1WS6A

The structure of thermus thermphillus hb8 hypothetical protein ttha0928
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
171
structure length
171
Chain Sequence
VVRILGGKARGVALKVPASARPSPVRLRKALFDYLRLRYPRRGRFLDPFAGSGAVGLEAASEGWEAVLVEKDPEAVRLLKENVRRTGLGARVVALPVEVFLPEAKAQGERFTVAFMAPPYAMDLAALFGELLASGLVEAGGLYVLQHPKDLYLPLGERRVYGENALTLVEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The structure of thermus thermphillus HB8 hypothetical protein TTHA0928
rcsb
source organism Thermus thermophilus
molecule tags Transferase
molecule keywords methyltransferase
total genus 51
structure length 171
sequence length 171
ec nomenclature ec 2.1.1.-:
pdb deposition date 2004-11-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03602 Cons_hypoth95 Conserved hypothetical protein 95
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 1ws6A00
1NW3A 1ZGJA 3DLIA 3A25A 3KPUA 5KYGA 2B3TA 3LSTA 5EMKA 3OZSA 2IPXA 3MERA 3FYCA 4M37A 3KQPA 1MHTA 4PWYA 3KR2A 4UOEA 2BZGA 2PVCA 4ER3A 4X60A 3O7WA 5FWDA 3UJDA 2HMYB 1JG1A 3GCZA 3LCUA 4LECA 2ZSUA 3WSTA 1D2GA 2BR5A 4P7KA 4BLWA 4FT2A 4BP1A 4YV1A 5BW5A 4ATNA 1B42A 5ICFA 2V74B 2KW5A 3TKAA 3BGDA 5K0NA 1OR8A 3EVGA 4RYLA 2P8JA 3FYDA 5EEHA 4C07A 4YMHA 3B5IA 2P3LA 3PX2A 3FPJA 4GC9A 4X61A 3KQSA 1G8SA 5CIYA 4XUCA 3E05A 3ERCA 3OZTA 3UJ8A 1XDSA 4C04A 1IM8A 3GGDA 5T67A 3NDIA 5EMJA 4YMGA 5K0CA 3KQMA 5F2KA 2AN3A 2PX5A 4YUVA 4DQ0A 2IGTA 1I4WA 3T7TA 4RTNA 3BGIA 4DCGA 2WK1A 2AN4A 2ZULA 2HNKA 3T7RA 3LPMA 3LDFA 1RJFA 3OE4A 1INLA 4O29A 1AQIA 5GP1A 1XTPA 2UYQA 1ORIA 3HA5A 4M36A 2Y1XA 1X1BA 5LR6A 1VQ1A 2GLUA 2HWKA 3ELUA 4GOOD 1ZGAA 2PGXA 2PJDA 3HVJA 5CUQA 2PWYA 4HG2A 3HA3A 1VP9A 4HGYA 4WXHA 3OPNA 3AXTA 2GA9A 3HCDA 4CTKA 4AZWA 2AS0A 1WY7A 3O31A 2P41A 3A7EA 3C6MA 3FUTA 1JG4A 1SVUA 3ANXA 4PGHA 3SVZA 3U81A 2GH1A 4EKIA 5DM4A 3NVKI 4GC5A 3DLCA 4BP3A 3SX0A 3KQOA 2ZBRA 5K0LA 1D2CA 3THRA 3VYWA 3X0DA 3KPJA 1IXKA 5K0JA 5CVEA 1SKMA 3HCBA 4RVHA 2I7CA 3T7SA 3QV2A 5K01A 4KDRA 5E9WA 3SM3A 4HC4A 4R6WA 4MHTA 1ZKDA 1V39A 1X1AA 1KPHA 4CKEA 5FUBA 3A4TA 3L8DA 4RTPA 2O05A 3KR1A 1Z3CA 3BWBA 4RTSA 1Y8CA 2DULA 3V8VA 3ELWA 1XCLA 3C0KA 2O57A 1UIRA 2ZFUA 5EHIA 4CKBA 4RTOA 1YFLA 1KYWA 3R0QA 4FSDA 5K8VA 3FTDA 5CVDA 2C7OA 3HCAA 4H0NA 3FUXA 3M4XA 4EKGA 3KKZA 4YV2A 5GIOE 2IBTA 2PX2A 2ZBQA 5ICCA 1KHHA 1NT2A 3FTCA 3GRYA 3NW9A 1G38A 8MHTA 1NBHA 3EVCA 2JHPA 4KVZA 4QQKA 4L7VA 4GOMD 3MTEA 1YZ3A 1TW2A 2YUIA 4PCAA 5ICGA 2IDKA 1L3BA 3BWMA 3MGGA 2N47A 2PWPA 3H2BA 2VDWA 3JWJA 1BHJA 2ONZA 1MJFA 5U4XA 2IH5A 2ESRA 1NW5A 4IKPA 2JJQA 5C1IA 5LQCA 1R74A 3G5LA 4YUXA 1XCJA 4FS8A 4FP9A 5E9QA 1H1DA 3HA7A 5E1DA 2GPYA 2ZIEA 5K0BA 1FPQA 3P9KA 1XDZA 5HIKA 3P9NA 3G2QA 3DMGA 4E33A 5KQSA 3KQQA 4XUDA 3BGVA 1T43A 3AXSA 1JQDA 1JQEA 3C3YA 3G88A 2PLWA 1P1CA 2H1RA 2XYRA 3HCCA 3HM2A 2QM3A 5EGSA 3G2MA 4PYMA 1EAMA 2HTEA 5E1MA 5CVJA 5DXAA 3FPHA 5M5BA 4MIKA 2FRXA 4PIPA 3CVOA 2OZVA 4E31A 4RV9A 4E2XA 3SSMA 2AN5A 2PXCA 2ZW9A 5F2NA 1YUBA 4LWOA 1RI1A 3G7UA 1F38A 2ZVJA 5LQUA 4U7TB 3QOWA 2JH8A 3LCCA 3ID6C 1RJDA 1R8XA 5DM2A 1IY9A 1UFKA 3ORHA 1NV9A 4ER0A 2QYOA 1SQFA 1WXWA 1M6EX 5DWQA 1RI2A 3BKWA 4R05A 2YTZA 3DH0A 4GEKA 1QAQA 4GOND 4C03A 4E30A 4MTLA 1L1EA 5DM0A 5DM1A 2FCAA 3DMFA 3FPEA 3R3HA 5GWXA 3ELYA 4XCXA 4AZVA 2QRVB 5BXYA 3C3PA 5E1BA 2PXAA 2WA1A 3A7DA 2NXJA 3P2KA 4K6MA 4Y30A 3M33A 5EG5A 4E2WA 5C9ZA 2UYHA 3R6TA 3CJQA 3PS9A 4P7JA 2OXTA 3F4KA 1ZQ9A 3TKYA 2AOTA 1RI3A 1SQGA 5EQJB 4OBWA 3LECA 2XVAA 4C05A 1KPIA 5EZSA 5ERGB 3TPZA 1Q0TA 3SR4A 3FRIA 3PFHA 1JSXA 2NXEA 1VLMA 4FR0A 4R8RA 5KVAA 3CC8A 3G89A 2HR1A 3FPGA 1AF7A 1YF3A 2ZTHA 4ZTBA 3TMAA 5P8WA 4GQBA 5LQAA 5FCDA 5HZMA 3GDHA 3LBFA 2FYTA 3RIEA 3TLJA 3TR6A 2I62A 10MHA 3BKXA 5FQOA 4CKCA 4FZVA 1FJXA 3VC2A 4X1OA 5EMLA 1R6AA 3CCFA 5K05A 4GBED 3P2EA 3P2IA 3FTFA 4R8SA 5GOZA 1YZHA 3LCVB 2F8LA 3E7PA 4RVFA 2H00A 4E2ZA 4PYJA 3CBGA 3HNRA 2OPBA 4M38A 4PONA 3UFBA 5GIPE 2G70A 3AY0A 3CKKA 3SSOA 2CKDA 4Y2HA 2YXLA 2B25A 2IFTA 5C0OE 2ZWAA 3EVFA 5H02A 4HTFA 2AOUB 1JSZA 4POOA 1EJ6A 2OKCA 3LKDA 5LQJA 5LQKA 2YXEA 3OU6A 3EMBA 4PYNA 1EIZA 4F85A 2ADMA 3DP7A 2YQZA 1PJZA 1NE2A 1VIDA 2G71A 3S68A 1KXZA 5FQNA 4KRGA 4X63A 5HILA 1EG2A 1WS6A 1G8AA 3EGIA 3MHTA 2R6ZA 1NKVA 2ZZKA 3BWCA 2OO3A 5FADA 5LSAA 1N7JA 3O4FA 4OQDA 2IDJA 3DR5A 3DXYA 1D2HA 4PYLA 5HIMA 3BZBA 3IV6A 3OFKA 4OA8A 1NBIA 5E2AA 2UZ4A 4DF3A 3G5TA 4EQZA 2OBFA 2LD4A 3VSEA 2ZZNA 1R18A 1VBFA 2GB4A 3DTNA 2O07A 1VPTA 1WXXA 3G8AA 2ZLBA 4MWZA 4QTTB 5HIJA 2NP6A 4MQ4A 5DX8A 3PFGA 1M6YA 5FULA 9MHTA 1JTEA 3GRUA 2K4MA 2B9EA 3OE5A 5EOVA 3LDGA 4GUAA 2PT9A 4U7PB 4PYKA 3P9IA 3E8SA 3GWZA 5FHQA 4EK9A 3FTEA 1WZNA 3UJBA 2I6GA 3PT9A 4KIFA 1EJ0A 1RJGA 2ZZMA 3UJAA 1EQAA 1QYRA 3D2LA 4QPNA 4FSXA 1WG8A 5FTWA 3P71T 1VE3A 3E23A 3MQ2A 4QTUB 4LG1A 5K09A 4YUWA 3GIWA 3REOA 5ICEA 5HFJA 3GRRA 1FBNA 3DXXA 3M6VA 1XXLA 5E8RA 2GAFA 4PYQA 3B3JA 2PSSA 3EVEA 2QY6A 3GJYA 2PT6A 3GO4A 1AQJA 3DXZA 3EVDA 2XYQA 4HRAA 3ER8A 2EJTA 3EVAA 2Y1WA 4WVLA 5EKUA 3DOUA 2O0LA 4HSGA 4IV8A 2Z6QA 3FUVA 3I53A 3UA3A 5EVJA 5JUWA 2I9KA 4DM3A 3CGGA 1N2XA 1XVAA 3NMUF 2YX1A 4DKJA 4PCLA 2WA2A 4CTJA 4RTKA 2AOUA 5HOQA 3UJCA 2A14A 5EEGA 4YV0A 5EPEA 1I1NA 4Z2YA 1TW3A 5KQRA 2AOXA 5BP7A 2P3QA 4OA5A 5GM2A 2PV0A 2FPOA 4KW7A 1BC5A 2JG3A 2EG5A 3PB3A 1KYZA 4DMGA 4F86A 2V7EA 2YVLA 2BM8A 3JWHA 3B7PA 2IIPA 3SSNA 1P1BA 2FK8A 3IEIA 3GXOA 3I5UA 2O06A 2BR4A 3HCFA 3KQVA 1NW7A 3G2OA 3VC1A 1R00A 3CJRA 3TRKA 5DSTA 3UJ9A 5HIIA 1JTFA 3TM5A 4PYIA 4A6EA 5EMMA 2VZ9A 4KWCA 5EZQA 5HEKA 3UJ6A 4DCMA 3BWYA 4DZRA 4YUZA 5DTQA 2OY0A 3ELDA 4RVGA 3FUUA 3NVMB 5DXJA 1RI4A 3KQTA 1NW8A 3NDJA 4ISCA 3FZGA 2P1DA 3EPPA 5E8JA 4QPPA 3TM4A 2UYCA 2VDUE 1BOOA 1R8YA 2QE6A 4QVGA 3HTXA 3OCJA 5DT2A 2P35A 1P91A 3K6RA 2AOTB 3NWEA 3HVHA 3DULA 4RTMA 3HCEA 2AVNA 5IKMA 1JQ3A 1NW6A 2NXNA 2PXXA 1YB2A 4RTJA 5LQRA 1X1DA 4PNEA 2Q41A 1ZG3A 5CD1A 1O9GA 2QRVA 4A6DA 3GU3A 1FP2A 5CVVA 1G60A 4RVDA 2C7PA 2B2CA 3UJ7A 2G8NA 2E5WA 5G02A 1VP3A 2EX4A 5DRYA 3M6XA 3SXJA 2JHAA 4JXJA 2OYRA 4P7FA 3FUWA 5B1SA 3EGEA 4C4AA 5GM1A 4G56A 1ZHFA 3HVKA 5FA5A 2IH4A 1N7IA 3IHTA 3NTVA 4AX8A 4P7GA 3KPWA 4YUYA 5EIWA 5DTMA 5CVUA 3P97A 2ZBPA 2AVDA 3I58A 3PX3A 3UWPA 1ORHA 3MTIA 1SUIA 5CM2Z 4C06A 1PRYA 3I9FA 4E70A 5K0EA 3LBYA 3UBTA 4NECA 2G72A 3TQSA 5MHTA 2EJUA 1AV6A 2CMHA 1QAMA 4CWAA 1KIAA 2HV9A 4B17A 1XJ5A 3Q87B 4QDKA 4AZSA 3OU7A 3THSA 1KP9A 3K0BA 5D1HA 3A27A 3NJRA 4E2YA 2XBMA 3V97A 3EEYA 3HP7A 3I64A 1NV8A 1TPYA 2ZIGA 2ERCA 3B3FA 3JWGA 2VP3A 1F3LA 2OB2A 4IV0A 1G6Q1 1RI5A 4XUEA 4C08A 3P9CA 4FGZA 2ZIFA 4GF5A 4RTLA 3MAGA 2H11A 3EGVA 5K0FA 1JG2A 1Q0SA 5LQNA 1SUSA 4OX9Y 3EMDA 1L3CA 3BXOA 4RSRA 2C7RA 3EVBA 1VL5A 4PIMA 3OZRA 4OBXA 5DSXA 3T0IA 1L9KA 1O54A 1DL5A 3GRVA 3G8BA 2IH2A 5EKXA 3HEMA 4EMSA 2OB1A 1X19A 4RTRA 3LX6A 4BY9E 2PBFA 3LL7A 2BR3A 4GOLD 5IH3A 4RTQA 5CCBA 4HGZA 2JH9A 2PY6A 3LHDA 3TOSA 3M6UA 3M6WA 3HVIA 4PGGA 5KS2A 2Z6AA 3C6KA 3B3GA 5GINE 3AWIA 5T6BA 4X41A 4V0QA 2P3OA 5E1OA 5FA8A 3LKZA 3KQWA 5DX1A 5EC8A 1O9HA 1JR4A 1QZZA 1UWVA 3JWIA 2ORED 3QOXA 5JR3A 2VDVE 2AR0A 3DMHA 3GRZA 4KDCA 3RODA 4DA4A 2VS1A 4QQNA 2PKWA 2UYOA 1YFJA 3R9XB 3Q7EA 2P7HA 7MHTA 3MB5A 5FWAA 3G2PA 4EVIA 5EIFA 2DPMA 1FP1D 3PLAE 3PVCA 1U2ZA 3B89A 4M7RA 5D1NA 1HMYA 1BKYA 5DLYA 3PTAA 4IWNA 4KIGA 3IYLW 4PINA 2NYUA 2R3SA 4E32A 4PYOA 4ER5A 1KPGA 3UZUA 2CL5A 3EEOA 2FK7A 4HTFB 3M70A 3MCZA 3CJTA 4FT4A 1L3IA 3SMQA 2XVMA 4AUKA 5K03A 4HH4A 4OQEA 1QAOA 2AOWA 2PX8A 1JG3A 1SG9A 2EFJA 3A26A 1DUSA 1XDUA 2AZTA 2JHCA 3ME5A 5E9JA 4RX1A 5T64A 3GNLA 5DTRA 4CXMA 3KQYA 2NXCA 3EVZA 1QANA 4V0RA 3ER9A 3OFJA 2YR0A 4AZTA 4R6XA 2CWWA 3KR9A 2NNWB 5DX0A 5CCXA 3SGLA 1KR5A 1P39A 2BM9A 1HNNA 2AOVA 3OU2A 1RJEA 2GS9A 3LGAA 5K0GA 5DRTA 2CMGA 1G55A 4ER6A 2NP7A 4ER7A 1M0EA 2G1PA 2C7QA 2P7IA 2XYVA 3MCTA 2P40A 3KR0A 3AJDA 3NWBA 3BUSA 3FPFA 3KU1A 4P58A 4QDJA 5E2BA 5FHRA 3UA4A 1X1CA 3R24A 3RW9A 3KHKA 3KPYA 4LWPA 5EHGA 2ZCJA 1I9GA 3KPVA 4QVKA 3FRHA 4BLUA 3P8ZA 1DCTA 2B78A 3TFWA 2YXDA 3LDUA 5DPMA 2IP2A 2ZWVA 4BLVA 3DUWA 4F84A 5BW4A 5F2OA 3BT7A 2PX4A 2BH2A 4RWZA 2IBSA 2Z6UA 2FHPA 2ONYA
chains in the Genus database with same CATH superfamily
4DM7A 4UU7A 3E5MA 3IPAA 3HBJA 4QGHA 2ATEA 4L0DA 1W2WB 3AIOA 3QOFA 4KKXB 4C88A 3TBKA 2G0AA 1VYHA 1CZNA 3NTOA 1MAHA 5L4NA 5CT9A 4GP7A 3PNKA 1D03A 4RCZA 4TQUS 4CF4A 2GSWA 1O5TA 3AP2A 4DTIA 2F3QA 3QKRB 2H5EA 5FWDA 2HMYB 4JJ4A 1PJQA 1WR8A 4F06A 3IBYA 4YV1A 2POCA 1DMRA 4MRRA 3QFSA 1Q0RA 2X8WA 1WV1A 3BGDA 4NMLA 2HNAA 1DAEA 3K8YA 1NONA 1KQOA 2WV7A 2BFWA 2NW6A 5CJPA 3BGSA 4D26A 2OE2A 1JDJA 1ES9A 2DMRA 2QTNA 3QWHA 4J49A 4KO3S 4F2HA 4DDWA 3S5UA 3W7VA 2O8NA 1QJCA 4J0GA 3F8TA 3N76A 1OSNA 3AINA 5K0CA 5LBUA 1NN5A 4B8ZA 4NDAA 2F9LA 4RTNA 2XMQA 4WKOA 1ESZA 1JW9B 2I87A 3DVAA 3NHFA 3H2HA 2CXTA 2XEDA 4O63O 1U3GA 2ZIXB 1COWA 3A06A 5JAZA 4FYMA 3IAXA 3KT0A 3CLSD 5TR9A 4KOEC 3H8SA 3U4DA 4IJMA 1UOOA 1NR5A 4PXAA 3EAQA 1JE1A 2CL7X 1ZJWA 1DTSA 3QP9A 4PRYA 4GT1A 3OQ1A 4H9GA 2Y1DA 3MC1A 1A7UA 1DG3A 4GKAA 2P41A 1H2ZA 2QT9A 2C5AA 2JZOA 3OIVA 2ZYAA 3EVTA 1AKRA 3P4XA 4KFUA 4BP3A 2DHDA 1E32A 2BKXA 3C7AA 1RHUA 1VLLA 2HF9A 4IIFA 5K0LA 2GXAA 3DKPA 5CJ2A 1G0OA 1Y81A 2IQ5A 5AXAA 1FY2A 4MV4A 1WHSB 3KKKA 5H0IA 3ZGVA 4A0QA 4EIWA 3OMXA 3EMVA 5A2QA 1A7KA 5J4LA 2XTNA 3HXTA 4KDRA 2IUYA 2CFRA 2CLKB 3A6ZA 4MK4A 3OT4A 3R7WA 1DXOA 1JG7A 5I3ZA 4IOKA 2L2QA 2GLTA 1IN1A 1Z06A 3QG5A 3B3AA 3DDUA 2GRUA 4Y18A 3MJHA 1BDHA 4Y67A 4JVSB 2VT7A 5BXQC 2WY2D 3TZQA 3FUXA 1NZDA 3R3YA 3UV3A 3BFJA 3V80A 4MRMA 3LP8A 2F1RA 2O20A 4CPDA 2P1ZA 5JCJD 2X15A 5EJIA 4A36A 4Z3KA 3GN2A 3FDZB 1GKUB 3KETA 1CU1A 2XMRA 1A72A 2Z9CA 2FPXA 3QVLA 3MGGA 2GPNA 2HK8A 2PWPA 1KXJA 2RAUA 2FY8A 2ONZA 1MJFA 2CXNA 2ZJ0A 1E5QA 1E0SA 1FS4A 1KAOA 1ZGZA 1GNVA 2HZ7A 3KK0A 5BV0A 4CL2A 5HDBB 5CW1A 4AT1A 5K8CA 1TZKA 1IWOA 2A3RA 4FS8A 1KQGA 1TFRA 4R2HA 3RKUA 3H1EA 3O0DA 4NCKA 1RBQA 4PSAA 5AKHA 4ZYTA 5IEJA 2X9NA 2Q5FA 2FX5A 4ZVMA 1AY0A 2ZK7A 3RHFA 2YV4A 5KQSA 2DFVA 4E3WA 1QS0A 3PRJA 1G2IA 1W4ZA 3HCCA 3E9YA 3OSZA 4HJRA 2QM3A 1CQXA 1U6JA 4X94A 2IEBA 3U7QB 3TQOA 2OD7A 4G5FA 2II6A 2GCEA 2X7XA 2OORA 2WWRA 4KEAA 3WYFA 5CAEB 1D07A 2HM7A 1X86B 4Y7CA 3F8SA 3R5KA 3RSCA 5JQWA 1UBLS 2JEOA 3IPLA 2X76A 3K92A 3LY8A 4HLCA 5AUOB 1XD2B 1TK2A 4DLYA 4AK9A 4NBVA 3NB0A 2IYUA 4FCVA 4DIDA 4H77A 4Z7QB 3AUSA 1J6UA 3RTEA 3WNBA 3U4QB 4RESA 1Q77A 2VRCA 4JS0A 4IHQA 1VXRA 2XKAA 2ZYTX 3PLRA 4OAOA 1YUMA 3VJLA 1V1MB 1WXWA 5F78A 2MSDB 3IKMB 3A28A 5B1EA 1ECLA 4J4BA 1XWIA 4KK4A 1UAYA 3EZ9A 3BJMA 1VE5A 1LNSA 1OHHD 3C3PA 1WF6A 2GF9A 4WTOA 1PIWA 4CV1A 1E1YA 4Y30A 3CZAA 2NV0A 1IYZA 3K3PA 1LFDB 2JGLA 3CRQA 1ZNWA 1CFZA 2ODPA 3DOEA 3KYIB 1UKBA 3GV0A 1OROA 3HI4A 3F4KA 3R6TA 4XWAA 1TEHA 3JQAD 4O4HB 1GZSA 2VYCA 5EQJB 4X64B 2R7MA 1HX7A 5A3JA 1E7QA 3TPZA 1ODKA 3F6BX 5F1PA 4QOEA 1JSXA 3K96A 4FR0A 3PHIA 3CRVA 1WMSA 3JRNA 5T3UA 3BFVA 3WA6A 4H1UA 1ZISA 5JAMA 3QU5A 1R10A 2Q45A 2FX2A 3CRW1 4M8LA 3S1AB 3E70C 3BCUA 4DLSA 5KWIA 2L82A 1O94C 1Z0DA 3EE6A 4L72A 2LE0A 5FOQA 5CB4A 1YR6A 2FFHA 1DC3A 3BKXA 3RU7A 1I14A 1RYMA 2P9EA 2OHFA 4RJ2A 5IJ9B 1N32B 3I9JA 3PXAA 1TM1E 4FCTA 4MUIA 5L6MB 5HCNA 3P2EA 1REQA 2W37A 1RJWA 2DUUA 2Y2VA 4R8LA 2R8OA 2ZANA 4K28A 3MJFA 4TX1A 3LCVB 4EUNA 1BMFD 2DFPA 3AI1A 2CXRA 1T2FA 5I7HA 4OHOA 5DYTA 1E1RA 5IC5A 3IKTA 2IFTA 1JRLA 5C0OE 2V98A 5DGHA 1E9CA 4JJKA 3L7LA 2M6SA 3OLQA 1MX9A 1H8ED 2H2FA 4NU5A 5CTJA 1QDEA 3W2GA 3STXA 3R9WA 4B44A 4FB5A 5A4AA 1V6CA 1SA0B 3PZRA 4IJ6A 4ASUD 2RFLA 1KZHA 4IMJB 1H2FA 2N3ZA 5FTMA 4BTLA 5IDQA 3L0OA 3ILHA 1XMSA 3AFOA 4XIIA 3RIHA 3DMRA 1DX6A 1EG2A 3HJHA 5KQGA 1Z73A 5GV8A 1B4DA 2GBGA 1MR3F 4K3UA 3BD8A 5TVKA 1QWOA 4CMAA 5FWXB 3TZEA 1FW8A 2AJCA 4PYLA 3RFCA 2VDWB 4KE9A 3WHPA 1SBTA 3ABSB 5KYXA 2YJNA 2ZZNA 2C99A 2FUNB 2IUEA 1J2JA 4QGFA 1VBFA 1H9AA 1NHGA 1SK9A 3CZCA 4TSFA 3WSWA 1JZQA 1XEWX 2A2ZA 1W52X 3S28A 3H5OA 5CT6A 1YVEI 2QZSA 4GG1A 4LXHA 2YFHA 4PEVA 4DLXA 1BCSA 1RWXA 4Q7QA 4EBFA 4BNWA 2EJWA 3V4PB 3RFUA 2ET6A 4GMXA 1N2IA 2QSUA 4C3VA 1OIVA 4A1OA 1XYGA 1WZNA 2QD5A 1NBMA 1PG5A 1F8YA 2PZFA 3UJAA 5A04A 3M2PA 2DKFA 1EQAA 2A5LA 2EKZA 4QPNA 1U8FO 2OQIA 1WG8A 1ZL0A 1ZBDA 3D6UA 1SKYB 3VOTA 2O54A 1LBSA 2RC5A 2YOHA 4L4XA 2XUJA 4MGHA 3I5AA 3S99A 4ZO6A 3EVEA 1E77A 2GBFA 2BJHA 4OOFA 4EJSA 1LW7A 4PZEA 2CSXA 1KI6A 1N7HA 3RC1A 1JSRA 1W0JD 3HWRA 3STUA 4A2CA 5JUWA 4H17A 5JBQA 2WSSD 1DRVA 1FFGA 3PG5A 2I91A 3L7CA 1QTRA 1C0PA 7AT1A 4P92A 1RC8A 4JI2B 2C5EA 1IN4A 1MB4A 2W2KA 4YDHB 4NS4A 2VUIB 3SQNA 4HQKA 1N4AA 3TX2A 1I1NA 3UWOA 3EOBI 3WS7A 1W87A 1JAIA 2HJSA 4HN2A 3QTBA 4KXUA 2FPRA 1TECE 4G3XA 3HB4X 1AM4D 3UMBA 2VYVD 3O92A 3TDNA 2VQFB 2IS1A 1V47A 3A36A 3PU6A 4OHCA 1RQNA 2H3EA 3EX7C 4IG9A 2JBAA 4G8JA 4F2WA 3LA8A 3OH8A 3RRXA 1WWKA 3I2HA 3MTGA 3RHZA 4BHTA 1A2QA 4L0MA 3F1LA 2C2KA 1J8DA 1HT0A 3FG9A 2ACWA 2F67A 2O5CA 3SJUA 1HE4A 1JNYA 1XL0A 2C8VA 3VC1A 3KZXA 3U6BA 1CIPA 1JTFA 3N2IA 5DHPA 3TM5A 2WP8J 4C4XA 1A88A 1PT6A 5EZQA 4CR7A 4YCCA 2QM7A 3QSYA 3LAWA 4ND1A 2O6LA 2NU9B 2QTVB 4UREA 1ZU5A 2GPAA 3AM5A 1U8ZA 1GUZA 2JI9A 5E8JA 1WXQA 2Q0QA 1Y5LA 5WRFA 3VYRB 1SHTX 4WZBA 3WLTA 3KKPA 2XXAB 5JS6A 4RHXA 5DT2A 1LQUA 4BN5A 3OQPA 3PC8C 4PXSA 3RC8A 3UV6A 5GVSA 1Z08A 2B1RA 1T36A 1DU4A 3BA6A 4G0OA 3U49A 5IN4A 3O93A 1E0AA 4MLPA 1E1DA 3FYUC 2UUAB 3QU7A 3KE9A 3RVRA 1UDAA 1OX4B 5DLDA 2YRWA 4AY6A 1XRJA 4Y6LA 1G20E 2R25B 3NH9A 4LZJA 4PO1A 4B0PA 2QTZA 4BNKA 1XMJA 1FW6A 3PDIA 4JK3A 4N65A 1S3GA 2GBIA 4QASA 2DTXA 3R5FA 4MLZA 1KMMA 1IQRA 1K8RA 2XMBA 5BWNA 1DINA 3ILXA 1D1TA 2G5CA 2ATVA 2WSYB 3R3UA 1N7IA 1Z33A 4J75A 4MV1A 1VHWA 3QELA 4DANA 3G1TA 1E0DA 2QHXA 2X6TA 2I3AA 1E99A 2BMVA 2ZBPA 2Q0SA 1Z6AA 2YZNA 3HNPA 5KKCA 3O3MB 4M1WA 2G72A 1M2VA 3DEZA 4TMZA 3B1ZA 3HU1A 2JW5A 2J59A 3HHPA 5G53C 2DTDA 1JAXA 4Q4HA 4HX2A 4K9LA 3EFOA 5CA0A 4TL7A 2V7QA 1A3CA 2H85A 1IZ0A 2XADA 4JQCA 1RBYA 3PSHA 4RCVA 3JQQA 4CKEB 1D9XA 4JELA 2R00A 1SKMA 4PSKA 2DCMA 1RI5A 4C08A 2D54A 5DNDA 1G7RA 1K9SA 2NAFA 3O82A 4GF5A 1Q44A 2I1VB 4LOKA 5C34B 4MUNA 2ONJA 1ZR4A 3CA8A 2J4CA 2P68A 3OHPA 1JI0A 1YDGA 2BUBA 4J4TA 4K8RB 3W1WA 1VRWA 3TDKA 4JROA 1PSWA 3BGWA 2GSDA 4UNNA 1FCJA 2HQRA 4KFCA 2IBMA 3A2NA 1O54A 3UW3A 5HDQA 4XYLA 3G8BA 2IH2A 2BBSA 4HUTA 4CEJB 1X19A 3JYOA 2GYVA 2CLHB 2FEMA 3A11A 4JASB 3UY4A 5C5DA 1Q7GA 3GLKA 3UICA 5IAEA 5IBQA 1YUNA 1GSOA 5HE8A 2E4XA 1Z9BA 2WJYA 1JIIA 4FE7A 5G0TA 5TPWB 2OXEA 4QWWA 3RK0A 5FH9A 1N7GA 1FSSA 2J3IA 3I28A 4PY2A 4YJ3A 4E09A 5EC8A 5ITZA 5J23A 1O9HA 1A97A 3A3KA 2BFEA 3A6GA 3EGXB 1EDZA 3UQYS 2AK2A 2AR0A 3C3DA 3COWA 4MS1A 4Q3KA 4BBZA 2UUBB 2MINA 3PD1A 1KI8A 1PNQA 2BN4A 2G06A 2WNIA 3BA1A 1MB9A 2ZI3A 4QO8A 4HAYA 4UAJA 3T7EA 1QFSA 5FWAA 3OURA 4GI2A 2JA2A 3UMGA 1YQ9A 3PVCA 1L6RA 5I7EA 2KM1A 4DR4B 1V48A 1OW3B 2IHZA 4CDNA 1ZEMA 1W30A 2GCGA 4CQLB 4YXFA 3KEOA 2QWXA 4QQ8A 3L40A 5T4FA 4D9MA 4AM8A 3IQEA 1WF3A 2B2NA 4H0FA 4G8BA 1L2TA 3GWGA 3IUBA 3NS7A 4G1BA 3AQIA 4GRDA 4PE5B 3UZUA 4YROA 4HTFB 2ZSDA 3VZDA 4GX5A 1YZLA 3DL4A 2Q2WA 4BP8A 4K9NA 2VSYA 1SUWA 2Q4TA 4LDNA 1H2BA 2XW6A 4A5SA 2J87A 1L5YA 5DTJA 1XTBA 3JALB 4UEWA 1CZLA 2H0AA 4EYGA 3ADDA 4MXDA 2FW8A 1ML3A 2IZZA 1BXZA 2B6HA 1T2UA 3QYPA 4MKRA 1Q50A 4CV3A 1O4WA 1VLHA 2GN8A 3BB3A 3S3TA 4AZTA 2CWWA 5G0SA 1OI2A 5EIHA 1WY5A 1UBEA 1CVIA 2NU6A 3LIPA 5DM60 5HGJA 3RAFC 3PTZA 2Z1NA 4ZALA 2PZEA 4TPKA 4YRSA 4PC6A 1J2UA 2B4QA 1VOTA 2XCTB 2W43A 2PLAA 5BPHA 1DIHA 3CE6A 2OZEA 3BUSA 3W8RA 1MQ8B 4OQFA 3D9QX 3KKMA 1G5QA 5EE3A 3UMRA 4HAVA 3PFCA 4LWPA 4P1ZA 5EHGA 5FOSA 1LRKA 3IR7A 4ZDKA 5KVSA 1FNDA 2IXFA 2PSFA 1KO8A 2RHGB 4IDBA 1VKJA 3L1VA 4OBBA 2C5FA 2J48A 3HGMA 3PUWA 5F2OA 4N5IX 3WGUA 3L92A 2ZJOA 1Y6FA 1E79D 1N6LA 2FN3A 4RWZA 3FWPA 1LBQA 2ONKA 4I2NA 2VHVA 2ZEJA 1V8OA 3JAWA 2O5VA 4CVNA 3PKIA 1PR2A 2H16A 3VX3A 4V1CI 1H5NA 1T13A 2GHTA 2XUAA 5HBRA 3FIJA 4I08A 5ALFA 3PQEA 1VIYA 4HZIA 1B0PA 4GR4A 1NXVA 1QBKC 2YWJA 3TFOA 1E8DA 3MGKA 3UH0A 1OVMA 2C9DA 3NDRA 3O7WA 3GCZA 2VJYA 4B6PA 1NMEA 2B83A 1ZUIA 3A9UA 3BB1A 4NMMA 1R0XA 4R8KA 5DCLA 4EG8A 5JHGB 3E7WA 1IUKA 1MC5A 4L15A 4B73A 2A33A 2R0QC 1YTUA 1U9IC 3B5IA 3M5DA 4FFLA 2HA5A 3CPEA 2Q3MA 3FPJA 4A6XA 4Z7JA 1S8OA 3LOUA 2BGWA 4FFVA 1PWZA 2C57A 4XUCA 4AI6A 3O9VA 2NTVA 4C04A 5HK8A 1E98A 3HWSA 1XD9A 2A84A 3PR1A 1A2KC 5F2KA 2WUWE 1KZ7B 2PX5A 2XWQA 2WKSA 2GA8A 2FGJA 3NZEA 1SUDA 2RGXA 1LC3A 3KIPA 4PHTA 3SHFA 1ONPA 1N57A 5HKBA 1Q5PA 1MB2A 2PNFA 2IYNA 4HPWA 4HT3B 3EUEA 3KUUA 1DFIA 1XTZA 2PX3A 4RLQA 1BDMA 2FQ1A 1Q3TA 4JODA 1RJFA 1QG2A 3QF4B 3QZUA 4PZAA 2YFQA 4TUYF 1OWPA 1KGSA 5JNVA 2J85A 1VQ1A 3QX9A 1N5DA 1ZBQA 1SZJG 3EA4A 3SZRA 4AW9A 2PWYA 5FB3A 2GN1A 4G0ZA 4GXRA 1ODLA 2DH6A 1E6CA 2X86A 3IPXA 4Y9RA 2I3DA 4C7BA 2W2XA 1I2AA 2PH3A 1QVAA 3J80A 1J21A 2FMXA 1P7ZA 2OXIA 4TTJA 2QTHA 3SHQA 2GQ0A 2GMWA 3QJGA 1MG0A 4JP5A 3AIMA 3C7CB 1YZVA 4BFCA 2JGRA 2C42A 1I5OA 1NWCA 1TC2A 2J3DA 1ZH6A 3QJ5A 1GQQA 3UHOA 5A7FA 3FWZA 4ND3A 3ULKA 1KBOA 2CFOA 2G9ZA 2B4KA 5K0JA 1QOQB 1Q0PA 1F2VA 2R5FA 4HDQB 3MUEA 3HC7A 4L5BA 2E55A 1U7TA 2O1EA 4M9UA 4LGVA 3IV7A 4QEKA 4R51A 1CJMA 3OQVA 2REXB 2HMAA 2HXGA 2XTMA 4EFNA 4N39A 4PICA 4UEOA 1Y8CA 3ZCTA 4CI9A 2C03A 2ZCUA 1FMJA 3E9CA 4Z4HA 4KE7A 1MORA 3SNHA 1HL7A 3UANA 1DKLA 2FDXA 2FHSA 4C2TA 3J81k 3TSYA 3NHBA 3USZA 2AI1A 4UOZA 2P0EA 4S04A 1NT2A 4N7MA 2K7ZA 4NJEB 5DVZA 1FUIA 1RQ7A 1U1FA 5FRDA 2VAWA 2WAOA 3IOYA 4MVXA 4LV6A 3O91A 1EP9A 1Z4OA 3BEDA 1XPOA 1P2UA 1T1IA 5KTYA 1G21B 1ODIA 5CTAA 3JWJA 3LPDA 3VA7A 1CRWG 3KXPA 1OPXA 1MZVA 1Q84A 4D9EA 2RGEA 4Z3OA 1E8NA 3P9ZA 3Q9NA 3RSQA 4NONA 1JHDA 1LTKA 1F2DA 1VG8A 2AZMA 3L4BA 5AW8A 1C9JA 5AK6A 2PZMA 1IJFA 1H1DA 4PLWA 4LF6B 3PUJA 4MV0A 1TUEA 3BMQB 4WK6A 2WJVA 1ZM4A 3RWOA 2Z2XA 4Q48A 1NBMD 1O6FA 1U4SA 4FFNA 4ND4A 3NR2A 3URMA 4ACAA 2I4OA 4E33A 3AXSA 1ONNA 1JQEA 3JQEA 5IYZF 1IWBB 4ARAA 4Q4AB 5L6LB 1MDFA 4IW3B 2ODNA 3QGMA 1BE0A 1ZW6A 1RS0A 2B34A 3TZLA 3AV3A 1ONSA 2FR8C 4QA9A 3D4NA 1DZIA 1QYCA 5LKRA 4E31A 1J2RA 2V7VA 3K2IA 4UTOA 4B31A 1JYFA 1YUBA 4M89A 4LHXA 4EJSC 3Q6NA 1OASA 1MFZA 2W6JD 2XNSA 3EISA 4D9GA 4F21A 1WXGA 3E9QA 4HFRA 3QOWA 4HGQA 5FIUA 2X0KA 2H5LA 3RTBA 1XD2A 3FPSA 4JNKA 3CEHA 2AT1A 3P9PA 4LZPA 5DF1A 2RHDA 1X3SA 3NTRA 3OKPA 4LXYA 4XIJA 3TIFA 2JLBA 2BGTA 2OSBA 1EDOA 3Q7QA 2J0UA 1QHHB 2QD4A 3SKYA 3SS8A 4E30A 2AFRA 4RQUA 3F97A 4RHFA 1X8XA 1YJ5A 2PQMA 3GUZA 1IK4A 2YQ4A 2WSMA 4X1KB 3DMPA 2EP5A 4JY7A 1VKRA 1H3EA 5AMXA 3R2JA 3E81A 3SBEA 1H4SA 4XQGA 3H6HA 3A4YA 3M34A 1N9GB 1V2HE 2RAPA 4QPCA 1YIOA 1Z5ZA 1XAHA 2BCJQ 5LXTF 1AKWA 1ODFA 2IF2A 4OY3A 4KREA 1MPXA 4KRYA 2XNCA 4Q3BA 1DWPA 3AEKA 1S4QA 3L4KA 3VV3A 4WH0A 2VWGA 5JFTA 1CS4C 3AOEA 5BN4B 1PWXA 4H59A 4EDFA 3DNFA 4WCFC 4WKGA 1ZOOA 4O4HF 3C5WP 4P4LA 3RRBA 1N34B 2C83A 1JXOA 1QGDA 2O2CA 3VR4H 5MN4A 4JZKA 1DJNA 3RF6A 4IHKA 3ZZMA 1FJGB 1NXTA 5CM9C 1EVQA 4BE9A 5IJWA 4TTPA 5BQXA 3FLMA 3LBFA 4MS4A 4U3JA 3SZGA 1YJQA 2I29A 3DSRA 3TLJA 3A4NA 1EUYA 3B2EA 2CL6X 1B26A 2W58A 1KZ6A 4JN6B 1EE1A 2G9RA 1ENPA 3GZNA 3QWAA 4OHMA 2BLLA 2BE7A 3V4VB 5M34A 2YY7A 4RDHA 5JU6A 2JASA 3VDMA 3IXMA 4R8SA 1KAGA 4O2AB 2W7TA 2UYGA 4DR7B 1IVNA 2EFCB 2WFMA 3PUHA 4K9RA 5JCOC 3A3NA 4PAOA 3DGEC 4HB0A 3JQ9A 1JSZA 4MS3B 2Z4TA 4YDQA 2GVNA 2GM3A 1T9CA 1EIZA 4JDUA 3OLYA 4G2NA 2E82A 2X4IA 4LTDA 3H86A 1Y8QA 1R9MA 2AUNA 4TL8A 4UBLA 2ZYUX 3D3JA 1QRRA 4X63A 1IBCA 4BZWA 2AW3A 3DGFC 4ISBA 1EVLA 1V11B 3C8MA 4XDZA 1VI6A 3VTFA 4YRAA 3MHTA 1XRRA 2ZZKA 4UQOA 1HEYA 1P9LA 3G8YA 2O2HA 4UNPA 3SZOA 3TRHA 3LNTA 4ARZB 2PNJA 1U0HC 2SHKA 4X6YA 2Z8YA 2DBRA 5H68A 3OCCA 2H1WA 4I81A 5FWXA 3EXFA 4BVJA 4B7AA 4KMMA 1KJZA 2B8EA 4UTZA 1OBCA 2IYQA 1KRWA 1TZMA 1QTIA 3OIDA 1GPUA 1F17A 2B37A 3HCNA 3MBIA 4JSTA 3BD6A 3N0XA 1LRLA 3MJRA 4LOLA 3SQLA 4EA8A 5EI5A 2B30A 1K6EA 3QYFA 4UMVA 3UXMA 4C7OA 1X94A 2FSGA 3C15C 4OUDA 1E94E 1L0BA 5HYVA 4U7PB 4UMFA 1W73A 2MSEB 3JQPA 3LKBA 4L2IA 5FNVA 2XRFA 1LVGA 2QLBA 2DUJA 1H2EA 3C39A 3Q9UA 3DBHB 3OOSA 3F5MA 5FTWA 4IVPA 1R6DA 2H7YA 2AD1A 2KYRA 1U65A 2BGUA 2QU7A 2PEYA 3CNEA 2FP4B 3GIWA 2COUA 2Z4SA 4K2AA 1I7SB 3JAKA 5I48A 5JQGA 1I7PA 5CPFA 2Q1XA 2WLTA 4WY5A 4XQEA 5DP2A 3VO8A 4D0GA 3LL4A 1AQJA 1B23P 3MOIA 3ONEA 4GXQA 3TZHA 1RP1A 1ZOIA 2VPPA 3ZWXA 1D1PA 3ZU5A 4CM3A 2VHWA 4G1VA 1ND5A 5TS3A 5DOVA 2DRIA 4UMDA 1SXQA 1DQRA 2EATA 3OIFA 3EWNA 4PZ0A 1RPTA 1N2XA 1YR8A 3LQYA 4E4RA 2GBLA 2IL1A 3D3EA 4DB2A 3S40A 1IQ0A 1CNFA 1E18A 3HB7A 2RBKA 3M0EA 1J8VA 2BI4A 3WI7A 2BKEA 2ZETA 1DJLA 3HB5X 4MUAA 3A4VA 2HGSA 1YULA 2ENWA 4TM8A 2DT8A 4LDZA 4HEHA 2WIBA 3CEMA 2E5LB 1JHAA 2O8BB 1TTQB 4DIUA 2WF7A 1BVYF 4WK4B 2L17A 3SF8A 2YVLA 1YASA 2H4JA 3OQIB 1Y4AE 3TTTA 5D86A 4TUYB 4P5PA 1NZJA 3IOEA 3C8ZA 3CEPB 1T2VA 1PNOA 4XM2A 5BURA 4WBNB 2FWAA 2O06A 4QWMA 1QFZA 1E1RD 1WDLA 2ZRJA 4MYUA 5ALSA 1ISPA 3G2OA 4B3XA 2Q6LA 3T94A 4B87A 1CBUA 1RAGA 5CFZA 2DVMA 3WWDA 5TRTA 4OREX 4ZYYA 1IEQA 1V4NA 2C4KA 3O8OB 4D46A 4G0QA 1TVKB 1U2QA 3ZKWA 4IIJB 4L73A 2QXUA 4X5OA 4EWLA 2OCDA 2ZQYA 2QVBA 1YT5A 4DMRA 1PJ4A 4QVGA 2VEOA 3A4IA 1W59A 1AKEA 2DUMA 2BMDA 3T41A 1NG9A 3KSAC 4UE6A 2CDBA 2A5JA 2WTBA 3EGWA 3ICOA 4MI9A 3WWOA 3A04A 3SYRA 2XCSB 1R16A 3JTEA 1DKPA 1OIWA 3D8SA 1B76A 2IYYA 121PA 2P27A 2PBZA 2YWBA 2DOKA 2YY6A 3KB2A 5IK2A 4YAGA 5EJ4A 3R6DA 4MKXA 4JBWA 1UM9A 1SU8A 3NUZA 2ODEA 3TIVA 1COZA 3EXAA 1NR7A 4DNFA 1M7GA 3SE0A 1LW6E 3MRVA 4U4AA 1VMAA 5BNFA 3K5WA 3UM9A 5FBQB 2FWIA 2DR2A 4C2UA 2VK8A 3AI7A 3C4VA 3W5UA 1B93A 4EVRA 2WUVA 3PDJA 4C1NA 1AF4A 3HYRA 3DHEA 2DP4E 4KGDA 4M2LA 5AM0A 1C0LA 1OBVA 4YCLA 1OIXA 2EZUA 4NH4A 3GP8A 4OHXA 1Z4MA 5KX5B 3KU4A 1DX9A 2I1WA 4EF5A 2QDXA 2IEIA 4H0CA 4PX3A 1GFIA 1P5ZB 3DZDA 3RYHA 3V1KA 1KJIA 1DCFA 4NYMR 5FFMA 1OB5A 5I3CA 4UEJA 3ES9A 1BSVA 3QNWA 3IE0A 1T10A 4PTZA 3HJCA 3OT1B 4LW8A 2OL4A 3BMCA 1YQXA 3VPXA 3GPCA 4DHEA 1QIMA 1Z82A 2QRNA 1W0KA 2O3UA 3Q2OA 4LKOA 1TZCA 2O48X 1F3LA 5KREA 4PAMA 1J9GA 4B6SA 3U0VA 1UANA 3NQ41 3O4JA 5AJVB 4ZT7A 3UUWA 721PA 5KOHB 4LVUA 4K1XA 3JW8A 4KAAA 3A2KA 1LPSA 3QX8A 1AC5A 1RT9A 2O19A 4KC0A 2EBUA 4B79A 4JOBA 1ZH2A 1K8YB 1L4UA 3L5OA 2GJSA 3EWIA 3MFQA 3OJFA 1WRBA 3BXPA 3DPIA 2IF0A 3DT6A 4TGLA 2BR3A 4CM1A 4Q3AA 4Q82A 1NQOA 1QS0B 2C3UA 4BNMA 2J0VA 3U3OA 2JKZA 3GDFA 4W5QA 3LGSA 2WB2A 1F60A 4QYMA 4GYKA 4YI3A 5KB3A 1W2HA 4Q18A 1L4BA 1JEAA 1K7XB 1LK5A 2M6RA 4MRVA 4KDEA 5SYMA 5C5EA 1I3LA 2YW9A 1AXEA 1UJ2A 1KK3A 1TIKA 1VIVA 2ZI9A 3IT2A 4YRBA 2IVZA 3PTLA 3CINA 3L6EA 3RTGA 1R1DA 2PH5A 3GRFA 1TMKA 4I9NA 5B55A 4QSHA 1VA4A 1T25A 4GX0A 1KDZA 5B3KA 3BCSA 5E95A 2G4CA 3M4JA 4XOUA 5AVKA 4B76A 2H1CA 1BKDR 4EO9A 4CEHA 1KRXA 1P7WA 4A27A 1XPJA 3COYA 4YTEA 4NYIR 3KWFA 2X2EA 3FMFA 2ZSBA 1C7RA 1ST3A 4RY9A 4U8GA 3QPDA 5CA1F 4AULA 2D0IA 1UDBA 3IAS6 1K7SN 3M70A 4HS9A 3S2YA 3WR5A 4FOPA 1LDMA 4FT4A 4KLNA 2PIDA 4RD0A 1ESDA 2OR3A 1Q7TA 4PYKA 1Z0JA 2B82A 3GMTA 2DZDA 4UOQA 5FUMA 1BIFA 4WN3A 3TW8A 3SVTA 3A26A 3CUEF 1G3QA 5E9JA 4CKYA 3OPVA 5IT9A 5JQGF 3FZNA 4YMLA 1WZIA 5IFLA 4G23A 1K8QA 5IUNC 3CZRA 4B48A 3W06A 2EFGA 5IRCD 3M6IA 4FNAA 5SICE 1CY6A 2Q50A 4JT8A 4II3A 5DX0A 3VH1A 1EJBA 1FL9A 5C53B 1VSQA 3PNBA 1KY4A 3R7SA 2ZBFA 3MINA 2CMGA 1JZSA 2BZ1A 1IN6A 3KKLA 3D81A 3NKVA 4MPJA 1KOFA 4L57A 4RIFA 2FPMA 2O2ZA 4X44A 3RNLA 1ZCJA 3KR0A 4OAPA 5FR2A 3SZ3A 2O0KA 1UMCB 4P58A 1U2RA 3F78A 1HE1C 1RBMA 4DGQA 1X1CA 2C9YA 3KHKA 4QRHA 4Q9AA 3IH5A 3TR5A 4L5AA 1I9GA 1U8AA 2N42A 5DGIA 3TPCA 1HTTA 3DCNA 1PQWA 4YMUA 4N3BA 3LDUA 1WL8A 5FL3A 4YRPA 1BX0A 3F6YA 3SIWA 3ZWCA 1KK1A 1KZ4A 4XSGA 3W1VA 2C00A 5JJKA 3B6ZA 2AZDA 1E2EA 3AOGA 5CDFA 3UFXB 3KPUA 2QQGA 4FZ5A 1N0HA 1UPCA 3OZSA 1G8FA 4KG7A 3PDWA 4NWIA 1OX6A 4IKOA 1CUWA 4MWDA 4ZRNA 1J56A 2OILA 5J2UF 1ZD5A 3AHJA 1T6YA 1WXEA 1BFUA 2HRRA 3D64A 3N5CA 3PC2A 4X60A 1BS9A 3AKCA 3BHNA 4P7KA 3GAAA 1ZL2A 5IF9A 2OAGA 5AK0A 3FYHA 1Z4KA 2FP3A 2V74B 3MWEA 4N5NA 3VPFA 1G21A 2RGRA 3PX2A 1H0HA 4MIOA 3AR6A 1P5JA 3T9FA 4LNAA 4L8VA 5JV5A 3QA9A 4GQAA 3DDSA 4D4LA 3NAZA 4KMRA 2ZJ6A 2ZTVA 3NDBB 3PICA 5IAGA 4OI4A 3V7FA 1RXYA 4B7XA 2DY0A 2X58A 1XKTA 1NPYA 2FVYA 1J9ZA 1XX6A 3NOVA 4CMJA 2EW8A 1HURA 1DEOA 1P0PA 2JFQA 3O26A 4K88A 1O87A 5JSKA 4JXXA 2Z57A 2HNKA 1E3MA 2RCYA 3LPMA 4OJYA 3SIXA 4UW9A 4ZHQB 5HVNA 3AVTA 1XTPA 4L1KA 5EERA 1X13A 3HKEA 1FQKA 3GGPA 4BYMA 2OV6A 1XXHB 4TRJA 4NE2A 5A0TA 3NP7A 1W5SA 5FD8A 1OH8A 3OWHA 4QICA 3HZHA 4NQZA 1GEEA 1SVOA 3T0GA 4KLZA 2ZBEA 4XD2A 2IOFA 4IXMA 1IBMB 2GA9A 4QJ3A 2HBYA 1X9GA 5CA1B 3HKBA 1RHQA 5EHQA 1YL6A 5B2FA 4I8XA 4HZUA 3A7EA 3DBIA 3W6NA 5DGXA 1BDIA 1HWYA 4UHEA 3SM9A 1II9A 1Z0FA 2WG2A 1SFRA 5C3MA 2LR0A 3SX0A 1R3DA 3QU4A 1RQRA 5KNDA 3KQOA 5IG2A 2PD3A 2ZBRA 3OI7A 3GLGE 1GYRA 4DR1B 2CDNA 3WRXC 5CFLA 2PQ2A 1HPLA 1GZ7A 2HN9A 3HS3A 4Y6PA 3U9SA 1T4CA 2X3FA 3MT9A 3WIUA 5DI3A 2YV5A 3OEEA 4JLDA 4U7DA 1MT0A 1KDRA 1I36A 1FVOA 1L5SA 1PDOA 1R0SA 4HNUA 4JQZA 1M0TA 2CHFA 2PX6A 5EJ5A 5JH7B 4CT0A 2HBZA 1Z3CA 2P5TB 2D1TA 2R4UA 3BGOS 3FKSD 3G2IA 4JLBA 3V8NA 1QFYA 1KYWA 2XCLA 4WX2B 5L7YA 2EIXA 4LMRA 5K20A 5JSQA 1FXSA 1MHPA 4HV4A 8MHTA 3IT3A 3ZWPA 1G6OA 1XP8A 3V33A 1E61A 1MTZA 1Z28A 2FUG1 2GHIA 1IM2A 3FMIA 4Q3EA 5BMVB 1E1QA 3WLIA 5I7SA 3C98A 3QHQA 4G01B 3RRMA 2GYYA 4LF4B 4LXXA 4RPJA 2YWGA 2X1MA 2VYFA 4WOBA 4QYSA 4N12A 3TAHA 3WL4A 3RU2A 1XEFA 2FF5A 2IXTA 1VB5A 2FEKA 5CGQB 1LK7A 3CRMA 3H5WA 2NO9A 1RAIA 1SUFA 1XCJA 2GOYA 4BPRA 3TZBA 1YBHA 3K5IA 5HIKA 1DMSA 5HQJA 4JITA 2DUWA 1H1TA 2XHEA 3V2IA 3ROZA 4E1AA 1V6SA 2EYQA 1OPRA 4DLLA 3DZIA 1T0BA 5JWRA 2C9MA 3KUXA 4MS4B 4N0EA 4PZYA 4Q3DA 1KI4A 4U3JB 3SLKA 4ZYLA 1RZRD 4UM8B 4BU1A 4TMFA 1S7CA 1JS1X 4EKEA 4O4LB 4BFWA 1IWPB 1X7YB 2AC4A 2JK0A 2X6QA 3FPHA 4MIKA 5KX5A 3V4SA 4WLUA 1T3TA 1OH5A 1Y5RA 1RHMA 1UKZA 3AKDA 2PXCA 1ZM3A 1UM8A 2NU7A 1MIOA 1N2CB 2OG2A 4HB3A 3BG5A 4NEGA 4RHTA 3WGJA 1KJJA 3EWAA 5CBPB 2GZRA 2QJRA 2Z3VA 3BIJA 3BD7A 3R6GA 4U7TB 3VKWA 2O8FA 5TS2A 2QMUA 2AN1A 1H93A 3RVDA 4XVRA 3C24A 1AS3A 3TGLA 3ZJYA 3U7JA 1IOLA 2NT3A 1KR2A 3CLHA 2X8JB 2WD8A 5AM2A 3DMFA 2W8BA 4MRSA 1UFOA 4KYIB 2IX3A 1F7UA 1M1YB 1ISRA 3E3LA 3SP1A 1ZA2A 2AEJA 2PH1A 2J46A 1QHFA 4MUMA 4NCIA 1T8YA 1HRDA 2JI8A 1ZAKA 2H17A 3EQ6A 3QOYA 1IJBA 3IAUA 4YP7A 5I7OA 5BYBA 2GBCA 1YWGO 1L4KA 5LP1A 1NXQA 1YVDA 4LC9A 3QPUA 2Q27A 4JLUA 1H2YA 1R64A 1C9MA 1RU3A 3CN9A 3G6KA 3ZLVA 1QB7A 2A1TR 4JB2A 1YE8A 1S3FA 2V3WA 1IY1A 3HSSA 2GKSA 2ES4A 4IIJF 4CR6A 3RJMA 3FPBA 1HZZA 4JKYA 2CNOA 4V0MA 3FCXA 4LV5B 1ZCZA 2R8RA 1XLVA 1VSBA 3H11A 4LJ5A 3B1YA 1JBKA 1NVTA 3S7ZA 3IQGX 4XD7A 4ZODA 3X1MA 2I99A 1R6AA 3BICA 4OB6A 1HDYA 1VE7A 4GPZA 5B2EA 1L1RA 4GBED 1CRZA 3VNSA 4B43A 4HXGA 3AF2A 4OF4A 3FB4A 2PZLA 3LLUA 4OK5A 5TV2A 3OC0A 2HSJA 2WHPB 1QYWA 5KJ6A 1KDPA 4YECA 2XMDA 2HF2A 1LPPA 3AVOA 2VF7A 3CKYA 3OCVA 3CPJB 4M0DA 4BE4A 3A4LA 3DBOB 4B09A 3NFYA 5JT1A 1U6KA 4HGRA 4AUMA 1PJ2A 4LJYA 2CBZA 3LUPA 4R40A 1V8BA 4D3FA 1RZVA 2QTCA 4P82A 2ASEA 3K9WA 4NJMB 1O5IA 2IXEA 1VIDA 3SXUB 1G5FA 2J6HA 5KI6A 1C2YA 2YJTD 1G7TA 2Z8ZA 3L46A 2JK1A 2WWXA 4KHPB 2H2GA 1ZM9A 4D8XA 5EYPA 1YFKA 1M2NA 2WMDA 3SC2B 4C5AA 1MW8X 1THZA 2X41A 3REQA 2UZ4A 1A0OA 1QO0A 4DG5A 1XTSA 2C0PA 3GD5A 3OJOA 4NPCA 1ZSVA 3HU2A 1GNRA 2PCJA 2H4YA 1Y3DE 3BDVA 1ZONA 3UK6A 1MT3A 1R18A 3H3XA 2R62A 3OFVA 4B6QA 1XNQB 3BVPA 3P27A 2CC2A 3IB6A 1B00A 3IAEA 3OJLA 2PSDA 4Z0HO 5FULA 4KDFA 5BWCA 3KAQA 2R44A 1JTEA 2V7QD 2GETA 2QQ0A 4MIYA 4NJMA 3K6SA 1HFEL 4B7ZA 3WQBA 2WIFA 1Q7RA 2PT9A 2I3GA 2YBEA 2VHJA 4BX2A 2E7ZA 4RACA 4JC0A 4C2BA 1JDTA 3R7WB 2WT4A 5EE9A 3BC1A 1W75A 1ZJ5A 1IZZA 1Y8RB 1KC1A 1OXUA 4TKVA 2P4HX 4FTWA 4B85A 2HSDA 3P71T 3W5AA 2PS0A 1JQAA 2XAUA 3QEJA 4DT1A 1GFSA 2GCOA 3EW9A 1FJ2A 5DCWA 4GOJA 4TL6A 1SCIA 4C6TB 1V7ZA 3KJFA 1PDVA 1HDCA 3VPBA 5ICMA 3H0KA 1GZDA 2Y1FA 3F67A 4KQ2A 1MNAA 2G8LA 1XL1A 3OHMA 4LZNA 5FPPA 2XBUA 4HNSA 1MABB 1LBIA 4HSGA 2DUNA 3TE6A 3UA3A 3IA2A 1UXKA 4JEUA 4ZZ0A 3W7BA 3QBJA 1ABEA 3BMOA 3K9CA 2YYSA 1EFPA 4CTJA 4F1WA 5I4IA 2UVPB 4PWZA 3T38A 3IDZA 4I50A 1YKFA 2FZ4A 1J99A 1AE1A 3T4EA 4DLWA 5BNZA 2EJCA 4UATA 4GM4A 5HF9A 4ALIA 2H5IA 2I1QA 2P3QA 1BYIA 4OYLA 1N0UA 4WLOA 1GQ2A 1OHHA 2J0SA 5IT0A 4IXNA 4KBYA 2VK2A 1K8XB 2XGMA 1VHQA 2RHWA 1DBWA 2BM8A 3U9LA 5EHXA 1CKEA 3W8FA 3EXIA 2OMEA 3OT1A 3ZXIA 1P1BA 2X13A 5AHOA 1BMFA 3VFDA 4CLHA 5C8ZA 1H2RS 4NVRA 4BV3A 1QHXA 5J63A 1I01A 1JKMA 3HCFA 4QUKA 2X9LA 5ITWA 2J7KA 3UJ9A 1U0RA 3E48A 1E3LA 3PPXA 4QOSA 3GEMA 5EMMA 4KWCA 2H7CA 2V54A 1H2WA 3R7NA 4DRXB 4P4UA 4YUZA 3WWZA 1PV4A 3WK9A 4GL2A 2Q3HA 4UHDA 4XI9A 1MX1A 2ZXUA 1YO6A 2CY0A 2P4QA 3KQTA 1Y6ZA 4ISCA 3FOBA 4B3CA 2H51A 3KHUA 2KJQA 2PLNA 1SU4A 2OLEA 3EF1A 2QE6A 2NO7A 3WTCA 9ABPA 2YMQA 4FOOA 3GLIA 3FNEA 4GSLA 1X0VA 2VPQA 3FNIA 3I52A 4QU9A 3V8RA 3QPBA 3QVOA 2VPYA 4FKMA 2KWIA 1P72A 1U63A 4EG7A 4DV0B 5KNCA 3QVKA 3ZZ1A 3HCEA 1M34B 1A50B 2PUBA 2HK9A 3U4GA 3R5SA 1N1GA 2GRJA 3VAZA 3IP6A 1BNCA 2AI2A 1DLIA 4YRRA 1NA5A 1D2NA 4O02B 1X1DA 4JCCA 4NOLA 2FZWA 1RXCA 5CD1A 3YASA 5CLHA 1C1HA 3PL1A 3HU5A 1DKUA 1Z8DA 3G9ZA 5G02A 3R7FA 4MYHA 3IVXA 4F6LA 4I1PA 1JB9A 4QU0A 2R751 1F20A 1Z6QA 4GXNA 1B1CA 2D7CA 3DEYX 4WESA 3RJ5A 1JR6A 5B1SA 3KXKA 3E9ZA 1T2EA 1DKMA 1H4VB 4IICA 5GM1A 2JI7A 4N0MA 4IIJA 3AR3A 4YMVA 2P11A 4BVFA 3KPWA 1BGWA 4FMCB 5KWVA 4BC0A 5CD9A 4FM9A 3GGGA 1RZ3A 1X7WB 2AVDA 4ICIA 5HKKD 2QMZA 4YPVA 3DYIA 4TWBA 2IOQA 2Z5GA 1G5TA 4ZMRA 2D2VA 2OBBA 3C1TA 1TRKA 2WJ3A 3AL3A 1GOTA 5HW0A 1KK0A 3JVIA 3OU7A 2WYUA 1RLMA 3FM9A 3IIMA 1QUFA 4AKTA 3HP7A 3SBOA 3ZDBA 4ZJZA 4GZ3A 3VR2D 1YJ8A 3MRTA 2JGIA 2YJ4A 3C1UA 4C6HA 3PK0A 3K0AA 1UDXA 2WWHA 5EKDA 5KVCA 1ZVVA 4U5XA 1E1NA 3ZS8A 1L5QA 2GVZC 3IDOA 4P86A 1DCMA 5FBRB 1JTVA 1Y8ZA 2ZGVA 5AVQA 2J41A 5AW0A 3HUDA 3U17A 5LBIA 1YVRA 2Y1EA 3MTQA 4LOAA 1UOPA 3MMNA 1DAKA 1XA0A 1RYNA 1JJ7A 1Q92A 2DQKA 2PO7A 2HLHA 3H5AA 3LW8A 1TRHA 3IBGA 5LVAA 1EHYA 2XA2A 3KBBA 3TK1A 3HB1A 4JUBA 2OYSA 4C1BA 3PR3A 4I1UA 1F4VA 2ZRGA 1RE1A 3EMKA 1T6ZA 1EWVA 1CUJA 1YR3A 2BJWA 5D5HA 4DY4A 1JHXA 2JCVA 2IT1A 3J7AC 1U3UA 2JIZD 4M6WA 3WB1A 2GBLC 2RC6A 4LRYA 3BXHA 1OXBB 4DUZB 4GP9A 4YAIA 3G2PA 1KJ9A 3PWKA 1P9WA 4QOHA 3K72B 2CSUA 5D5PA 1J7JA 2H4HA 3I5YA 5ALUA 1TDJA 5CYGA 4JVOA 4Q9JA 1N92A 4OQMA 1B3BA 4RHUA 3GLGB 1OFVA 2AJLI 2QR5A 5DW3A 4Q21A 3DZCA 3IAAA 3RLFA 5JS2A 3EEOA 3ZGZA 3C3JA 2C8JA 5CT5A 3VC7A 3AWDA 2QIOA 3WIEA 4MKHA 1J25A 4UE3S 1T9HA 4X6LA 1VL8A 5EWLB 4K9SA 3RTCA 1J2TA 3R40A 4IHAA 4YWHA 4B5LA 4CMBA 1UIMA 1RWWA 4ERNA 2JJ2D 4TLLB 1JLKA 3ER9A 4GOKA 3S44A 1RLJA 1N1DA 4KRFA 2O23A 4UNSA 3FVQA 5JWHA 3TJZA 3HSKA 621PA 2FH5B 3TTWA 3U2QA 2FR0A 3NHUA 2HPZA 5JTUA 2BM9A 1GPYA 4QUDA 3BH6A 4PANA 1QB8A 5GONB 1VJCA 3CVJA 1L5NA 3U26A 3AESA 3W3AH 1XEWY 3WMEA 4E15A 1T5OA 4ER7A 4OSPA 1TQ2A 1UC8A 3MCTA 2AR7A 3AEUA 4BNIA 5I7VA 3KAKA 3IQWA 3U1VA 3KU1A 1R15A 4OFXA 2ZCJA 1EBUA 3OWXA 4N49A 3PZBA 4IDEA 4LTNA 5DI9A 4NU8X 5ER9A 4ZAVA 2ARKA 1Z8FA 3GCGA 4C14A 2JHFA 3RS8A 4S3MA 1UJCA 2PMWB 2OECA 4UZSA 4KNYA 1L4NA 1D3AA 1KYTA 2B92A 2IBSA 4EJMA 4C2AA 5JXIA 4QVIA 1EUDA 4WZZA 3WMRA 1Z7GA 4DOMA 3X2FA 3ZDQA 2B3TA 5A9SA 2A9JA 3EC1A 4KSBA 2JFBA 1NP7A 4ETIA 3FYCA 1SZDA 3N8NA 1BQ3A 2C78A 2CT8A 4HNTA 4AD8A 1M2WA 2W22A 3BK2A 1UMDA 4X8OA 5JADA 1YIAA 5JO0A 3J81A 5DTIA 3SEZA 4IDOA 2BR5A 2XD4A 3WBKA 4A8JC 3CUTA 5BW5A 2R1UA 1AX9A 2KW5A 3A1CA 4FBGA 1EE2A 1KQPA 4LV8B 1WTCA 1IOZA 1YQDA 4RKQA 4V0SA 1GV1A 1HLFA 5DMHA 5E7JA 1L7DA 1L7RA 1L4GA 4KWHA 1WXDA 4S1PA 5CT8A 1IM8A 3N3AC 5J9FA 5IS2A 4YCAA 4Z8YA 4ZTUB 2GVDC 2XE6A 4QYXA 4TMTA 2ZB4A 3EZ6A 221PA 2D7DA 3LOQA 2GAIA 3GFQA 3IQHX 4FYVA 4KAFA 3CTPA 2JJ1A 4J0DA 4PSDA 4W8GA 4DCGA 4ZT6A 1SCUA 2AN4A 1LI5A 1ZR2A 3E7FA 4H6PA 1CW2B 1NYQA 4NBKA 4O29A 1I2DA 1AQIA 2D7JA 2J9GA 2JVJA 2O50A 5GP1A 3SC2A 3A6JA 5A6VA 1EQ2A 4FQ8A 1IB6A 1N6KA 1RRMA 2HSGA 4UHHA 2WJ6A 5ALRA 4H1HA 4HYQA 2NV2B 4I4NA 2C84A 3QK7A 2QRZA 4P8RA 5JCZA 2Q3CA 2X1VA 4U39A 1WZCA 3SXUA 4WA7A 4WXHA 4F8JA 1P61B 3RVLA 3JSAA 3ZDYB 2VP4A 1II8B 5LYJF 1UBJS 4R9NA 1YI1A 1YRLA 2Q6IA 3DFKA 3SVZA 4DPLA 5LJLA 5CDYA 4KH0A 1U7XA 2VXBA 2FSVA 4NFLA 1B6TA 1F3OA 1FMLA 3HJTA 2WYOA 2QX9A 4A03A 4EABA 4ZZIA 1GGFA 1MO5A 2Q4DA 5JH7F 3Q3GE 4JC5A 3M4YA 2BI7A 3DKVA 1YL5A 1IXKA 2NNLD 1E5XA 5HA5A 2XMSA 3S70A 4URFA 2CMDA 3CS3A 1T1GA 4L9WA 4RVHA 4XKJA 3D3NA 1TT5A 5DBIA 4FQ5A 1P80A 5E9WA 4Y2XA 3NYQA 1EEXB 3F9RA 3KR1A 1XZAA 3K09C 4Y9SA 1GRRA 1RADA 1Z63A 1UXOA 2O57A 2H1HA 3TIIA 3C3XA 1EX6A 3P7MA 1CQWA 4WN9A 4RTOA 3FHTA 5CIQA 4NJEA 6PFKA 5K0TA 1V96A 2IHVA 1ORTA 4JLKA 5LPNA 3HCAA 2NUBA 4GWLA 4R2XA 3K4HA 4IR7A 2Q8NA 4Q03A 5EZYB 2J5QA 4OQ4A 4TTRA 2RHMA 1L5MA 3EH1A 3HKCA 2ZS7A 2WYVA 4CTNA 3WWEA 1YIDA 1ZJ6A 3L4BC 1KYQA 1JHVA 3H2BA 3V1UA 1CQZA 2PA3A 3OZAA 1THTA 3DOOA 3A9WA 1YQQA 4JHLA 5ER6A 4E7OA 2R6AA 1DRWA 1GZVA 3CVYA 1R74A 2DKOA 1NSFA 2VI5A 3AYXB 3G5LA 3LT2A 4EG5A 1K97A 4IO1A 1SKQA 3HCOA 2GX6A 3D3WB 2QU8A 3P9KA 2GXQA 5ALKA 4N48A 3FBGA 2XYHA 3I62A 3M1LA 2E18A 2AFHE 1H23A 2FFAA 1T43A 1UK7A 1JQDA 4GBJA 1X77A 4MVJP 3R9IA 2MU1A 1ETUA 2WR8A 4CKZA 1Y6RA 2GESA 4FSHA 4FGJA 5F4ZA 5DXAA 4BAGA 3BK7A 4MYRA 1FFCA 1UBMS 1Q7EA 3GOQA 3GROA 3WP1B 3NPMA 1M76A 3G7UA 4BATA 3EOZA 2YCBA 4YCDA 5L3SB 4WHMA 1BGXT 2CF5A 1W88A 1Y1TA 2R7AA 4P6VF 3ORHA 1V3TA 2RK3A 3R0VA 4GE3A 5HG0A 3HRHA 1FFHA 2BISA 3B36A 1O6BA 2GN4A 2YN4A 3MWKA 4DNQA 4JHXA 1ZN8A 4HMPA 4IAOA 5MGBA 4W7HA 1U80A 3O2NA 2DXIA 4CLRA 4KGZA 1RAFA 2AZ4A 1P7YA 2HF8A 5H3LA 3ZX4A 3M49A 5I8WA 2PVSA 3S2EA 3WX0A 2PXAA 3A7DA 4JU9A 1OWNA 2ZRLA 3M4ZA 1WULS 2P77A 3A58B 3OX1A 1RYYA 3C8UA 4UBNA 4BWGA 3RARA 2UYHA 1G20A 1AS2A 1U5AA 3AF5A 4RKRA 4BCCA 2ZAYA 4RS3A 2ZITA 2H7VA 4QKQA 4OB7A 4I6EA 3T1HB 1RWMA 1JH9A 2BKLA 1CVRA 2CZGA 1KPIA 1JPVA 5LD2C 2OO5A 2V45A 2VJNA 3AVPA 4EG6A 3SEAA 2AKAB 2BTEA 4ARBA 3LX8A 3Q88A 3ZE7A 3Q7PA 3IB3A 3FPGA 3WRWA 3HNOA 2NQTA 1VDZA 2C7GA 5AKKA 4AKHA 2AHRA 4W1QA 2J08A 1YDHA 4GLBA 1KP2A 4E5VA 2E9SA 2AUTA 2E4VA 1Z37A 2IHKA 2WUDA 1RQXA 2A86A 3GJZA 2H29A 2JIMA 3RYFA 2BUAA 4JBGA 4Q9HA 3DYBA 3EG9B 4IV5A 4RIEA 4RY8A 2VIIA 4WUVA 3KZNA 4CR8A 5JAOA 5K05A 1ABBA 1HFJA 4NFHA 5JRZA 4IIUA 1KH3A 4IJWA 3E7PA 1I0ZA 2WUFA 2EJVA 1JDPA 1C7EA 2DQ4A 2I4IA 2OPBA 2M2IA 3F5FA 4NYJR 3A1VA 4D0NA 2XGJA 2WTMA 1UBRS 1L5HB 3KNZA 3V3TA 1MDBA 4NBSA 5EZYF 1E7MA 3C5CA 2WU4A 3VU9B 1LSOA 3U3KA 5C2JB 4R69A 1RPZA 1GA4A 3IESA 1QKIA 1OTYA 4UVEA 1GTG1 5LQKA 1CY2A 16PKA 2CFCA 1PTKA 1SOUA 3RUFA 4UBKA 4IDCA 4XJTA 1UAAA 3PI7A 4H6VA 1GTJ1 1FTNA 3EZNA 4D99A 3HR7A 4XASA 3E35A 4J16C 1P5RA 4MUYA 3P52A 4K05A 2WIAA 3UGJA 5AUPB 1Z8NA 2UZIR 2XKJE 3WGZA 4Z49A 1G8AA 2RB5A 3ZDZB 5IAJA 5KUTA 1JAHA 5CYFA 5BN3A 1DQPA 3L49A 3LX5A 1N7JA 3D4LA 4EG4A 4Y1GA 4GYJA 1NYTA 2WKQA 2ZDQA 2IDJA 3MYRA 4DY6A 1FLDA 1RWOA 5HIMA 5J4YA 3BZBA 3DE1X 4RMJA 5EJ9A 3KVOA 3RVJA 2JLSA 1N77A 3D4BA 1NN1A 2CNWA 1TGVA 1WXXA 3AJ8A 1BKSB 3HP1A 4YP5A 5E7QA 3VBCA 3WYEA 1NJ2A 4MR9B 4WXEA 2G08A 3DCYA 3PFGA 3PIIA 1I4LD 4UHBA 1R4NB 1R0WA 3L82B 5LYYA 1O4VA 1DEAA 1OV6A 5GZ1A 3D2BA 1PJ8A 2FN8A 3KQLA 1PJ3A 2QTWB 4LDJA 2K4MA 4ZAXA 2XOXA 1QR6A 3GF4A 1EXMA 2EGHA 4FN5A 1I1HA 2V5UA 3PDHA 4I5IA 3ZGLA 5IKEA 3DPUA 1J09A 5D8DA 4FDVA 1WIWA 4BASA 3I23A 3GUYA 4D79A 3R41A 3B70A 5I47A 3F9CA 4WECA 4FX2A 2CB0A 2EARA 3FFAA 2QUHA 5CR9A 1XCPA 1GTL1 3DEFA 2P9QA 2PUAA 4A3SA 2GAOA 1PJAA 3HL4A 3KUCA 4GBGA 1A77A 4JEHA 4LQDA 3M6VA 4HH3C 4OVKA 4EW3A 5C37A 4GGPA 4OQXA 3OTOB 2WQ6A 2NQ8A 3MJEA 4I8IA 2HMVA 4RD2A 4RD4A 4RVUA 1I13A 2YMLA 3C85A 2WSLA 2ZYRA 4HRAA 3EVDA 4WI1A 3WHKA 1Z7YA 1OI4A 3WL8A 3HBAA 1CG6A 2KBFA 1KZ9A 4LE2A 4GKKB 4IV8A 1SCKA 3I04A 1RYZA 4IQ0A 3WGYA 3FTNA 1R6XA 1UP7A 4DM3A 2Z9BA 4DUGA 1EZ1A 2B61A 1I7NA 2YX1A 3HJGA 3PNPA 2PKCA 4UEQA 4XX0B 1YA4A 2AOUA 2NZUG 3D1VA 3INGA 4JI6B 4EPXA 5K0ZA 1FTYA 1IK6A 1PGJA 1WVGA 1HRKA 2VP5A 2I4LA 4G24A 3KWLA 2O14A 4MW7A 1TD9A 3NP9A 1OA1A 4Z86A 5ESXA 3WLLA 3RS9A 4DBLC 4MW1A 4D9HA 4E5SA 5CA0F 5LZ4A 3MK31 3EA5A 1N2JA 3E3OA 5K51A 1T6XA 4DQVA 5KO2A 3UMJA 4PPYA 3HXQA 1HQKA 1PQUA 3HLYA 4IGFA 3TB4A 2I6XA 4NV0A 2OLJA 4OX9B 2FK8A 1MC4A 1UM9B 4WOCA 2PUDA 2IRWA 2IYXA 4EI9A 4GPAA 4JGBA 3Q2IA 1XZHA 5A9SB 4JLJA 5T8KC 1FP6A 1P4SA 4UDNA 4F9TA 3A0UA 3THYB 2I4NA 2Y93A 3ZH9B 4B6JA 1R5OA 3LQFA 4HLDA 3KVNA 5B7NA 4HB2A 1PV1A 2NO0A 4IX9A 1OAKA 1WEHA 3WZ2A 2AQIA 5AXBA 1MVLA 4ZRMA 3R23A 2RGBA 2H5JA 5E6UB 5A5VA 4OCZA 1AGXA 2IXBA 2FA9A 4P2BA 4K0KB 3EUWA 4OI2A 5M3BA 1Z22A 3QVMA 5AJYA 4YX9A 6LDHA 5KYWA 4CDRA 3NASA 3SVLA 2KLBA 1XNRB 4R7TA 1Z88A 1UOEA 3NC1C 5AVSA 4WK0B 4EI8A 4XR9A 3N2KB 2NXNA 2XODA 2Z5FA 4RM2A 5AJUA 3ZGNA 3L18A 3R3ZA 5C5IA 3LUJA 4MUGA 5AI6A 5CEEA 3GU3A 3ZEAA 4MB2A 1C9EA 3CX3A 1GCOA 1W96A 1YVUA 2XGGA 4YAWA 4F4FA 4QUGA 1A5ZA 4BRUA 3OKCA 3ECCA 4P7FA 5FDFA 3ASVA 3FLBA 5G1PA 5IM4F 1RD4A 1JX6A 1LX7A 2GEKA 2VNAA 2VP2A 3HVKA 1QZUA 3LS2A 2DFTA 1NJ1A 1WUHS 3H5LA 3NTVA 4GPEA 4MAMA 4MYDA 4EG3A 2YOGA 1E2HA 3I58A 3UWPA 4YXWD 1XTVA 5HS6A 5CG1A 1RKQA 3TTXA 3E5RA 3NHYA 1BJKA 4UULA 3C48A 4M1KA 2DWCA 1SBCA 2XT6A 3NTQA 3D6JA 4QDKA 3Q87B 1PW7A 3V6MA 1G6KA 1M1YA 2EKBA 1QU3A 4MZXA 4O2AF 4ZEWA 4B35A 4IH4A 3I64A 4CUJA 1Q22A 1C7JA 3HCWA 1YTLA 3E5HA 5DI3B 1YZTA 5DNYB 1WTAA 1KMHA 2VJMA 1E5VA 2G9VA 2ONCA 1M6HA 2P9TA 5K0FA 4C0WA 1J0BA 2Z58A 3CMMA 4Y6QA 4HNAB 4QRDA 4MPPA 3ITKA 2FNAA 4D41A 1M5TA 2YMPA 3RTDA 1E64A 3AI3A 3EMDA 3L93A 4KB5A 4QUHA 3SJ7A 4DAEA 4ESHA 4C0QC 4D8TA 2R7NA 5CLQA 3VR3D 3THXA 5DSXA 2GJ4A 1L9KA 3GRVA 4MV3A 5KU1A 2HUNA 2C9ZA 5EFZA 4O1HA 3WDSA 3QY0A 4J4HA 3OZEA 4N9QA 3BN3A 2G9UA 2QRPA 4Z4FA 5KX5F 4QIHA 1V35A 4I5EA 1KEEB 3ITEA 1B14A 3M6UA 3H87A 4LHVA 5KINB 3LA6A 4FOSA 3FSEA 3D4PA 4MMYB 2EQ5A 4V0QA 1ISSA 1K63A 3NATA 4PZPA 3GC6A 5KMGA 1PK7A 3ND5A 2EKDA 2GEJA 1H2AS 2QP4A 3INYA 1VJTA 1VPDA 4D1YA 4OHYA 1JZTA 2DAPA 3EASA 2VF2A 3T54A 3ROPA 1JHYA 4QU8A 2AF4C 4UPDA 5G1NA 4EY6A 3STYA 1UP6A 4EY5A 2HKIA 3E22B 2QYSA 3L4EA 4NY1A 3HY6A 4M7RA 5DBGA 5I01A 1XZQA 1QHEA 2CLSA 1SBHA 4DA6A 3GY0A 2DQSA 1K1EA 5EWJA 1AMNA 1LV8A 2BHSA 1B2RA 4CW7A 4LJLA 2EZTA 5KTRA 1O5OA 4CIXA 3GX1A 4E5MA 3IRUA 2WSIA 3U3ZA 1Q2XA 2O3SA 2WM3A 3MCZA 3RGGA 2OFXA 2X4LA 2AJ8A 2SNIE 3BHIA 4H27A 2IEAA 3SMQA 1H3NA 2QJTA 4KAJA 2VDNB 2G40A 3FBWA 3D1LA 5K03A 2X5JO 4BWVA 4FE3A 1H3FA 1U7OA 5EINA 3DCJA 2A67A 3ME5A 4RJJA 5T64A 2A9RA 3GNLA 5E7IA 8ABPA 4BV9A 5CB6A 4G1CA 4PN3A 4TYWA 2YR0A 2PO5A 1QFXA 3GGCA 4RDIA 5HGXA 3D3QA 4FQ7A 4YGYA 2DHRA 3TEMA 4RY2A 2JIBA 1D04A 1L9XA 3M8KA 5AW2A 3A1FA 3REGA 4YREA 3D5QA 4KO2S 3N2NA 4BBAA 5KYWB 2XQJA 2IPAB 4BRZA 4CIBA 1Z6ZA 1V26A 3KJEA 3KQHA 3P9QA 3FPFA 3URKA 1D6JA 1NUQA 3L3BA 1UAGA 2EVWX 1K08A 5AVRA 1TAHA 3P0EA 3CSUA 2FETA 4ZCMA 3G0DA 3H1GA 4M0CA 1N25A 4MLCA 1GUYA 4EF4A 1E9EA 2X2FA 1KO1A 3EQ9A 1H4QA 4X20B 5BW4A 2WJZB 2C31A 4QEZA 3A8TA 2ONYA 4URUR 2IOHA 3ZNPA 4C0AC 4J2TA 3EPKA 2JF0A 4RY0A 3MUFA 2ERXA 4U63A 1OX5A 1W36C 1KAMA 2RGUA 1AA9A 3FFXA 4LPSA 3PEEA 4JXZA 3LP5A 1U9CA 1E66A 1KI9A 3DMYA 3GVIA 4PWYA 5ALEA 3ENQA 2W0SA 3O21A 2AYXA 1P4RA 2UXBB 4W8HA 4BLWA 1EH5A 3CPHA 3IE2A 3JALA 3JQAB 4BP1A 1YONA 4BGEA 4CGZA 2R6FA 1E59A 3C4JA 1WOYA 2WRZA 4JT4A 3JD1A 3CVXA 1H0RA 3AVUA 1EGVB 3EVGA 4C07A 3ZKWB 5HQTA 3AHDA 1JKFA 4OGFA 1D7AA 1K3UB 1RMYA 2G63A 2ZRAA 5GONF 3PE4A 1XCBA 1OXSC 2HRDA 3KV1A 4J0QA 5AR1A 2I7TA 2NZVG 4U1RA 3BSFA 3OLZA 4ZAYA 1NVVQ 2BHNA 2GEFA 4MVJG 4DQKA 4JC8A 3DZKA 3E6AA 3H97A 4OFBA 3T7TA 4AXBA 1C4WA 3D2AA 4UVDA 3G17A 4Q34A 2Z30A 5MGNA 1HGXA 3T99A 5E9AA 3A2LA 5B7GA 4P80A 3LP6A 2JIZA 1IHYA 4M36A 3AK4A 3CB2A 1NLUA 2Y1XA 3KM0A 3Q6IA 2I1LA 3SS9X 3NTUA 4K9QA 3STWA 1UBGA 4DDKA 1AKQA 4KOAA 4BWFB 1RXUA 1Y4SA 4PZUA 1JPNA 5CAEA 1CUHA 2C8LA 2Y71A 1UJ6A 2D8MA 3MINB 3QEMA 4N54A 1X2BA 3RVQA 2AS0A 3F71A 5FWYB 5GGXA 1AUVA 1W35A 1YXMA 1OBFO 3R0JA 2Y9MB 3C6MA 4H3SA 3VYSB 5KC8A 3GPLA 2GH1A 5TGZA 3VVLA 4AP9A 3G8DA 1KY5A 4MR9A 5BQ5A 2HQOA 1PE0A 2BFAA 1FX0A 1EG7A 5B58T 2WWTA 4AF7A 4FEYA 3IUPA 4D02A 3NLLA 3VYWA 1S3IA 3IR5A 5FUYA 2JH3A 4Q4JA 5IABA 2FDCA 3B6IA 2HB6A 1G5PA 2KMLA 2QX8A 4DUYB 1V39A 1O0BA 5K99A 1PLLA 1PR4A 1UT5A 2Q1SA 4RA6B 2BMFA 3A9SA 4YS6A 5G4KB 1PNRA 5F1OA 4UCWA 4GNKA 5TDHA 4OHWA 3UOGA 3GJ4A 3I09A 4FSDA 1YQWA 5HCIA 1D4ZA 4BJ3A 2C7OA 2ZR0A 1LDNA 1EDBA 2EG9A 3HPQA 2FB9A 2ZXFA 4K40A 3RFXA 4XIFA 1VL6A 3NHSA 4TYMA 2I7VA 4Q1EA 4XRGA 4II7A 1LLDA 4JBNA 2CCGA 3Q7RA 5HKOA 3CUSA 2HNBA 1FQJA 2CYCA 1Y6QA 1KWKA 3Q8KA 4PQGA 3T06B 1A9OA 5JCJA 4WEOA 6Q21A 1PX0A 4PQRA 1WHSA 4F12A 2CUTA 4W9RA 3H0EA 4LIPD 2EW1A 4JP2A 4W6ZA 1GFZA 2GPYA 1CUCA 2ZIEA 3HXOA 3T9DA 1V43A 4DV7B 1DO0A 1E1QD 1ZVKA 2VH2A 3CLUC 3KXDA 1KAHA 4BX8A 2GILA 4HAOA 5C8YB 2ZWIA 3MD0A 3BXGA 3ONFA 4CKCA 3ZCQA 3AF6A 2OGTA 3ET4A 2ID7A 2PWBA 4NZ9A 4MO9A 2VSXA 3TI9A 1EWQA 1UWLA 4RADA 4AUEA 3TB6A 2H0QA 3DLPX 3N3BC 4JXKA 2FRXA 4OHFA 2Z95A 1MQ9A 3I2YX 1JKXA 1PR6A 2F4NA 5K9ZA 4NULA 4FD2A 2XTAA 3H2SA 3R1IA 4FMCF 3V9AA 4ES6A 3JYHA 1AKTA 2ORIA 4I36A 2DHEA 4EPVA 2IYTA 2OQRA 2BM1A 3COJA 5KTSA 3LDHA 1H5QA 3ZXSA 1PEDA 1RZRA 2HFKA 2NYAA 4LX0A 3ZCVA 3WAJA 1V6AA 2DPYA 2VP0A 4HNRA 2E1PA 2C20A 1RI2A 2IZ1A 1WXIA 3M4NA 3Q3EA 1SBNE 4C03A 4JJ8A 4YXWA 1PQYA 1T5HX 1UWKA 2VHQA 3E9RA 3JD0A 3OM1A 3UC5A 3AO0B 2QVZX 2ZRCA 1G7SA 1SK8A 2AGVA 3QHPA 3ZDDA 3AVXA 3BS4A 4YP1A 1N33B 3GLFE 4AG6A 1Y33E 3B78A 1QC5A 4E2WA 2AE2A 3PE3A 4B3RB 1W19A 5BVGA 2Z83A 2QL5A 3O2JA 1SCAA 4ND5A 3U6KA 4Q01A 3QEOA 5EQFA 1ZIXA 4OBWA 4WVFA 1IVSA 2OZPA 3OY2A 4Z8XA 3JYNA 1KZ1A 3G85A 2I4RA 5HMLA 3K0KA 3OPQA 4PSVA 5LQRA 3NBXX 2BEUA 2X9GA 4WK2B 1ZVJA 4PHFA 1YF3A 2XE8A 5BVHA 4IFIA 1NUAA 4E6PA 3QVGB 1EB9A 3EPHA 4Y98A 3CUYA 2HCRA 3H5IA 2V9CA 2WC1A 2YJ6A 3IUSA 4ROTA 4U0JA 3RVBA 1R0BA 2ZJFA 2ZROA 2CUNA 2X9QA 4K9OA 1L1FA 1QIHA 2B99A 1GPBA 2I62A 1CE8A 3FNRA 2KI5A 1W4CA 1T4BA 3AW8A 4FZVA 4O8CA 3CPSA 3VC2A 4J16A 5EMLA 5IFKA 5KQMA 3W5DA 3CCFA 5H82A 5JMPA 2O4CA 5JD4A 1JLRA 4J1NA 1JIQA 3MUNA 1Z7EA 2QRKA 1NJ8A 1D0SA 4W63A 4A91A 4PCUA 1B0UA 5F7OA 1C80A 3IMEA 1M7HA 3Q12A 4ARIA 5DLQC 1T9AA 4B3SB 3CBGA 3UFBA 1XMXA 2IIVA