1WS6A

The structure of thermus thermphillus hb8 hypothetical protein ttha0928
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
171
structure length
171
Chain Sequence
VVRILGGKARGVALKVPASARPSPVRLRKALFDYLRLRYPRRGRFLDPFAGSGAVGLEAASEGWEAVLVEKDPEAVRLLKENVRRTGLGARVVALPVEVFLPEAKAQGERFTVAFMAPPYAMDLAALFGELLASGLVEAGGLYVLQHPKDLYLPLGERRVYGENALTLVEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The structure of thermus thermphillus HB8 hypothetical protein TTHA0928
rcsb
source organism Thermus thermophilus
molecule tags Transferase
molecule keywords methyltransferase
total genus 51
structure length 171
sequence length 171
ec nomenclature ec 2.1.1.-:
pdb deposition date 2004-11-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03602 Cons_hypoth95 Conserved hypothetical protein 95
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 1ws6A00
2H00A 3CJRA 1M0EA 1XDSA 3ELDA 5K01A 5G02A 1SQFA 3FTCA 3QOWA 2AOWA 1I9GA 1VIDA 4MTLA 5E1BA 3I5UA 2XYVA 4XUCA 2JG3A 2HTEA 2IFTA 4RVDA 2ZLBA 3SXJA 5CCBA 2XVAA 4QVGA 5D1HA 5K0LA 2BM9A 2I7CA 1UIRA 3UWPA 3IYLW 3UBTA 1PJZA 4RTOA 3HEMA 3DLCA 3PFGA 4WXHA 3BWYA 1L9KA 3BWBA 3BKXA 1AF7A 3G5LA 1KPHA 5FULA 3RODA 4DF3A 4M37A 1EIZA 4RTNA 4PYNA 1NBHA 4QDJA 1YUBA 1KR5A 2ESRA 2P3LA 4FP9A 4AUKA 3GNLA 3DMFA 5K0JA 5ICEA 3HCBA 1XCLA 4F85A 2YX1A 1DUSA 4QTUB 2O0LA 3P97A 3KQSA 3MERA 5BXYA 1SG9A 2FHPA 4FT2A 1KYZA 2IH2A 3ER8A 3LKDA 5FHQA 5DPMA 2VDWA 5E8JA 2ZIFA 5EQJB 3UJ9A 4XCXA 3I58A 3P2IA 1TW2A 2A14A 3G5TA 3MGGA 2VDUE 4E2WA 2B3TA 4V0QA 3LCUA 3LSTA 5EEGA 4CWAA 4BP3A 3LPMA 4E70A 2ZBQA 4OQDA 3MCTA 1DL5A 4P58A 4PYMA 4C06A 3NDJA 2I9KA 3S68A 3EVAA 1X19A 4K6MA 3EMBA 2P3OA 2AOTB 3A7EA 3FYDA 5T67A 2EJTA 2UYCA 5HIMA 3HTXA 3CC8A 3HM2A 1ZGAA 2OY0A 4AZVA 2ZBRA 2AOUA 3LCVB 4RTRA 2FPOA 3MHTA 2H1RA 1JG4A 3DULA 4Y2HA 3DXZA 2HR1A 4HSGA 4C04A 3LBYA 4MIKA 2ADMA 2PKWA 5GM1A 3F4KA 3A7DA 4X63A 5CVDA 1KPGA 2GB4A 5JUWA 5IH3A 1RI1A 3FPFA 3KHKA 5DLYA 4ZTBA 5FWDA 3RIEA 2C7PA 3KQYA 5K0EA 3UA3A 5K03A 5DTRA 1MHTA 2B9EA 2GH1A 2LD4A 5CCXA 3NWEA 3EEYA 4HH4A 3MTEA 5K8VA 1G8SA 3FPJA 3GO4A 3OZRA 4QPNA 4YV2A 3B3JA 3ERCA 3DXXA 3G2PA 5KVAA 2B25A 3G7UA 4QQKA 1R18A 4PYIA 5EKXA 5LQUA 3SMQA 1EAMA 1KYWA 1I4WA 3GRRA 4FGZA 4YUVA 5U4XA 3V8VA 2ZZMA 2ZZKA 1DCTA 3B7PA 4P7JA 2UYOA 2HV9A 2PVCA 1XTPA 4KIGA 2ZZNA 3HP7A 2GS9A 3R6TA 3SSOA 2NXNA 4M36A 4OA5A 1RI2A 3KPWA 4C03A 4E2ZA 3DOUA 4V0RA 3SSMA 2OB2A 1I1NA 3IEIA 4R6XA 3CCFA 2OO3A 3KQQA 2OPBA 3DUWA 3MB5A 4PYOA 4RSRA 5H02A 4BP1A 4YUZA 2PX5A 4F86A 1KIAA 2JHAA 2Y1XA 2XVMA 3EVEA 1NBIA 4HC4A 2P8JA 4PYLA 4GOLD 4RTLA 2ZCJA 3THRA 4AZTA 1NT2A 3Q87B 4ATNA 5LQCA 4AZWA 1N2XA 3M70A 2AS0A 3NTVA 4FS8A 2G1PA 4P7KA 3G2QA 3FTEA 3R9XB 5BP7A 2B78A 1TPYA 3HA7A 3HVIA 4BLWA 5DXJA 1QAQA 3OZTA 5E1MA 1ORIA 3ELUA 2C7OA 2ZULA 3IV6A 3A25A 1VE3A 3EVDA 5F2KA 2PWYA 3G8BA 5KS2A 4AZSA 3LDFA 3P9IA 3SVZA 3THSA 5DM0A 4HGYA 3GRVA 2QYOA 2VDVE 1QANA 3E05A 1P39A 3NWBA 1KP9A 5KYGA 3OE4A 3UJ7A 2C7RA 2QM3A 5FQOA 3UJ8A 4E31A 4RYLA 1FP2A 5LQKA 1VPTA 5FCDA 2G8NA 2FK7A 3REOA 3OPNA 3M6UA 5E2BA 2PV0A 5EZQA 1WXWA 1EG2A 4IV8A 3TR6A 3M33A 5HILA 3PT9A 4PCAA 5EMKA 4HTFA 3FPGA 2IDJA 4ISCA 5K09A 1N7JA 3GU3A 3UJBA 2AOTA 4M7RA 4H0NA 2NP6A 3KPJA 3MAGA 5LR6A 3JWHA 3QOXA 1RJGA 2HNKA 1OR8A 2B2CA 5FA8A 2IP2A 3R0QA 2UYHA 2OYRA 1YZHA 2ZVJA 3T0IA 3GGDA 2OBFA 3ELYA 3NJRA 3UFBA 1X1CA 2QRVA 3P71T 2R3SA 1YFJA 4A6DA 2AN4A 1JQ3A 4O29A 1UFKA 4E2YA 2IIPA 4WVLA 3T7RA 3PVCA 1NW7A 1KXZA 1VP3A 3FUVA 2PT9A 4HRAA 2DULA 4Z2YA 5BW4A 2NXJA 8MHTA 1R00A 2XYQA 4FSDA 4DKJA 5GWXA 3TLJA 3CBGA 3BT7A 3GRYA 2CMHA 3BGVA 5HIIA 3SX0A 2Z6UA 4X60A 2FK8A 1X1BA 5E2AA 1YB2A 2PX4A 5HIJA 5BW5A 3KKZA 3FPHA 3KPUA 3CGGA 3PX2A 4EKGA 3GCZA 2DPMA 2ZIEA 3UJAA 4RTKA 1YF3A 1XDUA 4DMGA 3HCEA 3ER9A 2ZWAA 2YQZA 3TMAA 5DX8A 2YTZA 1R6AA 4GEKA 3BWMA 1VLMA 1O9HA 2GPYA 2VP3A 3A26A 5E9JA 4RVHA 5EHIA 3B89A 3HCDA 1G8AA 5ICGA 5FWAA 2O05A 3DH0A 1R8XA 2EG5A 4RVFA 3SGLA 3MQ2A 1YFLA 2FYTA 5D1NA 3I53A 1JQEA 3EPPA 1NKVA 2NYUA 5CVEA 4YV0A 1QAMA 5EMJA 3CJTA 4IKPA 3M6WA 4EVIA 2ONYA 3FUTA 4OBXA 4CTKA 2BH2A 5LQAA 1RJFA 5HEKA 5EGSA 4PNEA 2GA9A 3UJDA 4DM3A 4PIPA 2O57A 3EVZA 2NXCA 5ERGB 3LBFA 3TFWA 1FBNA 4FR0A 3KPVA 2EFJA 5FTWA 3GJYA 3P9CA 2IH4A 2OZVA 1MJFA 3EVFA 5DM2A 5EIFA 4OQEA 5K05A 5EOVA 4KDCA 4RTQA 2WK1A 3CJQA 5EC8A 3PTAA 5JR3A 5LQJA 5B1SA 1HNNA 2BR5A 3I64A 4PIMA 5E1OA 1BKYA 4CXMA 3LX6A 3FZGA 3KQOA 2G71A 3QV2A 4FSXA 4PONA 1H1DA 3UJ6A 4R6WA 4BLVA 4M38A 5DT2A 1AV6A 4PGGA 5ICCA 4GC5A 2BM8A 1BHJA 7MHTA 2ZFUA 5HOQA 4EK9A 3FUXA 4CKEA 1VL5A 3BGDA 3LDGA 2PY6A 5LQNA 5KQRA 4F84A 4YMGA 3ORHA 4RTSA 3OE5A 2VS1A 3KR9A 1Y8CA 4MQ4A 3UA4A 4JXJA 4NECA 3GRZA 3LCCA 4YV1A 4C07A 5F2NA 3ANXA 3R3HA 3BZBA 2O06A 3B5IA 3HA5A 1BOOA 3FPEA 5E8RA 3P2KA 1Q0TA 4ER7A 5C1IA 2XYRA 4X61A 3OZSA 2OXTA 3LKZA 1KPIA 1AQIA 3HCCA 2XBMA 3E23A 5IKMA 3C6MA 2G72A 2AR0A 3VC2A 4GQBA 1L3IA 1SUIA 1BC5A 2EX4A 2V74B 3AY0A 4RVGA 5EEHA 1JQDA 3G8AA 3L8DA 3V97A 3D2LA 5K0FA 3HCAA 4PYQA 5K0NA 1RJEA 2F8LA 2ZSUA 3B3GA 5FHRA 3PB3A 9MHTA 3M6XA 4E32A 2EJUA 2UZ4A 3NVMB 4C4AA 1L3BA 1FPQA 5CUQA 3EGEA 2IDKA 3OU2A 5DSTA 4GC9A 2AOVA 4A6EA 4DQ0A 1AQJA 1Q0SA 3G2OA 4EMSA 5C9ZA 2PX8A 3I9FA 5DTMA 4YUYA 3HVKA 3HNRA 1M6EX 2P3QA 3P8ZA 2ZBPA 2PBFA 2ZW9A 3JWIA 2ZWVA 5DSXA 1G38A 3KR1A 4LECA 3C6KA 2K4MA 2ZIGA 5CVVA 4OX9Y 1ZQ9A 2N47A 4MHTA 3TPZA 1JSZA 3NMUF 3BWCA 4GUAA 5FUBA 1SKMA 3E7PA 1R8YA 4R05A 4R8RA 5M5BA 5FA5A 4LWOA 3NW9A 1WZNA 2IPXA 1RI4A 1L3CA 1WXXA 1F38A 3O31A 4QQNA 5DX0A 2PSSA 2Y1WA 2AOXA 3M4XA 3KQMA 2PJDA 1N7IA 3E8SA 2CWWA 5MHTA 4CTJA 1SVUA 2YXDA 1P1BA 3TRKA 1QZZA 5EPEA 1VBFA 5HIKA 3TM5A 2OKCA 2NXEA 3DLIA 1WY7A 1ZGJA 4ER5A 1TW3A 1JTEA 3VC1A 4DA4A 3H2BA 4IV0A 3DR5A 4QDKA 1XJ5A 2JH9A 4GBED 2BZGA 4KRGA 4L7VA 2GLUA 3VYWA 4C05A 1D2HA 1HMYA 3GIWA 4FZVA 4ER3A 3K6RA 4HGZA 5FQNA 1NV9A 1RI3A 4IWNA 5CM2Z 1JG2A 4GF5A 2OB1A 3AJDA 2AN3A 3BKWA 4QTTB 4E2XA 4Y30A 1INLA 3HCFA 4KIFA 1D2GA 1NW5A 5C0OE 3C0KA 3SM3A 4QVKA 5DTQA 2Z6AA 3LL7A 4EQZA 3DMGA 5FADA 3KPYA 1XXLA 2WA2A 3R24A 4HTFB 3NDIA 4E33A 2PLWA 2IGTA 3PS9A 4DZRA 5K0GA 4DCGA 2I6GA 3PX3A 4PCLA 5EKUA 1NW6A 2IBTA 3TM4A 1RI5A 4PYKA 1KHHA 1QAOA 2P41A 3LGAA 2AVDA 5DRTA 4RTPA 2P7IA 3X0DA 3SSNA 4HG2A 1NE2A 3A27A 3FTDA 2E5WA 1EQAA 4KDRA 3B3FA 3MTIA 4PGHA 4RV9A 3KQTA 5P8WA 5CVUA 5CVJA 3GXOA 3CVOA 3LDUA 3ELWA 1P91A 3GRUA 5GOZA 3OFKA 3ME5A 1VQ1A 5KQSA 2JHPA 3LECA 2UYQA 3GDHA 3IHTA 3PFHA 1JR4A 3EVGA 1JG1A 3G2MA 4XUEA 2PWPA 5EMLA 5GIOE 3TOSA 3FTFA 5LQRA 5T6BA 1X1AA 2BR3A 3UZUA 2ZTHA 3Q7EA 3OFJA 5DWQA 1NV8A 4GOND 5E1DA 4UOEA 4YMHA 3HVJA 3FUWA 2JHCA 3O4FA 1FJXA 1WG8A 3DTNA 4DCMA 3ID6C 5DRYA 3GWZA 1SUSA 2JJQA 1P1CA 4P7FA 10MHA 2H11A 3G89A 2HWKA 2I62A 3KR2A 3JWJA 2VZ9A 3KR0A 3LHDA 1L1EA 4MWZA 4BLUA 2QE6A 4PYJA 2P7HA 1WS6A 5HFJA 2YXEA 2PT6A 1PRYA 3DXYA 5GP1A 2PXCA 3P9KA 1IM8A 2PXAA 4P7GA 4PINA 2NNWB 5CIYA 4BY9E 3C3YA 3T7SA 4POOA 1QYRA 2JH8A 3BXOA 2KW5A 4RX1A 3T7TA 1XVAA 3HVHA 2C7QA 5EHGA 3AXTA 3K0BA 4QPPA 4YUXA 3FRIA 3AWIA 2AOUB 3P2EA 2PXXA 3HA3A 4LG1A 4X1OA 5DM1A 1R74A 4B17A 4OBWA 1IXKA 4RTJA 3M6VA 3DP7A 4U7TB 3VSEA 2ONZA 5HZMA 2IBSA 1EJ6A 2YXLA 2Q41A 2P35A 1NW3A 1JSXA 4KWCA 1ZKDA 5ICFA 3TQSA 3FUUA 4KVZA 4CKBA 4XUDA 5DXAA 5F2OA 1EJ0A 3AXSA 1G55A 3EGIA 4C08A 1G60A 2P40A 1XDZA 1Z3CA 3A4TA 3KU1A 4ER6A 2IH5A 3EMDA 1B42A 3BUSA 4R8SA 1ZHFA 2CMGA 1VP9A 3FRHA 4G56A 4EKIA 3FYCA 5EZSA 3CKKA 2HMYB 3BGIA 3DMHA 3KQWA 3EEOA 3JWGA 1O9GA 5E9WA 5CD1A 1FP1D 4CKCA 2P1DA 3G88A 5EMMA 3RW9A 5T64A 3TKYA 5E9QA 2R6ZA 2WA1A 2CL5A 5DM4A 1UWVA 2YR0A 1M6YA 4GOMD 4X41A 5GINE 5DX1A 4GOOD 3UJCA 5GIPE 2FRXA 1ORHA 4LWPA 3OCJA 3OU6A 1XCJA 2PX2A 3EVCA 3P9NA 4RWZA 3C3PA 3KQPA 1V39A 2GAFA 2YVLA 4U7PB 1O54A 5K0CA 5K0BA 3U81A 3KQVA 1JG3A 4YUWA 2AN5A 2QRVB 1SQGA 3SR4A 5GM2A 1G6Q1 5EVJA 4E30A 2AVNA 5LSAA 2YUIA 2AZTA 2BR4A 2G70A 2PGXA 1T43A 2FCAA 2QY6A 3O7WA 4FT4A 4ER0A 2NP7A 1F3LA 3TKAA 2ORED 1RJDA 2O07A 1NW8A 5EG5A 1X1DA 4AX8A 2Z6QA 1U2ZA 3PLAE 1D2CA 1YZ3A 3MCZA 4OA8A 3OU7A 4KW7A 3EGVA 1JTFA 3WSTA 1IY9A 1ZG3A 2ERCA 5EIWA 3EVBA 4RTMA 3NVKI 4PWYA 2CKDA 2V7EA
chains in the Genus database with same CATH superfamily
2HQBA 3BX1A 4CLRA 5IABA 4DV1B 4KB5A 4Q66C 3SJCA 2I6XA 1D9ZA 2C57A 3ELDA 4QASA 8OHMA 2E6UX 3FTCA 5C52B 1E8NA 1W85A 4F3NA 4EITA 1JXQA 2IHKA 2I7DA 3COJA 2C58A 1GCGA 5I9NA 4DW8A 5KSPA 4ZCPA 3EUWA 2Z8YA 4HNAA 2ZQ5A 4EG7A 3L4JA 2X86A 1YTUA 2Z5GA 4UUAA 3T3GA 1L5GB 2EKZA 2ZDHA 3DLCA 1OWOA 2WD9A 2H2FA 1B14A 2EZ9A 2R25B 4TMVA 3MS7A 5H8WA 1YULA 1GM5A 3BKXA 1AF7A 2GDJA 3GMIA 2VZ8A 4QDJA 2BW0A 3GH1A 3RE1A 2WFMA 4JYAB 1N6OA 5ICEA 5D5PA 2E82A 3A1EA 1FVXA 4C6TA 4HEA6 2ECPA 4KQ1A 5D6OA 2FHPA 3UXYA 3JD1A 4EZIA 4LYYA 3DW3X 1Q15A 2QTWB 4CLDA 5BMVF 3WB2A 2GETA 2XMDA 4RBNA 1EP3B 1VXOA 5CFZA 3JVIA 1AT1A 1D1PA 4JJIA 4DBZA 1FB5A 1ZEMA 3CZ5A 3G5TA 4PZYA 4WBNB 2WJGA 1I4LD 1N3BA 4WTOA 5A6VA 2ZJ0A 1N3LA 4BCCA 3IPCA 1W94A 3QVWA 3UC9A 2OT3B 4LOLA 2VVTA 4Q9KA 1Y33E 3NDJA 2I6QA 5DTEA 2MOKA 4HDRB 4RF5A 3VR1A 3HB1A 1RWNA 1PIWA 2I2BA 5CXSA 3WWYA 3QSGA 5DN6A 2GLTA 2BMVA 3ESZA 3V6MA 4B43A 1U0GA 1WR8A 2YQ4A 1AS2A 6YASA 1MHPA 2C61A 2OBMA 4UULA 4BB5A 4EMUA 5CB6A 1MVNA 4UNIA 5MN4A 2NV2B 4R69A 1KEKA 1JG4A 3U7EB 2HA4A 4TT3D 1JVNA 2ZR9A 4HI0E 3VBCA 5DBIA 2CJPA 2PKWA 4OLJA 1L5ZA 1T4DA 3EWAA 1EHCA 1OXTA 2WSIA 4NYIR 1DB3A 2FR8C 4WFIA 4J0CA 5E95A 3RHSA 4C7KA 2XUAA 4JITA 2QP9X 1U7TA 2CFOA 2W6ZA 4TMTA 1PF7E 2PE5A 5I7AA 2QJTA 2WU3A 1GN8A 1ULZA 3AINA 3HV0A 4I1UA 3MTEA 5J4YA 3ZU6A 2FA9A 4KQGA 4LRXA 4YONB 3TR5A 3T5BA 2ADOA 4H3SA 2ZAGA 3L46A 3HV2A 4QPNA 4FU0A 3EOAI 4EVRA 4B34A 3U9LA 2B25A 2FJ0A 5GV8A 3T6KA 1YI8A 3LVRE 3DE6X 4IBOA 3AJ8A 3DDCA 3AI1A 4RXUA 5U4XA 3LLCA 1U9JA 1E3DA 1SBHA 1W48A 2PKXA 4MH0R 3HFSA 3EDCA 4BWVA 5AHWA 3KKEA 1SCUB 5BSMA 3NVAA 5F5NA 2H2WA 5I9MA 1NJGA 3ZE0B 4E7PA 2NVOA 1MB9A 4JT2A 4N3GA 3H6GA 5C7OO 4KO4S 5LQDA 3CRNA 3NR2A 4MVYA 3UAXA 5HHTA 5AI4A 1XLTC 5JQGB 2HMSA 2ZYVX 2LDBA 2CBXA 2QT0A 1KZ6A 3DAFA 4R8LA 4UXHA 4QGHA 3TLCA 1WB9A 1SEVA 1IJKA 1Z2PX 3A05A 3Q87B 5AESA 3KYJB 1DBPA 4MYRA 4Y2YA 5LNK6 4X1IA 3EXG2 5AJZA 5JFGA 5M04A 4B0PA 2N46A 3LPNA 3QA9A 4I2VA 1N7HA 5DEIA 3HL0A 4G9EA 1OLXB 3TOZA 2OMKA 2Z30A 2WMYA 4IQGA 3D02A 5F64A 4JOCA 3DYBA 5L7TA 2BUCA 3HBMA 4JIMA 4OD0A 3KTFA 4JMPA 1KQNA 4TKLA 1K8QA 2P2SA 3FPAA 1H2BA 3LLMA 1R6BX 4TN1A 2DETA 1C3LA 1IZYA 3IIJA 3DHVA 2YZNA 4ITVA 4P35A 4PFJA 1KOLA 2V6MA 3UJ8A 3BCHA 3R7FA 1FP2A 1PT8A 1UQRA 4KN6A 3MS4A 4IQFA 3LT0A 4CNBA 4EUNA 1I1OA 1RHRA 4TT8A 1OXBB 2O2IA 1W35A 4ZT4A 1D4ZA 3G7SA 4RSHA 4K9SA 4HTFA 3ENZA 3PSAA 2NUTA 4KAJA 2AUMA 3M4ZA 3EDMA 1PDVA 4GDFA 1X92A 3QIAA 4JLJA 1J1UA 2CLSA 1CNEA 3CS3A 3K72B 3I9OA 2I1QA 3P0FA 5CR9A 4U6SA 1Z5VA 1CIJA 1LDBA 4OHUA 1UDAA 3R0QA 4E5VA 5AKGA 3UXEA 1VB5A 4S3MA 4TV9B 3T3OA 5JAIA 1NUAA 1V5WA 4EG0A 3RVQA 1C7JA 1SVMA 1FRNA 4MV7A 2RCYA 2QRVA 521PA 4ZJYA 2PQ6A 2J9YB 4I4TB 3AQIA 1GRCA 3MTQA 4REQA 4WVLA 3OMWA 2BPOA 3RU9A 3UC5A 3JYLA 4QLOA 4A16A 5M2QA 4IQ0A 1U7HA 1NMSA 3HSYA 3W7VA 1JH9A 4MKFA 2GZ2A 3BGVA 1XDBA 5BUQA 2JCGA 1VM6A 1W1UA 2QRUA 2WZCA 4NBSA 3FPHA 3HC7A 3QOFA 2HC9A 3KPUA 3WK7A 4C4XA 4DNPA 1E4EA 4MGKR 1I4DD 2QYHA 3FROA 5LC1A 2I80A 3WMGA 2UV8A 3ER9A 1JJVA 4JA0A 2E5FA 4LY0A 1KBZA 4F60A 3M3HA 1L7DA 5K3FA 1LPNA 1GKLA 3L7LA 5BNIA 5G40A 5ALQA 2FN8A 1O9HA 3NJ4A 3QLUC 3A26A 3I72A 4XGRA 4BV3A 3H4MA 4CQMD 1YQWA 4EZBA 3JVUA 4UQLA 3FOZA 3S8EA 1Z34A 4BX9A 2WVHA 2NIPA 4TWAA 4YHHB 1H8ED 1FFSA 5AI8A 1LTQA 3AF6A 1U3VA 1BGVA 3D7NA 3OD1A 2W71A 5AI9A 4JSRA 1U8ZA 3WGLA 3IJEB 4YRCA 4V0KA 1M8FA 2MYPA 4HPXB 3H8WA 3MAAC 1BGWA 5K1ZA 1L8XA 4HATA 4OBEA 2O57A 3JWEA 4PZEA 2FWJA 4DM3A 3WLTA 1XEWX 3KPVA 5CBPB 1AKYA 2C04A 2PZ8A 5FTWA 3PGKA 4X91A 3F73A 4UHFA 1PGNA 2FX5A 2KI5A 4OMUA 1GDTA 4KDCA 1XELA 4KWTA 2RB4A 1EE9A 1N75A 1T2NA 4PIMA 1BKYA 1HSZA 4ALNA 4F5EA 3QV2A 4FK8A 5AW5A 4PONA 3SYKA 1X1EA 1E2FA 1FFAA 1MJNA 2Y0DA 4R6WA 4WECA 5DT2A 3JQCA 3VSCA 1WKVA 3QEMA 2RHWA 3IVXA 2HA5A 2R5NA 2C9DA 4V39A 1OAKA 4R8MA 1E7SA 3G49A 1KAOA 1TO2E 4Q4HA 1YRYE 3O8CA 4WLNA 4IHJA 3PDHA 2HNBA 3GRZA 1M8KA 1U7PA 2QI9C 3Q3CA 3F2IA 3UMCA 5LZ8A 4N5NA 3SR3A 1J42A 1JVBA 3MCAA 4HWTA 4X0EA 3BF7A 4KO8A 2XNJA 3RJZA 4E09A 3KBBA 3ZVRA 2FX3A 3WQHA 1NOKA 3MTAA 4KFTA 3A1FA 3CSDA 3C6MA 3KYDB 4LGVA 3BE5A 4YJKA 1IRIA 4L76A 3DZJA 3ZK8A 4D9MA 4Z7NB 4V1CI 4MULA 3FH0A 4X3OA 4N0EA 5E7IA 1CHDA 1Q3TA 3L8CA 4BO2A 1WJGA 1C30A 4Q9JA 1IHDA 1F3OA 4FYVA 4JLOA 3ZQKA 4LTNA 5K0NA 1J23A 2D2EA 2XAUA 3AIIA 2R7LA 3FI0A 1K4MA 3KKPA 3M6XA 3R7SA 4I46A 1DRVA 1XTSA 3B12A 5DBFA 3TRJA 3OP4A 1LPMA 1K4YA 2QM8A 3PA8A 3DKIA 3UCEA 1KK3A 1TJYA 3QWHA 5C8YF 3EDYA 1TEVA 4GC9A 2JKYA 2WTXA 2D00A 2PX8A 1W1WA 3JZDA 1HEUA 2AFHE 4MS4B 4XWGA 1VXRA 2QLJA 1M6EX 5TVGA 3P8ZA 3VNBA 4F4JA 3A9CA 1NUUA 4QIHA 4IIXA 3CZAA 1JHVA 2JLYA 2C4MA 4Q9DA 1NRJB 3Q7IA 3T0GA 4BAGA 3OFND 2UZ1B 2FZKA 3ICVA 4KXXA 4ZI2A 1F6WA 2AXEA 5G3YA 4G1BA 5JJIA 1U11A 3R23A 1X3SA 4KSYA 3JATB 1XZEA 3QWIA 4FZ3A 4P31A 4QUBA 3RLFA 1CUAA 4IDAA 2AOXA 1LW6E 3E03A 3V2IA 4TMZA 4IXTA 1OHHA 4JOBA 4KZKA 2CE2X 1R2QA 1Z35A 1IZ0A 4I6EA 4JB2A 5CH3A 1CTQA 1J8VA 2NN3C 4K9LA 1XK7A 4GP7A 3PL5A 4NCNA 1E2QA 3SOZA 3ZG6A 1ZGJA 5BRNA 4F38A 1E5VA 3LPLA 1VHTA 1RJWA 1JHQA 3Q88A 3GGCA 1PFKA 2I4OA 1MQAA 2ZSHA 4LISA 4RENA 4E08A 5JJCA 1T35A 2WSMA 1GZDA 1Q77A 3I32A 4TTJA 1XQ1A 1D1SA 5JO9A 4U2CA 3K6RA 4LZLA 4FHGA 4OOFA 3GLHA 4RYDA 2OVFA 2XNHA 2G0AA 2GZRA 1XIVA 4QTTB 2OGZA 4MMYB 4NARA 1XVTA 1N78A 4RLFA 2HF2A 3IELA 2C5SA 3OHPA 1EP2B 1JR3A 1LV8A 2YXNA 1BQ4A 4UDXX 4XEUA 1KH1A 2FMKA 2EFHB 8AT1A 1ENPA 4HTFB 4JS0A 4JZYA 3PWTA 1PR0A 3L7MA 1JIUA 1E3SA 5K0GA 1HZJA 4CMGA 4UFOA 1JRLA 3QYPA 5U9CA 1TZ2A 2WEKA 3THXA 2WPNA 5CFNA 1CJVC 1U3TA 3D3QA 4MA5A 3WBFA 3USCS 2GO7A 3ROGA 5CB4A 3BDAA 5EHZA 2FZGA 2P2YA 5BSEA 4PVCA 4FFWA 4TV9A 2YVAA 4I50F 3QHQA 4D0RA 3GXOA 2LCIA 2B5VA 1XPOA 3A6GA 1P91A 5A5FA 2BSXA 4M9UA 3CRMA 3DZKA 4RMJA 3LKVA 1F51E 1KI6B 2HY7A 4C0LA 3BD8A 1LU9A 4DNXA 4V0ME 1KI9A 1N5JA 1GYPA 1TKAA 2AL7A 3CLHA 4LNHA 3RSSA 2G82A 3GN2A 3T7AA 1QP4A 1O58A 3ISVA 4QNRA 1AM4D 1X77A 3E53A 1CJSA 2OWEA 2H17A 3IE2A 3L40A 2JHCA 2PQ0A 4ABYA 3IODA 1VLJA 3HXMA 4NENA 2GXAA 2ZRKA 3WZLA 4JUFA 2R1UA 4GAEA 9GPBA 3W1EA 3MFYA 3D6VA 2R68A 5KREA 3VVLA 3AMVA 1VCIA 3K1YA 2PGOA 3M6IA 4FW8A 4ZT5A 5JIBA 5JYEA 3B1XA 4YAFA 4HHEA 1YQEA 2D1RA 4BFLA 3CM0A 4DLSA 4HVAA 1QYRA 2F17A 3BMNB 1B8UA 1XVAA 2CLIB 3DMTC 1C3JA 2CXPA 1ZSYA 4WIAA 2QE7A 2ICAA 3D6NB 4KO1S 3RM3A 2RH5A 1G8MA 2GM3A 1FX0A 3AWIA 3KZMA 5JCXA 4BB6A 1JWAB 4RD2A 5CT9A 4CPDA 5HQ3B 5HNKA 2O8FB 1FSPA 2VYNA 3A9TA 5C4GB 3VPBA 1N2OA 2PZGA 3WHIA 4EG4A 5KNBH 1M0TA 4KMMA 3M6VA 1T8PA 2FUCA 5B58C 2G0NA 3P9XA 3GUZA 2Q41A 4XX1A 4C4SA 4MVJA 4CEHB 4I55F 2XI4A 3II6X 2AWNA 1F12A 1QGOA 1Z0KA 3V8MA 4QWMA 4BMPB 1VYHA 1Z25A 4BQFA 3SICE 2HI0A 4UTNA 4B8ZA 2GR9A 2XADA 4ZYTA 5JU6A 3FWPA 3GVXA 2P9HA 2A7XA 3P1JA 4C6SA 4Q1CA 1ZHFA 4MSUA 4H1WA 1FTWA 1HOXA 2PKEA 3KV3O 2POQX 3W5BA 4PAWA 5HA5A 13PKA 1VIMA 3ORRA 3TD6A 1O9GA 4J6EA 2AKAB 4MHSA 4CKCA 5EMMA 1PHRA 1T10A 4XJTA 3K5PA 4LK2A 4OSPA 5E9QA 4JC5A 3EC2A 4IVPA 3OZVA 4YI5A 1GG8A 1JQBA 3LBAA 5LA6B 1VA5A 3OU6A 2QD4A 2X8AA 3MJDA 3S2EA 3R74A 3BMOA 3FCEA 1O54A 4I8IA 3CIFA 1RAAA 2FFAA 4REMA 2YWJA 3B1KA 1SQGA 2X9LA 4W7SA 4RPCA 3GLIA 1XX6A 3NNSA 3I04A 4PANA 2JGDB 3NC1C 4ER0A 2WAXA 3NP9A 1ZUHA 2PWAA 4HBGA 1T3TA 2HNAA 3PFBA 5AXAA 1KY2A 3EZXA 2C78A 1NY6A 4HYTA 1E0KA 3P9RA 3VAYA 2VTEA 2BEKA 4LOJA 1HLPA 4GNRA 4BCBA 4BAZA 4O4LA 3AUSA 3U1BA 5IHXA 3G2IA 4FKZA 3D8UA 2O8NA 2ERCA 1OU0A 3IRUA 2TS1A 3O8DA 3CSSA 2PSEA 4JDPA 2H00A 3OCUA 3CKYA 1XZNA 3E9CA 3L93A 5D3ZA 2DKNA 2DWPA 1VPEA 4LJ7A 1XDSA 3X1KA 4H27A 1IE3A 4CM4A 2FW8A 1O0CA 2ZDQA 3GLQA 5ITSA 2K7ZA 2I76A 2ZRFA 4FNMA 1VRWA 4XUCA 1Y1TA 4ZO7A 5BOVA 4BNVA 5C5DA 3ED5A 2AYXA 1G5TA 2QJRA 1Y37A 4G36A 3SNHA 4NHEA 2BM9A 1ULSA 4ZEWA 4DHEA 3QQ5A 3UYKA 2O19A 4ND5A 3OJLA 2PPVA 4GLFA 5AUNB 1XZPA 3T5PA 2Y1EA 4YRRA 4IQ8A 2AFVA 2ODBA 4MWGA 5ALXA 2J3HA 3JQGB 3RSOA 3RBVA 4LE2A 2QROA 4FZRA 4A2CA 4FP9A 3ZV7A 1VKZA 3B1WA 3PXDA 2J9FB 4I1IA 2IXAA 4ZZ2A 1M1ZA 1XCLA 2I71A 3G6WA 3OLWA 1QR6A 3KQSA 3C4VA 5TGTA 4F9TA 1YA4A 1KYZA 4A73A 3DXFA 3OKPA 4B46A 2AKEA 4CKBB 2R6JA 2C5FA 1EM8B 2R8ZA 1C7EA 3QW4B 2WP0A 3NYIA 3R3ZA 1W4BA 3KJXA 1RKQA 5B3AA 4P4UA 5TVKA 5IT0A 2YJGA 3R3XA 4N0MA 1TW2A 1G8GA 2W2TA 4D9JA 1ISPA 2JGEA 1HE4A 3BWDD 4GMFA 1N77A 2RGXA 4NYMR 3AZQA 4O3MA 3ZCRA 3TTXA 5IKOA 4CIWA 5L3SA 3AVYA 1TQ2A 2ACWA 3HB5X 4L2IA 4R16A 3KSRA 1KDPA 3WDSA 1STOA 2Q6LA 2WMDA 2GYWA 2HLDD 3BWXA 3NAMA 1CJKC 4OBBA 2G9NA 1Y7IA 5EE1A 5HIMA 2NVUB 1ZGAA 3O21A 1B8VA 2J67A 4X9XA 5FJIA 1JQKA 2AOUA 2N1BA 1EX9A 2FPOA 4XIYA 3ILYA 2B8JA 3DULA 3H5IA 5TQ2A 4NXMB 1AK2A 4D3YA 4C04A 1FNCA 5DH9A 2FSUA 4WA7A 1PUJA 1F4VA 5DCYA 2QL9A 2V6GA 1Y3BE 3BHNA 3F4KA 1UDWA 5CB4B 5H4HA 1N2CB 3JARB 1ZH2A 4RV5A 1RMTA 1Z2DA 1YGPA 4LXGA 3KHKA 4MR8A 4QYMA 1GNRA 3N87A 3X1YA 4BNGA 5KJ1A 5BV1A 2B9EA 1O94D 1G6HA 1Z17A 2A5YB 3KUDA 1G8FA 4RHYA 3IT2A 5FRDA 1DQPA 2LGJA 3EEYA 5JXWA 5L4SA 2GJ9A 2B92A 2JCBA 4PPQA 1S3FA 2AK3A 1P5RA 2H2DA 3S2ZA 1ODLA 1UPTA 1XYYA 2G1KA 4WPGA 3DXXA 1GTVA 5K51A 4J9UE 4BTLA 4AKHA 2I7VA 1E1MA 1R18A 4ZEMA 3JQ6A 1K06A 3QELA 1PX2A 1VRVA 2IOHA 1NRIA 2A8YA 4FHZA 1BXRA 4MUMA 1VSVA 1OA0A 2A5GA 2PUWA 1XTPA 2P27A 1JDZA 1NT4A 1K5GA 2QGFA 3HP7A 3OX3A 2RB5A 3WL5A 5KWVA 3ADDA 3CTMA 1P45A 3KXLA 3CCBA 1QSGA 2X8WA 3KJFA 1MH1A 4G0YA 2BMEA 2WUGA 1I7NA 4OQXA 2BVNA 1F6BA 3TUJC 3QKIA 1QVWA 1Z33A 3MB5A 5IH3A 5AW4A 1QOPB 1FVOA 4FMDF 3SD7A 3W5AA 1G8YA 2KPOA 1FLDA 5HJ2A 3SQNA 2FI1A 3DDWA 5EJ6A 1A88A 3FOEC 3SM9A 5KEIA 4BEBA 2DF8A 3RAJA 2GN2A 1ORTA 4KO2S 3ZVLA 3MJHA 2DBQA 3ET4A 3OEHD 3RFVA 4A1OA 1E2JA 3DT6A 3JQ9C 2IYAA 2YRWA 2WSBA 2PMCA 3DEAA 3SEAA 1JLLB 1WWKA 1NR5A 4RHXA 1F14A 3AETB 1D0IA 2PRJA 3BEDA 2WAOA 3NCTA 4OLFA 3B13B 4QJ4A 1YJ8A 5COQA 1TIBA 5I8ZA 3RH0A 1M66A 3KZOA 5MN5A 1UZNA 1F8YA 4AKTA 5JFTA 1WMSA 2ZVDA 1YRQA 2G77B 2AXNA 3I76A 4XGIA 3ZLBA 3FOBA 1U0OC 2MINB 1GKIA 1NBEA 2PKQO 5KYGA 1A8QA 2BGKA 3QTBA 4INJA 1USIA 1VI5A 1PZMA 3PQDA 3U6BA 1KIMA 1FNBA 1JAZA 1U7ZA 2PZJA 2XW6A 4G8JA 1G63A 1MG0A 3H9UA 4P6VF 4U9IS 3WKCA 1Y6GA 1SKBA 5F23A 4IV8A 4E14A 3LTEA 4IDCA 4OMFG 3MJ4A 4Q4LA 1U4SA 4U0KA 4ZALA 3ZY6A 2NT3A 2C95A 3VMMA 5ALWA 2GEJA 3C41J 4ZO6A 1PGPA 3FJ1A 2YS6A 3R5SA 4NBKA 1KSFX 1CPYA 1O97C 4Z0HO 1NYLA 5E4FA 1K86A 4LOAA 4ZCIA 2AH5A 1N5KA 4AJ4A 3NBXX 3P0JA 1VJGA 4QC2A 1E3WB 4DSTA 4I1OA 2DPXA 1UWLA 3GGDA 4ZOLA 3ZW9A 1NVTA 4YCMA 2ZUFA 3AW8A 3A1CA 4J1TA 4LJ8A 2F7SA 1V2GA 2C5BA 2AYYA 1A7JA 3PE4A 3EJ6A 1G4AE 4N4AA 1Q1EA 3C5HA 3I1FA 1EIWA 2J6IA 4D3SA 5KDDA 1AHNA 4MKRA 2AQHA 2I2WA 1UF9A 16PKA 4ACAA 2QTHA 2V9CA 3C5EA 4IYRA 1JR3D 5BW5A 1JZQA 2EBFX 3CXRA 3M5WA 2CC2A 2JNWA 4MNTA 3GCZA 1EGHA 3JD0A 1OVGA 1DKLA 4MUXA 1FRZA 1YJQA 2B30A 5BWNA 5LB2A 3CKMA 3HCEA 2QMHA 5BWLA 5HZHA 2H92A 2YQZA 1TU0A 2OHJA 4UASA 2FDRA 1E99A 4KKVA 2L17A 5A3VA 4EAQA 1YR2A 3CVUA 1GGNA 4CMCA 1EX6A 3ISTA 4Z4HA 3RG8A 4DCJA 2SECE 2W6NA 2VSFA 2NUTB 3B89A 1YVUA 4CW7A 3WB9A 5B6JA 1CP3A 1TGYA 2YWHA 1SC4A 3VTAA 1G8PA 2VKQA 1M8GA 4I4NA 5CA1A 1MW9X 1U8YA 1ZM2A 2H1LA 2VA9A 2VDPB 1GU0A 4KPEC 3DOCA 3I53A 4K7JA 4PAMA 1MFZA 2FFHA 2NYUA 3RUHA 4KPYA 2B69A 4XB1A 3ITEA 4H0CA 1WDMA 4G5SA 4LIPD 2XUJA 2GZHA 3FUTA 1BTOA 3ZDFA 4E7OA 3E0QA 2ASVA 3UMVA 5LD2C 1XR3A 1Y80A 1WPRA 1AQUA 1VSTA 3DL0A 3JAWB 2BEVA 3OX4A 2NO0A 5AWFC 5CLQA 1BMDA 3AJEA 3NZEA 5L3QB 4UBLA 4DEYA 4FWBA 4G0XA 4A0HA 3EVFA 4F06A 3HYNA 1IQ0A 5JRZA 3WLRA 4O8ZA 4BGUA 4YIHA 3BRSA 4HH0A 2P9JA 2QVXX 2O8CB 1VLQA 5ALKA 4CRWB 1UBKS 5ALDA 5K4HA 1UMCB 5LZ2A 1BEEA 1I2CA 3S6JA 2G25A 2BR5A 2IXEA 2QGZA 3OWXA 3QKTA 2XMGA 4XYGA 1Y4ZA 2IBMA 5CIQA 3J80A 2YN0A 1JR3E 1Z4PX 3QPCA 1H1DA 1VGQA 2PCJA 4MI6A 3NWPA 2UVPA 5ARDA 3D7SA 4CUKA 1TVMA 4FJ1A 2ZUEA 4K26A 1Z74A 3THOA 3B9RA 1PR6A 1ZK4A 1Z6QA 3MOSA 2C7GA 3NDPA 4NMWA 2Z9DA 3DO6A 6GPBA 3EG5A 2VKTA 3T8YA 1CVIA 1WD7A 2GMWA 3K0FB 4REOA 1BS1A 4I55A 2NWQA 1K7SN 1WXIA 3PC3A 4FYJA 4QDTA 5TIIA 2BWJA 3VUEA 3O93A 4QEDA 2HO5A 5DYTA 3MWFA 2OYSA 2RMKA 5DK4A 1GGHA 1PV2A 2ES4A 3U13A 3C6ZA 2APJA 3A4NA 1VIAA 1SUIA 1WE2A 3DT9A 4N01A 2V58A 1T34A 4D9BA 2VRWA 2KYRA 3KAKA 3FVTA 4IVRA 4JH0A 4B3GA 1CRPA 2VDKB 1TYEB 3D2LA 2DPLA 4TGLA 3RRMA 1V7CA 5A4MS 4IH9A 3ZZ0A 1MF7A 5CP8A 3B3GA 5A4IS 3CUUA 2LV8A 5DYIA 5A3QA 3LP8A 3L7IA 2WT4A 2XJ9A 3V00A 4OQMA 2DP4E 1FVHA 2NZXA 1D6SA 3EGXA 4L6CA 4ZAZA 5HFAA 1N5MA 1UIMA 1L7XA 1RKVA 2I4NA 3QEMB 1KY5A 5FTNA 3ZHCA 1XCPA 4ZCMA 3BJIC 1UR5A 1VE6A 4HDQB 5F7JA 4DRZA 3HVKA 4JDUA 4M0MA 1TCUA 4GX5A 2JLAA 1XDGA 1XU9A 3A6JA 4MR9B 4ZQFA 3AJRA 3HY4A 4Z54A 3KR1A 5K3FB 1YQUA 3EF1A 2JAPA 4FC7A 3BH6A 2X5JO 3HU2A 2ROQA 3TGWA 5LYJF 5IBQA 3TW4A 3BA6A 1F7VA 1N8NA 2DPGA 2ATVA 3IALA 1TTHA 1YQ9A 5I9LA 1PWZA 1WUJS 2X5NA 4XR9A 3ORFA 3IMCA 2FX2A 4A27A 4Y2VA 2XT6A 3MINB 1TAUA 1CEYA 5KTRA 5ADHA 2ILVA 4QQNA 5DX0A 5IBRA 1I1HA 1JLRA 4QELA 4R51A 2FUG6 4IH1A 1E3TA 1TA9A 4UHHA 2QN7A 2YZKA 3GDOA 1WMBA 4IMPA 3D3NA 1L7RA 3LNTA 1PD0A 1OUMA 5HIKA 4G0VA 3I1IA 1KEVA 5JBQA 3DLIA 4QBHA 1BD3A 5EHXA 3EIWA 1Z6YA 4A92A 3VHRA 3QU4A 1QF9A 4NONA 1JAIA 1NTRA 2ZYUX 2PCLA 1F5NA 2XMQA 3GFRA 3JYPA 3LBNA 4IV0A 2IYXA 4Z9YA 3C2QA 4AURA 3A3YA 2FEXA 3W2IA 3HTXA 2O0HA 5JTUA 1R4MA 5K20A 3GIWA 3EF0A 1IWBB 5AJHA 5FQNA 1O97D 5C34B 1QGYA 2WJJA 1V45E 3CF0A 4OM7A 3ZDEA 1MB0A 2PYZA 3C1UA 2AN3A 2BT4A 2FEWB 3K0SA 3AG5A 1MMFB 2XTMA 3V80A 2FMHA 4J07A 4NMLA 3KPYA 3R8XA 3PX7A 4K6OA 3GIDA 1GL6A 5DHPA 4DCGA 3JQBC 3VR5A 1GZ4A 3LHFA 3M2TA 5IH7A 5FORA 3I2FA 3N8GA 5D87A 5HFNA 5ITWA 2F90A 4HCJA 3G5MA 1QO7A 1KI7A 5F35A 2OBNA 4FFNA 3SK0A 4LS3A 4FHEA 4MW6A 5A6SA 1KOFA 3QM1A 4X1YB 3NYWA 4C9BA 3CVOA 3RRNA 3U62A 1W88B 4B3SB 2HMVA 4P5DA 2JI9A 2Z04A 1NJFA 3PDIA 4KN5A 3BTUA 4XDHA 5DNVA 2ZUUA 5ES3A 4AF8A 1XMOB 2NUAA 2HPHA 4AMBA 3EPRA 2IY7A 1JR4A 3BG5A 3SS7X 2ZJ7A 1X7ZB 2PBZA 3F3SA 2LW7A 3D4PA 2EHJA 4U7WA 5I01A 1ODCA 5JI2E 2ZROA 4MRMB 4KR7A 1GZ7A 3L7AA 1A9XB 3BXPA 3HDGA 3AR2A 2CW5A 4PRYA 4UEQA 2GNAA 1O9BA 4OXQA 4ON9A 3ZDXB 4BV8A 3ZHUA 3AVWA 1PYGA 2WHYA 3CXUA 4PRKA 2FPRA 3CMMA 1MAHA 3P9SA 3OOYA 4L3VA 3SE0A 2GHQA 2ORWA 2EX0A 3RGWS 4F9GA 1NVAA 3WSVA 1L2TA 1OI3A 1UOQA 3PQCA 1YGYA 2FOLA 2HN9A 3C6BA 5TE9A 1PRYA 4HMOA 2QTCA 4YRTA 1ZIDA 4RDCA 1GAJA 4J03A 4JEHA 3CT6A 1LNSA 1IHUA 4RE6A 2Z98A 4POOA 1EJBA 3ROXA 3VI3B 5I3CA 3EK2A 5EFZA 3TRFA 1SZDA 4KN8A 4UBMA 1QGAA 1ZZGA 3ZX4A 4BQPA 1SK8A 3AU9A 2EFYA 2C4WA 2UZ1A 2W4MA 4EW1A 1KI2A 3GF4A 3GRKA 2VJCA 3A9WA 5AOBA 3C1AA 1A7KA 4OBWA 5B58T 4Z1OA 3B2QA 9ABPA 2FPWA 5THKA 5JCPA 3L7BA 4RY2A 1T9DA 5LOVB 2BY4A 4DV5B 2NMVA 3JQ8B 4KYVA 2H1CA 1RBQA 1JEQB 1SHKA 2VP9A 2IYPA 2XCQA 4G1VA 1Z75A 4YBZA 1YB4A 2EDAA 3PIDA 3M6LA 2WT9A 3I9V6 3O47A 5DHFA 3EXEA 3M5DA 2ZIXB 1IK6A 4B31A 1YMVA 2B8EA 1QQ6A 3SU8A 3QBJA 1IPHA 3QYAA 4N1AA 1OZHA 5IJXA 4ND4A 1B42A 2UDPA 3PTZA 2XUOA 3DHEA 5CJPA 5CH5A 1NN5A 1TVKB 1W4CA 3I9V1 3F4LA 4OGKA 4OHMA 4UZSA 4G56A 5TPWA 3F3MA 3G7NA 4C3ZA 5I7OA 4X24A 2Y27A 1FSSA 3IP7A 3OURA 3WK5A 4CIDA 4ZJZA 5CBKA 2JD1A 5KTPA 3T1TA 4LGCA 2Z08A 4ZMRA 5JDIC 3RW9A 1SH7A 2AG6A 2G9UA 3OA2A 4PX9A 2Z5VA 4YT4A 1YS9A 4I1RA 5DM4A 1M6NA 2C2XA 4X41A 3VR4A 4H35A 1FQOA 1QZXA 1NSTA 4QFDA 1OLUB 3LPAA 4DV0B 4MR7B 3ONDA 1W0JD 3PENA 4ARBA 4RWZA 5ADVA 3JY6A 3VAAA 3KYCA 1L6RA 1Q84A 3OMLA 4O0LA 1E32A 5K0CA 3FZNA 1ULHA 4CF6A 3PUZA 5JMOA 3QE0A 4QUGA 2NACA 4CVNA 1PG2A 4Z9BA 3QG1A 5DIZA 3I6MA 4PRZA 1OXUA 1VGVA 1KMCA 2DUWA 2BFEB 2G70A 2VP5A 1LDNA 1ODTC 2XQKA 3ZTWA 2IZ0A 3EZ7A 1SM4A 1JHPA 3O9VA 2NO6A 1PLJA 2RGWA 4Y3UA 1KI6A 4OA8A 2GZAA 4CE6A 5IKPA 4DMHA 4C6RA 5JDIA 2FEMA 4EI8A 5FFNA 2Q3DA 3UYLA 4E5SA 1U6KA 3WKAA 1P80A 2LR0A 4D0GA 3EGXB 3DFFA 3OM9A 1TQ8A 3FHJA 1Y4AE 1H2RS 5IC5A 3RUPA 3CURA 5JJLA 3IKTA 3C16C 3U7FB 4OQYA 2ODEA 1DJQA 4UHCA 1Q0HA 4ZI7B 7YASA 1BN6A 2R62A 5IWCA 5KCZA 2IFTA 2ZJ8A 1E6EA 2WTEA 5DYWA 2VH2A 1C9KA 1Z15A 2G1JA 5L3VA 1XTUA 2WTBA 2A92A 3TE7A 2HBZA 3S8MA 5HVNA 3GT4A 5FOWA 4XQEA 2PH7A 3UK6A 2Q4DA 3RU2A 3C98A 4RSGA 1ZP6A 3GPDG 1S8NA 4P7BA 4ZCLA 4KI0A 2GESA 4KV9A 3QYFA 5ETJA 2CT8A 4OEHA 4GPZA 4M8KA 1KR5A 1B8OA 1XMJA 3GNLA 3VGPA 3CZCA 1XFAA 1R0CA 1JFLA 3LTNC 4YCCA 1GZSA 3PPWA 5ENDA 2GK3A 5BO5A 1G8JA 1SVKA 2VJKA 2RKWA 2QN6A 5EPOA 5F73A 2FF5A 5EQJB 4O4LB 1WVMA 4BGDA 3PPYA 3E9DA 4R1NA 4DDWA 1RZRD 1N6IA 5ERYA 4MVXA 1LRJA 3L8GA 3RWMB 4WN3A 1WBDA 1ZW1A 1P2BA 4BP3A 3F78A 4H6VA 3MXTA 4NZNA 3T41A 3O8RA 3HN7A 2CHFA 3DF9A 3MG9A 1B93A 4NCJA 3ZOKA 2R0QC 1ZVVA 3EMBA 3SBDA 3TQFA 1SCUA 3TUZC 4N54A 1NI4A 1DRWA 3FYDA 1W36D 4EX7A 2J9XB 2R7AA 2B6HA 4RD0A 1HG0A 1I2DA 2AT1A 3MJTA 2IU3A 1D4OA 1U3WA 3FZQA 2PQMA 3QZUA 4BMCA 2QSJA 1HM5A 1O7JA 3TCXB 3GLGA 2GCOB 4DCSA 1TTPB 3N58A 3MHTA 5JQGA 1P5HA 3O83A 3KZ1E 1V3UA 4IHKA 2ADFA 4AUEA 4HV4A 3IPYA 1AGRA 4GI1A 4HH1A 3H5TA 1LI7A 5C3UA 4NY1A 2X42A 4MX8A 4BMVA 1BCRA 2ZB2A 5IJ9A 5A0TA 2ZI9A 5G41A 3MVEA 1H3NA 1DRJA 2FN3A 1FC0A 1PV4A 2BM0A 3BT7A 5CCXA 1L1RA 4X1KB 4YXWD 2ERYA 3COZA 4JB8A 1QWOA 2GK6A 5KTYA 2VZLA 3AUXA 1TM3E 3TLYA 3PE3A 4V0SA 1ZJYA 3MPUA 1EM8A 4IF4A 3VISA 1SUPA 1K7EB 4Q39A 3RRZA 1XTRA 4IAOA 1XNQB 3R7WA 4M9SA 1FE8A 4O4HB 1DHRA 1T0PA 3UJ3X 4IMJB 1R9GA 2P62A 1ZK1A 2TMGA 3DEHA 4OFZA 4YR7A 4R0VA 4EF6A 3ULKA 4MVJH 3TZHA 4HMQA 2XUPA 4MRNA 2OCPA 5JSZA 3H4IA 5HSGA 2BTQA 2XOKD 4PO3X 1DGQA 4L2IB 3L05A 1YDEA 1TC1A 2XYPA 1RI2A 2FVXA 3C3WA 3AYZB 1EGMB 3CF4G 5L40A 1N3YA 4DCCA 3DUWA 1IN6A 1PFWA 2LTAA 2RHCA 4HQFA 3C8DA 3RVRA 1R5JA 4CIBA 2P0AA 5HBGA 2C8VA 3A9SA 3ABQB 4I9HA 1KAQA 3PPVA 4FR5A 4JKOA 5T4FA 4FSHA 4I4IA 5E3IA 4BNFA 4AP6A 4R9VA 2IX3A 4GOXA 5CYOA 2IHTA 1VIYA 4XQ0A 3W9YA 1FXSA 1V1JA 1I4TD 3HVIA 2ZKLA 1Q1QA 3D4OA 4WOPA 3SJUA 5LU9A 1Q16A 3AF5A 4QBTA 5E1MA 1T5BA 4RUKA 4WFQA 5FR1A 1ESDA 2ZJAA 1UKBA 3DZIA 1ZYUA 5EY5B 2OGTA 5KS2A 2HHLA 2QAJA 4QPZA 3UANA 3AI7A 5DM0A 5IDWA 1XD9A 1IM5A 1EUZA 2XB9A 3GRVA 1GA1A 2WHEA 4GYWA 4KGZA 1IHPA 2B7BA 3EXEB 4G4IA 4E12A 3ZHSA 1NDQA 1Q0UA 4R71A 4QDUA 2C2KA 3HSSA 4NOKA 1YVEI 4XASA 2V6IA 5I5EA 5KC8A 5KOHA 2PKYX 3F5DA 5DZSA 1TVKA 5TPWB 2C8KA 3TQOA 2H1WA 3REOA 3QU2A 2RK3A 2VAPA 4RLSA 1RU3A 4X92A 3NOVA 4AP5A 5JMTA 2PV0A 5TJHA 1WXWA 5EL0A 1M8JA 1DC5A 4C76A 1KYTA 1USGA 2OUKA 1QONA 4EUSA 1M2WA 3AKEA 2IIBA 3ZNQA 3I09A 2IDJA 5LYJB 2O20A 2WABA 1WOYA 4NXNB 3QHPA 2XGOA 1KFKB 4JLAA 3KT0A 3C3XA 3V7FA 1XYGA 3WNBA 3KPJA 3JQ9A 2W6CX 4DY6A 3T9FA 5GONB 2WZQA 3MGKA 1NW4A 1OR8A 2B2CA 3R0XA 4LMRA 4ARVA 3D54D 4YXFA 3MJCA 4TV9F 4UC0A 5CT5A 4DJTA 3OOJA 4TMXA 3EGDB 1X1CA 1VE9A 1Z5ZA 2Q3JA 3B36A 1CZNA 5EHNA 4FHFA 5A4DA 1F7UA 2AEJA 3JARA 1B0UA 1A9RA 3FBTA 2AFIE 3NS7A 3FUVA 1EFVB 1Y4SA 4UAGA 3PPXA 3PFNA 2HM7A 3HCOA 3QVXA 4B3TB 5TNXA 2IW3A 2CB0A 3K9GA 8MHTA 1VTKA 4YI3A 4DB4A 3HDQA 3CBGA 3MWDB 4M9CA 3R5HA 3CUYA 5AK5A 2NU7A 4NLLA 2XZDA 3T4XA 4HAUA 3V1YA 4GS5A 4DCVA 5G2OA 4MRPA 2RH8A 2RC5A 3WGMA 4ENWA 1SBIA 3GLUA 4JUCA 5FH9A 4ZDWA 1I94B 1JHAA 4F4IA 4FN5A 3WKEA 1QGDA 1C8BA 4HQNA 4CMIB 5E4YA 3OZ7A 3BS4A 1H94A 1Y3IA 4MGZR 1TK2A 1QBGA 3BWMA 1Q6YA 5ELLA 3IAM6 3S7ZA 1IBMB 3L5OA 4XB2A 4C0HA 4MLCA 1ST3A 1XZGA 1YTLA 3I2HA 1PJ2A 1YB7A 4BJ5A 3UK0A 5D86A 2B8NA 2RHJA 5ESDA 1VYTA 4RS3A 4RZSA 1OU4A 1WHTB 2DAPA 1JQEA 1TKCA 1E1RD 1Z7EA 5CVEA 1PJCA 5F12A 1RRFA 3H5AA 4MEBA 3I45A 5JMPA 2F55A 4B3JA 4E5DA 1FOEB 4A2QA 4PNEA 5LJIA 3UJDA 2ZXUA 4ZK6A 3I8SA 1SXQA 1OLSB 1K8XB 1AF4A 2J32A 4DA0A 4ZICA 1JLLA 5CPFA 4W7IA 4AB1A 1ISJA 1TCCA 4OQEA 2P0EA 5KKCA 5KNBA 2OZEA 1K6XA 5G0TA 1P2FA 4OL0A 3PTAA 2DKFA 4L8GA 3H1FA 2HT6A 4NQRA 3ZHZA 4AQ7A 2KLBA 1ZMRA 4LTMA 3CW8X 5BNWA 1OILA 3EZYA 2AJBA 4GBMA 4GXQA 4INZA 2MINA 1K5DA 4OXIA 1Z7GA 5BYAA 4GC5A 2BM8A 1QQTA 3NBUA 4OGLA 3DCNA 5HM6A 5HOQA 4PSVA 3RWOA 2P9CA 1YKSA 4HJXA 5DI9A 1R1DA 2AI2A 3I37X 1QQBA 3KOZA 4H7DA 1MZPA 1Z62A 2GO1A 3VR3A 3AIMA 3K5WA 2FSHA 3PFCA 3F0TA 2N3ZA 2D1QA 1ZDMA 3HO1A 2A0FA 2CYBA 5JZMA 4LQLA 4RPKA 4QARA 2GCOA 1TUIA 2XV1A 3F3KA 5AK3A 1EESA 4KSBA 4HB2A 4A0RA 1Z4LA 4PRLA 2RGDA 4BX3A 1QPZA 2YV5A 1U0EA 3FGOA 1Q0RA 3LXMA 3RVPA 2XBMA 5ER6A 1VHJA 4MGEA 2G72A 2AR0A 2GXSA 3AP2A 5FB3A 4DLPA 3VR6A 1QZTA 3G8AA 3L8DA 2ZRAA 5HGXA 1GDHA 3MWEA 4JVNA 3ZHRA 1DBQA 1RJEA 1FFHA 2RAVA 5JNLA 3QXCA 3R77A 4H18A 4ZIRA 5LQMA 1ZHOA 4K46A 2XF8A 3G23A 2GKGA 1M2FA 2WVAA 2OHHA 5KX5A 1L3BA 1EFCA 3G79A 3EGEA 1JMKC 1ZGGA 3COWA 5DEOA 2RHTA 2UVPB 4CIVA 2EEPA 4EMSA 4YYZA 3U19A 2P65A 2AIRA 2GPAA 3KT6A 4ESVA 1WBBA 5LBUA 2VK4A 1E7WA 1E0AA 3WRYA 3GEGA 5LYYA 4PX2A 2ZE5A 4KP7A 4WXEA 2N47A 2DBYA 3RHTA 2FWBA 4QEZA 3NMUF 3DW1X 4GUAA 1SXJD 3ICEA 3AV0B 1JIJA 5IBCA 1VE7A 5K3AA 5BR7A 4H15A 1DFGA 5LMZA 3GCWA 3ZGXA 3C7TA 3QMVA 2Z2KA 5KHLB 4NV1A 3TL3A 5JEDA 2YXPX 3BRWA 3OF2A 1SIBE 3QE9Y 3N5KA 5FBKA 4ZVSA 2I8AA 1UT6A 3M4XA 2V8BA 2Z58A 3BCUA 4PPGA 4DUGD 1EFKA 1VFNA 2GM4A 1N33B 3NHUA 3FX2A 3LUDA 1W5FA 1P2VA 3W0LB 3IP5A 3C3EA 2GTPA 1H3FA 5BURA 3ORQA 4R7TA 2C92A 2C9OA 3GLVA 2VP0A 3LS2A 4AKSA 2WWWA 1C7FA 1GVHA 3P5BA 4TTQA 3MT0A 1YJCA 1XJ5A 2KHZA 2WJ6A 4XW2A 2FPGA 4M7PA 2FW7A 2GLUA 3M5CA 1E1NA 1RBYA 2Z3ZA 3L1VA 1L5WA 4OHFA 1BA2A 2BJHA 3FLAA 2Y9MB 3PKJA 4HXFB 1K8YB 2IK8A 5EXPA 4NU5A 4E2XA 4CIXA 1NF2A 3MUEA 2OCLA 1R0XA 1NW5A 3PQ5A 3C0KA 4XPIB 2E5LB 3IV7A 1K7FB 4FR2A 4PNZA 1WCWA 2WW8A 1HEIA 1SB8A 2QN3A 3H84A 3L1KA 4CM3A 3GR6A 3PS9A 1TX4B 5AIAA 4LRYA 1O6ZA 4H1TA 3VQTA 4PPYA 1GPDG 1CW2B 1XJCA 1IN5A 3Q15C 5DRTA 2G83A 2P7IA 4MB6A 3X0DA 5I7EA 4WUVA 1BROA 1G7RA 3KFLA 3B3FA 4F93B 5MFPA 3SBXA 1GPYA 4S1OA 3IEMA 4KNYA 5CVJA 1GADO 2BIFA 4L8YA 2H31A 1TD9A 4WKPA 2VF7A 2F3PA 3NHJA 2IYTA 1UZLA 4C0JA 1JLMA 5B4TA 4CHGA 2G0TA 2H18A 4B3HA 1R6DA 2D1YA 2QENA 3G9UA 3PFHA 3GDHA 4LQCA 3WBJA 5GIOE 2H7YA 2XVYA 1FDWA 1XP8A 4B4OA 3MGAA 4YACA 3VYVA 3LX5A 1YZQA 2HXSA 1T2VA 2XLCA 2ZTHA 2IITA 3FFTA 3CNNA 1IJBA 1ZHHA 2R00C 4KQWA 1E3JA 2GFQA 2PFKA 1Y9ZA 2RONA 3IUPA 4MUEA 4C7BA 4DV4B 2LRHA 2YWDA 5AKHA 3HY6A 5I3ZA 5ILGA 1R9MA 1VMAA 1AMNA 3QKRA 3ZXXA 2QA5A 4UFPA 3HJHA 3EE6A 4M54A 1RLOA 1V16B 1NC1A 1O8BA 2D3WA 2HWKA 1EA7A 4YJ2B 3JWJA 4RC9A 1L1EA 1QS0A 2F48A 2YXEA 2C94A 3BILA 3MNFA 4X94A 2HF9A 1NVMB 3IUSA 1QLJA 3ND5A 3BERA 3T7SA 4XZ3A 4RD6A 4RX1A 5KYYA 1N2CE 2JF0A 1FDSA 3AEQB 3VNRA 3FVWA 1IIRA 4U4AA 4FHCA 4QPPA 3MSXA 1FFGA 3FRIA 1RAFA 3BMOB 3NFRA 4WY5A 4DMRA 5DM1A 3ED1A 1K6JA 5JCJA 3WK4A 5EE3A 3D8RA 1ADBA 3HS3A 4P0TA 3HUDA 2RHHA 5LP1A 4DR6B 1T6ZA 3RFFA 1D4FA 4BTEA 3OQHA 3GLIB 4RZXA 3K94A 4KMOA 4ZOQI 1RQ7A 2AI3A 4RCYA 3OZFA 3W4KA 2XNDA 2C97A 5CT6A 5ALJA 1X7ZA 5EQDA 3D6HA 1HE2A 2P4HX 3TRIA 3U4DA 4E3WA 4ASUA 2G5PA 4CMKA 4ZTUB 3LT2A 3AXSA 2GYYA 1XTZA 3R3VA 2J6HA 5HJEA 1B1CA 2AFHA 4CL2A 1HLFA 4A0FA 3B51X 1S3IA 3B3QA 3EMDA 5DFAA 2WQ7A 1PFVA 2FEOA 1SCJA 3I0MA 4JBHA 2PHZA 3ZR4B 2XCTB 4FYHA 4UJ5A 1QE3A 3ACBA 5EKDA 4G1CA 4L0MA 4HXEB 3AL2A 3WLLA 5CB4F 4K9RA 1W2HA 3IC5A 1BA3A 1CFJA 4S1TA 3I1JA 5ES4B 2EW2A 3G0GA 4XRGA 5J58A 1M6YA 5GINE 1NLYA 4PSUA 2VBFA 5DX1A 1JA0A 1NC3A 3DMYA 3KEMA 1OCEA 1FFXA 1BWRA 4OB6A 2ZP1A 4B4DA 5LWQA 4OX9B 3P7MA 4DIFA 2VQSA 3P9NA 1IN4A 4NH0A 1DHTA 1KS2A 2FH5B 1G7TA 2YVLA 1DJPA 4N3AA 4N40A 1JI3A 1F2VA 4Y9SA 4LF8B 4DC0A 3KTDA 1ONSA 2G63A 3F1KA 1OI4A 2QRQA 3RT1A 3ILVA 3D4LA 4BU1A 2WWYA 2DFNA 1Y1QA 4BKUA 2WWHA 1SEPA 1V71A 1VKHA 1JILA 1QHEA 5EVJA 5IAKA 3AO0B 4WKCA 2CHQA 1U5AA 2HT1A 3OQNA 2QY6A 1Z29A 1ZKMA 2PGXA 2QM7A 3OOWA 4X1YA 1F6DA 4TKMA 4TV8F 1P7YA 5AJTA 5CMLA 2X77A 4Q3AA 4BFXA 1XAIA 1HLDA 2ZIXA 1OYYA 1N6LA 3FNGA 2I7XA 1CVLA 1SURA 1NIJA 3HYCA 5FPHA 5IJAA 3T3MB 3B6ZA 1AO3A 2QORA 3EG9A 2GCEA 3OTGA 1LBSA 2EP8A 5KPJA 3I6YA 4PWYA 4AY3A 4P4SA 5DPMA 1U1IA 4BLOA 1HEYA 2P79A 4XOIA 5THXA 4AMUA 1ZL0A 2MHCA 2XZOA 1FW6A 3MUFA 4KPUB 2AOWA 1I9GA 1QXSA 3AP1A 4ZTZB 5JANA 2V3WA 1G98A 1KH3A 1S8FA 2ZLBA 4FOSA 1RQNA 4J49A 2R60A 1CJTC 3TTSA 4C7MA 4Q0MA 1QK4A 5D3MB 4YWJA 3FLEA 5D3QA 3KOUA 4RF4A 1JVSA 1RC8A 3C8UA 1W0KA 3DDZX 2VF8A 1Q7RA 3OZDA 1RABA 3SHOA 4TQAA 4B7AA 4R1LA 1J0EA 3WDMA 3ZE7A 1GV0A 4ETWA 1ZWKA 3F8TA 1KEEA 1TCAA 3KETA 1L7EA 4KQKA 1HL3A 2IVFA 1YUBA 1Z5WA 2UYYA 2Q4EA 3DMFA 3COPA 3CW2A 3LLVA 2VNIA 4NJEB 1E63A 1GQRA 3DBHB 2H4JA 5J5CA 5IVPA 4M0EA 5BXYA 1JXMA 5LOVA 1L1FA 3A6DA 3EFBA 3ES9A 4I4TA 3LKBA 5G3ZA 5FHQA 1E2LA 2EP7A 1Y5MA 3BHMA 4BB9A 4PYRA 2ZYIA 4IXMA 2NTYC 3SS9X 4KXLA 4MI9A 1D03A 1MX3A 3OIDA 1PJSA 3UQZA 1U0JA 1J9ZA 2P1ZA 2VTVA 4Z9FA 2B82A 5KU7A 3MCTA 4WGFA 3OE7A 2CK3D 2P9YA 4OSOA 4TVKA 3ZXYA 4CKEB 1JU4A 3ZLJA 4I1YA 4DLVA 2J5BA 4IDNA 4N6OA 3SHVA 2V7PA 1R6UA 2QYTA 5TQJA 1GSHA 3WO1A 1KDVA 4QWWA 3PRYA 2PZAA 2R6CA 4L08A 5E4JA 4CM1A 2IHNA 1E89A 1AKUA 2B7LA 2FU5C 3R6WA 4GMKA 1BHSA 4P5PA 821PA 4A6PA 1B73A 2WFLB 3INTA 5IM5A 1OLUA 4XJSA 1R64A 4BYGA 1PNQA 2I91A 1EK2A 1JYFA 4UU1A 4F91B 1A2QA 2HRZA 2PAFA 4JXKA 4ZOLF 2HMAA 5HIAA 1LW7A 3WZ2A 4EFLA 1GNPA 3IAXA 3KOWA 1JG6A 1GZUA 1SRQA 1OI2A 5IWAB 2C9MA 3SDZA 3G13A 3VHQA 5BYJA 4KR6A 4F71A 2OYCA 3LFTA 1U2DC 4PF1A 4HMPA 4IL5A 1GUZA 4CT5A 2WM3A 1T5IA 3FPJA 3PNYA 4O25A 4BFCA 5B2EA 1FUIA 3SBOA 3V7UA 3RYIB 1TFUA 3C24A 1KMNA 5JCZA 1F4LA 1PBTA 2H0QA 1AXGA 1HETA 2PWBA 1SXJA 3SFVA 4MUGA 5IAAA 4DAEA 4TZ6A 1ZH0A 2Q2VA 2V0NA 4GZ3A 1GITA 2O2JA 2ZQZA 3BDVA 1YCDA 3A6KA 3H3JA 1N92A 3IHKA 1WUTA 4EFNA 2EX1A 3WLMA 3S2FA 4FI3F 4ARZB 1OIVA 2NXNA 1W5EA 1WAMA 3HCRA 4QUIA 3DOHA 3N3BC 2BFBB 2VR1A 4V0RA 4KQHA 2HSEA 2SKDA 2GUWA 1QF6A 2OPBA 2Z83A 4Q4HB 4RSRA 4QTYA 2E4YA 1VPWA 3QITA 3UUGA 1KDTA 1BW9B 3HKBB 1E1QA 4M1YA 2QTLA 4EUHA 2WYHA 2D6FA 3NRCA 4B3FX 3REQA 4GFDA 1CR1A 2HPVA 2C59A 4LK3A 4W6QA 4BMSA 1OQAA 1KK2A 1Z06A 3ZWDA 1EFLA 5LKAA 2P2ZA 1QM5A 1ORIA 1W0JA 2VK1A 5KPDA 4NC9A 3NM5A 1Z4OA 2PWYA 4B32A 3O26A 4HZGA 1XQVA 1A8HA 5EXDA 2PL3A 2HJGA 5GQSA 1KWKA 2PA0A 1JMVA 3LPCA 4RDXA 2ZE7A 4TOIA 5KJCA 2O3JA 3DO5A 3PGLA 2NZ8A 4CDMA 4D96A 5D7NA 5KI6A 3BSSA 5JSZB 2C3UA 2UAGA 3J81A 3TTYA 4CQLA 1VPTA 2HMUA 1G8KA 5AXBA 3OQMA 3VNVA 3KAJA 1XT6A 4K81B 1H93A 2D1SA 1II9A 2XGSA 4QFBA 3ER6A 2BELA 2FUNB 1HK7A 1A2OA 1LF5A 1T91A 2NZWA 2OILA 3FYUC 4OYLA 4UM9D 4Z4CA 4GECA 2IWHA 1C3OB 3DQPA 1N0UA 5C7IO 2VJOA 2UXDB 2ZJFA 1C0IA 2I7TA 1NI4B 2BFFB 2R7MA 4MLPA 3MT8A 3MAGA 1Z2EA 2OGSA 4PAOA 2H1VA 3AR6A 3VVMA 2YYZA 1T0UA 1NDUA 3F47A 4LUCA 5FA8A 4YPFA 2VQ3A 3PG5A 3RTDA 5K7SA 3ZBPA 1YZHA 1Z6GA 3DFUA 1IBKB 3VC7A 1IU9A 3LX4A 3NASA 4QPJC 2GGSA 3VSBA 3SQWA 4JX9A 5AJWA 3RC9A 1A71A 2NAPA 1E0SA 3NJRA 4L95C 3SFZA 2R3SA 4H4CA 1L5LA 4LJ5A 3RVMA 1M6VA 4ARIA 1JQ3A 1BCRB 3DDUA 1YC2A 4OOEA 1VP3A 2PO7A 3S70A 1FU8A 1M2VA 3JW8A 3QYJA 5CHEA 3T61A 4A8TA 4CL3A 3R3YA 1Z16A 5CFOA 4FUTA 1BHO1 5BSGA 4YJGB 4B6OA 2GM9A 4BNLA 1N2BA 1ZGCA 3QVOA 5SZHB 2E4UA 2GRAA 2Q5QA 5E2AA 3ZKWB 4IOKA 1IFXA 1OFTA 1GEGA 2YNMC 3R76A 1RLJA 3R4VA 3JPYA 4HNHA 5A03A 2PS0A 3AI3A 3G9TA 1JPUA 3HO8A 2HDWA 4RHUA 5FLKA 1TGVA 1NULA 2WF8A 4UPDA 4H59A 2FWAA 3OJWA 4XFDA 2NV0A 3TVDA 4E5UA 4KPUA 2RG7A 1VE1A 1MUUA 4JEUA 2X0KA 1XNRB 1LPSA 1NM5A 1GYRA 2FLVA 4G5HA 4QAQA 2TSYB 1EB8A 5LCXA 3UMSA 3WLHA 1YFLA 2XKBA 1AZTA 3DWFA 1HOTA 2VDNB 2ODPA 4Q00A 3EC1A 4NF2A 3RSQA 1NJ1A 3IO3A 5JDCC 1GLVA 1P2GA 2ONYA 4OBXA 1XVUA 2Q1WA 1O2DA 3TOCA 2CCGA 5GVSA 5EP3A 1QR2A 1PO7A 2AG8A 2YUTA 2H4YA 1DAPA 3AEXA 2WQZA 1V9CA 3P9CA 4ETNA 5EIFA 1U65A 3J7AC 3KNZA 4ZVLA 1WTAA 4EG5A 4TZTA 4BVEA 2WUEA 3ZY2A 2FPKA 2ZJZA 4XCQA 5EMHA 1HTBA 4W5RA 4OL9A 1NG9A 1BQEA 3S40A 4CXMA 1S7CA 1W93A 1EWVA 1SC6A 1ZCAA 4TMKA 3RS0A 3EBOA 3EXIB 1Z8DA 4G65A 2F3QA 3N70A 2DVMA 3CF6R 1ZM7A 3OMXA 4JKYA 1SC3A 3CUSA 3WLPA 1H2AS 3FUXA 4CKEA 1CF2O 4J2OA 4YJ3F 3SHFA 2WYVA 5LMNB 1P62B 5JCJD 4IDPA 1F1BA 2GEDA 2R48A 5JDCA 2CUTA 3WGZA 3LCCA 5TGDA 3V34A 3NYQA 2VP6A 2XH8A 4RU1A 2VQDA 4GZLA 2VYQA 1YS1X 1NP3A 2R8PA 1QHFA 4C6HA 5HZKA 1UH5A 1CY8A 3ZDRA 2DLCX 3OPVA 2HCBA 3V8PA 2LNDA 1WZUA 2HLNA 2JLVA 4EUFA 2G4VA 1A69A 1PQPA 4RCZA 5IF3A 4NAUA 1LF0A 2JEYA 1L4YA 4K6FA 5JLJA 3P20A 2P9BA 2PGLA 1KIFA 1UWKA 4PHTA 1VG0B 1UOOA 1VJCA 1E6MA 3G3EA 5EIHA 4ZZIA 5I7FA 3UMBA 1YDFA 3OU2A 4HUQB 3OHSX 5EMNA 3GEDA 5C8YB 1QDEA 1GCOA 4IXWA 1TLFA 1B8PA 2XQIA 3CB4A 4FGUA 4R0MA 1T29A 3MAJA 5DTMA 3TSAA 4EUEA 2PZEA 1QV7A 5H83A 3IS3A 2NTEA 1TMYA 2OD7A 3I01M 3IVGA 4H6WA 4NNJA 4AO6A 1Z07A 5KWEA 1ZQ9A 4DLWA 1ILWA 4OHBA 1PS8A 2WAMA 2H7CA 4KIJA 2H52A 4ZXPA 4TXHA 1L4NA 1W4LA 3PJEA 1Z8NA 5FOVA 5IJ0A 3VH2A 3LCRA 4TZ0A 1LUAA 3IURA 4O4IA 4H6PA 4ZJPA 4TL7A 2J5RA 3G2KA 5FPTA 1ZAKA 2Z57A 2ZEJA 3UHAA 4W1SA 1VE5A 1XZFA 1VA4A 2V8OA 3PFWO 5EZYF 3ZWVA 4Q7MB 1BDIA 4F2GA 3LQYA 3DC7A 3PFKA 1WCV1 4EJFA 3TRKA 3FGPA 4ZAGA 1C7RA 4X84A 1W47A 1HTWA 2XZTA 3MD9A 2OXIA 3H1BA 3ZCTA 2NUAB 3ODGA 1OLSA 5CLGA 3WLQA 2QS9A 3WYBA 1PAUA 4GKVA 5K3EA 5K6AA 1ECLA 5DK6A 4JJ6A 4NCXA 2AEMA 3ITKA 2WJZB 4GZ6A 4R2LA 1CIPA 1QH1B 2QAGB 4XIFA 5HK9A 4BXOB 5J1SB 1O96A 1KF0A 4CQJA 2PANA 1VMKA 1TB4A 2GD1O 2YMPA 1L8LA 2QN2A 3BSYA 4AP9A 3D31A 1GILA 4F04A 5B7PA 1EFHA 3LYHA 2BP7B 1INLA 2QR2A 2W90A 4G5QA 3HR7A 4HAYA 4O1MA 5B1DA 3HN2A 1MP0A 4ZKEA 4PZAA 3AOEC 1HZZC 3VJMA 3BXXA 1ZRMA 2C2HA 5EUQB 1E3MA 1C3OA 1X3LA 1RFLA 3PXBA 2C5HA 4BNXA 1DAHA 1JA1A 5T7BA 3Q0EA 2I6GA 4PCLA 3PGJA 4YROA 1LI4A 3DBRB 3GPCA 5BVHB 2PU5A 1RRCA 3A6PC 4RAQA 4DJAA 1SA0B 1PQ4A 3PHLA 3VTFA 1ODFA 3U5TA 4QU5A 1SQ0A 4ONEA 2R8EA 1U98A 4FFSA 4RESA 1PJBA 3BGSA 2FMIA 2P2GA 5CRIA 3PJRA 4MPPA 4UEJA 3H1EA 2FG7C 4E22A 4YRNA 4ZI3A 5KQSA 8ABPA 4HQOA 4X90A 5EP1A 4REQB 2CLKB 5NLLA 4PLPA 3O94A 3UXMA 5C8XA 2UUCB 3G2MA 3ZLUA 3IBYA 4DJ5X 2ZJ5A 3H5WA 3CZRA 4KBYA 5LJLA 2G67A 5EJ2A 3P94A 3IQDB 3ZKWA 2QMQA 3NTLA 2PUAA 3U56A 1L4GA 4PQGA 3FUWA 4DABA 3K96A 3W6OA 1SCBA 5DT9A 3JTEA 4GGMX 3HJUA 4DCMA 1RXIA 4G89A 4M1QA 3RUCA 2JFPA 1X8KA 3TN7A 3KR2A 2WIJA 4OSEA 3KC2A 4IILA 3S27A 4II2A 2POCA 1IULA 2LCQA 5KWIA 3TLMA 1NN1A 2PXAA 1AKTA 5AH0A 1XXHB 3EODA 3PQ7A 2DFDA 1A98A 2GF2A 2FEAA 2ZANA 4LJ4A 5BV2P 4MR7A 4LXYA 3T7JA 3RLIA 3G5UA 1E98A 1OC4A 1MV5A 2JCSA 2FPIB 2DFVA 3GP3A 2WIBA 3MBOA 3MQ4A 4HWPA 4CKXA 3B60A 4ZDKA 4J0QA 4J0HA 1XWIA 1MXHA 1ZJ6A 2FW9A 1ZSVA 4WFJA 4LF7B 3O6VA 1Q50A 1IUKA 2D0IA 2JLSA 1CZRA 2WUWE 3C7KA 2RGYA 3BGWA 3ILHA 3VR4D 4JGGA 1CNFA 3B20A 4ZVUA 2LWIA 2XGGA 3W1WA 1AQ6A 4KWCA 1X8LA 2QZ4A 5EIAA 4AS2A 1S2MA 1T6YA 2OXRA 2C9YA 2WIFA 4NH4A 3V3KA 4BNIA 4ZJUA 4B83A 2VH5R 1Q1BA 5BSVA 2I6SA 2J7PD 1YCHA 1A9SA 2P9GA 1LTKA 3GOQA 3BUSA 3H6KA 3HN6A 1S8OA 5T4BA 5BQ3A 1M1YB 4UU7A 3C39A 2KLHA 1XCBA 5JXJA 2FPGB 5L8VA 4U7GA 3RUAA 4YB8A 4HFNA 2V7UA 2XVXA 1CQWA 3O73A 2Q7XA 4F3CA 5K99A 5GJVC 1TAHA 2GZ3A 1QUEA 1QVAA 1P6QA 4R98A 5BN4B 3SQDA 4AI6A 4QM6A 2FGKA 2CL5A 1VMEA 5AOCA 4CU2A 1U5BB 5AK6A 1CBUA 4GW3A 3UHJA 3WS7A 4MQEA 4OQNA 1KFJB 2WJIA 1IVNA 4BBZA 2IXBA 4PSDA 2B5WA 1BZYA 3L43A 3N6VA 4B9EA 3RFTA 3RGGA 2NSLA 3CF2A 3AFMA 2WP8J 4ZHQB 3K1AA 4Q82A 3F9IA 1SCIA 1JG3A 2R4QA 3H7AA 4WCDA 2YASA 5AOAA 1D2NA 4ZOCA 2HDNB 4OTZA 4UZFA 2X0JA 3BOSA 1R4ZA 4URHA 5LB4A 3WWZA 4WK6A 2NP7A 1PQUA 2HRQA 3I9KA 5EJAA 1FFWA 2QV7A 1GZ6A 1VHWA 1YZ3A 3MCZA 1HE5A 3K5HA 4Q19A 1NQXA 5K3DA 3SX2A 3QW2A 2I2CA 3BIFA 5EXSA 3F6BX 4NBVA 4WKGA 4EJMA 1K1EA 1JFFB 3T5GA 3C7DB 4D3FA 4HUQA 4GUDA 2G04A 2EYQA 1YDHA 2ZQYA 3AGQA 3OX2A 3WBBA 1Y3DE 2C2BA 1XTIA 2AQIA 2JL1A 1RJ9B 1K4KA 4ZYWA 3JALA 5JPCA 2A58A 5AO9A 1NVVQ 1D1QA 2QAGC 2P9TA 4ZODA 2HLPA 1Y89A 5FYDA 1QOZA 1YL6A 1MRZA 3CN9A 2WV7A 2FUKA 3HPRA 4K3UA 4PC6A 4GLJA 1Q1ZA 3O75A 4FONA 1TU4A 1NY5A 5DHTA 3SXJA 2WQ6A 3GLGB 4D97A 2I7CA 1L4MA 5L51A 4Q93A 1NXWA 5B55A 3RIGA 5JZOA 4F12A 3DYIA 2J45A 3AEQA 5CNMA 1FY2A 1YV9A 1Q1AA 4KQCA 1QOQB 1E18A 1S6YA 1ZVMA 3W5UA 1EIZA 5CXXA 4MRAA 3D6FA 1U8UA 3OLCX 4Q5IA 2CFIA 3RC7A 2P2LA 1XHLA 1I3NA 4WEQA 1Z26A 3O84A 4A82A 4ZVVA 3IE1A 1L5MA 4M9ZA 4X1KA 2XHEA 4TLCA 1KSHA 1YBVA 2M6SA 4BLQA 1KI4A 2HBQA 1HFEL 3CO5A 3LOQA 1QHGA 2QW8A 4Q3NA 3LUBA 4M3NA 4MDYA 1S3SA 2FZEA 3P0IA 1DCMA 4H7JA 4NFYA 5E7MA 3PFFA 4NP6A 5EEGA 3ZV3A 2BMJA 3FNHA 1EBBA 3KUXA 4XVUA 2JFGA 4RGVA 4X7RA 3UK1A 4L0DA 3O03A 4DIMA 2XE4A 2XYHA 1TZJA 3N0RA 3I61A 3PVZA 4MYSA 1X70A 1HA3A 3H83A 4X7MA 2EQ5A 3ZS9A 4GICA 2H4HA 5B1IA 2H7XA 1K7XB 4LYHA 3AHDA 4QEKA 2JFWA 4L4XA 4F8EA 3FWKA 1Z36A 2I2XB 3I34X 1N5IA 1UBMS 3EFHA 1BE8A 1FFXB 2PTGA 2WKRA 4NFHA 4G5FA 1PJQA 3KSBC 5A7HA 3THXB 1L4UA 4N5DA 2VSXA 4W5OA 1SVIA 4B2LA 4HEJA 3UMFA 1DJNA 5EUCA 2IEIA 3PR2B 5IK2D 4RQBA 2HGZA 2JDIA 4RHFA 3UA3A 1SQSA 1DLIA 2WG1A 3EIXA 4U6QA 1RYDA 1KVRA 1J97A 1UP6A 2BBTA 2W2OA 3JAWA 3NWEA 1KK1A 4YJ3A 5CFPA 3Q6NA 4J2TA 3PIRA 1AUXA 1G8SA 4JQSA 4EYSA 5KTSA 3GEIA 2OCYC 4HAWA 1H1TA 4TXJA 5BMOA 4OXRA 1DXYA 2PZMA 1YK1A 2C1ZA 1PUXA 4PZ0A 2WUDA 4Q6BA 2PMDA 1H0KA 2J6CA 4ARAA 3EEFA 2HSJA 1I4WA 1UAGA 1YDMA 2Y2UA 4WH0A 4BECA 2W37A 3AT1A 2IEYA 2W0SA 1O8CA 4FIDA 3VJLA 4NMMA 4P4SB 3GUYA 4NCKA 1HI9A 3A04A 3CZMA 1J20A 4LZAA 4PPNA 4HVCA 2QUKA 2O4CA 3DPUA 3KPWA 5JNVA 3NHYA 4IX1A 4UCWA 4DIOA 2XB2A 5CDTA 1QH9A 1C9MA 1HDRA 4MS1A 2XECA 1PWXA 5AVYA 1ML4A 3KQQA 4Z0PA 2VYVD 3LU1A 2I2FA 1W96A 1YIAA 3IPRA 4HADA 2FSPA 3SZUA 5KSWB 1N2GA 1WLSA 1Y5IA 3E2PA 3IVMA 1XNGA 1Z4JA 4FEEA 4FOLA 3F5FA 1RHUA 1TMKA 1SBQA 3THRA 1IXRC 2FPIA 1DMRA 1H2YA 1FUYB 4FMBB 4EG8A 4DDTA 1XQ9A 2X5OA 3OBIA 3OQPA 2NPFA 3S3TA 2O8FA 5IC6A 1QAQA 3EGDA 3B7GA 1JLHA 5I9SA 3ZYCA 4BGIA 1T5DX 3A25A 1VE3A 3P0HA 1ZJ5A 3E9NA 4WJZA 3ENKA 3ICQB 4KAFA 4LJSA 3LDFA 4XYEA 3OTIA 1WDLA 4UDYX 2YYSA 2X9VA 3TBKA 2IE8A 1FP7A 3WQSB 4IGEA 1TYBE 5TB5A 1KY3A 4C6TB 2C96A 1IDN1 1VKRA 4P8RA 2TMYA 1CRZA 4WESB 4UBIA 1ZBDA 1SXIA 3GA7A 1JKJB 4IIDA 4MINA 4D80A 1OX5A 3FTQA 4LJAA 5AVQA 4OGWA 3UENA 2W48A 3G8DA 1E96A 4C78A 3EY4A 2XWSA 4HOYA 4DR2B 2YY6A 2OAGA 2AQ8A 1TM7E 4RDHA 3PQFA 3AF3A 2X58A 4YAIA 1OIWA 3P4XA 4PCAA 2ZBFA 3MWGA 1GJRA 4EJSA 1E69A 1NNLA 2Q45A 5LD2B 3GU3A 2O8DB 1Q1NA 2R65A 2RFLA 3TQIA 1PT9A 1IBSA 4L16A 5CD9A 4OAOA 3VUFA 3LT1A 4CDRA 3KZCA 3O90A 5DYNA 3JQAB 3KDAA 4RFSA 3T0IA 4G0UA 4O3FA 3CEMA 3K1AB 2JGFA