1WSDA

Alkaline m-protease form i crystal strcuture
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
269
structure length
269
Chain Sequence
AQSVPWGISRVQAPAAHNRGLTGSGVKVAVLDTGISTHPDLNIRGGASFVPGEPSTQDGNGHGTHVAGTIAALNNSIGVLGVAPSAELYAVKVLGASGSGSVSSIAQGLEWAGNNGMHVANLSLGSPSPSATLEQAVNSATSRGVLVVAASGNSGAGSISYPARYANAMAVGATDQNNNRASFSQYGAGLDIVAPGVNVQSTYPGSTYASLNGTSMATPHVAGVAALVKQKNPSWSNVQIRNHLKNTATGLGNTNLYGSGLVNAEAATR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords M-protease
publication title High-resolution crystal structure of M-protease: phylogeny aided analysis of the high-alkaline adaptation mechanism
pubmed doi rcsb
source organism Bacillus clausii
molecule tags Hydrolase
total genus 98
structure length 269
sequence length 269
ec nomenclature ec 3.4.21.-:
pdb deposition date 2004-11-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00082 Peptidase_S8 Subtilase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.200 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Peptidase S8/S53 domain 1wsdA00
3D43A 3DE0X 4RYDA 2ID8A 3PTLA 4KG7A 4OMDA 4GI3A 5B1EA 1WMFA 4AKTA 1V5IA 5JXIA 1TM4E 1GA4A 3A3OA 4OV6B 5AVJA 1SVNA 4MZDA 4J94A 3VHQA 1SCAA 3WHIA 3TI9A 2W2QA 1SUAA 5ARDA 1XF1A 4KB5A 1SCJA 3DE3X 3L1KA 2V8BA 1SPBS 3I34X 1YU6A 3CNQS 1EGQA 1GCIA 4AKSA 1HT3A 3EIFA 2ID4A 3Q40A 3I2YX 3DE5X 1AH2A 2GKOA 3A3NA 3DE6X 2Z2XA 3GT3A 1WMDA 1GTG1 3WIUA 2Z56A 1AK9A 1SUCA 3F7OA 3QFHA 3F7MA 4DZTA 2W2PA 2X8JB 2SECE 2Z2YA 3ZXYA 2DUJA 4C3UA 1AQNA 1IC6A 1TO2E 3ZXXA 2PKCA 3PRKE 3VYVA 2WV7A 3QTLA 1NLUA 1Y33E 1GNVA 3DE1X 3Q5GA 5JXHA 4NMXB 1VSBA 1SIBE 1BE6A 2W2OA 4H6WA 3DW1X 5SICE 1AF4A 3VTAA 2TECE 2E1PA 3CO0S 5K7SA 1SUBA 3BX1A 3EDYA 4DWWA 2Z30A 2ZWPA 4FONA 3DDZX 4JP8A 3VSBA 2PRKA 1PTKA 3OSZA 1PJ8A 1C9JA 2B6NA 2SICE 5FFNA 1KE2A 2Z58A 3GT4A 1MPTA 1OYVA 5ARCA 4I0WB 1BE8A 2PWAA 5B1DA 5JMOA 3AJ9A 5FAXA 1NDQA 2PYZA 5AVKA 2WUVA 1C9NA 1DBIA 4YN3A 1BH6A 1GA1A 1CNMA 3I30X 4Z2AA 1BJRE 1SBTA 3BGOS 3SQOA 2HD4A 3TI7A 1SIUA 2X8JA 4LVOA 1R0RE 3DWEX 1BFUA 4H6XA 2DQKA 5CW1A 3LPCA 1TMGE 1R64A 2Z2ZA 1P7WA 1T1IA 1PFGA 2SBTA 3LPDA 3I37X 1C3LA 5AQEA 1LW6E 1Y3CE 4CFZA 3DE7X 2PMWB 3BPSA 1Y48E 2XRMA 1YJCA 1Y3BE 1SN7A 1WSDA 1Y4DE 1MEEA 2PQ2A 1SBIA 2QTWB 1YJBA 1JEAA 2DP4E 2IY9A 1Y34E 1TO1E 3GCXA 2G4VA 2WUWE 1SBCA 4C3VA 3DE2X 1AU9A 1SUPA 1P8JA 4CG0A 4ZOQI 1OYOA 2ZRQA 4K8RB 1ST2A 3DE4X 1WMEA 4BWGA 4WOCA 1GTL1 3VV3A 2IXTA 1EA7A 5I9SA 4NE9A 3DVSX 1ST3A 5JXGA 1KDYA 1ZVKA 1UBNA 4ZARA 3LXUX 3H42B 1SELA 1GT91 4CFYA 1S2NA 1A2QA 3GCWA 3LPAA 3DW3X 3SICE 1IAVA 1S02A 1T1EA 4DJ5X 3EE6A 1SCDA 3AFGA 1S01A 1SCBA 1GTJ1 4M1ZA 3UNXA 4HX2A 1SUEA 3P5BA 2ST1A 5FBZA 4B5LA 1Y4AE 1P7VA 3AJ8A 3D9QX 1SBHA 3DYBA 2W2NA 4OMCA 1Y9ZA 3T41A 1AV7A 1NDUA 5JXJA 1THMA 3VV2A 1T1GA 2HPZA 2P4EA 4LVNA 1KE1A 1KDVA 5AMXA 2ZWOA 1Y3DE 1Y3FE 1Q5PA 1ZVJA 1TM1E 2SNIE 3F49S 4HVLA 1SCNE 4KPGA 4NE7A 3WIVA 2W2MA 5ARBA 2WWTA 1SIOA 1TK2A 1C9MA 3QMPA 1R6VA 1CSEE 1YJAA 1AVTA 2PWBA 1SH7A 3TECE 1OT5A 1BFKA 1PEKE 3HJRA 2Z57A 4WOBA 1SBNE 3WQBA 1GA6A 1WVMA 3DVRX 1V6CA 1TM7E 1TM5E 1Y1KE 3A3PA 2XTJA 4H6VA 1DUIA 1SUDA 1TM3E 3DVQX 1KDZA 1TECE 1GNSA
chains in the Genus database with same CATH superfamily
2XX3A 4PO8A 5HRCA 1NQUA 4US0R 5CK4A 4UBOA 4B3JA 4XUGB 4EYKA 4ZMSA 1GYRA 4BY9E 2Q6VA 3DM5A 1OJLA 2QAGA 5IXYA 2ID8A 4LV6A 2ZETA 1PJQA 5LC1A 2R9VA 3ND6A 1P9OA 3R8XA 5DHTA 1BYUA 5EYPB 4DUGD 5JIBA 3PWKA 3DT8A 2VT7A 4GRIA 5J2TB 5AKZA 3IJRA 5CITA 3WGJA 5LP1A 4MV7A 1V5EA 2WJPA 1E2LA 5T6MA 1MN6A 1ZWKA 3LGXA 4ZTUB 1DKMA 4AZTA 1QX3A 1RWXA 4ZTZB 1KMHA 2QRMA 4X3PA 2UU9B 4LF5B 4LFAB 2Y9PB 3FRJA 1Z0UA 2VUUA 3HJTA 3IP1A 4DV3B 5JY6A 2FQ1A 2QE7A 4HB0A 4I9UA 5G3YA 1N1GA 4M8SA 1ZOLA 3TW0A 4CWAA 3HCPA 4YX9A 3TG8A 4CU5A 1RMQA 3VNUA 1KEVA 2GBPA 2VT3A 3DBOB 4REMA 4JGIA 4QNRA 2O14A 3ZDDA 3ZU3A 4DLLA 4GXQA 5ALSA 3B78A 2PLAA 4E46A 2IP1A 4JB3A 1H4TA 3RSGA 4H7FA 3ZCPA 2CV2A 1GZ7A 4S1WA 4B6EA 3ZVLA 4FUTA 3GFRA 5JYBA 1O95D 1TMYA 2X7JA 3OZWA 4LYDA 4DCNA 1K8RA 4ZODA 1G7TA 4IYRA 3VR2D 1MB4A 5L3QA 2R4UA 3TZHA 1CJMA 4UVGA 5FA8A 3QZUA 2HHLA 3BK2A 3GLUA 1FNMA 4IRMA 4M21A 4TS1A 1SC3A 3D1LA 3QFFA 4F1WA 2I7DA 2Z2JA 3ML1A 4K3VA 3W0LB 4BS9A 2RGXA 3KOWA 1Z88A 3IS3A 4I4TB 2O5RA 2P9EA 3G1TA 2X4GA 1WUIS 2GCIA 3EQZA 2A8YA 2I54A 3DYIA 1W8DA 1UBRS 2LW7A 1UXIA 5AI5A 2OO7A 5B2FA 1ZH2A 3SLRA 1ZI8A 2X5XA 4RGQA 1Y8QB 3QU7A 1XTRA 2JDID 3A10A 2B30A 1Z39A 3LJKA 4M9CA 1J56A 2OVFA 4B74A 2RAPA 1TRKA 2WF8A 3ESDA 2ET6A 3DE6X 1E3SA 2OXCA 3UG6A 3P19A 4X8LA 3KEFA 3AIIA 4DA7A 4F2GA 2EAUA 1AS0A 4GE0A 1AQUA 3MMXA 4GGPA 5A1JA 4Q4HB 4C9BA 3AERB 3CF0A 1B6TA 4ZQBA 2YS6A 2WQ7A 4M0FA 4B44A 1UWCA 5E6UB 3OQHA 1GPWB 4XARA 2AWNA 3PTZA 4ZJZA 2NX2A 1ZICA 3ANLA 1D6NA 4RIIA 3P4XA 4EJSB 3UW3A 4J16A 2EVWX 1M76A 4B0PA 2JZNA 4C3UA 2JLQA 4F5YA 1GG5A 5LMZA 4WZBA 3PIIA 1YASA 1Z34A 2J7PD 3PEVA 2BYTA 1R9NA 3M3PA 2V1UA 4TXMA 1ZNWA 1DINA 3GROA 1Z5WA 2P9FA 2R8RA 4B17A 2GYVA 5J40A 2NSJA 4AUEA 2NU9B 1Z2AA 4CMCA 3D6JA 1W30A 3GUZA 1NY5A 1ZN9A 1AA9A 3IUSA 4NDZA 4ZD6A 2PKCA 5FWYB 4ZCTA 1CQIB 4W5JA 2WWIA 3DDCA 4L78A 3NRBA 3FCCA 2AX3A 3B1YA 4F2DA 4HV4A 2YKGA 5IJZA 3CF6R 2HREA 4HUQB 4X93A 1IPHA 1T24A 2CVHA 1GNVA 3LLUA 5ER9A 3VR0A 3QVGA 1EI9A 1CR1A 1YE3A 4Q3EA 4RY0A 3PFKA 2H2HA 5DDIP 4Z9YA 5TT0A 3RUAA 3R9IA 1M2FA 3QWIA 2CHVA 3O8DA 1BCSA 5COBA 1C3VA 3SIPA 1WE2A 2RGNA 2VP4A 3C5WP 4ZIRB 1CY4A 5C5CA 3WI7A 5CR9A 3SYMA 4ND6A 3ENNA 2VJBA 4GMFA 4P98A 3Q87B 4NYIQ 2C4UA 3BZUA 3H5TA 1X94A 2AQHA 1EFTA 3W5UA 1CZOA 4CLHA 1E9CA 3OZ7A 4C2TA 3OOEA 3EULA 4O4JB 2YMPA 5AI0A 1KETA 3BFJA 2QTGA 5CFZA 2DWOA 4BZQA 2VVTA 4QDXA 3MN1A 2ZJBA 4YCAA 3KSBC 1ZK0A 2BV3A 4E1VA 4C0BA 2OZEA 4LHSA 4BP8A 4IYJA 4KR2A 1X92A 3ZWKA 3HXLA 1X0XA 4ABYA 2FUEA 4D8VA 2GNOA 1TQDA 4LJKA 3WIOA 2XV1A 2ZTLA 4QNNA 4D0SA 5CM9C 1PR9A 1FX0A 1XKXA 3CXRA 1MPTA 2J3KA 1GYPA 1IK4A 1KWKA 1TEHA 2G76A 2JJ2A 2RK4A 2B9EA 5JAMA 3KFXA 1T9GR 2FHPA 1RSZA 1EXMA 4QXRA 4RF2A 5IDWA 4YAFA 1Q19A 2FUG6 1Q77A 3UMBA 1S2MA 1XU4A 1ULZA 2WLSA 5T8KA 4EJ2A 4GPEA 3H8SA 3HKDA 1N2CB 2J07A 4J2HA 4M1OA 4IRUB 2B8WA 3TOZA 2AHRA 5LLTA 2IE0A 2PYDA 4J9UE 4XSGA 3VXKA 4GPZA 1LLCA 3D4LA 1GQRA 3WJ2A 5SZKB 2H51A 3FUTA 2JD1A 1UQRA 2NVWA 4NBRA 3AETB 3LZCA 5CGZA 3RS8A 3PHJA 1OZ0A 2DWPA 3LT2A 1T2AA 3G5TA 3L7LA 1LBHA 2ZDQA 5KVSA 3L7KA 1C9KA 4QXQA 2HU2A 4UBLA 4PZDA 4AZWA 3IA2A 3K6RA 5BRNA 5AKGA 5IYZF 3UAGA 2GK6A 3DOJA 2IEZA 4G6ZA 1NY6A 1T2NA 1PEYA 4NENB 3UV3A 1X80B 1OPRA 2BE7A 2ZIVB 3KX2A 4HP8A 4PC6A 5FLKA 3ZVRA 1YJQA 4M0EA 3BL6A 4OI1A 1SHKA 3B48A 1E2EA 3FYUB 3ZE8A 2ZSKA 3BJIC 4UDOA 2X15A 3F6BX 4RF4A 2XDYA 4ZVLA 2V3VA 3INYA 1E3DA 3ONDA 5EWLA 1Z74A 3HWX1 3DFFA 1CFJA 4DRXA 4O5AA 1FTGA 5G0TA 3W6OA 4LJ5A 1E6LA 2OM2A 2W2LD 3DXYA 4GGMX 5H4HA 3WLEA 3ZJUA 3AC0A 4IS3A 2OBNA 3VO1A 3O84A 4R2MA 5AHKA 3RB8A 1ACLA 3W5SA 4NYMR 5TQJA 3K72B 4YUXA 1H2WA 1FNSA 4GMGA 4P1ZA 1I0LA 1NJ2A 1C7IA 4B6OA 2BR4A 3RTBA 2C4KA 1UBOS 1XZCA 2I1WA 1E99A 2YRWA 3EXHA 3GA7A 3R40A 2R79A 4P38A 1NM5A 2HRZA 2F9FA 2WIAA 3JARB 4JT4A 1SR8A 3BWDD 4G5YA 4W99A 5ECWA 2A0FA 1WXWA 3VC1A 1OU4A 4ETMA 2B7CA 1P7WA 2OCLA 3M4YA 4C0LA 2H2GA 3GEIA 4OXQA 2IRWA 2ILVA 1OV6A 4H2DA 4MYUA 2BMJA 4NX2A 3W5VA 5CPFA 5IYZA 5BN4A 1TYEB 1RU3A 2JJ2D 3E35A 3ET4A 1C3OB 1T2FA 3SVLA 3LPDA 1BCRB 1CKEA 3BFKA 3PUKA 3QHPA 2OCPA 4FFDA 2NW6A 4BC0A 1GQFA 1F1JA 3RIHA 1HDEA 1T8SA 3TJRA 4GWKA 5DW0A 5B3LA 1QO7A 2GSWA 5GP1A 3HBNA 1JJBA 5I8ZA 3HYSA 4ALJA 3RSLA 3LYLA 4LSMA 3ZCVA 3H18A 5JU6A 4F7DA 3A6EA 3LBAA 4CPDA 4OP2A 1U5BA 4HEA6 3WFZA 3GIWA 1XTTA 4YPFA 2C5AA 1U7UA 5BSTA 4BJ6A 1MP0A 1R88A 2BEUA 1LTHR 3R3XA 4WY8A 3RGGA 1JL3A 2RGEA 4MP6A 1LS1A 2M9MA 5KYXA 2QLFA 1U2GC 4ZZ1A 2ZRDA 1UBMS 3ZV7A 4DL9A 3U17A 1Y4UA 4RPKA 2XUHA 2C96A 5KNCH 2I7XA 3GLHB 2ADMA 3DYVA 4MRMB 1M2VA 2G40A 4I5DA 1IK6A 1E1RA 1P33A 4US1R 3ZUPA 3I1FA 3L0YA 3IP8A 4M49A 4HADA 1Z82A 4WZ6A 4K0KB 4BV2A 2R5WA 1CRZA 1ZGCA 1L8AA 1W49A 3BE6A 4N49A 4ND1A 2OT3B 5KTRA 2F3QA 3KAPA 3QLUA 4HWKA 5HS6A 4FNOA 4KACA 1XFDA 3F3SA 4F2HA 3WO1A 5BR1A 3MAJA 3VPAA 2HEIA 3MWDA 2IYOA 4E22A 3FUCA 1C0IA 5HDQA 3NZEA 1GGFA 2UYCA 1QQ7A 4LZPA 3I62A 1O5OA 1X9IA 4DA4A 2JH3A 2FEKA 2QTVA 5C80A 1P29A 2XZLA 5HBGA 4XR9A 1XL0A 2GBCA 3DMPA 4M60A 3VNBA 3H3JA 4JFAA 2O8FB 2C61A 1N34B 1QP0A 4S12A 4A1FA 4TMFA 2O3QA 2X9NA 2ZS7A 2FGKA 3H8JA 3FW1A 4FMDF 3JQ7A 3T12A 4OQZA 4PRZA 1NIJA 3UMYA 3O2SB 4B6PA 5CVJA 4E2XA 3OEHD 4UUOA 4F92B 1RLUA 3JX9A 1QNFA 2D3TA 2J48A 2ORYA 4TRRA 3ASUA 4KQWA 3MCUA 3JR3A 4MVJE 3SBOA 3SR0A 2X0DA 2BMEA 5AT1A 2ZJYA 5AI4A 2HU5A 4QJIA 4RD0A 5EJ5A 4QGAA 4GX1A 2YVLA 5CIWA 4BB5A 4OP1A 2OEPA 3F3KA 1OAOA 3OJEA 4TYNA 1XDDA 5ES3A 2WTUA 4UCWA 3H6GA 3X43A 1UBNA 5B1IA 3D6MA 4KDEA 2VTBA 1B2LA 2BBTA 4XWTA 4ITRC 3W8DA 1W4CA 1JTVA 2DUMA 2XA2A 3LXUX 3E81A 1JU4A 1IZYA 3F78A 2FEMA 1GT91 3PV0A 1DOHA 4M8LA 4N0MA 4WFIA 1U02A 5AOCA 2QRKA 4ETWA 4F93B 1VKHA 1VIDA 2Q3JA 4CMAA 1UWLA 1I7LA 1E3TA 5ALGA 5C4MA 2B61A 3LU1A 5E3JA 1N3IA 2YJTD 3NONA 3VH3A 1SO8A 3PNVA 4OHPA 1JG2A 2BVNA 1GCAA 4G89A 4DJJA 2XCSB 2HMUA 1QE0A 2CCKA 2J8ZA 2QL5A 1MW8X 3MGBA 1PQWA 4DRZA 3EARA 3RFTA 1PLLA 1SCDA 2IHTA 4Q4LA 4R3NA 2UVQA 3EBOA 1RWVA 2K2WA 4WAUA 4BO7A 1CRLA 1L1RA 3ZBUA 1G8YA 4KPUA 2P9TA 1QO9A 1Z6PA 1RQ7A 2GLXA 1QRDA 5ANRB 3DQQA 1OXUA 4N6NA 3UFXB 3SLGA 3VSAA 1RDFA 2A78A 2TMDA 2ZKIA 2ST1A 3BAZA 4ZVSA 3GAMA 1BU5A 5FBZA 1SG9A 3HRKA 5FBRB 3ZXIA 3EC1A 3T7TA 3D2LA 3AF1A 3ZYZA 3UAWA 1L7VC 3AOEC 4OVKA 4BZPA 3O4HA 3EW9A 3D9QX 4JX8A 3ZWAA 3B5JA 1JWAB 3GR6A 4O29A 1CJUC 1KO1A 2FFAA 3H9QA 5D86A 4IGKA 1RJ9B 1NGSA 2QYSA 4LY3A 2PKEA 5B6IA 2NQ2C 5CBPA 3AF6A 2O2XA 3GJ7A 3TBKA 1SB8A 2V45A 1FVOA 1A7UA 3AUYA 3P0IA 5IHPA 1ZX1A 3QFTA 2IHVA 4WLUA 4B3DA 1T1GA 4MS3A 4JJ4A 5KCMA 3V7YA 4NZ9A 4FS8A 3WZMA 4DCGA 5IU6A 3B6IA 4JIGA 2MSWA 5D1HA 2AEEA 4OJKA 1WKVA 2CXUA 3E18A 3ZCQA 1VIMA 3IPLA 3TNFA 4BFYA 4NZNA 1XDGA 3IDFA 1GL7A 3I8OA 1TM1E 2M6KA 6REQB 1BJKA 2BSXA 4JQSA 3IEMA 1VE5A 3KDAA 3S2SA 2R7MA 1Y8RB 4Y2JA 3MWKA 3H1EA 1O03A 2CN1A 4JR1A 5BWLA 2GPYA 2JH9A 3C8HA 1NBEA 1PKEA 2W2MA 2DLCX 1SIOA 5KKCA 1H66A 3GRVA 1JX6A 3VU9A 1ZHHA 2BE9A 4KYUA 4ESOA 3RI3A 3W4KA 1KF0A 2PLRA 2WA2A 2HNAA 4HNAA 1F12A 4I50B 5B4VA 3SI7A 2C4MA 1HK7A 5DOVA 5CVEA 4DSTA 4C7MA 3KLPX 1ENYA 4FR5A 2VNIA 1NMSA 4LJ7A 1F9EA 3IHKA 4TV9F 4Z7OB 2UYYA 3MT9A 2JGIA 1K2VN 1OT5A 3I04M 2QQEA 2E7ZA 4YR9A 3MTDA 3DMGA 4WOBA 4BP3A 1SBNE 2QA5A 2Y2UA 1ZM3A 1MQ9A 4L9RA 3DPSA 5KTNA 2W98A 1EK0A 1N9KA 1NF3A 1RWMA 3EG9B 1AUPA 3IUQA 1GTVA 5TPZD 3EGXA 3WLJA 4DUYB 1IPFA 2V7UA 5HCIA 4CLOA 3IVAA 4CLRA 4L6IA 3PX2A 3FZGA 1IJEA 1A71A 2PVCA 4D4KA 5JH7F 4LISA 2IUEA 2QPTA 4MRPA 1VSQA 2XITA 3A2NA 3VKVA 1I6LA 4UATA 3C39A 1E1CA 4AYWA 2IS6A 4LRQA 5CA1B 3AEKA 3S0JA 4TL8A 4ZICA 1ACJA 2HU8A 2WJVA 4MCJA 4AUMA 1QDLB 1ZR2A 2XMSA 2CFOA 2RGYA 4D26A 1EGHA 2IU3A 2X0JA 4WEQA 4DIFA 1E5QA 1M54A 5E6RB 3CRRA 1VYUA 5H83A 3RVSA 1PFYA 3OBIA 2FR1A 4P7JA 3H2KA 3JZIA 3VGPA 4AIRA 4DOMA 5TDHA 3CPHA 3EGVA 3KJXA 3NKVA 1CY0A 4V3BA 1U6KA 5TS2A 1Z56C 3RSOA 2H1FA 1J0XO 3O0TA 5HF8A 4O5OA 1J8YF 3HDTA 5GJBA 3WTBA 3B60A 1NSYA 1WMFA 1IQRA 2FEXA 2LKDA 2ZYUX 3EAQA 3N8NA 5K0FA 1MO2A 3PFHA 1WETA 2IXDA 4OV6B 3GFQA 5HUHA 4AXBA 1FSFA 3FOCA 4I08A 5E8RA 5EJGA 5AVJA 1TCCA 1T6ZA 1ZUNB 2ZUTA 3TVDA 5JH7A 2GETA 2QYOA 1YQ9A 4MVCA 4RGYA 5FT9A 4MVYA 3WC4A 3MJHA 1GY8A 1I1OA 1M6WA 1HTWA 4BUCA 1AKNA 1DKRA 2QRVB 4KO2S 4ZXPA 4J1NA 2ZYVX 4JROA 4OTZA 3WIDA 5KYYB 3HO6A 2QLLA 1DFGA 4FFSA 4CTNA 1X42A 4FIDA 4PY2A 3U40A 2UUAB 5JPDA 2V0GA 4HAZA 1QYCA 5EIAA 1RXSA 4URYR 5IKPA 1A77A 2C9BA 2O3UA 3TXAA 4U3JB 4ND8B 1ZJYA 5FWXA 1AKMA 2AMVA 2JS7A 5JXWA 2IEIA 4WADA 5ICGA 4JI8B 2ZUEA 1LB1B 4F60A 5K05A 1VPWA 3KWMA 3I34X 1LI4A 4BLPA 4KRYA 1KAMA 1QIFA 5DM4A 4LWPA 3PI6A 2I55A 3EIEA 4JUIA 1EWQA 3LLVA 1NQTA 3KR1A 5AM4A 2O8DA 4C29A 1Z4JA 3WX0A 1E7MA 4BECA 4YRQA 1D1SA 2P9HA 4TXJA 4KVFA 3ENKA 1IY8A 1S8AA 3IURA 1HT3A 3LC0A 1U98A 3DS8A 1JIIA 4DB2A 1JJVA 3WMGA 1VE6A 1ADFA 2OC9A 3K6KA 2HT6A 2O2SA 1D2MA 4LCEA 4LNAA 4DDKA 2ID4A 3DNFA 3OE7A 1FIUA 1PLKA 4IXNA 2N3ZA 2ZRJA 2ZRKA 4BQSA 2O4UX 4B87A 4JJKA 1ADYA 3AB7A 4EVRA 2C9CA 2XF8A 4LJAA 3UA3A 1GPH1 4DQDA 3HUEA 4ETIA 4JLMA 4CVNA 1KIFA 1U65A 4JEIA 1UBUS 2NVBA 3VPFA 4BFWA 5F3DA 4R9UC 4GC9A 3V00A 4J7UA 3ADKA 3VISA 3FNEA 3HFRA 5IARA 1WMDA 2QR2A 3N28A 4R9NA 3GGGA 2IDKA 1R16A 2WDZA 3BVPA 1E9AA 2IUYA 1MC1A 2JHAA 2R6JA 3BFPA 3Q1KA 1JVNA 2BTQA 4HB3A 3TSCA 2NXEA 1P9RA 4GW3A 2QU8A 1KFCB 2J85A 2P2GA 2R65A 1DX9A 5EHXA 3KOXA 2Z83A 4K28A 4RL6A 3ZLJA 5HUJA 3N3BC 1PJ3A 1PJRA 1PZNA 1TJ3A 3KAKA 1COWD 4DLAA 1LPNA 5HIMA 4XD2A 3DLIA 4NONA 3UEOA 3NR2A 4OQMA 3ZW9A 2G1KA 3WYEA 3R8FA 1DBWA 1N6HA 1Y6RA 1Y37A 4EKGA 1IOVA 4FN4A 3VZBA 4UOZA 3ZHQA 1MA0A 1NKTA 1B00A 1RLMA 4L8YA 3HJAA 4XGNA 1R0WA 2P5TB 3HN2A 2EQBA 5CYPA 3R6TA 3TB4A 1I6MA 4A0QA 4DY6A 3ICQB 3IB6A 3HU1A 4KTTE 3ABIA 2YFYA 1MR3F 2WP8J 2Z0MA 1I6KA 2HH9A 2WJ3A 3C6BA 3ZZNA 4C43A 1Q74A 1ZISA 2D74A 2AKAB 3RWBA 2Q2VA 3RO7A 3ZNNA 1PV1A 2HRQA 4KK3A 4M6WB 4UBNA 1WP9A 1QGUB 2G9NA 3FHOA 1CT9A 1J42A 2PMCA 4ZFNA 3EJWA 4GUDA 2X4IA 3AZOA 4L02A 3TR0A 4FE4A 2FOXA 2P6RA 3CINA 1C1XA 1SUBA 3UQZA 4LDPA 3NHBA 3OOYA 3ASYA 3BX1A 5LP6B 1UKYA 5IAAA 3I2HA 4YV0A 1FRQA 1H5UA 1NOIA 2ON6A 3ICWA 4N3NA 5FR2A 3WWPA 5KOIA 2A88A 5D7BA 4M36A 3RANA 1H1TA 1G8HA 3UT5A 3G1WA 1PG5A 3VBCA 3TL2A 4BMOB 3TK1A 4REQA 1PL7A 2YJZA 3OIGA 4NATA 4UNNA 5G40A 3ZJTA 2CKMA 4FFMA 2OCAA 2OSBA 2ZTVA 4BO3A 5F9MA 4J8PA 4WZAB 4B7CA 5LZ4A 1OXBB 4JI0B 1OXTA 1A5SB 4QUEA 5C5DA 4DEYA 1M6VB 5C8YB 3JYNA 1G1MA 1KH1A 1ONBA 1G5FA 3B5IA 2PUGA 5JO9A 1ES9A 3WQQA 2N0SA 3KG2A 1YONA 1NNI1 4S3MA 4PGHA 2P65A 3ZX4A 1LCIA 1ZEMA 5BOVA 5A03A 3BTSA 4HTFB 5D6NA 4S05A 5K0CA 4CW7A 3BIJA 2IUFA 2MSCB 1QVWA 3IVXA 4S35A 1O94A 3CH4B 4IQGA 3WNZA 1XXHE 4UM9D 5IAOA 4QGHA 4RQBA 3C5VA 3OHPA 4CZ2A 2QOEA 4ED9A 2GCPA 2ZJ7A 2AG5A 3UUEA 4BO9A 3OM0A 1EQ2A 4W5RA 1RTKA 4RH1A 4QPCA 3R9KA 5JBIA 4XWWA 4X62B 2XF2A 1YVEI 5ESDA 1P19A 1RW4A 2JPDA 4J76A 4QDOA 3WGLA 5DYWA 5I5GA 1XCPA 4ZTBA 2V9ZA 2RHCA 4G0ZA 4X5OA 3UK2A 3WGUA 4R1NA 2O8NA 4C1BA 5DGCA 4M1TA 3W8RA 4B9EA 4URHA 4FU0A 4FHFA 4GQIA 5HTKA 5K4GA 3USCS 4O4IB 3C70A 1ZC3A 5JNSA 2PS1A 5T4BA 2RH8A 2A67A 4QBGB 4P7GA 2WUEA 1ZD4A 2FW0A 2CK3D 2JBHA 2R66A 1V8FA 2Y1CA 2ONKA 4NBWA 4TXNA 3D4NA 4ARZA 1EFRA 5KEIA 5EIFA 3ZE2B 5A0FA 1V9LA 3QPCA 4BBAA 1ABFA 3KQPA 3E23A 1GLNA 3F3MA 4QYSA 1KZ7B 4R81A 4WKOA 3Q9UA 2B94A 2WMYA 3QW2A 4Q3KA 4FILA 4AZ0A 2PAAA 2HYDA 3IDAA 4GPD1 4MIOA 4RSHA 5KYTA 5IT9A 3UPUA 2YL2A 1YNOA 2CXNA 1GWNA 1K6IA 2GN8A 2I6TA 5AKKA 2YBEA 5ESRA 3T1QA 4CQMB 4JV5B 1REQA 1GR1A 5KOJB 3BYZA 3OY2A 3ZE0B 4FLMA 5H4GA 4U2BA 3QMWA 5BW5A 2Z2ZA 4YCMA 4FOTA 4Q7LA 2ZM5A 3WLTA 3L7AA 4DADA 5CCBA 2DOKA 2I87A 2YYAA 4IIEA 3A1UA 3VU3A 1MZVA 3W06A 2OY0A 3M9WA 3RYFB 2OHJA 4FCWA 1KP9A 1VHLA 2G0AA 3DT9A 5JSYA 3E1GA 4A0RA 2OFPA 1PGQA 3GJZA 1RXWA 2JLVA 3W8NA 2AH5A 4Q4DA 4E5DA 1FFWA 1O94D 1NUPA 3KB8A 2GHQA 2ISQA 4FHDA 1ZOIA 3DVAA 4QBKA 3AEUA 3SC2A 4XVCA 2RB5A 3PJDA 4JK3A 4B8WA 4WX2B 3D0RA 1XVTA 2AOTA 3WGNA 4I99A 3H1TA 1UT8A 4ARBA 2AX4A 2WSMA 4X1YA 4AWBA 3ZHCA 4JASB 3LW7A 2N9UA 1C9DB 1VE1A 2PD6A 4PFKA 4M86A 4F06A 1X8LA 1I5RA 1R5NA 4GMDA 4Y8VA 4J6EA 1KMIY 1PL6A 1O87A 2EBHX 2W42A 5JVDA 2C88A 1C14A 3HKCA 5TS3A 4FFPA 1YDFA 3FTFA 4IJ6A 2C99A 1WTCA 2HWKA 4X60A 1Q14A 4EAQA 2OECA 1GCUA 1IDOA 4P5DA 6GPBA 4TMXA 3NIBA 1WSDA 4EYGA 1FJHA 1CIVA 1SBIA 3I9MA 3COYA 1YJBA 1AMUA 2DP4E 3D6VA 3IJEB 4N39A 2G5TA 5ALUA 1L7OA 2DXIA 2VUSA 2FMKA 3GCXA 1RKQA 1YZUA 4A2WA 3HVHA 5KMGB 3ORFA 2WUWE 1WZ2A 3NG1A 4FZRA 4DLBA 2JF0A 3DDUA 5F4BA 2IP2A 3ZZ0A 1SBZA 1V47A 2W8BB 4FFWA 3REFA 1DKNA 2OXRA 2YVQA 4OCZA 4IO1A 3A05A 1W4ZA 1T0JB 3U60B 2IZ0A 2HR1A 4PLTA 4D97A 4DJEC 5C3MA 2I9PA 4RFSA 3WRVA 2HQRA 2XUIA 2ZZKA 3G7NA 2VAXA 2LD4A 4TYQA 1M5UA 1BMTA 1NQWA 2J0UB 1RMYA 3HA3A 4XWYA 3GJ5A 5CM8B 3ZTYA 1PV4A 1TB4A 5DTQA 4F6RA 4JVOA 2EX4A 3OU6A 2WM2A 4TV8B 3GLFA 4YJDA 1EYZA 2VFAA 4ZC1A 1CERA 3RH0A 1IOZA 4QKQA 3PITA 4CTKA 3TE7A 2IU4A 3LP6A 2JFYA 3S2FA 2VSOA 3PQ7A 1OTYA 4KVZA 2P3SA 1V8DA 3T5CA 4G0UA 1U28C 2X2EA 3EF3A 4GEGA 2HA3A 4ETNA 5EWJA 5T6BA 2ZT6A 1GTL1 3SHFA 3L6RA 1NF9A 3TQRA 1WZCA 4B81A 1EA7A 2RG1A 3O8QB 3CEAA 2V58A 2FMUA 3F2VA 4KK4A 4MUBA 4OM8A 1GPMA 2P9BA 2J32A 1T1RA 3MCZA 2G1UA 5A05A 4LA4A 1JI3A 1XJ0A 2CGEA 2ZQYA 3H8VA 4GVXA 1G98A 1W88B 3SN6A 3OFJA 2W6IA 2JGDB 1DWOA 3BMNA 3MERA 1ZJ6A 2FZ4A 5AH0A 2WKRA 4EHBA 4LTMA 1NYQA 1U63A 3KLOA 3ELUA 1U8ZA 3PEFA 1QFMA 1OH5A 3MOSA 1SOMA 1XSEA 1N2OA 3PNQA 1U3TA 4LVUA 4M8NE 3CS3A 1XU9A 4YDRA 1Z5UA 2YXNA 1N32B 6PFKA 3K5WA 2YXDA 3HP1A 2C97A 1TPZA 4ARSA 1Z2EA 1T9CA 3BORA 1TAUA 4OKNA 1CV2A 4DZZA 2WJ4A 4E6PA 1JYEA 2IX9A 3E5RA 1JHQA 1FYDA 2YV2A 4G25A 4YJFB 2QW8A 3E3LA 3NNNA 1QV7A 3IAS6 1ZNZA 4XWAA 4Z0TA 3TDKA 4KQIA 4HDNB 4JI6B 3AHCA 1TVKA 3TIXB 2OK8A 1NNSA 2IUSA 2QIPA 3IT0A 4EO9A 1W6RA 3JQ6A 3F5SA 1XZBA 4M1ZA 3RIYA 4Y9SA 2X0KA 3PCXA 1A50B 3PC2A 3LQQA 3FTNA 4D0LB 1E1QA 1UBSB 2VEOA 4JWKA 2DG2A 4DNOA 2XLCA 2P6UA 1GOTA 2IH5A 5EIBD 3DHVA 5E6SB 4II7A 4J0QA 1Z7GA 1MRZA 1KPIA 2GK3A 4Q82A 2DR0A 4KQ9A 3WOVA 1YS6A 5I9LA 2C20A 4KNYA 4LSZA 1RE0A 2C5LA 3QVSA 2YIMA 2XUAA 4CIWA 2AXQA 4B82A 1JWLA 1Q11A 4LQ4A 5AIBA 4HAVA 1AKRA 2FP4B 2WDPA 3LSTA 5LLDA 4R2WA 2H1WA 3S40A 4BNKA 3SXJA 3FWKA 2I34A 4CL8A 5JWOA 3EPKA 2RJ3A 3L8CA 3GJ6A 2R1UA 3WGKA 3NQ41 2QN1A 4PZPA 4OYRA 4F97A 1ZGAA 1G41A 5DGTA 2DWQA 1B76A 5JRZA 3I09A 1NAHA 4NV0A 1HXHA 2WF9A 4UKDA 5EP3A 3GLIE 1M8GA 1H9CA 1YDHA 3L0ZA 1E5VA 1KJIA 2HMWA 2W6ID 4JYBA 4D8XA 1VC2A 2PU7A 3CUKA 1J21A 4G0YA 1QM5A 2Z8YA 4R0VA 4TTSA 1BHO1 4LW8A 4ZCQA 5THQA 3UPDA 3QFCA 4EABA 1N2XA 5A4AA 1RIIA 3U5ZB 3LC7O 3WDLA 5HZHA 3TGPA 2B4YA 2F9MA 3EVAA 3GEEA 4KODA 2P3LA 3WLHA 5IFKA 4R9SA 1T3ZA 1IBKB 2GJ8A 3T5GA 2VP0A 1FDOA 3BIWA 5D85A 4BCDA 1GLVA 5LOVF 2BM0A 4QSMA 2HRDA 1C80A 4HMPA 1SQ0A 3CX4A 4JI1B 4ARVA 3PC6A 4AN1A 1J2YA 2CE2X 4J2TA 4HTAA 5AHRA 3LCVB 5E2IA 4OQNA 3S2EA 1W8IA 2HHCA 2IHKA 5CB0A 4IXTA 2R68A 4YECA 4DLTA 4L2IB 2EF0A 4ON9A 1WS6A 3KT8A 4FNAA 3OX3A 5AJZA 1QVZA 2Y9MB 5I7WA 1B0UA 3UKDA 1S7CA 2X6QA 3THRA 4PGGA 1RRPA 5FBKA 4MZXA 1R8XA 2X5KO 2NXJA 2ZITA 1Q91A 1XQVA 1PJCA 3OCVA 3D4IA 4G0MA 5C34B 5JSZA 1DGQA 1QF9A 5JAZA 3HE3A 2A0XA 3WA6A 2ZI7A 1EX6A 4TRNA 2XYVA 4BJ3A 4GKKB 3FYCA 2R5FA 2PMBA 3EIQA 1XRMA 3DO5A 3PPYA 3KQHA 1QIIA 1EM8A 2Q1YA 4IVRA 5IJ0B 3N8KA 3E5MA 4BRSA 1FUEA 1JMKC 1V11A 2ZB8A 4I1UA 4FDTA 4M1MA 4FFBA 4G8JA 4OGFA 3VR6A 3IQEA 3BD6A 3R7FA 2QP9X 4E7PA 2WU1A 1Y1KE 1CP3A 1G8PA 1Z0FA 3C3JA 4PW0A 1NN5A 5CP8A 3ZZUA 5AUNB 4YK7A 3F67A 1SAYA 1NJSA 1Z5VA 2I1VB 5AHXA 4MUFA 5I9TA 2FSIA 3QA3E 2PGDA 4Y9UA 2PGAA 3A14A 2GEUA 2RBGA 1U90A 1R9JA 3AV3A 3I6BA 4I8XA 3SE7A 2H1VA 3R6LA 3PQDA 4TN5A 3K2EA 2JA1A 3NC4A 3K0AA 4JT9A 3PX7A 2VF4X 1SXJA 2F3UA 3GEMA 3JQRA 1IJKA 2CNKA 3SQNA 3HMKA 2HJGA 3S68A 1E66A 1I24A 2VTDA 3OF3A 1TTTA 5BVGA 3E6AA 2FNAA 3I52A 3L1UA 4GM1A 4CMGA 4KSBA 3DD5A 2I80A 3WMEA 2QJTA 3UIEA 5KJ1A 2LIVA 3G59A 3PXCX 4M9ZA 1WIWA 4HGRA 5TXGA 1GEGA 5IBRA 4TT3A 5CDSA 1KI1A 1IEVA 3E2IA 3DP9A 1X7DA 3RSFA 3DZHA 3TEFA 1C30B 1AA6A 3K7EA 3LOUA 5E4FA 1Z35A 4MV8A 3WJ7A 5K6AC 2DEUA 5DHUA 4D82A 4QASA 2HQSA 1BFDA 3ROQA 4V0QA 1PG2A 5EJ4A 4MYHA 3CRVA 1JZTA 4ZVTA 3LUHA 1QDEA 2O1XA 1XEWX 4IJMA 4L1KA 3FD8A 3L2OB 3N8HA 3ZGLA 4C6RA 3WJAA 1LX6A 4UTXA 1DBPA 1J8MF 2X14A 4JDPA 1PN3A 1GQOA 1A72A 2WIKA 2XWPA 2ZR7A 1K8XB 4L75A 4TTIA 3RSHA 3ZTWA 2RKWA 4NRDA 1JH8A 4F3NA 2YY7A 2RI6A 1KVSA 3K1YA 5FB3A 1ZEJA 4LYJA 4WA7A 2P4UA 1UODA 3RRXA 2O7RA 2VPYA 3CNQS 1KYWA 5EHIA 2Z5LA 2VATA 2ZB4A 4LXIA 5ILGA 5JC8A 4OOFA 4H0FA 3T06B 4US2R 2VAWA 4ZMBA 2VWHA 1U8FO 2V6JA 1E3EA 3HJUA 1AMOA 3VPXA 1J7KA 1TYAE 4TSFA 4CQJA 1SPXA 2D5LA 2XT0A 3CNBA 3X1KA 3I1YA 1KFJB 1EQAA 2XQIA 1JHXA 1YDEA 3A06A 4BU1A 1M0TA 3IBTA 3PWSA 4MR8A 7AT1A 2MYPA 4DLRA 1QC5A 4EHKA 1NMQA 4P58A 1Y1LA 5FPTA 2PY6A 1ADBA 2G09A 5ERYA 1RZRD 4AFNA 1BU8A 1AV6A 1L5HB 2E4ZA 4DQVA 2QW0X 3PHGA 4JY7A 2CF5A 3PA8A 5FBWB 1XT6A 2C00A 4BMVA 2DQYA 2ZT5A 2Q2QA 2GWHA 4WLEA 2F1RA 4FVTA 3LLSA 2PUDA 1X1DA 4WOKA 5K3DA 5JJBA 5BV0A 1RQLA 1NLMA 1MH9A 4LF9B 1MZPA 4XIJA 1UBLS 1UAGA 3EEYA 2C58A 2LR0A 2G0NA 1SWWA 1FQJA 3PE6A 1UC4B 3A4MA 1PP4A 5I4BA 5EJAA 5CEEA 1Z4QA 5JJCA 3VC7A 3CLUD 2IDZA 3LHDA 2VF8A 2X8JB 4G37A 4UNIA 1CDZA 2Z2YA 3VUFA 3G02A 4CF6A 4PNEA 1C8KA 2I62A 2PT5A 2QRHA 3A31A 4OHVA 4EY5A 4IIVA 1P2UA 2GRJA 1XCBA 4WHMA 2JGMA 1Q1BA 3UK0A 4JB2A 3PCRB 3GMSA 4BFUA 3DEAA 1R6XA 4XM0A 1ICIA 1KAEA 1M5TA 1QBGA 4IIXA 5LYJB 1AO0A 4I81A 3VH2A 2IOFA 2PGNA 2ZUSA 3DKKA 3FGPA 5EVCA 3WKCA 4QWMA 2PN1A 5H02A 4C6TB 3H9BA 3OO0A 4LFCB 4RD3A 1AQ6A 1F2TA 4U5QA 3H17A 3TLEA 4YRIA 3BTUA 1X6VA 5FA6A 1YZFA 1QR2A 2C2MA 4Q1BA 1E6KA 1MHPA 1YKFA 3EVCA 4K87A 4YHBA 3L4BC 1KDPA 1KFKB 1EWTA 3ZNQA 1AQJA 1YDWA 2VK4A 2BKVA 4UM7A 1SU7A 2A1UA 1YR6A 3QOFA 3UAVA 2MYTA 2XUKA 1A95A 2V7XA 3W4JA 1RWQA 1ENOA 2NU6A 2P2CA 1Q7EA 2XMBA 3C1UA 3GZJA 4CI0B 1UM9A 3K94A 2YV4A 3JQBA 2HMYB 4ZCPA 5CW2A 2P62A 5EJFA 1FTWA 4C0XA 2BUBA 5CIQA 2Z30A 3AM1A 1NLZA 1PZXA 3NM4A 4F4FA 4JC4A 5IFLA 1Z5ZA 4Y2VA 3HBAA 1EB8A 3U4QA 1NYTA 3MQ4A 1VZ2A 4OREX 3UY4A 3TZBA 4D4HA 1N2SA 4NFSA 1OILA 1Z6YA 1SWVA 1PTKA 2ATIA 3B1WA 3O3OB 2C9OA 3UT6A 2OHVA 3BRWA 4Y18A 2ZYRA 4C05A 3KJQA 1Z38A 1QRRA 2J08A 5IJ9A 3NANA 2Q3BA 4HD8A 3UJPA 1QF7A 5HHTA 3EPPA 3SDBA 1TVCA 1KI2A 4WK2B 4PXAA 3NM5A 2Z9DA 2BW0A 4HDQB 3QE0A 4MQLA 4YACA 4D92A 1CZKA 1JG7A 4XCXA 5TEWA 2QZJA 4E5VA 4M1SA 3UTCA 1NJ5A 2KHZA 3FNQA 4UAUA 3DNMA 4JLBA 4FR2A 1KR2A 3Q7EA 4JYCA 4RMJA 5K3FB 1DWQA 5GY7A 5FL3A 4Z4EA 3B51X 2A9KA 2H5IA 3M6IA 1BROA 1Z33A 1ZH8A 4L27A 2IDMA 1DBRA 1U0FA 3OQPA 3CY6A 1ECGA 1G17A 1R8SA 2KX7A 2Y2VA 3B1JA 3F46A 3JY6A 3M8KA 3TKYA 4W5TA 1HYQA 1U1IA 2JATA 5D01A 3WTCA 1T34A 3AFIA 1HBJA 2ZIZA 3LDUA 4XLZA 7ADHA 1DBIA 3QSYA 3FIUA 1RYFA 2PZ8A 3U39A 2IOFK 2HXGA 1DO8A 1JHDA 3WLNA 1UBCA 4KGVA 1KERA 2V7QD 4PLPA 2PKWA 5CEFA 1EUCA 4HH0A 1RQNA 3H9GA 4YI3A 2BI7A 2DWCA 5BN3B 2CNNA 1ZG3A 2NAFA 4JSYA 2QT1A 4ZI7B 3A1WA 4L85A 5JCOA 3SR3A 3KBBA 2ZIGA 3MQFA 2ODAA 4TTPA 2DFTA 5AM2A 4XGKA 4EQZA 3BGOS 1F8XA 1M33A 2H6EA 2WZBA 4RWZA 5BR7A 5J2UA 1GZUA 3NGMA 2ZBPA 1J07A 2Q2WA 1SJ9A 1JDZA 3B85A 3HRIA 3IDSA 3RS0A 1B16A 1WDLA 4QPJC 5BOSA 3P52A 5ALDA 3VJMA 3AUJB 3TVYA 4YALA 1JNYA 1OHHA 2WAYA 1E7YA 4OJNA 5E8JA 1P4AA 5FLEX 4PYKA 1XPRA 4JKYA 2Q46A 3Q6MA 2JAPA 1GZ4A 4MQEB 1I5EA 4GLOA 4CDMA 1HEIA 3DLBA 5L9AA 2CCGA 1V1MB 3FYSA 2QMOA 2QTTA 3BRWD 4MVJM 3QLVA 4UJ5A 4P93A 5JCZA 1N2JA 2KWIA 2O1EA 3CN7A 2CBXA 5M04A 2ZWIA 4ARCA 3KLMX 2IHJA 1MAVA 2XD9A 421PA 2BGLA 5JI3E 2DU8A 2JJ1D 3TEJA 2EEZA 2DPXA 1UJCA 1LD3A 2OLJA 1E9SA 1JIVA 3WLSA 1EX1A 2OGWA 1NQ5A 3GP5A 2DQZA 3E53A 2FPPA 2RGWA 2A7XA 4L76A 3VNAA 3JAWB 4EJSA 2VXCA 3OJXA 1SKAA 3GRPA 4R2HA 5ALWA 1SHJA 5BQ3A 2NXWA 2N75A 1Y3HA 2VJMB 3HNRA 3MGAA 4HPWA 1W87A 2BHSA 4HDOB 3QMVA 4B7ZA 2C03A 5HNKA 3TQTA 1XZPA 4KXUA 4D4MA 3FPAA 1HFKA 3LRPA 4YTEA 3PL5A 4J4TA 3ZKAA 3SYLA 3GNSA 4GKBA 1O9BA 4RS4A 1FFDA 2WWHA 1TQ6A 3KTAB 2NPIA 3RARA 3ZD6A 2PX5A 3MWEB 4NF2A 1Q7TA 1N7JA 1XCLA 3QH4A 4L4YA 1FS4A 2FK7A 4OJYA 4I9GA 2VHQA 5ERGB 2H8KA 2HF8A 3DLAA 1XZDA 2C7RA 3HLYA 3HTXA 4NFYA 1ILWA 2GZAA 4ZHQB 2VUTA 1I3NA 1U7HA 1VDMA 3HY3A 3IB3A 1TFRA 3K9HA 5CLQA 3QUQA 4EPYA 2RI1A 5AVUA 4DA6A 3PIDA 2WTXA 4X20B 3IAUA 3UGQA 5DN6D 1O97D 2FH5B 4AKHA 4YXWA 1KZ6A 2OO5C 4W9RA 4I1YA 1FE8A 1Q57A 2H59A 1DEHA 4HAXA 3A70A 4XX1A 3NXKA 5EE3A 4RZQA 3SK0A 1A7JA 3CLSD 3LIIA 3T7RA 3PBKA 1G20E 4HH1A 2W43A 3ANTA 1U0LA 4E5KA 4IDPA 2PUTA 2XRFA 3ET5A 4U63A 4TMVA 4B3CA 2AJBA 2H57A 3DMTC 1OB5A 4CHTA 4H31A 5JEDA 1CS0A 2HJ9A 1JW9B 5IMSA 2R6HA 3D59A 1L5KA 1N5KA 3EC2A 1VLMA 4KIWA 3R3VA 1Q83A 3NWPA 4Q24A 1G9XA 1A4XA 3HDYA 1RYEA 2B2XA 4TPKA 4CKCB 1AF7A 2EEPA 2A1TS 4RL4A 3ADPA 4J03A 2ZS9A 1IYZA 3M7IA 1AY0A 3NAMA 5BT9A 5IUNC 1E3WA 3COSA 3WOHA 4L0DA 1UT5A 3ETEA 1YO6A 3AY0A 3SMQA 1SB9A 2QTNA 4LJSA 3SJUA 3VC3A 1T8TA 4QYIB 4MMXB 3BFVA 1QHXA 4ZEXA 1K5HA 2PPLA 3WRYA 2KB0A 4WTOA 3SYNA 4BYGA 2G07A 4EB6B 2DF8A 4X3OA 2EU8A 3S2YA 4MYTA 5IKMA 1G21A 2RHRA 5K0LA 2GO1A 3H3XA 1DBVO 1N3LA 3PWTA 5JSFA 2FZLA 3FPGA 3F97A 4FQ7A 2AOWA 4R7ZA 3D7NA 4LSGA 2YNMC 2ZT8A 1VMDA 3EPLA 4MO9A 1CR2A 1I0ZA 1YD7A 2QRQA 3ZDCA 1T6YA 4ZARA 2JVJA 1J49A 5SY4A 1DQNA 1IHPA 1N6OA 2IBMA 2J9RA 4CGYA 3AHJA 4W6QA 3GDOA 1J5PA 2IL1A 2XUQA 3N2IA 3CH7A 2XE7A 4YYEA 1C7EA 2H4HA 4PLYA 4HG2A 3C8ZA 2MIIA 3HRHA 4FD2A 4LN1A 2G71A 1FCJA 3LPAA 3P96A 2ZRIA 4YASA 3T7DA 4YXWD 1NI4B 5KTKA 1NLYA 4B32A 1JG4A 3C85A 2GWRA 1ZGZA 4Q34A 2QPOA 1X7WA 4TRMA 2D5IA 3OPQA 3FCAA 3FMPB 5EUBA 4YJ3B 4NJEA 3VOBA 1HE8B 5E3HA 2MINB 5L45A 1KAQA 4DJ5X 3PRHA 4IKOA 3HWSA 3RK4A 5CCEA 2WK1A 3JWEA 2ZJOA 4K2HA 2ZRLA 1WQ3A 1VCHA 3DDNA 1J33A 4XGQA 5JADA 1N9GA 1RQPA 1IPEA 3BUSA 4BUJA 4E15A 5EZYB 2R47A 2I03A 2DPHA 2YDYA 3PHBE 1U7TA 1Z4LA 4BAZA 5K8TA 4D6YA 4LJ8A 2QSYA 4NZMA 1W4LA 1GGVA 1WRBA 3TQOA 2E55A 1KYQA 3JQGB 3CEHA 3PDJA 4TL7A 1FX1A 1XVLA 3QHQA 3C3KA 2VYQA 1U3UA 4QUHA 5FIUA 3SQMA 2ZRBA 5A5FA 3CISA 2PX0A 3IXMA 1SULA 4GYJA 5E7QA 4G5GA 2W4IA 3VJKA 1KTIA 1XPJA 3OIVA 1YR3A 3AJ8A 4H7IA 3BE5A 2H9AA 5AKEA 1FRNA 1O0SA 2CLMB 4XYGA 1ZBQA 5F5NA 3T9AA 5B58T 4NXMB 4REOA 2OQ2A 3P0RA 4RIHA 5CFMA 1A2KC 2G9UA 3H65A 4G85A 1CUAA 3THOA 2EP5A 2JHGA 1GNLA 2YVKA 5BO5A 2HJSA 1AJEA 4I55B 4QAQA 4JL5A 1Q15A 4PTZA 3WL7A 1T5TA 4ZU1X 4MS1B 1Z36A 3FJYA 3AIKA 3NYQA 4R05A 3FVQA 4EUNA 2V3WA 1EK2A 5FOXA 2IA5A 2NO9A 2QTAA 3BHNA 4ZP1A 4QGSA 4WACA 2R2GA 3FZQA 5JATA 3S1SA 3PGLA 2Y8EA 4LK2A 1NBMD 1KMCA 4TKVB 4RF5A 3QE4A 2GNAA 2X9GA 3ENWA 2P2YA 1FUYB 2I99A 3X44A 4E21A 3P20A 121PA 4RPHA 1KDVA 5CJPA 4WGFA 1ACMA 4KIFA 1W4AA 4KQHA 1UBEA 1B41A 1MUUA 3PYLA 1FMCA 4MHSA 1JGTA 4OK5A 1EUQA 3MILA 4KQEA 3OPVA 1T10A 1EJBA 2PH7A 3U9SA 5FADA 4K03A 1OLUA 4BIIA 4KE7A 3CIOA 4MMYB 4X0EA 3OWXA 3OLZA 3KDSE 2XUJA 2OYCA 1ZD1A 1UFQA 2DT5A 3DZKA 1QHHA 4YREA 4JFRA 3H5RA 5JZVA 1E8DA 1RR6A 1VPEA 4QDZA 2JLYA 2BM8A 4CEJB 1NXPA 1EP3B 3VR4D 2JI8A 3JSXA 2RHWA 1GZ6A 3QU4A 1FMTA 1TKRA 4P9NA 4QUGA 1EE9A 1P1CA 1UDXA 2DR2A 2REQA 1QTRA 3VO8A 1JS1X 3DLCA 3PIRA 1Z2PX 3A3YA 3T4UA 1X19A 2WPDD 3IBCA 4DV2B 2JIOA 4IIYA 1DRJA 3A6GA 3EZ2A 4R71A 1J09A 3O93A 3TH5A 3BBPA 2Y6UA 4OA5A 2P27A 3PR1A 5KNDA 5CA0B 4X8HA 5SY6A 2XYGA 3EDCA 4EENA 3AP2A 1KXZA 1UDCA 1U1DA 3CPSA 4PVCA 5SYMA 1U7PA 4ZKDA 4G5FA 2C5SA 4AXXA 1V96A 2RB4A 1BAPA 1GV1A 2CVQA 3ITEA 2QNRA 4L07A 1UWVA 2X42A 1TUBB 2DM6A 3EEFA 4WV3A 1AZSC 2DBYA 2N47A 2Z1NA 3KT3A 4D8TA 1P2GA 2OAEA 1Q21A 4EY7A 4IJUA 3T35A 3HP4A 4YDQA 1GPAA 1V8BA 2RI0A 4C06A 1EFAA 5HBRA 1GEEA 1N8SA 1P81A 1E3MA 5FPSA 2I3BA 1GU7A 4OQEA 1NW9B 3EDRA 4MCIA 5DH9A 2RDMA 3M6UA 3G13A 3WYNA 1H2HA 5DBFA 4H6VA 3HKEB 4J3FA 5NULA 1R6AA 1DARA 1DUIA 1SUDA 3EGDA 4H35A 3QLTA 4YPOA 3DVQX 2QVCA 3G82C 2ZIXB 5ERXA 4EFDA 4B83A 2G04A 2A7QA 1D6MA 2X19A 2O57A 3L1HA 1RAEA 1U2PA 1CQXA 1J9EA 1VSTA 1VYTA 2P2NA 3A32A 3B2QA 3OAAA 4FMPA 1X0VA 2JL1A 3EG5A 2R11A 1IY9A 1NPTO 1TT7A 4U2EA 1ISHA 5EZ6B 4K88A 1L4HA 4D81A 1GNRA 1JQ5A 1IJBA 2AR9A 1ZGBA 1IVNA 3BTVA 1VDZA 3F6CA 4FYWA 4AMUA 1M34B 1XN4A 3HNPA 1VCNA 2Z95A 3B2EA 2VH5R 1GG2A 2HCTA 3F1LA 2Y93A 1U0TA 5FWNA 2B8JA 2MSDB 3PFFA 4XWOA 1NL3A 1SVNA 3IOBA 3LF1A 3NORA 5E7IA 3ZDYB 1E9DA 2IE8A 3IT1A 4V24A 4YGXB 2H31A 1Y9AA 1J90A 1KK0A 3MBIA 4EGSA 2PZBA 1VJ1A 3I58A 2XVXA 1E94E 4CDGA 1SUAA 1YJ5A 1UKBA 3DC7A 4A23A 2I4OA 3IPAA 3VMMA 4DJTA 3O2QB 4R5MA 3DWGA 4RDHA 2BCEA 1SRRA 3D8BA 5GZ3A 1XXHB 4DXDA 1HFJA 1PVOA 3FI9A 3CT4A 2VXOA 1RKUA 4OXXA 4KRGA 2B3TA 1IWBB 2VSYA 3CZMA 4S0ZA 4YQZA 1YK0A 5B7QA 3G49A 4LRXA 3EVTA 2WYOA 3EA5A 3K73O 3L8YA 3MW8A 4NPCA 1SA0A 4LGMA 3F6RA 5FBVB 4WCFC 1MIOB 1HL7A 4F2PA 5KO2A 4LJ4A 4K9NA 1CW2B 1ORTA 1M8PA 3SZMA 3I2YX 3WV4A 3DE5X 1MHTA 4EHIA 5J58A 3AHFA 3BMOA 1NA5A 4MVXA 2FR8A 4CMKA 3H0CA 1FP6A 1JR3D 1X8JA 3I8XA 4AX4A 5EXDA 2EFCB 5DIFA 5BN1A 4DABA 1KWGA 3IKTA 2V0CA 1Y1SA 3D0OA 3GUYA 4K86A 3V4LA 1XA4A 4EJ0A 3LHSA 1P6QA 3WAJA 1P39A 3EXIB 4CKBB 5F78A 1JLHA 1SQGA 1QVAA 2XIJA 5IH3A 2GN9A 4K0RA 5CFQA 2SCUB 5K3OA 3A37A 3I4CA 3KQLA 1SCIA 3BGIA 1XTBA 3FSJX 2DUWA 2FRDC 4OSOA 3FMIA 1V9CA 3GFFA 4GDMA 1E2DA 5HIJA 4DMKA 1N5IA 4AP6A 3UM9A 5FTMA 1F7UA 2CFSA 1A7AA 1Q12A 3EGEA 2P40A 3LO5A 1IQ0A 4J3NA 4NQRA 4BVJA 5KNBD 4DVJA 2DUJA 4N5LA 2C7OA 1F48A 3I32A 4TWRA 3I9V6 4JC8A 5I3ZA 1LA2A 1XQWA 3V8QA 3F0TA 4P92A 4O0MA 4ZT3A 4LMAA 1VPDA 4DIEA 5EUCA 3EDMA 5F73A 2WT4A 1E0DA 3U3ZA 3GWGA 3CLKA 1DAIA 2X2OA 2JFHA 3MTBA 1T8WA 1Z22A 3RS7A 2B37A 1QFZA 3NBAA 1E69A 2IY8A 4WZBE 2O8BA 3M5PA 4EZIA 1DDGA 1GPYA 1UJ6A 1PLJA 2A9FA 1WW3A 3L5OA 3Q5GA 2GXSA 3WP0A 5CLHA 1ML4A 2VDVE 1VL6A 3FIJA 4F8JA 1CUJA 5H9WA 3JASB 1MG0A 1HOTA 4KYVA 4JJAA 1B73A 4NYJQ 2R96A 3R20A 4B4KA 2W2OA 2NT4A 2EJBA 3KYJB 2UYOA 4G4SO 4OHWA 4DILA 1U4SA 1N33B 1GSHA 5EC8A 4NSNA 2TECE 4JJ8A 4BXOA 1JVBA 1Z12A 2HRBA 3SX2A 2QTHA 3TNLA 5K7SA 1EK5A 3A1TA 4DMCA 2ZRCA 5AVOA 3GJTA 2CZQA 1KQPA 1UF9A 2G5PA 5EHQA 2D7JA 2IPLA 5HQ3B 4TZKA 1JHRA 2PQMA 4FKMA 5EWMA 3W6NA 4EFLA 5BQFA 2X0FA 4LZAA 1H65A 4GP6A 4RXTA 4MTLA 1Y1PA 1YR8A 3PT5A 4ID3A 2RGRA 3SHWA 2OQIA 3DEYX 3PI7A 2Q6OA 3Q2KA 1JMVA 2WJYA 2EX1A 3MJDA 4A7PA 5F23A 3O4GA 1IXYA 1OTXA 3TGWA 4E51A 3BH6A 4RETA 4QARA 4CTOA 4OFWA 1JG6A 4KXFB 2HO5A 4DKXA 5HWSA 4NZPA 2QVXX 2XA1A 1C3XA 5BSWA 1JR4A 2F48A 3NV9A 4EO4A 4G4SP 5B1DA 3T7AA 1UZAA 4TLAA 3CVJA 4BZZA 2VQEB 3RAEC 1Z63A 3RBZA 3VAYA 2IPAB 3MTQA 3QY9A 4Q7MB 3M6AA 1J0DA 5B3KA 9GPBA 3WSWA 1PV2A 3G8BA 1BXGB 4BE4A 4EFNA 3B12A 2YZ7A 2ZIUB 3O7MA 2NZYA 2NV0A 3RVDA 2CD7A 4OYYA 2IYPA 4JLNA 5FL7A 3JYOA 2VKTA 3UATA 4QJBA 4RJLA 5MFZA 4KOEC 2LUOA 3OM8A 1KU0A 2AFHE 3IGFA 1D5CA 3B6JA 3H87A 3MBOA 2RKBA 4R7GA 3NYWA 4QJ4A 2ZQZA 2BIFA 3WK4A 1EQUA 5AUQA 5CAEB 4JC0A 4F4DA 4Z7QB 1LJ8A 2FQXA 2NUAB 4K9PA 3R6GA 3QITA 3KDPA 3QVXA 4RLHA 5DXAA 3ZIDA 4BEWA 2HK6A 1PYGA 3WWCA 4IDCA 2ZI9A 3ESQA 3DMYA 3UJ3X 3LD9A 1RCUA 2PKQO 3HN6A 3PFWO 3EJ6A 2A86A 3I6IA 2EKBA 4PAMA 4EW2A 1GG8A 1KEPA 4HOYA 3TQIA 1ZGGA 3ROKA 3SAJA 3DOCA 1SVSA 5KPJA 1SC6A 2Y1DA 5FWDA 2IYEA 4J07A 3IAEA 3W9UA 3AKEA 1WZIA 3V1MA 1H3NA 1U0EA 4HX5A 3KZKA 4G84A 2GLUA 8MHTA 3TLGA 3ESBA 4MQFB 5JS8A 4FMBB 3RM3A 1L7DA 3OMXA 4EX7A 2OCYC 3N2GA 2O9JA 5DNUA 2VDRB 1K9SA 3RTGA 1IHUA 1Y8ZA 3NNDA 5ULLA 3H5OA 4BVLA 2WTBA 4EF5A 2J3HA 2BGJA 2FWIA 3I9FA 5F3WB 2NZXA 1WUKS 1A9XA 1JLLB 1MBZA 2J9FB 3KJFA 1NG1A 2CVFA 3SVTA 3NHMA 1RHKA 4C4ZA 3GAZA 4XR4A 1XAIA 3VKGA 3KAQA 4D98A 2HSGA 2VO1A 4MNTA 5LZ5A 2ZE5A 3SIXA 5KQMA 4RO0A 4QLAA 4ERNA 1BWSA 3PB3A 4PRYA 4ZMRA 3PXDA 4FDLA 1IU9A 4OUDA 2XCIA 5JC1A 5IAJA 1CZUA 2A9VA 1D6JA 2DFPA 1KRXA 3SXPA 3RKRA 1KS9A 2Q4TA 1YBFA 2OB2A 1L9XA 2O06A 3DMRA 3TSYA 2VRCA 5J1TB 1HLDA 1RYZA 2HAEA 4PLVA 5J63A 3I76A 3BGWA 2GQ0A 1XLTC 3QFRA 1ZCJA 1XAJA 1JPUA 3HXPA 4IUBS 4P3KA 4GS5A 4URFA 3VU1A 1BSVA 1KJYA 1MNAA 4W8OA 1QH8A 2C9YA 3AU9A 3WB1A 3EWIA 4L0MA 1U3CA 4V2UA 5LWHA 3BPSA 5AYVA 5ISMA 4C7OB 1Q95A 3MPUA 3ZV4A 1UPFA 3BMCB 3UK7A 2P6NA 1TT5B 1Z6QA 3FPKA 5G0UA 1FTQA 5K6RA 2GXAA 3C0KA 1XDSA 5B6JA 3UHAA 2C92A 3TZEA 2PQ2A 3GDFA 3BMQA 5HIKA 2IXFA 4GP9A 1BVYF 2DT8A 2I7CA 3QX8A 4YP1A 3H2HA 3QWHA 3DV0B 5IX8A 1A8PA 3M49A 4WNCA 1ODTC 2EKZA 2XDAA 2QV7A 1NWCA 1QAQA 1WCIB 2ZPTX 5FWAA 5TB5A 3G8YA 3RT1A 4D8UA 1PWXA 2NZ2A 3GLIB 1NWHA 4XTCS 2C1XA 1INLA 1GXSB 4PAGA 4ZT7A 4DJFC 3I9OA 1QK5A 1U2RA 1FFSA 2INGX 4OSPA 2XUGA 5DNAA 2FDCA 2GZDA 4COOA 3GZ4A 2CJXA 2NUPB 1H2YA 3H97A 3WYDA 4JJGA 2WBLC 1G19A 1ONNA 1TKBA 1WSAA 2ZS8A 1YB5A 3PZRA 4DCOA 1ZQ9A 3H11B 2C8KA 5IKOA 4BKQA 3IHWA 4D9NA 4BLUA 1SXIA 3U7GA 1RMTA 3F4LA 3NVAA 5CYGA 3T5PA 4EF4A 1P3DA 4NCJA 4RVHA 3LXMA 2JEOA 3INNA 2BFWA 1UMBA 2Q3LA 3L43A 5FBHA 5I7UA 2AR7A 2FSFA 3DFZA 1NASA 2PZMA 1KPGA 3JQ9C 4O2AA 3UV6A 5HSGA 3DBHA 1PR0A 3R7WA 2E5LB 2CHQA 3ESYA 1EWRA 4A3SA 2PX3A 3KZCA 3UVEA 4ARUA 1TJ4A 3ANSA 2QKYA 3V1TC 1JPNA 2I6XA 3HEMA 4K1LA 2V59A 1HOXA 4NOKA 2OBLA 2IYVA 3QVKA 2ZJAA 3E9DA 4B31A 2GM5A 1KR5A 4IDDA 4YAIA 2YMQA 5COQA 1W7AA 3O8BA 1FYWA 1NV8A 2BOVA 4WCFB 4PN7A 2HSJA 2ODNA 2IIPA 4X6XA 1OKKD 4KYTA 2MOKA 2J3LA 4BU0A 2VRCD 1BHSA 4Q93A 2Q5JA 3N07A 1QQ5A 1SKYE 2BFDA 5EMMA 2OTCA 3AVXA 4Z2YA 2GXQA 2RC6A 4P7KA 1KYXA 5LWQA 4M2LA 3RSCA 3WMFA 1H9AA 4MGIR 1EFVA 3RT7A 2COUA 1DC8A 3OLWA 3GLSA 4P35A 1OU0A 5D3ZA 5HM6A 1XROA 3HLTA 1HEUA 3IEUA 5JCJA 3TGLA 1GTMA 1O1YA 3EQ9A 3IEXA 4MWGA 1KZ1A 2X8AA 4NIMA 2BEJA 2HPAA 2QS9A 4B40A 4BX3A 1EJ6A 1RWPA 3QEMB 3R3UA 3W3AD 3BOSA 4DAOA 1VHQA 4MUKA 3M1IA 2D6FA 5CVVA 4B46A 4WVLA 1LSJA 4C20A 3CO5A 4EW1A 3QYFA 1WVIA 4DM3A 1YV9A 4ZVVA 4M0PA 5A4MS 4F4UA 1RACA 3DEHA 2VHJA 2NZUG 4YRDA 3PT9A 3TM5A 3EF1A 2B5WA 3F9IA 3OPMA 4J1SA 3RNLA 4KX3A 4Y1GA 4OQLA 3SS8A 4BE7B 5AW8A 3TTXA 3QXXA 2ZREA 5LD2C 1NUHA 3AU8A 3HV2A 2QVLA 1T6NA 4MV1A 2X0EA 1KKLA 3KQYA 5B53A 4NYIR 3OFKA 2I2WA 5K0JA 5JQGF 4UCFA 3RIXA 3RJ5A 1QTIA 2FRXA 3QKWA 2CL0X 2O20A 4V0RA 2V6GA 3D2BA 1HZJA 4JITA 3MUFA 4D0RA 4ZDJA 3T99A 4Z4IA 1GQYA 3MT8A 3M3DA 3K20A 2NGRA 2D8MA 1YB1A 3HKBA 1E5DA 3S6JA 2H1CA 5DGDA 4RIGA 1G3IA 3BEDA 1OX6A 3WBBA 2BH2A 2V6IA 2FX5A 2FXIA 3KWLA 5GWXA 3WNQA 1S96A 1MRSA 1NT4A 3A9UA 2C9ZA 5SZJA 5A0TA 4J0CA 1E5XA 3NBFA 4OMFG 4RM3A 1RRKA 3I2JA 1J1ZA 1JA0A 3OO1A 1NV9A 2WD7B 5EJ7A 3JTEA 1D0IA 1NDUA 2Z1DA 3W6ZA 4F3RA 5JXJA 3ZXUB 1QJ4A 1RNLA 3E15A 5BN5A 1RC8A 4WNYA 3MT7A 2PH5A 1XZAA 4CT5A 1LF0A 1EGMB 2H3EA 2ZUUA 4TLEA 3TBFA 2DERA 2CXHA 3H1PA 1ORVA 1LZKA 1NI3A 3DMDA 5J4YA 3EDQA 3IVMA 1KMNA 3GJXC 3VZQA 2D2XA 2P0AA 2ZVQX 4CQLB 3TLZA 5JLJA 4S1VA 4JBLA 3N0VA 4MGYR 1HI9A 2I6UA 2PJUA 1NXXA 2ZAGA 3B2NA 4M54A 3AEQB 3GD7A 1VGRA 1Z17A 3F49S 4IDEA 3VYWA 2ETVA 4XH9B 1GVNB 1TTHA 4GXNA 4O02B 5FUVA 1AKQA 5BNIA 3JQFA 2H1SA 4NE7A 1ANKA 1HKHA 2Y05A 4TLBA 1KXJA 3UJ6A 3DKPA 3ZW7A 2EJVA 2HDOA 2Q45A 3ZEIA 1WL8A 1U1GA 3ROMA 1XTSA 2TS1A 2XNSA 3ITKA 5FO1A 1DI0A 1SG0A 5F12A 4C04A 1M6EX 3BXPA 3CZ9A 1MOPA 1USIA 2AK3A 1W4RA 1DWUA 1VKJA 1QFXA 1I1HA 1EUZA 1HFEL 2A4MA 2FSVC 2CJWB 3I8SA 4JBYA 3AGQA 1T36A 5CT6A 1C8VB 2BHLA 2HBZA 1MVOA 4FYHA 4G5RA 4GSLA 5FI3A 1Y5LA 5HJ7A 1R6BX 3KEGA 5DLEA 3KOUA 5THKA 2FMTA 2PWYA 2ID7A 1K7SN 2FX3A 3D6TB 4B35A 2YHAA 4JOSA 2G06A 2WRZA 1RJWA 2VHEA 5LQJA 2AI1A 4UXIA 4HDRA 2ROQA 4G8BA 2BM1A 5GZ6A 4U7JA 1BEUB 1DX4A 3MB8A 3VR1A 4ZOLF 1RJEA 3HXQA 4PX3A 2ERYA 2V74B 1IIRA 1PWEA 2FW6A 2PPVA 2Q9BA 3R0ZA 2R6CA 4KRXA 3TR5A 5KQSA 2Y1FA 4FXPA 2WAOA 3G2LA 3A1VA 4L3OA 1VECA 1M1NB 2J5BA 3MQ2A 1OB2A 1FFEA 3C1OA 4C0HA 3BH7A 4YJGB 1J8VA 2GHIA 1Y8AA 3T5TA 2PD4A 2R6ZA 3A3PA 4Y9RA 3SZUA 2I4LA 2ZSUA 1W1UA 4LBZA 4BB6A 3NOXA 5ALFA 2F8LA 2PR7A 3QA9A 2PUAA 1YVUA 4ADSG 3GLGA 3X1ZA 1KEEA 1KL7A 4K6FA 1OH7A 2DJ5A 3B3FA 4PSKA 1XGKA 4A6PA 1JQDA 4MJ7A 1Z29A 4ZO4A 1V6AA 2R8XA 1V8PA 1NRIA 3AYZB 3ESCA 2ADOA 4U7WA 1DG3A 2P3OA 4Q3DA 5HKLA 4TTAA 2LIPA 1YB2A 2A92A 2W22A 1T25A 1ELOA 1FFAA 4FOPA 5TRTA 3C43A 5IKXA 5MF6A 3A3OA 3D5TA 3HGTA 2F9LA 3OECA 4P3NA 1A9ZA 1PJTA 3FHCB 5CYOA 4DM7A 5I7HA 3FG9A 1KAGA 1XTPA 2I3ZA 3ETCA 3NH6A 4MV0A 4LXHA 4RZXA 4WASA 4NMHA 3CR3C 3A6PC 1TA4A 1OFVA 2YC2C 3GQBA 1Q16A 5JNRA 1U9ZA 1SY7A 1U11A 2FPIA 1H4SA 3TNJA 5FFMA 4RZSA 3GRRA 3IE0A 3VYTB 3W5CA 2GFQA 4O4LB 1R5JA 1QQTA 5LKRA 2CMKA 3GGPA 1OYWA 1S7GA 1U8AA 1LEHA 5JROA 1KDTA 3M9LA 3L1KA 3SNHA 5K3SA 3K6SA 4LKOA 1HH4A 2KQUA 1W93A 2GN0A 2ZZMA 4ARIA 2K7FA 1NMXA 3G9ZA 4XFKA 5K3CA 4MRSA 3FB1A 9ABPA 3VOSA 2VQFB 3TKAA 1JHZA 3BERA 3DUFB 4J3JA 4WNAA 3T1NA 3WKAA 3KC2A 1QHYA 2H4FA 2YJ3A 4XB1A 4H3KB 3AVYA 3HBJA 5F1KA 3EVDA 2XRYA 5ABPA 2EQAA 3OC0A 1PVDA 4JQYA 2OGZA 1U28A 2H0QA 3WLIA 3VKUA 2X7XA 4P53A 1VLZA 1N0VC 2XDQA 3KRTA 1E5TA 1L7MA 3TOCA 1TA9A 4GWGA 1S4QA 3LZ6A 1PT8A 1UKEA 3AM4A 4IHJF 3A8TA 1Q0ZA 4HDSA 2WHYA 4FD3A 5EN4A 2QGFA 3HUFA 1B26A 2JGNA 1V4VA 3MTIA 1K2WA 3NTLA 1NRJB 4CXMA 4UUNA 3DUWA 4NMLA 5EP4A 3L8FA 1KJWA 4P2GA 2GVZC 1UKAA 3X1XA 5BMVF 1QAMA 2YIJA 4MQ4A 2H2WA 1U0GA 5F64A 2RHBA 4FCCA 2VDOB 3Q3GE 4OHOA 1A9TA 1QH1A 3TW4A 3H9EO 1A27A 1QV9A 3AJEA 3L40A 1DAHA 1PGOA 3Q6IA 4H7KA 4YDHB 5DYGA 3TIIA 1E5LA 1U1FA 1K4KA 3V4FA 4B6QA 2SECE 2ZB2A 2Y1GA 3Q12A 1C7QA 1IAQA 3KU1A 2XXAB 1G7SA 1SOVA 3IFSA 3UJAA 2C04A 3T9EA 1GU1A 5LPNA 5G4KB 5AW5A 2JIZA 3PFGA 2CLDX 4RY2A 4CN9A 5ICCA 2FYTA 3DEJA 4M99A 1LRJA 1NF8A 5ALEA 3DM9B 3EZYA 3G8CA 4EY8A 4GMXA 1WW8A 1QB7A 2WVGA 1L4YA 4QBIA 1J4AA 1QNLA 1E1DA 4IHJA 1N2HA 1T9AA 4QPPA 1MA3A 5FI0B 2HLDA 2VN8A 4ASUA 5KUTA 1ZKMA 3KE9A 4HHEA 2IH2A 5IAGA 1H1LA 3G0HA 2DUNA 1CVRA 1E1KA 3KR0A 1ATIA 3MRXA 1W52X 2Q3DA 2CL7X 3MUOA 1Y7TA 3O90A 4PSUA 4C78A 5ITZA 4WN3A 3FVVA 3IUEA 4UUBA 5BMVA 2J4CA 3NO4A 3FJ1A 3QX7A 1DQYA 4A26A 2BMDA 4HZIA 4L5AA 3AKCA 4N8EA 1RPTA 3W2FA 3R5FA 2H7CA 1DEOA 1HTBA 1HE3A 1P1IA 2ENUA 2QX8A 1KQ3A 2W6JD 2XGMA 2XE6A 3AQIA 1HDCA 4IIJF 4L51A 1J23A 5B57C 1O5TA 5HTOA 3PVZA 4CEIA 5CFNA 1PS8A 4IIDA 1E6EA 3R1IA 4R1LA 4V0SA 5EXXA 4Z1MD 1JRLA 5CURA 3JPYA 4X54A 2AG6A 3BK7A 5TV2A 5BXQC 4UMVA 2GPBA 2ZSIA 5AICA 4FDMA 3PXBA 5B7GA 5CH8A 4Y2PA 3VSBA 4KDFA 4ZQCB 1ECCA 1SKUA 2BGUA 4HDKB 3PXGA 3D7KA 1XHFA 3EFEA 4TZ6A 2YYSA 1U2TA 2WAXA 5G0SA 4HRYA 3CH6A 1MO5A 4KLRA 1MOSA 3N0XA 3U0VA 3VC2A 1FF9A 4CIVA 2IZ6A 2ZRHA 4NS1A 2ZJ1A 4KPEC 3VDMA 3SIRA 1EVJA 4BEBA 3JQAB 1BXRB 1G20B 3D8HA 3WLOA 1X39A 4MQMA 4DY4A 1CEYA 4W7IA 2V55B 1OWOA 5FUXA 1BE8A 1DDOA 2VK2A 4PE5B 1ZGJA 2GF0A 3O47A 1T5SA 1RRFA 1Z7BA 3FSEA 4JWTA 2E6KA 1C1DB 2M2IA 4ITUA 4NV1A 2IU0A 4FS3A 3WB9A 3ZVKA 1OFTA 2EX0A 4M0KA 5FAXA 2GTPA 4IIJA 5ENVA 2VPQA 4RA6A 4DDWA 2VHCA 1XCOA 5IT5A 1C7FA 3JRNA 4FW8A 4Z9XA 3IMEA 3ZGNA 2O54A 1DVRA 2O3JA 4A8JB 2SKEA 3PDUA 2YQ5A 1SFRA 1WZUA 1ECJA 1M2NA 1WNFA 2FEPA 2FG6C 2QG9A 1R1DA 2FZGA 5F2OA 3V6MA 2PHZA 4E08A 3NUQA 5I3CA 5J4VA 3SHOA 4JQOA 1FOEB 1F6WA 2KM1A 4YAEA 1O3YA 3HC7A 4GI2A 1ABEA 1ORWA 3U7IA 3DCIA 4QUAA 3T7IA 3W1VA 1EPUA 1PU2A 2XCRB 2Y1XA 3DKRA 3GGDA 4B3GA 2XHZA 3GGCA 3FSGD 3IV9A 4A2QA 3PVSA 5H70A 2ZXFA 4X9XA 2X0RA 2XE4A 4PGAA 4J16C 5CG1A 3AR5A 3ZGZA 1A2OA 1ADGA 1S2DA 2C2KA 2W71A 1ZBDA 3PQ6A 2WYVA 2GUWA 1XZLA 4G9GA 2H2IA 2AE2A 4DLZA 2V7PA 1YHNA 4EB8A 3T1VA 4DR6B 1LJLA 5REQA 4YV1A 1GKIA 2NO1A 3L5KA 4GR5A 4RK4A 3SFZA 3GRFA 4OLJA 4NC9A 1XZIA 4M0MA 1XXLA 4C4AA 4C0AC 1P4JA 1YFLA 3AH8A 4UXHA 5IDXA 2QDKA 4KITB 1AIPA 2H5JA 2PGXA 1NN0A 4H6XA 3TD2A 4Y2SA 4RU1A 5T7BA 2EZ4A 1U8XX 3RAJA 2WU8A 3W5IA 2BRUA 4A82A 1Z28A 3SPXA 3KQSA 3U3RA 4LNUB 4V1CI 3L6BA 1QS0A 1QFJA 1PT5A 2RGNC 4RV5A 4WK4B 4G56A 5EMKA 5HZKA 4UZFA 2F55A 4LJRA 1GGKA 4MDEA 1KZ9A 4C4RA 2QBYA 4GVPA 1DCFA 2EATA 3OD5A 3R3JA 3R76A 3PRYA 1F2VA 4K5QA 5BSGA 2H18A 4CKWA 1PNTA 4YRRA 5FA5A 1GVHA 1IB6A 4EKEA 1K75A 3K30A 2PZGA 3G0IA 1HDYA 3KPYA 3GRAA 1HNZB 3U7QA 3ZC3A 2GAJA 2BBSA 3NEYA 1MU0A 4LBVA 4NMMA 1R66A 1E92A 4DF3A 1QQBA 1S5PA 3E0QA 1R0LA 1FTNA 2HK9A 1ZK3A 3PC8A 1ZM2A 4WDQA 5ITVA 3EXEA 4BNTA 2IHBA 5BW8A 2GEVA 3EFOA 2FHSA 3ODPA 3PQFA 1VIVA 1N3BA 2FF5A 4GBGA 3RC1A 1W29A 4E2WA 3HM9A 2NN3C 1LGYA 1KSHA 1XWWA 1WU7A 3L92A 4NLLA 4F04A 2O0KA 2F17A 3PHIA 3X0DA 1H8HD 1FZQA 2A14A 2JAWA 3CLTC 3ZR4B 2D59A 3L7MA 2F59A 4MB2A 1PR6A 1H85A 3VZSA 1DKOA 3I1IA 4R9VA 5KX5B 4B4VA 2FUNB 5T8KC 3S5UA 5KU1A 4RA9B 2GASA 3RTDA 3W7AA 2ZYIA 2NTJA 1ESDA 2JCSA 3PFIA 2M6LA 5BYJA 4N76A 3U49A 3NW9A 3QFSA 1F0YA 2W0SA 4I4TF 2BHTA 1XJCA 3ICVA 1WKBA 5JAOA 5JYEA 1UMCB 4CR7A 4TYMA 5BSMA 2EIXA 2W37A 2W6MA 1IZ7A 2UUBB 3VR6H 3CUTA 1WXFA 2V5UA 3HJGA 2FY8A 3F8SA 4PIMA 4BNDB 1CE8A 1Y82A 2J5XA 1W73A 4Z7JA 5ALLA 2PUHA 1JPJA 3CB2A 3DC2A 2W8ZA 4MV9A 4D46A 3TS1A 4BMDA 2VDLB 4TXHA 2E9SA 3LMKA 1SCUB 3QTBA 3ZHZA 1LPAB 3ERCA 1QGOA 4LPSA 5C52B 3G5LA 3NUZA 2XMRA 4D3DA 2RGBA 3HB4X 7REQB 3NIFB 4YEDA 4U2GA 3ND9A 4MI3A 2PT9A 5AW0A 1C81A 2ORWA 4PV7A 5SYAA 1E7QA 3AUTA 4U8GA 3FWPA 4EG1A 3LYHA 4K46A 1XMVA 1RHQA 5TX7A 2W2KB 3K9QO 3QU5A 4TTJA 1XEWY 5AWFC 4L8WB 4E5NA 1YACA 3LCJA 1LLFA 4B2IA 4HR7A 1TK9A 2IYZA 4QDTA 1R9GA 2BP7B 4QM7A 3EXHC 5JAPA 4PO1A 1E4EB 1NM5C 2DPYA 2FLWA 2GBGA 3OX1A 3UTDA 3ZWNA 5C32A 4QFDA 3S3TA 5KYWB 4QHYA 1WY5A 1XRSB 2RH5A 4F84A 3HU5A 1Y8QA 5GOZA 4MLDA 4NHOA 2YJGA 4YRMA 3UC9A 1OASA 2V4ZA 1CUCA 2DC1A 4HAOA 5F7OA 1R6TA 1Z83A 2J9ZB 2AQKA 3TTWA 5YASA 1QK4A 2EZ8A 2HHAA 3QELA 3USES 2JGJA 3GXOA 2X77A 4V0MA 4LF6B 2QQFA 4M89A 5DI3B 5DASA 3L4BA 1I4DD 5IABA 4MCHA 1A8SA 1PT9A 2AN9A 3GCDA 4X91A 5E6UA 2RIPA 3TRJA 2V4MA 4KXWA 3WLPA 4CMHA 4D5GA 3ZD7A 4KXXA 3ISJA 4H59A 2GX6A 2EKPA 2JFVA 4RYLA 4RZ3A 3K1JA 2VDUE 2P5UA 1M0EA 2HSZA 4RVNA 4R0NA 1UQUA 3D0QA 1H69A 2IZ1A 4CJXA 1C4XA 1O0CA 2YBDA 3Q3EA 3F4KA 4CETA 3NBQA 1NURA 1HNNA 2IFTA 4MUMA 1P60A 5F1OA 3TLCA 4BLSA 2AN1A 1CNFA 4ZYLA 3AR3A 2I65A 5FWYA 1CQIA 5ITSA 1LSUA 1O89A 1XCJA 2QAGB 1R4ZA 3GH3A 3MHPA 1Z13A 3OCJA 5KNCD 2YW9A 4FOLA 1DLJA 2ZAMA 3FNFA 4H0CA 5IT4A 4ZANA 1V4NA 4HUQA 4JQZA 4IDOA 3UMFA 4BGUA 2H52A 2WSSA 1G42A 4KLAA 3II6X 4BJ5A 3VYSB 3H05A 3LBIA 2CYBA 5CJJA 4QO8A 3DYBA 5CFOA 3NRCA 4R84A 4YCBA 2IVFA 3K1TA 4JR0A 1HEYA 1W0KD 2P77A 1T3GA 4P83A 1ISIA 3T7EA 4BJHB 3IVRA 4U5XA 3RADC 3QLUC 5MN5A 2XEDA 5EUQB 3ZCUA 1DPGA 2O05A 1TAHA 1Z0KA 1G9SA 2OOKA 1ZSVA 2NVUA 3EMDA 4R8MA 5IF9A 3NVDA 1HURA 1YJ8A 2EC5A 1P62B 2QLMA 1C4KA 3GN2A 3JXEA 1UPCA 4UBJA 3AVQA 1QLJA 2P4EA 1YI1A 1ONPA 3IBGA 4YJHA 2WI8A 5DM60 3HB5X 1TW2A 4IXDA 4QHSA 4UVEA 4BLVA 2AV6A 4PZZA 2G6BA 4EQ6A 3KPWA 4ZK2A 1DAKA 3GGSA 2JLBA 1VE7A 3B70A 5BQOA 4PYOA 3SWWA 4E12A 4P86A 3P7MA 5GJWC 4B6RA 1I01A 2FUG1 2PR2A 2HA0A 2Z3WA 3PJFA 4EJFA 4AKIA 3GYBA 1IFXA 1FMFA 1Z62A 5IK2D 3RHZA 5KQLA 3NRJA 2FW1A 1IXKA 2FKNA 4IO0A 1OWLA 3EYAA 3QK7A 4ALMA 4EKIA 1T0PA 5BSEA 1UM8A 2A5GA 3N3AC 3CCBA 3PXAA 4Y3UA 4GF5A 2QG4A 1IUKA 1QIMA 2JFPA 2K5UA 4OI2A 3LI2A 5DNVA 4PFJA 1RCTE 5D1NA 3P0JA 3KOOA 1VKRA 4KNVA 1XZEA 2QLJA 3SY8A 1Q0PA 1T4DA 1A76A 1TUIA 4ER3A 4C87A 1XKQA 3C3XA 2E82A 1OAOC 3A26A 4X92A 4BATA 3EVGA 3OG9A 2PTGA 4C0SA 3GU3A 5AHWA 4PZUA 3DEZA 1ZD2P 2ZFUA 1A9QA 1AVTA 5AXCA 1YC2A 2HXSA 3WKBA 2J9YB 3H2SA 3ADBA 4MWSA 1KVQA 4FYKA 4L9WA 4OUKX 3GJQA 4BPRA 3HJRA 3RU7A 3TXXA 4DQKA