NZ3 A;  2KQ4 X;  1PUT A;  1QIL A;  2MH7 A;  1A70 A;  1IGC A;  2FUG 1;  2BYT A;  4LK0 M;  2KAJ A;  1T3Q A;  2G9H D;  1TY0 A;  3RFZ B;  4KKJ A;  2K9X A;  2BS3 B;  2GI9 A;  1CZP A;  3TEX A;  1VZ7 A;  2WXH A;  1L5P A;  1VJK A;  1WSP A;  3L4P A;  1D5M C;  4YSY B;  1KF6 B;  1TY2 A;  5T8I A;  5HI1 A;  1JW9 D;  3HRD D;  3TSS A;  1FMA D;  1P7E A;  3RPF C;  4KGR A;  2M0A A;  3MFG A;  1YN5 A;  2KAC A;  1FXA A;  5AUK A;  4GDK B;  5LNK 1;  1ROE A;  2BS2 B;  5HHD G;  2CJO A;  1NYR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...