1WSDA

Alkaline m-protease form i crystal strcuture
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
269
structure length
269
Chain Sequence
b'AQSVPWGISRVQAPAAHNRGLTGSGVKVAVLDTGISTHPDLNIRGGASFVPGEPSTQDGNGHGTHVAGTIAALNNSIGVLGVAPSAELYAVKVLGASGSGSVSSIAQGLEWAGNNGMHVANLSLGSPSPSATLEQAVNSATSRGVLVVAASGNSGAGSISYPARYANAMAVGATDQNNNRASFSQYGAGLDIVAPGVNVQSTYPGSTYASLNGTSMATPHVAGVAALVKQKNPSWSNVQIRNHLKNTATGLGNTNLYGSGLVNAEAATR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords M-protease
publication title High-resolution crystal structure of M-protease: phylogeny aided analysis of the high-alkaline adaptation mechanism
pubmed doi rcsb
source organism Bacillus clausii
molecule tags Hydrolase
total genus 98
structure length 269
sequence length 269
ec nomenclature ec 3.4.21.-:
pdb deposition date 2004-11-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00082 Peptidase_S8 Subtilase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.200 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Peptidase S8/S53 domain 1wsdA00
3Q40A 1Y48E 3QMPA 1IAVA 2Z2XA 2PYZA 1R64A 3DE2X 4RYDA 5JXJA 1WSDA 2IXTA 1Y33E 4NMXB 5ARBA 1OT5A 1WMDA 1GCIA 2TECE 4AKSA 1TK2A 1YU6A 4OV6B 1GA6A 1C9JA 5I9SA 4NE9A 1YJAA 5CW1A 4C3UA 1SUAA 1WVMA 3DE4X 3H42B 1CSEE 3D43A 3DVQX 2WV7A 1OYVA 3SQOA 1SIBE 4DZTA 2ID8A 1EGQA 2W2NA 1PFGA 2ZRQA 3Q5GA 2WUWE 3BX1A 1Y4DE 4CFZA 2X8JA 1TO2E 2ZWOA 4I0WB 1P7VA 4LVNA 1BJRE 1GA1A 3LPAA 4B5LA 5AQEA 3DDZX 3VYVA 5B1DA 1C9MA 3DE0X 1SUCA 1SUPA 3I30X 1MEEA 1SBIA 3LXUX 3CO0S 2ST1A 1PTKA 3WIVA 3A3NA 2W2MA 3F7MA 1Y3BE 1THMA 4ZOQI 1AH2A 1GNSA 4Z2AA 1BE8A 1NDQA 1AVTA 1GT91 2SBTA 1SCJA 5ARDA 1Y34E 1NLUA 2Z2ZA 3BPSA 3DW1X 2HD4A 1T1IA 3SICE 1Y1KE 3WHIA 1OYOA 1KE1A 1A2QA 2WUVA 2GKOA 5FFNA 1VSBA 1Y3DE 1ST3A 4WOCA 1KDYA 1AK9A 3TI9A 1TM7E 2ZWPA 2IY9A 4OMCA 1KDZA 1NDUA 1S2NA 1SCBA 3DE6X 2PMWB 1AQNA 3DE3X 3QTLA 2ID4A 5AMXA 1SCAA 3TI7A 1SUDA 2Z56A 3OSZA 3DYBA 1Y3CE 3WQBA 2Z57A 3EIFA 4KG7A 5JXIA 3DVSX 1HT3A 4H6XA 1SH7A 2XRMA 3LPCA 3AJ8A 2DQKA 1TM5E 1SELA 3UNXA 3WIUA 1MPTA 5B1EA 3I2YX 3A3PA 3GCWA 2HPZA 1GNVA 4YN3A 2SICE 1GTG1 3AJ9A 3GCXA 1EA7A 4DWWA 1C9NA 1P8JA 2E1PA 3TECE 3GT3A 3L1KA 1TM3E 3ZXXA 3VTAA 1ZVJA 4KPGA 5FAXA 1SCDA 1AU9A 3PTLA 1C3LA 3P5BA 1Y3FE 3A3OA 3I37X 4MZDA 1LW6E 1WMEA 1CNMA 3VHQA 1Y9ZA 3GT4A 1SBTA 2W2QA 1SIOA 1Y4AE 1SBHA 5K7SA 4ZARA 2X8JB 5AVJA 3HJRA 1ZVKA 4CG0A 1Q5PA 4LVOA 1UBNA 2WWTA 3DE5X 5JXHA 1TM4E 4NE7A 1SBNE 1SBCA 2PWAA 3VV3A 4DJ5X 1TMGE 1KDVA 3BGOS 1P7WA 4C3VA 1SCNE 2PKCA 1S02A 1S01A 4BWGA 1JEAA 4GI3A 1TM1E 5AVKA 1T1GA 2PRKA 4KB5A 4AKTA 2PQ2A 2G4VA 5JXGA 1GTJ1 2SNIE 2Z2YA 3T41A 1BFUA 1BFKA 3EE6A 1BE6A 3DE7X 3F7OA 2Z58A 3F49S 2SECE 1V5IA 1DBIA 4FONA 4WOBA 3DE1X 1R0RE 4JP8A 2DUJA 2B6NA 1V6CA 1KE2A 1T1EA 2W2OA 3D9QX 1XF1A 1GTL1 4HX2A 4H6VA 2DP4E 2Z30A 5SICE 3LPDA 3PRKE 1R6VA 4OMDA 1DUIA 1TO1E 3CNQS 2P4EA 2V8BA 1SIUA 4H6WA 1SPBS 1TECE 3VV2A 4M1ZA 1GA4A 1IC6A 1PEKE 3DVRX 2PWBA 1PJ8A 1AV7A 5ARCA 1YJCA 3DW3X 4K8RB 5JMOA 3ZXYA 3EDYA 1YJBA 1SUBA 1ST2A 1BH6A 5FBZA 3AFGA 2XTJA 3VSBA 4HVLA 4J94A 3DWEX 3QFHA 1WMFA 1SN7A 1SUEA 1AF4A 2W2PA 3I34X 4CFYA 2QTWB 1SVNA
chains in the Genus database with same CATH superfamily
1Q44A 3IESA 1ZHHA 4A2PA 4OM8A 3UIEA 1TCAA 3I01A 221PA 2VF2A 2WHQA 3QUQA 3TDKA 1NYRA 1NUAA 2B34A 3G5MA 4IAOA 1OBVA 5H83A 2OT3B 3MD9A 4A1FA 3WA7A 4Y6OA 5F1KA 4M9RA 2FR0A 3V80A 1Q1ZA 4H7EA 1A7AA 1JG7A 1DV2A 4R9RA 5DDIP 1T8UA 4JOSA 3BB4A 4AWBA 3QYJA 4XQEA 1OT5A 2WRZA 1R16A 4H3KB 4NR0A 2KLBA 2HL6A 5K3SA 2VQEB 2RIRA 3RVOA 4MQEA 4P7FA 1LF0A 2FEOA 4D79A 3CRNA 4OV6B 3WL6A 2BJWA 2NXWA 3KDPA 4UHEA 5DXAA 2XDWA 1NVWQ 1C1YA 1SC3A 2GETA 2QU7A 2XVAA 3IB6A 3KKEA 4NEHB 2D5AA 2BEVB 5B1YA 2ZCJA 1QGUB 3D8NA 4GMGA 3GD5A 3AETB 3QEBZ 4R9UC 4Z4FA 2JS7A 1JDVA 4OBEA 1C4OA 4G0MA 2UU9B 1U5AA 2H31A 5MDHA 1NSTA 2GFHA 3VPGA 1YR8A 2O23A 4C07A 4J2TA 4NS4A 4UVGA 4XVUA 1XP8A 2PAAA 5FD8A 3MLAA 4BFTA 4CIDA 2OB1A 2RAUA 5IJXA 2DERA 1P74A 1CF9A 1N1EA 1U0NA 2POQX 2IPNA 3KVNA 1PJSA 4AZTA 1X7XB 1S8FA 1QU3A 4KWTA 2Y27A 1ZH6A 3DVQX 3D4IA 1B8NA 1G3MA 5KDLA 3SY8A 3VAZA 3SEQA 1Y42X 3TQQA 2IUSA 4MCIA 4ETWA 1LUAA 4HV4A 4ALNA 3A10A 4LHXA 4CKCB 1BIFA 1IZ7A 1ECJA 4JH0A 2H0AA 5FBLB 3ZLJA 4URZR 1JAYA 2M1ZA 1GZ6A 3GRKA 3JZDA 4ZAFA 2OCDA 4HAXA 2XCSB 1W25A 2IOFK 1T5TA 1BS1A 3NI2A 2GXSA 5F7OA 5DOVA 2QAGC 4Q4CA 4MHOA 1N5LA 4G1FA 4QO8A 3IIJA 3EXFA 3P0RA 1UBLS 2YY7A 4GI2A 4HDMB 3CZMA 5J4VA 3EA0A 2H2IA 4D5GA 7REQA 2B30A 3UJPA 2GCPA 3E9MA 1I2CA 2V3VA 3FPEA 2FRVA 1NNSA 3ZUGA 3ZWKA 1PZEA 4ZAGA 1GCGA 2JGDB 2WNSA 3M3DA 1MG5A 2Y6VA 1BEEA 1Y89A 1XMQB 1MZPA 2PLNA 1JMKC 1SMKA 1H2HA 2X6RA 3VBCA 3I5AA 2V6IA 1PDOA 2OOSA 3PNKA 4QULA 4BIMA 4BNLA 3K1TA 4KWEA 4JLJA 2W90A 3NR2A 5E4TA 3HHPA 1GXSB 5LWQA 2JIDA 4U2GA 5K8LA 3ND8A 1AZWA 1WTCA 5AI6A 3AVYA 2EFGA 3DDZX 3KR1A 4MXDA 4DC9A 3FCYA 4EUSA 1WB9A 4BO4A 1QKJA 1T8PA 1M6YA 3PWKA 1L8LA 1C9MA 1JYSA 2QQ5A 3C7DB 4RL4A 4D4JA 5EE0A 4JLUA 1S8OA 2ZB7A 2ODBA 4RZ3A 7ABPA 2KBEA 3CJTA 2Y77A 1C7ZA 1VE3A 3W4IA 2GGSA 4N82A 3ZX5A 2R6CA 3D0RA 3KX2A 1PTKA 3N2KB 1KBOA 3TE6A 5AP9A 1UBOS 1FS5A 4GL4A 3ENWA 4IG4A 4YHBA 5KYUB 4PC6A 3SU8A 4MROA 1JMVA 5KQSA 1EYZA 2GBCA 3O3MB 2H1CA 2J85A 1GRVA 3C48A 4RTRA 5HHTA 4HWKA 3B5JA 4RVFA 4DMGA 1ZLXA 1IRXA 2GYYA 3ZZTA 5EZQA 2AFIB 3FZNA 3HA7A 1DPFA 1R66A 3A1WA 3V4FA 3O3NB 1U8TA 3JRXA 7MDHA 3NDPA 1XTUA 5EWJA 1NC3A 1RS0A 1Y34E 4PVCA 3JVEA 2PMEA 2A9QA 3TR6A 1ANKA 1V9LA 3DV0B 3OPYB 3VC1A 4LSMA 4J4HA 3E3NA 1NLUA 1CRWG 4ER3A 2CUNA 2PLRA 2CL7X 3LKDA 3O73A 3F46A 4JWKA 2AKEA 3TD9A 1P73A 5BYAA 5KWSA 1HE5A 3ANLA 4S1OA 1GZUA 3S8MA 4TTVA 2FRDA 2G40A 2NSDA 6CHYA 4KZPA 3FF1A 4QU5A 1A8PA 4EHKA 1P80A 2J59A 5JNLA 2VHZA 4WT7A 2EBFX 1OYOA 1KE1A 2CW5A 3ZBQA 4EG4A 3DBRA 2A1IA 3G23A 3PQ5A 3WYGA 5SYNA 1ZJWA 2YWFA 2QRVB 4XM1A 3BRWD 4UCWA 3RS4A 4ZN6A 2QYOA 2GESA 4HQOA 3IHTA 3R0QA 1RYHA 1YMQA 3HUEA 4Q1VA 3ESZA 3UCFA 1F5NA 1U3UA 3GHYA 3KEFA 2FQYA 1E4YA 1RPJA 3EARA 1O77A 4PN3A 4ZIRA 4OMCA 5LLSA 1ZL0A 4D92A 3LRTA 5IBQA 2NZ2A 4LCJA 4YGYA 5TPWA 4IUCS 5K0JA 1RM5A 3BT7A 3SLKA 1ORDA 4QUJA 4F8EA 4LTMA 3U44B 1Z4IA 1FU8A 2A0KA 4K81B 3L46A 3TMAA 4BNVA 2RSLA 1Z2OX 1CRLA 2VZLA 2QTVB 1HF3A 3JWIA 4YO7A 5K03A 3Q3IA 1QIEA 5LP6C 3WGTA 3OKPA 4X1KA 3T4XA 2O07A 1F2UA 3NHPA 1RC1A 2B5WA 1A7JA 5B3JC 1N5JA 3O8DA 1O3YA 3AP3A 3AL0C 1WUYA 2VK1A 4WGGA 2IZZA 2G08A 3V32A 4U39A 3L6OO 2UVPA 1WXQA 2AQHA 1JN0A 2WU4A 3I2JA 3RTEA 1E1QA 1IULA 3MCUA 3VNBA 5HWSA 3ITNA 3VSAA 4DSOA 5L3QB 1UPAA 2XMQA 4BNHA 3QY9A 1XK7A 4TKUA 1AHPA 1L9XA 2Z3VA 5B1SA 1Q3HA 5JLJA 2R8EA 1S2MA 3LUDA 5NULA 2BI7A 1Z8FA 3MWJA 5TV2A 2WJYA 3CCCA 1EG2A 4LXXA 2Q3HA 3FM9A 1GHTA 1W1WA 3L0SA 2O3JA 2ZRIA 4I9FA 4FB4A 1VKNA 2CMFA 2OESA 3IQZA 4EEKA 1L7RA 3HVIA 4KQEA 4X7BA 1T1JA 1V4VA 5D3ZA 4YPVA 3BXFA 3CZ4A 4OX9Y 1VJ5A 5EJFA 5IAEA 3D31A 4EO4A 1GNVA 3EZ6A 4Q1EA 4TVOA 3COJA 3IBYA 2OA0A 1CE8B 1NV8A 3BZBA 4MQEB 2JI8A 2DWUA 4WIAA 3CNOA 4NFHA 2FPIA 3A1NA 4NAVA 1L4UA 3TEFA 3L8ZA 1JR3E 2O20A 1V95A 5CHYA 5TGDA 1FC0A 2C5HA 2F3TA 2H5IA 3FXAA 3V4PB 4C03A 4JEMA 6AT1A 3AJAA 1TLTA 4P2GA 3Q0TA 4LZOA 4YPFA 1A72A 1X8LA 2DHDA 1R9NA 4X44A 3OO1A 1I6WA 1VMAA 2WJVA 5FWNA 2N3ZA 1TUBA 1XWIA 1BKYA 3IBGA 4WXYB 1OLOA 2PKQP 2ORYA 4M60A 3W2EA 4ZICA 5BQXA 4ZQIA 5JH7A 3AZPA 3PGLA 1QQ6A 3MAGA 4GGMX 4YMVA 3T4PA 2I3AA 2R4TA 2OZPA 1AKWA 4MJLA 5IUKC 2I2DA 4ZCPA 4ZHQB 1ONOA 4P4LA 2PMCA 1FTNA 1XD2A 1DIOB 1JAXA 3RIMA 1SC1A 5HW0A 3BHMA 4XTCS 3PFFA 1XZQA 3D81A 3MB8A 3I04A 4YQFA 3HPRA 2JLQA 1NW5A 3IKMB 1BA3A 3P9IA 1D6SA 4H6PA 3UF0A 4X8HA 2P9YA 2ZR9A 3KPWA 3VHQA 3IKJA 1JA1A 4L95C 4WLUA 3G5AA 5KWIA 3EWIA 1VDZA 4II3A 1SIOA 2C82A 2DFNA 1SIWA 3B78A 1XYGA 3HNPA 4WZBE 1KPHA 4NNOA 4NU8X 1E5QA 1GQRA 2R1VA 3HB1A 7REQB 1DAKA 1L5QA 2FSVA 3QVXA 4GM1A 4Q3KA 1DO0A 4BRUA 2MMGA 5KTMA 1KMIY 1Q5PA 2WD8A 3OE1A 4K9OA 2FMFA 1PJ2A 3BFXA 4M7RA 4QT0A 2W5UA 1WWKA 4MVCA 1J7JA 3ZQ6A 5HUHA 3FDFA 3QEMB 1YMVA 3H8WA 1JJBA 3DYIA 2Q3LA 1H69A 3EFBA 3K0BA 1CDZA 2PQMA 3OQPA 4LNUB 2RAPA 1SBCA 1OFVA 1EXWA 2BZGA 5TDHA 2X0JA 3C6XA 1SHZA 3NH9A 4TL8A 2IHVA 3A36A 1TMGE 1PW7A 4HVTA 4UHCA 5K6AA 3ZZMA 5AW5A 5LP6F 3H5LA 4C3VA 2J4CA 2P4SA 5JYBA 1GG8A 4HGYA 3EXAA 5JPDA 1NMSA 3BKWA 3FBTA 1ZCZA 4LWZA 4ZVOA 1DAFA 1JDNA 2OYSA 3ZTTA 5ECYA 1MOSA 3F5FA 3S1AA 1XRJA 1W8IA 2JL1A 3BWXA 2Q9AA 4URWR 4PZPA 1IG3A 5JNSA 1N2OA 2H9IA 4HR7A 1LPNA 4Q66C 4A9AA 5AW7A 1Y4ZA 4TWIA 5I7HA 4BO8A 3BICA 1RM0A 3AHJA 2O8BA 4W9NA 4R6XA 1XN4A 3AR6A 1MHTA 4B47A 5HG0A 1JQ5A 1OLXB 5E6SB 3TQFA 3ZCVA 2NV2B 3G2QA 3EPLA 5A9RA 3BF7A 3AT1A 4Q48A 4IZ6A 2OFXA 2PWYA 4UVIA 5B58C 1M6EX 3WK6A 3IXMA 2PVPA 3M3HA 2Z1MA 3PTAA 4TTAA 2FWRA 2O3UA 2GKGA 4HADA 2N42A 2BV3A 2HQRA 2BEJA 3LTEA 3O31A 2J41A 4XWOA 5HIKA 4MRNA 2W37A 1G42A 2A3NA 4DABA 3F9RA 5F98A 1EWQA 4DLPA 4U7HA 1X92A 2JDID 3EGCA 1XTVA 3CF6R 3WLQA 4OGLA 2EP5A 4LFCB 1NBIA 1C3OA 5TEVA 1RKQA 1TCUA 1Z56C 4OY3A 1JDUA 4TTJA 5E9WA 3ROTA 2QE7D 1P81A 3C15C 1SVOA 3EBLA 1UR5A 3AF2A 3E5MA 4IR7A 2J3IA 2QTBA 3MELA 4Q1BA 4I4TA 1NVVQ 1KE2A 2XKJE 4DC1A 3U1BA 5AVTA 3W1VA 3RK1A 3ZNPA 4EF5A 2VHVA 2VDWA 3E3AA 2W2LA 1U2DC 3IERA 3SZUA 4BU0A 5JCOC 5J4LA 1AA6A 5TPWB 4JLOA 2EKDA 4LNAA 2CXUA 1Y4SA 3NTXA 2AK2A 4OD0A 1WZIA 2B7LA 2HC9A 3E7DA 4TT3A 3RC1A 4PSUA 1XMOB 2OAGA 4E4TA 4MKIA 1XKTA 1Q0LA 4N54A 4LYJA 5FLEX 3T5MA 2XE7A 3RUHA 4F38A 3RQSA 1F2UB 2QYSA 2DH6A 2WG0A 1MFZA 3OU6A 3TW4A 2FEWB 1QK3A 3MCVA 4UE2A 3X2SA 1J24A 1OA1A 2VHCA 2WOJA 3SOPA 4HAYA 4CM5A 3KKLA 3ISTA 1D2CA 3RWMB 3WYFA 4YUXA 4P81A 4C1BA 2A5DA 3AMVA 3TJMA 1E5VA 1ENPA 3DPSA 1HFKA 2UVPB 4GLOA 4HGZA 1TECE 8MHTA 3RVDA 4CIWA 4DQXA 1RMTA 4H27A 3G1UA 3W5VA 5SY6A 1NMQA 3ANNA 1XMSA 2J9GA 4PPNA 4QQRA 4C7KA 1QIFA 4KKVA 3JQBA 1Q7EA 3D0OA 3T5PA 1ECLA 4E5DA 1ATZA 4EKNB 3ER8A 3SDZA 1POXA 2E4AA 2QTTA 4UAVA 1WETA 4AMVA 3E9YA 4RAQA 1UC9A 2GF9A 3EG9B 4LPKA 2V7EA 5ALOA 1PUIA 3MWEA 3U2QA 3RS9A 4FWTA 3C97A 1RKBA 3CONA 5K0NA 3TD2A 4ZTBA 3GR6A 3WLOA 2MYNA 3JR3A 5BQ5A 2BGWA 3HLYA 1DRUA 4B4VA 3EFOA 2E82A 4IW3B 4OK6A 5JSZA 3JY6A 4C4XA 2D5LA 3CEPB 1QKIA 3PB3A 4OGFA 1RBYA 4MUMA 4DGQA 5LWHA 3VSBA 5C0OE 2WYHA 1D2GA 4TSRA 3IAHA 1E94E 1K92A 2B1GA 1ZP6A 4IDPA 2IHKA 2HK7A 3WWYA 4FGJA 2W2VA 1XZKA 3COPA 3SQXA 3L49A 4C0WA 1PT8A 1QIHA 5CGQB 3R7NA 3DL2A 2ZUSA 3H18A 1KZYC 3KV1A 1BWQA 3DNMA 3OLVA 4O1MA 4L9SA 4OMUA 4WTOA 1U7ZA 4TXHA 4EPXA 5AHKA 4ETNA 1Q0ZA 2R2AA 3DOFA 4BFSA 5IWAB 1A1VA 5JH7B 3AO0B 4E51A 5EZ5A 1AF7A 2B20A 4DTCA 4WAUA 2HO4A 3OJ0A 4IDAA 4IDHA 4OQQA 1KRXA 4HYTA 1X2BA 3PC6A 5J59A 3U7IA 4IDDA 2WOOA 1XD2B 3E9CA 1AHHA 1BKDR 3EDCA 3D4LA 4MNTA 4ZEMA 2PUGA 3ZC3A 2C7RA 4FT2A 1DFGA 1Q84A 2NSHA 3X1DA 2VH5R 3HUDA 3PT5A 4MEBA 2NUTA 1PK9A 3VO2A 1EDBA 4KSBA 4E07A 5BSGA 2ONYA 3UHAA 3UH0A 4D9KA 4B6OA 1DXOA 3KWJA 1Y8QA 2Z08A 1QRTA 4LG1A 2BZ1A 3HXPA 4LGMA 3DYVA 5DN6A 5H1YA 1K3UB 2C84A 2I4MA 1PNOA 3SF8A 4D56A 3CTMA 3VR2A 3SFVA 1RWBA 4MV5A 3U19A 1TK2A 3R0JA 4R7GA 2DCMA 1GGVA 3SE0A 2BM8A 4YGXB 1YU6A 2BMDA 1EFCA 2YZ2A 3UHOA 2O54A 1GA6A 2R1VB 5CMLA 4FIDA 2ZTSA 5GOZA 4ES6A 3SJAA 5F77A 5F51A 2OP0A 4FNGA 3ZCTA 2WWRA 4D1YA 3HKBB 3CLTC 4WI1A 4PO1A 2P68A 4ARIA 4EO7A 4RORA 1AKYA 2QVBA 1UK9A 4E70A 5AFSA 1LTHR 2QR5A 5MHTA 1SKBA 3UAVA 1Z6GA 4P3YA 1PEAA 2H8KA 3K15A 2Y67A 3QHQA 3OZCA 4CEIA 2JGLA 1PGJA 2XNDA 2IGTA 2FLWA 3OOEA 1W19A 2ZCVA 4FZVA 3RS7A 3R6TA 3OZEA 4D80A 3IAUA 5FTLA 3N0VA 2N75A 4OU5A 5GM1A 3ZJYA 3WKBA 5TX7A 3CG0A 2E4WA 4MUFA 3TM4A 4F1KA 1M74A 4RPIA 4CUJA 5J2TB 3GLGA 2ZYDA 3PE3A 4Y2HA 1EVKA 4PYKA 5DGHA 4LXUA 2AI1A 3SM3A 3ADDA 4FYPA 4WV3A 1Q95A 3WK8A 2I1VB 4DJTA 1JH8A 3IOYA 1NQUA 2B0CA 2R8OA 1XZPA 3FNBA 2BM9A 3LT2A 3OLXA 5IULC 5KNBH 1EGQA 5HNKA 2QN9A 4ZVTA 2IW1A 3JSXA 3S1AB 4PGAA 4LZAA 3WY9A 4IIJB 1QP0A 4OPMA 4YQZA 3TINA 3QENA 3UMFA 1R4MA 1TNDA 5HOEA 4Z86A 5IKEA 3G85A 2QXTA 4JUIA 1TKRA 1JJAA 1DOAA 2PZMA 4FYHA 1NZJA 2XKBA 2G9VA 4UUQA 2X8JA 5HK8A 3UYKA 5ABPA 1O97D 2QY9A 2EW2A 3PC7A 1U7HA 1XVVA 4JODA 5KNDD 4RTMA 4DMUB 3BUSA 4N8DA 5K8JB 5HJ2A 2BFMA 4OSOA 3X44A 1K3FA 2CVPA 3ESXA 3V2GA 1CQJA 3ZDRA 2DLDA 3UMGA 4R1OA 3L1VA 3L6CA 2HNKA 1YS6A 3BZUA 1KVRA 1WF6A 4FYJA 1CPYA 3V7FA 2VJAA 3K4PA 1YHYA 2FUCA 2C8KA 5ENDA 3VHRA 5EP3A 1M66A 2XGMA 2Z8YM 4DF3A 3QLJA 4NCAA 4TTQA 4TQ9A 3OAAD 2VJOA 4B3GA 1ZA1A 3P26A 3IJ5A 2LWIA 1HLDA 3GGGA 5TNXA 4AN4A 4DM3A 3H97A 4IQ8A 2WJZB 2HDHA 1M9NA 3DCNA 4JDUA 4RQAA 5EIAA 3FJOA 2I55A 1C3OB 1DAOA 1N2CE 1LBIA 2H2WA 4CM9D 2NVOA 2I2WA 2BR5A 2VZ8A 3LXUX 4QQNA 2GK7A 3CEMA 2OLEA 3KR9A 4AG5A 4D97A 4I4TB 1YFJA 2ST1A 2JGEA 2WKSA 4JITA 2I6SA 1IPHA 1PQPA 1L4HA 1S3FA 1WY7A 1X7WB 4G41A 1U9JA 5CW2A 3WWCA 4E5KA 4LZZA 2YJ5A 2DY1A 4UREA 1I1NA 3LLCA 4XWGA 4MIOA 4Q9NA 4AJJA 4V0LA 4C7BA 2VLIA 4N49A 4EVQA 1OIVA 1EFRA 1UZLA 1P1JA 3AF4A 3AEUA 3C39A 4QVGA 1LS1A 2YFYA 4GP9A 4KQCA 1B43A 5LA6F 1NDQA 3VUEA 4PCAA 2JW5A 2QXYA 1O95C 2TMDA 1B6SA 2OQRA 5ERXA 1RP1A 3NUZA 4CM6A 3OEHA 1DAHA 1KMNA 1SC9A 2I4RA 4YRMA 2ZJ4A 3IRUA 5LU9A 3ILXA 2QX6A 1KIFA 1TU3A 1DAIA 4PYRA 3S29A 1NURA 4CMIA 1QFSA 2G1PA 1NPDA 2Q0SA 4E7PA 4D25A 3QW4B 2C7VA 1EX7A 1Z7YA 4RK1A 3QKIA 4B35A 4F6RB 3WQSB 2AHOA 2A9RA 4XASA 3W8FA 3S1SA 5AVOA 1COZA 2FLKA 3B1WA 3LL4A 2VK2A 5DXFA 3FVQA 1Q0TA 1W0JA 4Q3EA 3IAM1 1R5BA 3ABIA 4ETIA 4CDNA 4TWZA 3I1FA 2WUVA 2LCQA 2WYWA 3BQMB 1GY8A 2JK1A 5LMUB 2JVIA 5DXJA 1BXKA 1ZIDA 1ZM3A 4FFBB 2LDBA 4HZUA 5EZ6B 5G4LA 3TQOA 5I01A 1KH2A 4B1FA 1JG6A 2GA8A 4RETA 1LJUA 1SU7A 3FI0A 4UE6A 3OICA 1NJ5A 3L0ZA 3UBMA 4NBNA 1RLTA 1YL7A 4AZ3B 1M1YE 1YFZA 1U7UA 1E5DA 1Z25A 1L7AA 2G7ZA 3FIJA 4UEJA 2IIBA 4G2TA 4ZJZA 2ECPA 3M1YA 2IEYA 2WU3A 5E7JA 3HKEA 3KVRA 5H82A 3SK0A 4URXR 5IANA 1QSGA 4WDRA 1TFRA 1SCBA 3G8DA 1HTWA 1DRWA 3RUDA 4IF6A 4F46A 3EFOB 4R2IA 4U6SA 4LJSA 1C0LA 4QTUB 5JSZB 3LUGA 4C7OA 5HIMA 4IOMA 4NYMQ 5ES4B 2PKQO 1TZBA 1V5FA 3JYPA 4DBLE 3HJTA 3WTCA 2ID4A 1YQ9A 5IZCA 4J1SA 4HB0A 2Z6QA 1T9AA 4EF6A 2Z09A 9MHTA 4K9RA 2GJ9A 4MV6A 2HSWA 5B6IA 1T0PA 4IIYA 1KRHA 2J45A 2V6JA 1TRHA 3F4KA 1JEYB 1SXJE 3QWIA 1KYQA 4K6OA 4YRQA 2Z57A 2L18A 2QUAA 2MSKA 3ICQB 1HMPA 3GEBA 2HXYA 1DCMA 1GUZA 2A30A 4OLJA 3IQWA 4ADSG 3DHVA 2CXHA 5KWEA 4V3CA 4IFTA 1LPAB 5DFAA 1RI1A 3VPBA 2AW3A 4H6XA 3WICA 2PFKA 1BJKA 1OFIA 3AJ8A 5SZHB 4C14A 2NUTB 4IEFB 1V7CA 2A9PA 3SJBA 1ULUA 2RHMA 1ISGA 1X80B 2GN0A 2BMFA 3OKFA 3H1EA 1L4EA 1Y8QB 1FFHA 4RFSA 4ZOCA 4S1TA 2QB5A 3ZD6A 1U65A 2GCEA 3DQZA 1F0YA 3RSZA 3PDHA 4S0ZA 3SF8B 5CXUA 2UDPA 1RRCA 1KY5A 4F5EA 3KOXA 3SQWA 4DOMA 2BP7B 1CFZA 1DAGA 1PZMA 1QO0D 5G1NA 4EZIA 3UXYA 1E6UA 3AESA 4DQLA 4OUKX 4KBGA 2X0FA 2XQGA 3C74A 4LQ4A 2ZRGA 1P2GA 4K6GA 3PJEA 2OHHA 1AQIA 3F3SA 5A4AA 2A9FA 4ZCQA 2Q99A 3PUHA 4GGOA 3OZBA 3STTA 1FNMA 4B3BA 4P82A 2SCUA 2HCJB 5B1HA 3R44A 3PPIA 1QOZA 4GUAA 1IQPA 3DNFA 4OFZA 1O94C 1RBZA 3AUYA 4QECA 1H5QA 1UQRA 1PVOA 2FQ1A 2Y0PA 3AF1A 1K5DA 5L3RA 4D9GA 4HGNA 2FW6A 4CEIB 2ZI7A 2CKMA 3B6JA 5J40A 3LF1A 1H9BA 2J9FA 2PZAA 4ER0A 5C7IO 2OP1A 3H75A 4QRDA 4RSMA 3GZNA 1CUEA 1BKSB 4BQIA 1Q16A 2OCGA 3MLEA 1I1QB 1RHQA 3NVMB 3MPUA 4J29A 1OBCA 3U7EB 5HKBA 3GLGB 2LR0A 1XWWA 3VUFA 3B20A 3FWZA 3WLTA 5CR9A 4TTIA 1A5TA 1NR1A 3NM5A 4ZQBA 2I4TA 2HJ9A 3COSA 4UMFA 4MVJM 1MO4A 3Q15C 1TLFA 5GAJA 3PX3A 4MV0A 4NZOA 2PKXA 1DFIA 1GAWA 2Q1YA 3EVGA 3LW8A 1YQGA 1Z6QA 4RAOA 3ZQKA 3I4CA 4OK3A 1NBMD 8GPBA 5T57A 4Z1MD 4IFEA 1CBUA 1XAIA 1B74A 1MB0A 2Z5FA 4JFRA 2OM6A 5DM0A 1R4MB 1XAJA 3PD1A 1N0UA 4FZ3A 4RZ2A 1P18A 3B9QA 2EV9A 3FA2A 3TF5A 2X8JB 4INJA 2R7AA 5K0EA 2O3TA 3OWOA 3L0OA 4G5SA 3H4MA 2LNDA 3QXJA 5DBGA 4CG0A 3MJHA 4M6WB 4DSNA 3C8ZA 1IXYA 3U3XA 4JV5B 3GN2A 3JSAA 4EY3A 4LRQA 1CQJB 3HQ4O 3LHIA 4O2AB 4QDJA 2WDPA 3OCCA 5DNWA 3MC1A 3VC2A 3W8RA 2IQIA 2VQ6A 1I0LA 2YNMC 2IYQA 3OH8A 4YRNA 1G5TA 2GZHA 3COVA 5IBRA 1L7BA 4LHWA 3NIGB 4JYZA 3QX8A 5A5VA 3H2IA 1NP7A 4BUJA 2ZPTX 3AVOA 2BMVA 3G0CA 2QK4A 3VC3A 5KDOA 3U5TA 3E0QA 1NW4A 2QI9C 1KDVA 4BNDA 4UFPA 3RC9A 1NNI1 5IC5A 2ECKA 4JI8B 3IUEA 5BSMA 1VG0B 2H85A 2Q3DA 1NUTA 3WMRA 2R5FA 2ZAOA 1UBRS 4JL5A 3G9XA 1F51E 3I1YA 3DWGA 3HS3A 3ZE6A 4NBTA 1FDSA 4OYLA 3H7AA 1W5BA 4LOLA 2HOQA 4RA6A 4KIJA 2FKNA 3QGMA 3N8IA 3I9V1 4K0RA 5EPOA 3ZXUB 4ESVA 2B4RO 3NHWA 3VYUB 3AHEA 5AVKA 4IIFA 2IYUA 2BTQB 2C83A 2ZETA 4RNDB 4S0XA 1EPUA 1SB8A 3AEUB 4RVOA 3WYNA 2BRUA 3F7NA 1QP7A 5A62A 1IN6A 1T2CA 2F1OA 2YV4A 2ZRNA 2NU7A 4JP2A 1I33A 2ZSIA 4ZVUA 4CKEB 1YQUA 2J9RA 1SXHA 2H3EA 3HXOA 3NYRA 1DQRA 2IUYA 4Q3BA 2CNKA 2J9YB 3FW1A 3RUCA 5IXSA 1YUNA 2W83A 3V9AA 4O2BF 1YC5A 1ISFA 1BHO1 4BLTA 4EB3A 1DADA 4TLAA 3HXLA 2XNKA 4J1NA 1IXRC 3O93A 1QIGA 4U7FA 3T61A 2FG6C 2R44A 4LVUA 3ZY3A 4BMYA 2WHPB 2ZAYA 1UDWA 3G0IA 1JG1A 4NBSA 2HA7A 3I5XA 1Z4MA 1OZGA 5AKHA 1QRSA 1M0WA 3KKOA 3C7TA 3ASVA 2DR2A 3KZMA 3QJYA 4BCCA 2BMEA 4FR0A 5CD9A 5FOTA 2GMWA 4QPPA 5KBYA 1CUUA 3NAMA 1K7SN 3UMRA 1LRLA 3SBOA 2OHIA 4HQLA 3OIWA 1GU0A 2B6NA 4YCDA 3ASZA 5B37A 2UYCA 4W99A 3RUFA 3VKFA 2ZYVX 3SHWA 2J7KA 5B57C 5G2OA 3MMPA 1G8GA 3W8NA 2ZUVA 3HKEB 4LA4A 2PX3A 1CU1A 2XB6A 4BTLA 3SP1A 1VYTA 2FUKA 3OSUA 3W3AA 4AP6A 5IAAA 2ZM6B 1T9ZA 2QLLA 4XIGS 4BVJA 2BIFA 3K16A 3NV7A 2MSCB 5EE1A 8ATCA 2Z30A 1CNEA 4UBJA 5SICE 1L3BA 3F71A 2P9QA 3IJRA 4OGWA 1H0SA 1XVUA 4P86A 3UW1A 2V3CC 1EK6A 1J0XO 2W2TA 2WF9A 2VH2A 3DAHA 2OORC 3HV2A 4IX1A 3WLHA 4MB6A 4RM3A 1ZNXA 2V8BA 4IGKA 3HYTA 4CMCA 1XNQB 3I5MA 3AJDA 4MIKA 1RXEA 1YKFA 2PSFA 5JJCA 5AJVB 1MUUA 1P4AA 1VPTA 2D06A 3PS9A 4BKMA 4F8JA 1LV8A 2A8YA 4OJYA 5HBGA 1DFHA 3I6YA 3CGWA 5J2UB 1SG0A 2ORVA 2O2HA 5TR9A 5KTTA 4MK4A 3QX7A 3TPZA 3DVRX 3V8QA 2O2GA 4BEVA 2AJTA 1ZJ6A 5T7BA 4UBMA 1AV7A 1TJ5A 3VPDA 4WGFA 4QXQA 5DX1A 1Z4OA 1T8WA 3NYIA 3CY6A 4EHDA 3U17A 4RFSB 2G63A 3VMMA 1JEOA 4F93B 1JSXA 5AUQA 1YKSA 1P4JA 3J7AC 3NB0A 3P4UA 1ESEA 4MW5A 3V42A 3FTFA 4KPUA 2XUQA 4C2BA 2QN6A 3NOVA 1FNBA 2BGKA 1RRFA 2G4LA 3E8MA 4U9UA 4M0DA 5CFPA 2W42A 1OXBB 2Y99A 3DS8A 4JVNA 4BP9A 1AN9A 1NZDA 1Z22A 3D6NB 5BXQC 5JRDS 1FSGA 2I7XA 3QFHA 4HRXA 1YVUA 1T1RA 1YBAA 3PUKA 1KFJB 1SN7A 3U60B 3O8NA 2QMYA 3AJRA 5M2QA 4K2HA 2X8LA 2GAOA 3B6EA 4FCCA 2VDKB 5HF9A 1J2RA 4AVYA 4ARSA 4X95A 3F5MA 2AI3A 2AOUA 2VP6A 2Q0HA 5JV5A 2J9FB 1FX0A 1JS1X 2EU8A 1KJIA 1OXKB 4D44A 2C78A 4CTMA 3DDOA 4RJ2A 3GZNB 1NT2A 4GPAA 1KKMA 1JSCA 1COWA 3AV0B 3NCTA 4FFWA 5KQPA 2E0IA 5A0FA 3NEPX 5CLJA 2QENA 2XOEA 3O47A 3I1IA 3SC4A 3BQ9A 3LWDA 1CXZA 1B14A 5JXJA 4OFXA 1F48A 6LDHA 4NMXB 3Q9SA 4ZC1A 3ZTWA 5KVVA 3GT0A 4DILA 4DPKA 4P98A 5AXAA 3WHPA 2WT8A 2JD0A 3TYXA 4TL9A 5HBRA 2IXBA 1QCCA 5EJEA 2VFAA 3RABA 1UMCA 1JQAA 2GCGA 4Z8YA 2BVNA 4P93A 2C00A 4TL6A 3RK4A 3VJLA 3ZZNA 1TUIA 5IABA 3H2ZA 3FDIA 3PNOA 2GD1O 1K6MA 2I4IA 2K2QB 2RGCA 4MLDA 4UARA 3ZBUA 4YV2A 3S8YA 2C8JA 2J9ZB 3QX3A 3SVZA 4AJKA 4QO7A 1I3KA 2FU5C 2NYAA 2V5AA 3KE8A 1FSSA 2X19A 3L06A 3NO4A 4KYVA 4YDQA 2JJ2D 1YI0A 4OK5A 3MS4A 4RKYA 2YMQA 3BXEA 4H7HA 4TL7A 2M98A 5FOUA 2MYPA 1TVMA 1GGMA 1U5BB 2MDTA 3BOSA 1QFXA 4HUQA 3ELWA 3OJXA 2HF2A 1DCTA 3DTVB 4YCBA 1VA4A 4LTDA 4ESHA 1KARA 5HMMA 1L1EA 4BWYA 5KREA 1GZDA 1A9RA 1U11A 2RGYA 2YV5A 3A1SA 3II6X 4HX5A 3ECAA 4YAOA 3RKSA 4B6QA 1CUYA 3BGWA 4CV0A 1MC5A 4MI6A 4RD1A 3V2IA 3M4JA 4P3PA 1E8NA 3IUPA 4O5AA 2ECOA 5FPQA 1CFJA 2NU8A 3TAHA 1G16A 3LBIA 4MB2A 4RY0A 1DQSA 1QK4A 3LDFA 2HRRA 4KAXA 4M9QA 2AX4A 3GJYA 2DFKB 1SCIA 3JYHA 1WV1A 5F4BA 2FPWA 4N4AA 4F85A 1L5SA 1QFYA 1J1IA 4IHJF 4M3NA 4Z5XA 3NAZA 4RLFA 4RDHA 3ROKA 3ES9A 1PFUA 1CQZA 1GGFA 2GEJA 4LXGA 1IZ0A 3LDAA 4HAUA 3VKUA 4NCBA 2J3LA 2IE8A 4BO2A 2IZ7A 2NYUA 1Y3AA 1P5RA 1VCNA 3EXIB 3MA0A 4DR1B 4DRXA 3LQKA 5B3KA 1NJ6A 2BHNA 5I7SA 3WBKA 4EFDA 4JHXA 5LD2C 2VJPA 1UWVA 3COZA 3BJRA 2A5JA 3G5LA 1K6JA 2GNOA 3N6VA 4TN5A 4P34A 2NZWA 3EW7A 3FHLA 3UJBA 4BVHA 3LFTA 4R7ZA 2D2XA 1B1CA 4RS4A 1XE3A 4TMTA 2HREA 5DYTA 1TCBA 5FBKA 1DU4A 3GUCA 3W6UA 2VDPB 4GRAA 4UU0A 3IEIA 3A8TA 4NCIA 4WKNA 4G3XA 5HUQA 1QC5B 2PMFA 2QRMA 1ZW6A 5JZSA 2FETA 3ZDDA 1G3QA 3C6BA 4FEEA 4UM9D 3LQQA 3DHNA 3FYUC 2CXXA 1NNLA 1EZZA 2PIAA 3MWDB 4JBHA 1SUCA 4QGGA 3W90A 4YCMA 2A5GA 4RK0A 2PUWA 3UXEA 5D3QA 4CTOA 4L08A 2SKDA 5EUCA 4AZ0B 1PWHA 3HI4A 4P9NA 1KSFX 3RADC 4QX6A 3HEAA 4UTOA 2ATVA 5GJCA 5CT5A 2J4DA 2UZ3A 4FS3A 4AS3A 5K8CA 3PJRA 1Z29A 2DBVO 4RKFA 4ZQGA 1GNTA 4K1LA 3V48A 3WGNA 3WLLA 1PE0A 5TF0A 2IXFA 1ZK4A 1MB4A 1B8UA 1JI3A 1Z2CA 3FUTA 4BV8A 2BM0A 2QN2A 4CIYA 1GRRA 3RT1A 1XHFA 1XZGA 2XCIA 1S2OA 5LC1A 4B9EA 2BONA 2OXCA 4QUAA 3MIZA 1EKXA 1BN7A 1IB6A 2XYGA 3GEEA 4TXLA 5J63A 2VHQA 2WPDA 1NVFA 3IOMA 2RGGA 2ZB2A 3VR4A 3ZKAA 4B31A 2FRXA 3C45A 4KMOA 4KIGA 1V6AA 1JHDA 5IT5A 4QUIA 4CNBA 1EDZA 3G2IA 2P40A 1UDRA 4NCKA 3I23A 3I0NA 3M2TA 2ZP1A 4MV7A 5K8TA 3D8TA 2Y66A 1AV6A 2QM0A 3HU1A 1M7GA 3DXYA 3AUSA 5K09A 1NVMB 4RM2A 3PKZA 1U99A 2O5RA 4HTFA 4ZU1X 4HRVA 4L51A 1JHQA 4U8GA 5J4KA 3ETLA 2H4HA 2HJWA 4QSMA 3RU9A 1G0OA 1WUTA 2AYYA 5TY0A 5DTEA 3EIUA 3D4BA 1Z2AA 3OZRA 4C0BA 3O3OB 3GJZA 2HYDA 4BCDA 1PFWA 3H4IA 5JQGA 4I1PA 1YO6A 1E2MA 4N48A 4RGQA 4IXTA 2ODTX 4D9BA 1FLNA 5CVUA 4BATA 1RYNA 3U9LA 1D7AA 1Q7RA 2V5UA 1K0FA 3HNOA 3QRWA 4X8OA 3ML1A 4QOIA 5A6SA 4WDQA 1JSLA 2IY9A 3R5SA 3T1TA 4RJJA 2Y68A 1CHNA 4AKHA 2H1IA 4Q03A 1Y1SA 2MIIA 4CRWB 5IS2A 3VSDA 5A7GA 1M2NA 5CP8A 1TW2A 2F00A 2HFJA 1YACA 4KPUB 1AQNA 4ZP1A 1R0ZA 2HO5A 5E8RA 1NSFA 1KBQA 5F5XA 5FV4A 5KVAA 2JFYA 3EBPA 4RVNA 4L75A 4PFQA 1NONA 1PYGA 2V9ZA 3PNBA 3MT0A 4WACA 4DZZA 2CT8A 3D2CA 4FJ1A 4ZOAA 5BWNA 1XWFA 3R8FA 2QW8A 3KSUA 4B5KA 4KLAA 1Z45A 2OUKA 4FMPA 1XZDA 2QAGA 3KCNA 3MMZA 4TS3A 5E9QA 5C1IA 3U4CA 1AQ6A 1DXYA 2PLWA 3EZ2A 4CN8A 4E2ZA 2HDNB 3CTPA 4S2UA 4EMUA 1E5LA 3E7FA 1Y8CA 4YUAA 1VMIA 4JHLA 1H23A 3FPHA 4FBGA 2RK4A 3SR3A 1FX0B 1VHTA 1VI6A 3TLBA 2J1LA 3T06B 1HMYA 2GK6A 2C9YA 1FQWA 1R6XA 3NXKA 4LBYA 4YLEA 3P9QA 4GOKA 1OKKA 1QH1A 4GSKA 4BYGA 3K6SB 4WXHA 4GEKA 2E5FA 3H9EO 1FDRA 2DPXA 3UNXA 1D2MA 3WIUA 1GL7A 5FA8A 3OMWA 3IO3A 2V7TA 4DGSA 5LU8A 2QD2A 3LRXA 4YECA 5MFZA 4WK6A 5AKKA 4IMJB 2FV8A 2Q6KA 1M5TA 1UJCA 4QQFA 2IU0A 5HIAA 3KYBA 1MRNA 2HU2A 2YWRA 2SICE 4MRSA 4E33A 3DPIA 4QATA 3A9VA 3UXMA 3WWZA 4JJZA 1GSIA 3O8LA 4L3VA 4A2QA 1UMCB 2OBFA 3LHFA 5TB5A 5JASA 2ZQZA 2O7RA 1FDIA 2ERXA 3KXDA 1VBFA 3IP5A 1Q0QA 3PPYA 4MAMA 4U9HS 3LGAA 3OX2A 1OWOA 3O9ZA 4UULA 1XQXA 1ZNWA 3LY7A 4MW4A 2HYIC 1EH5A 3DM9B 3C5CA 1REQB 4IZOA 4K6KA 4DVJA 4ZGBA 4RTOA 1FIUA 3TLJA 1Z4KA 2GF0A 2LZ0A 3AV3A 3A6FA 5EMJA 1W8DA 2DR3A 2ILVA 3L4BC 3PSAA 2WE8A 3NC4A 4FOOA 3B53X 3QPUA 4N5DA 1TQ4A 1W4RA 3SKVA 1SCKA 1P2DA 2D2VA 2GS9A 3EXHC 4TMYA 5IDVA 1ICIA 3TTUA 1VECA 2QLNA 3G8BA 3GBPA 2NU6A 3TNLA 2IZ5A 4C9BA 4ZZIA 3T34A 2PYDA 2ZVPX 2PX6A 1GR0A 2GZDA 3KQPA 1OZ0A 4MRPA 3O38A 3QMWA 3BGDA 4OF4A 4N0QA 4B3DA 1XZAA 1U6IA 1SXGA 2X77A 3EXEB 3GDGA 1T2EA 1QZ3A 5EQJB 2PUCA 5KSPA 3VPSA 4MINA 3GLIB 1U28C 1BX1A 2BH2A 5A5DA 1JE0A 3DMPA 2NU8B 3ELDA 1UT5A 1YTUA 2CHQA 2CDRA 3FSGA 3EHEA 3EF1A 4BN4A 3LLSA 8AT1A 4BZPA 3GJ4A 1QBGA 4UC0A 2AFVA 4G85A 5FF9A 1E1QD 1KYVA 2OAP1 4I81A 4BGVA 3U09A 3OLYA 2EZTA 4DUYB 1GL3A 1KGSA 2RGWA 1VPEA 4QELA 4S1PA 5KOYA 3F6CA 5BNWA 2EEZA 4KYUA 3UJNA 4JK3A 4URFA 3PR2B 2XV1A 3OHPA 3QU9A 3AIOA 5EJAA 4EGSA 2CV2A 5TT0A 1WD5A 2DUNA 1ND6A 1I6MA 2GSWA 3LYHA 6PFKA 5CB8A 5C52B 3FN4A 1JR2A 2I22A 1E1CA 3OOYA 3VNUA 4OJQA 3ROGA 3VR1A 2Q5FA 2O2YA 2XAUA 4EUFA 1AK1A 3PFGA 1WDWB 1P1RA 3C3EA 3HJGA 1KXJA 4EBBA 2ZITA 1WQ1R 4K9SA 2XXAA 4K0KB 5HJ7A 3RYTC 5CK4A 4QYSA 3N8NA 1GZ3A 5BW8A 3HXQA 2AEMA 2HJSA 3RVKA 3GXOA 3RV3A 5TMEA 1OILA 4G24A 4LV6A 4QWWA 5JNTA 5FOXA 4D4MA 1CJUC 4AICA 4EK9A 5BOVA 2F9LA 4DNPA 3G0DA 3HCPA 4DIEA 5LP6A 1A2BA 5HCUA 4KWCA 1WVGA 1E0JA 2XWPA 1IXKA 3D4NA 4KFSA 5B3JA 2V55B 2DJ5A 4U6QA 2PYIA 2X7JA 2I29A 5LOVF 4GUDA 4KHZA 3A1UA 3K2BA 3TB4A 1E20A 1ODLA 3PFNA 4AUEA 4MVJI 3AL3A 1XZCA 5HTOA 1CHDA 4UNPA 4TXNA 1BMDA 2D1QA 2ZI9A 3WSWA 1B42A 2Z04A 3IILA 3L41A 1H4TA 3EH2A 2VC2B 3HV0A 4BLQA 2QWXA 3U4AA 5TGTA 1AUXA 2P30A 1YHNA 2CWDA 4UJ3A 1WQ4A 3O2NA 4B4UA 5AOCA 1U0EA 4GR4A 5IN5A 2YJNA 3BTUA 3I8XA 3N3AC 4LQDA 5D3KA 4LOHA 1BTOA 2OHGA 1PT9A 3ILYA 4NABA 2YBEA 3DZBA 5CM2Z 1QGDA 2WR8A 1X2EA 5AK5A 3W2FA 3RUPA 4H0CA 1B2LA 1FMFA 3AM1A 3E27A 1J6UA 4DMFA 1Z07A 1K8ZB 2NPIA 4B9AA 5IM4A 4EPRA 2J6CA 1W96A 1KQNA 2LKDA 3BSSA 4O8ZA 5EJMA 2QTCA 4GKAA 2ZUUA 4HTFB 4IJQA 4CIBA 5FO1A 1AO3A 3RAJA 3L8DA 1TL7C 3MJ4A 4WFKA 4HBGA 5AKJA 4BFLA 3VGJA 1ECBA 2A78A 1O6BA 4Z0NA 2PBFA 4WBSA 4BY9E 3U4IA 1RYZA 4DAEA 2I62A 1TVCA 1ZOPA 1ES9A 1OFUA 2PXCA 4UQPA 4ZCRA 3ITDA 3STVA 4X7RA 5HS4A 1HKHA 5HZHA 1NY5A 4OA5A 5K3BA 4BNIA 4ZRNA 4UUBA 2B1IA 3PR1A 2J67A 3QVMA 3KJXA 4GEGA 4MGZR 2FSHA 3EGVA 4HT3B 2W2OA 3K9QO 4ENVA 5JJBA 2VUSA 3R40A 3LSYA 4Y2RA 4P0QB 1QOQB 4DCSA 4I08A 4EJ0A 3KQOA 4JU8A 3BRQA 1TVEA 4E13A 2AH5A 3VJKA 4R83A 4ZXPA 1YMUA 3IAS1 3QNUA 1CRQA 3QU5A 1XXHA 4TKMA 4WUVA 1E3EA 1G98A 2C98A 3M83A 4XW2A 5BSTA 3SHVA 1XFDA 1CZKA 1JR4A 1TK3A 2V7UA 3OQ1A 3CC8A 4HWPA 2V6GA 3IDSA 3MFQA 3MT8A 1KI1A 2XWSA 3GOHA 3IP7A 4FHEA 2UUBB 2GLUA 1W4ZA 2V98A 4NZMA 4EY5A 4CETA 3BTVA 4KITB 3GH3A 3NQ41 3L82B 3D7SA 3NV9A 1LNQA 2QS9A 3UUEA 1L7MA 4BVFA 1SIUA 2W6CX 3G7NA 3OT1A 2QAGB 2QVYX 2FWIA 4H6WA 5ICFA 2R7LA 3RVMA 4DZRA 5JUWA 1HY3A 4KXFB 1XRSB 4OJNA 5CM9C 4J43A 5JJLA 1MRZA 1B8PA 4G4SO 1QIIA 4QWMA 1F12A 1CB0A 2WWHA 4BAUA 2EJWA 2FPGA 5CVEA 3FMVA 2BGRA 4GBJA 5HRAA 5AI5A 3ADOA 4QAJA 1E4EA 1JLSA 3UOWA 3CINA 1EFAA 4TZ6A 1EDOA 4TUYF 1L5LA 1CD5A 3AEKA 4Q82A 3RAGA 4X9XA 421PA 2WMYA 2XWJI 3WX0A 2XQJA 5EIOA 2BF4A 2FN7A 3B3QA 2JAOA 3ZV3A 3WGIA 1HE8B 2V96A 2WIJA 3WGYA 4CF6A 1FW6A 1ZOSA 1BH6A 1Y1QA 4FFVA 4BFZA 3PU6A 4LMRA 5ADHA 3EDQA 4BEJA 1RAAA 2LIVA 4A5SA 4QXOA 3FTEA 1ONNA 4WOKA 5FPHA 4ZI3A 4MKZA 3K0KA 3OJFA 3EDRA 1KK0A 3PG5A 3X1KA 2A67A 2I1QA 1RJGA 2P5TB 4BJ5A 2ZJOA 4QG7A 5ES3A 2P3OA 1IE3A 4EPYA 2PZGA 3R76A 3S2YA 1RAIA 4FCTA 4E4YA 4PYQA 1CULC 3CPJB 2ZYGA 3MB5A 2WAAA 3V34A 2I7CA 1T6XA 3FVVA 2H59A 4GQBA 4M86A 4BMPB 4OHXA 1KVSA 3GG9A 2PWZA 3K9CA 4TVBA 1MC4A 1PG2A 1XBTA 2NU6B 1GR1A 3ZGNA 3AVWA 2WY2D 2XB9A 3PQCA 3UGJA 3RBXA 4RE5A 4G8CA 3ZY6A 3ZY5A 1Y6GA 3H17A 3RUAA 2LUOA 3QOFA 4ILKA 4IICA 4MS1A 5DK6A 3CWQA 1E64A 2BFPA 3EMBA 3PC2A 4E09A 5HGXA 2P4UA 4KGZA 3G2LA 5JAIA 3BL6A 4F6LA 8ADHA 3NBAA 2Y8EA 3H1AA 4YFYA 3WFJA 4R2LA 5A4IS 5KTRA 3EVNA 5KHOC 1SM4A 4BLSA 4E5SA 1U4OA 2POCA 1OYWA 1SKUA 1V41E 2FFJA 1DIBA 2HM7A 3JQ7B 1UFVA 3NNSA 4OHUA 5I7AA 3V8NA 3AVUA 4AQDA 3AGQA 4JJAA 4BO6A 4JBIA 1U9IC 1SQ0A 2YMLA 1PFVA 1W34A 4HG2A 1V43A 1NBWB 2CLLB 1GKLA 2GWHA 3PT9A 4P0PB 1FPMA 5LZ7A 2YWEA 3DM5A 2YN2A 1QHYA 1VJDA 3L8FA 1GPDG 4Q15A 5B6PA 4K6HA 1SZJG 5FRDA 5FV7A 5CB4F 3EEYA 4XKJA 4YTEA 3MGAA 4IIEA 5C31A 1DQPA 2JATA 4U02A 1RXCA 1YCHA 3DFMA 1NWHA 2HA4A 5K0CA 4HAIA 4QICA 3IKVA 1U2DA 2WHEA 5JCOA 4R1UA 1LSSA 3VXKA 2XXAB 4C43A 1B3RA 3P9SA 3DCIA 4FMCF 5EL0A 3T1HB 4ZJYA 1UT6A 2PDAA 1FE8A 2CLSA 1GSOA 4KRYA 5A4FS 5F73A 1WB5A 1UFQA 1FP6A 1P60A 1DMSA 2BSXA 2Z95A 3D43A 3KM0A 4XUDA 1OLSA 2H11A 4JCOA 5LP6B 1N75A 2H5EA 3AW9A 4QUKA 4BRZA 1XN1A 4NU5A 3RWBA 3PXGA 1RI2A 2FZEA 2RH8A 3ENKA 4OGGA 3THYA 1Z4JA 1B8VA 4FR5A 1RPZA 4KQ6A 1AN0A 1O96B 3WGHA 3KQUA 1PWZA 3ASUA 4KO1S 1L7DA 1J0AA 3IVGA 4HPXB 1OH7A 4Y2VA 1GQFA 1N2ZA 1VL1A 4NOLA 3TZKA 3WP1B 2R96A 3FIUA 1Y4DE 2CVZA 1E1RA 5ERYA 2X8AA 1P33A 3UJ6A 4Y67A 1W6RA 4M0PA 1G9SA 1R6UA 5JS2A 1Z15A 5E8JA 3IJEB 3ICOA 5DSTA 2XMBA 3DEFA 1A8QA 3CISA 1V48A 4YAJA 2REOA 3VR6D 1HNXB 4WNAA 4E5NA 4GBMA 4RUKA 3U16A 3QE2A 4JAVC 1CZNA 4GMFA 1K68A 2BEWB 1OTHA 4NQZA 4MB0A 5CDYA 1W88A 2R5WA 1TMOA 3JD4A 3IMKA 1NHGA 4UATA 1L5HA 3K0EA 1D09A 2PXHA 4RPKA 1S1CA 1SKYE 3ZYCA 3LPLA 1KO1A 4M1WA 8OHMA 1VSVA 1FMLA 3TFOA 3NIWA 1EVIA 3LP8A 3PWZA 1LSOA 2VPPA 3B48A 2F3PA 2VK4A 3REOA 5DMHA 1IVSA 3A2NA 2HNAA 7GPBA 2MJLA 2WTAA 3H16A 1F06A 1QCYA 1IY2A 1CVLA 5EKUA 1UKEA 2B8WA 2BYTA 2WZCA 4DWVA 1ISSA 1CDDA 3LUHA 3L01A 4W7HA 5AKIA 1E2EA 1WM1A 2GPJA 3S5JA 2DUMA 4H3HB 3N39C 4QLAA 5LNK1 1Y3BE 1DXQA 4O8CA 4JNCA 4AZWA 5LM3A 1M0EA 3AY7A 2P2DA 4TLDA 1UDXA 1CB7A 1NVUQ 1E2PA 4PS1A 1ZX1A 2CLKB 3BREA 4DXDA 4LY9A 5M7EA 4ZOLA 4CM4A 2ZSBA 3F67A 1NU6A 4ALJA 4KHPB 1MO3A 1NP3A 4LJ9A 3CO5A 5LA6A 4RMGA 5DMXA 3BCHA 3RYHB 3RVSA 3K1AB 5HJEA 1QTQA 1G21A 2GN4A 1P0CA 3D3WB 2VPZA 4MITA 1WCV1 2I2XB 4HXFB 1EDDA 1N2IA 1JEQA 3TAUA 4CG1A 2XB4A 3LLUA 1VXOA 4R81A 2ZJ2A 3IT2A 4W1QA 5FIUA 1GD1O 2G1JA 3GJ3A 3MCAA 3ONEA 5H0IA 4J0HA 1US8A 2IELA 2WA1A 2YFKA 1QE5A 3OT1B 3EZGA 1XJWA 2G36A 2ZR7A 1M0SA 2J87A 4XRGA 4B3RB 2PM8A 1NW7A 3RFXA 2NADA 4H7FA 5KYGA 1G8AA 1YR2A 5CXQA 1A5BB 3FF4A 1UKBA 3NASA 4TMKA 2FPOA 3NGXA 3TZQA 3TM5A 3CLSD 4LJYA 2LKCA 1TQHA 3KEOA 1XRRA 4J91A 4L76A 4LHYA 4TWRA 1JG2A 4DM7A 9LDTA 4P2BA 3AEKB 2XYQA 2CHFA 3JU3A 1YT5A 1V1MB 3VO9A 3PITA 3ZDYB 3UJCA 2BFAA 3L7YA 5TQ2B 3U61B 2ARKA 2WINI 3G6WA 4LXYA 3F3MA 4N3AA 3DOUA 2QD5A 3AR4A 2R8XA 4TQGA 1DJOA 2DLNA 5AVUA 1B15A 2OCKA 4UHBA 4ZDWA 3WMGA 5CPBA 1CUBA 4IVRA 1TAQA 4KI7A 4OVKA 1EG7A 1V3QE 4EECA 3I2KA 3RF6A 4EDFA 3ZXIA 3WAJA 3EY4A 3R5FA 3VYRB 1SCUA 1IJEA 1O9BA 1FQJA 4HLQB 1P4HA 1N2EA 4RKEA 5F5LA 1SB9A 4XGKA 2XA2A 2ZR0A 1W47A 2RK3A 3UMMA 3ZH2A 1FJHA 1NF3A 5LPNA 4TXJA 3DUWA 5K6TA 1PLLA 1TZ2A 1YU9A 1DS6A 5F76A 3F6EX 2CZCA 1XAGA 1XXLA 1XT6A 5JQWA 4JUAA 1NN1A 4TROA 3GEMA 4NARA 4PTZA 3QNWA 1RIIA 5J4YA 1ZS9A 3WLFA 4AIRA 1UC8A 3CLUD 4KG7A 4XLZA 2ZBEA 4CEHB 4G2NA 1AB6A 2CL0X 2P41A 3LHKA 4QXAA 5DTJA 2YWHA 1B6TA 2QNIA 2H7YA 5LZ2A 1NBAA 2O14A 2NTJA 4MHSA 5I9TA 5TT1A 4LHZA 3RARA 3CUTA 5JSHA 4MS1B 4RULA 5U4XA 4L9AA 4BB9A 5E3HA 4D81A 2BT4A 1EVLA 1L6RA 2QRUA 2DPGA 2WNHA 3PIRA 4Y6PA 2I4NA 3OY7A 3TQSA 1LB1B 1AXEA 1YR3A 3KB1A 4EVIA 2HPZA 5DULA 4UU7A 4EW2A 1EIWA 4WERA 5I7VA 2BFDA 3PCTA 4H2DA 4BO7A 1DLJA 1GTG1 1GUBA 2ZREA 5LB4A 3T4UA 1IBMB 4BMSA 4IIGA 3EGXA 3RS5A 3LNCA 4FIZA 5AICA 2Q8QA 2XD4A 3NKLA 1CUHA 2Z9BA 4OQXA 5CVCA 4DFDA 5A4MS 1WABA 4ROSA 1SHUX 1XQWA 1Z6AA 3PHCA 4W5JA 2AB0A 1IB0A 2WUFA 3NHMA 4G5XA 5FQNA 3BE6A 3WGLA 1VCOA 4AK9A 3H05A 4XB1A 3M70A 4AW9A 4PNPA 2ZRPA 4BGEA 3VBEA 3U1TA 2GPBA 4PWZA 4EUKA 3T5AA 2H4JA 4A26A 4QM7A 1YCGA 4L2IA 2C54A 3CR8A 5KKNB 2X5JO 4V0KA 5ED0A 1EE1A 3N3BC 3WXBA 1QDLB 5T4EA 4MARA 3X43A 1TTPB 1I3OA 2ZRFA 4H9GA 2GLTA 1JVBA 2HQ1A 3HK2A 4PC1A 3TBFA 4EGCB 5FR1A 1I0ZA 1O95A 1OLSB 4M0LA 2HQSA 3CUSA 3OFSA 4W9RA 2ET6A 3TRKA 4L3OA 4N3GA 4PPQA 1DT5A 2DQSA 3W5AA 3IR7A 4CM8A 3RAEC 4AKSA 4MWOA 3Q6MA 1AXRA 5EC8A 1OIXA 5H3HA 2B0JA 2XMDA 1MV5A 3KXKA 4C5BA 1N6IA 3B60A 3SF0A 1D4OA 3CLRC 4C06A 2VJCA 2BDTA 3C1AA 4L22A 4MQ4A 1DELA 1I3MA 1R8QA 5HQTA 2VPXA 3F2IA 4HL6A 1A2KC 1KQOA 3HYNA 2XGJA 4A0FA 3RK0A 3RRNA 3LO8A 4X6YA 2VF5X 2BGJA 2R7KA 1E2DA 2YYZA 4B0OA 4ZT2A 4EYKA 1N2HA 4YAGA 5BN4A 3DZJA 4N6GA 4WE3A 4WNAB 3WK7A 3M6FA 3WV5A 5AVWA 1G38A 4C2UA 1KAGA 1L2TA 3QVJA 2GAJA 3KFLA 4Z3OA 1RCTE 2JH8A 1CKEA 2XCOA 1AGPA 3FX2A 4QOFA 1HDYA 2PT5A 2GILA 4HRAA 1OZAA 4XXHA 1W88B 3PTZA 3M4YA 4RABA 5E4YA 3ZWMA 5CFMA 5IMSA 3OZGA 5K2OA 2I2AA 1L5HB 3WYBA 4PTYA 4DN6A 5IG2A 4MUNA 1NW8A 1TTHA 2HBYA 2HU5A 4WFQA 4NXMB 1JXQA 1GRNA 4MPDA 3BFVA 3ZOZA 1ZAYA 2IYSA 3FJYA 2A94A 3V4ZA 4JL6A 3Q7QA 3LKZA 2ZZMA 1EQ2A 2XVZA 3GEGA 3BSYA 1E7MA 4HZIA 2NZXA 5DPMA 3TTWA 4DIUA 4YYZA 2GTIA 3A27A 2J09A 4PRZA 2Z8YA 1L5OA 3KU1A 3A6HA 2FA9A 4CMHA 4EI9A 1TMKA 5FOVA 4F9EA 4BJ1A 1TJ3A 2Q1XA 3KPYA 3W6NA 4L57A 4XJVA 4JR2A 4PG8A 1R0CA 4G65A 4GQAA 3ROFA 1ULZA 4B4KA 4MZXA 4FGWA 4BFUA 4KB5A 1LLQA 3DXZA 4ZOLB 4CM4B 3QIAA 2HLPA 1D1PA 2CZGA 4C6RA 5DGIA 2OUIA 2JIOA 1SVIA 3H1TA 4LDZA 4PC7A 5LA6B 5IFLA 1DAEA 3Q9UA 4NDNE 5BMVF 1YULA 1KP9A 1G21B 1BXRB 1C2TA 3JARA 3FOEC 5JMPA 2BLLA 4NCJA 3L43A 1JEQB 4H08A 4WL0A 2G72A 4JVMA 1MJFA 1E1YA 3HR8A 1R74A 2JGRA 2PJUA 3SAJA 2FR8C 1BFUA 1BFKA 2GEDA 3Q41A 4TYQA 2JRLA 3PGA1 1EB9A 1KYYA 1U0HC 2WF6A 1GPMA 2Y9PB 3K05A 3ABRB 4OXQA 1YL5A 2QZSA 4C2TA 3SMVA 3H5AA 3Q7SA 1ZJZA 1IBCA 5D1NA 4KACA 2Z58A 4DBLC 2OCBA 2GA9A 3KYDA 1F4PA 1HT2E 1MR3F 2A9JA 2VATA 3BXOA 1CNFA 3F49S 3GRAA 1D2HA 3T7AA 3WQHA 1X42A 3RFCA 3DL0A 3L6EA 5F7JA 3I28A 4Q3NA 1HDOA 1XFAA 1DBIA 3M6VA 1IM2A 2YJ6A 3N70A 4DLYA 3MTQA 3OF3A 3KD2A 4MWBA 1P1HA 2LXNA 1GFSA 3KEMA 3U3OA 4AURA 3PXXA 1SXJC 1AK2A 1OV6A 2BFCA 2IXGA 2QTNA 3EWSA 3LC1O 3PPVA 4U7DA 4KR3A 4DIMA 1WB6A 4C6HA 1XCOA 4TKVA 4NYJR 5I4CA 4TM8A 2PRJA 4JSRA 3KXLA 2COEA 2WB2A 1OU4A 1AB5A 5KNDH 1HDXA 3OFNA 5JZVA 2J0EA 2E37A 2XMZA 1N1MA 2YXNA 3GNSA 4FEYA 3V8VA 3DTVD 1ECCA 1Z5WA 1XF1A 4XZ3A 4YR7A 3N2YA 1RAEA 4RTQA 2X6QA 1X13A 4DY6A 4WZ6A 1KYIA 1VFNA 1VLJA 2P2GA 3FRIA 3R77A 5JZOA 2QZ9A 5BNZA 4PZUA 1W36B 5LQDA 1Q1AA 2DP4E 4GKBA 2JHFA 4M83A 1SCUB 2X4GA 1NQVA 3JW8A 1I24A 5F52A 3FKJA 4YQEA 4N0MA 2H1OA 1JTEA 5JNWA 1Y7TA 4MUBA 1M7BA 2W48A 2Y1LA 4TV9A 3KTOA 3LUJA 1GQQA 1ESZA 2ZJZA 1TU4A 4MQ5A 4MULA 1XIVA 1X7DA 4FR2A 4NBRA 1ZSYA 2B4KA 1VL6A 3O83A 2QMEA 5D6NA 1Q1QA 2ZVQX 3ETGA 2EARA 1XNRB 2FP4B 1JYFA 3QWAA 1NBEA 1YC2A 5ESXA 4HFRA 4HEA1 4R0MA 5TARA 2GO7A 2OVFA 3OHSX 1CY6A 4YAWA 2RHRA 4IRMA 1R8XA 4IF4A 1H4SA 2JZCA 3CYFA 3DZGA 4C6SA 2OWEA 1RLJA 5AM2A 2C95A 3O4JA 3GMSA 2YNMA 1JQEA 1LLCA 1XKXA 2YHSA 3HA3A 3PSHA 1IUKA 1ESNA 4H15A 1XKLA 5EZYF 3D7NA 4C89A 2FGJA 5KYWB 1PGPA 4O0LA 2PL3A 3GIDA 5A02A 3HU2A 3GGOA 4IIDA 4O1IA 4V0ME 4Y3UA 2CJYA 5EXXA 5BSUA 4JEHA 1ZYUA 2O5VA 2BFDB 1NVVR 1LJ8A 1LWOA 1T6BY 1ML3A 2GPWA 3L5KA 4TX1A 4M1QA 5DTMA 1PV2A 4XGIA 3EGXB 3RCBA 4EA8A 2CEKA 2PS0A 5K8VA 5F21A 5E6UB 4RZSA 1FVFA 1K6EA 1QH9A 2DHEA 2JHAA 2VVTA 5CXXA 2ZIXB 3N2GA 5DASA 4ARUA 3I8OA 1JIXA 2PJRA 1XTRA 1J1ZA 4MJ3A 2NUAB 4XD2A 3LZDA 3PQDA 4MVJP 4AYTA 4L0QA 4IIXA 1B2RA 3F78A 3P19A 1N4AA 4BXOA 1L1FA 3TVTA 3ETHA 1GNPA 3T12A 2AJCA 1BU8A 3GJ5A 5LYJF 1ZM2A 2ATIA 2HSZA 2IPLA 1I13A 1M2EA 2R6DA 1ZCBA 1RJDA 2WYUA 3LM8A 2X5KO 1WG8A 3K32A 4RSHA 3O5AA 3ZWPA 5H8WA 2UUCB 1OQAA 3FNFA 4WEOA 3GVCA 3W3AD 1NXOA 1TYAE 1EVQA 2NZ8A 2D1YA 3F2VA 3U48A 4C05A 5EP2A 1B26A 1MIOA 4PGMA 2P0EA 1U8CB 3IDFA 1NQWA 2C42A 3MBKA 3TW6A 3GLHB 2QT9A 3IOEA 1B73A 5IT9A 1DXHA 3T7CA 3OLQA 2VJLA 3OM1A 4GPTA 3NBKA 2UUOA 2IXTA 1FLVA 5AM1A 4HHEA 4FOSA 4QGHA 3TRJA 4Y9UA 4GLJA 3BSFA 1N57A 1T0BA 3AR7A 3RM3A 5ICEA 4DKJA 1RYDA 1T5IA 3KOYA 1Y8AA 3M6LA 1T3ZA 3RTBA 4AP5A 2XDAA 4XR9A 4AG6A 3CUYA 4D8VA 1WDMA 2A1TS 1KFBB 4UTNA 2DXIA 1SHTX 2QTLA 4MVJA 4DIBA 2DF8A 1X3LA 3QYPA 2EL9A 4OHRA 1A5AB 5LDHA 1IWOA 1E2QA 1ZKMA 5I9SA 1YR1A 1KR2A 4WUTA 3SZGA 1GTSA 4IKPA 5CBPA 3PEUA 1NSYA 3ZLUA 4E12A 2Y2UA 2AGVA 1IQUA 4HDNA 1YJAA 4NE9A 1NQAO 3I6QA 1XJ0A 2BSAA 1J9EA 5HK9A 1EX1A 1NBME 1ODFA 3AB7A 1H9AA 2ABWA 3PGVA 4XGQA 3SKYA 4O4HF 2FUG1 3ACDA 1WZ2A 1SD2A 2RDMA 2B5OA 5H02A 2C5LA 4US0R 2ZJBA 3L6UA 1Z0DA 5FOSA 4C0HA 2AMYA 1WDKA 3RRFA 3VU0A 5CD1A 1XNJA 2VJBA 3G2HA 2L17A 4D3YA 2IRWA 1DEOA 5BV8A 5TMPA 3LX6A 3FD8A 4OQNA 2I66A 2OORA 2JIPA 2XBLA 4S24A 4ZMRA 3HBJA 1PUXA 1GPAA 4JEUA 4WNCA 3DP7A 1KTVA 2CBZA 3SC3A 4AL4A 3WGUA 3B7WA 4LF9B 4BEWA 1GVHA 3HYCA 4IHJA 4N9QA 3DL7A 1JAZA 2PIDA 3V4RA 3EC7A 3QKTA 3X1WA 1FDTA 2TMGA 1O4WA 1PL0A 2XGGA 3PDUA 2G80A 3H99A 1N6PA 1U7TA 3PXDA 4OH7A 1EMDA 3OUTA 2GXQA 2BR3A 3G89A 1YCFA 3V1UA 4X90A 3A4NA 1P2FA 2CNBA 1EVEA 3FGZA 3JARB 2GD0A 1OI7A 3MLBA 4I0WB 4I9GA 1KJ9A 4MUJA 4OHBA 4XDGA 4RMNA 4CCAA 5DWDA 3GFGA 4MPPA 3ZZUA 4YWHA 1BEZA 2OR3A 5NLLA 5KTOA 4W5TA 1FNSA 2J3JA 1JFTA 2P91A 1A97A 3CRQA 4LKRA 4HS9A 5CT8A 1LI4A 4LBZA 1M34A 2O05A 3NNDA 3RRJA 1TQDA 4BKRA 4DG5A 3LCMA 3KYDB 3ONDA 4K87A 4NZYA 4QPNA 1DKUA 5HQ3B 4PIPA 2NZYA 1W2GA 1XDZA 2GHRA 3N0RA 4RK6A 3I5UA 1RWKA 2QRKA 4K26A 5CNJA 3JASA 4AF8A 3CB4A 4OJKA 3RSLA 2HDWA 1BCSA 1SUPA 3O9MA 4PSAA 4PX5A 5GONF 1J8DA 2QRJA 5EY5B 3L02A 5L6LB 1ENZA 1LD3A 1WIWA 3NATA 1T4DA 5CDUA 4BBJA 2LCFA 2VJQA 1QV7A 2IYVA 3D1VA 5H7XA 4IX9A 4DNQA 3HSKA 4TKVB 5EIBD 4WH0A 3NTRA 1U2RA 4GM4A 1XTTA 3V00A 5DGTA 1D4AA 1OCEA 1UFKA 1XK6A 1MAAA 2R25B 2X3UA 2PKYX 3FNEA 3K09C 1AGRA 2YRWA 3MS7A 4FDAA 4JC5A 2VTDA 4JD5A 2QVXX 4L5JA 4QU0A 1NXTA 5LVAA 1G5RA 2O1XA 3LC7O 1GNSA 1UXKA 3CT6A 4KGVA 2FCRA 2A57A 3WHKA 1GNLA 3B2QA 3H8VA 2PUVA 4PNZA 1RYEA 1L6IA 3IIEA 4MVYA 3WGOA 4MCAA 2RFLA 4UCFA 1E2JA 1GT91 1Q7TA 1B4DA 1IEWA 2M6KA 1XTZA 4QYWA 4V03A 1NJSA 1GIAA 3VJMA 1CQIA 4YCSA 4HATA 3N0TA 5JY1A 3GLFE 1PT5A 5T41A 2H63A 1ZJJA 4CKWA 4IDEA 2NSJA 3D4OA 4FYVA 4RTKA 1YIDA 4IG9A 5KNCA 1IONA 5EINA 2Y2VA 2DYKA 1DX4A 1W9HA 4YRCA 3OJCA 3FFAA 1PS8A 2GJSA 4NBWA 2HD4A 4ND8A 4JVOA 1XTSA 2OECA 2WLTA 4CV1A 5A3RA 1AUPA 1K98A 1NQTA 1A4RA 1BD3A 2FUNB 2IIPA 3DZKA 3LBAA 1AKUA 1HL7A 2ZIUB 3QMVA 4MMYB 2UYYA 4NF2A 4RD4A 2AJDA 4QBTA 4AO6A 3L0PA 1SK8A 2DECA 4LV8B 2W22A 3MT7A 2IF2A 2VHUA 5J47A 4KLRA 3E9EA 1FUYB 1RKVA 5CIYA 3OX3A 3RQIA 1N3BA 1LZLA 3L05A 4WX2B 1OXMA 3U1VA 4FFMA 3ZQJA 4MO9A 3CH4B 2DTXA 5GGXA 2AJLI 5L3SA 1V8BA 2VYQA 3HLTA 2OOKA 3Q0IA 4PSCA 3LV8A 4RKWA 4K28A 4RXTA 1UADA 4GNKA 1QJCA 1C0KA 1RYBA 2PMWB 3A4YA 2ONZA 4UVDA 2AN9A 3OI7A 2YVLA 4D5EA 1Z0SA 2DULA 2HA2A 3EGWA 4JB3A 3TIFA 1OR8A 1QQ5A 3B3AA 4NZNA 4ASUD 4H35A 4PYIA 2BW0A 2VZ0A 1YK0A 3NW9A 4PG4A 5BSWA 2CYBA 4MSUA 3H2BA 3N2GB 4NE2A 3RV4A 1Y8RA 4REQA 5EG5A 3PXEA 3I73A 4G5GA 4BO3A 1RBQA 4EPTA 4BKUA 3N86A 1PS9A 3GAAA 3EY9A 3RTAA 4DV6B 1Q1BA 4HWSA 3IPXA 3GEIA 5IAKA 4QPZA 5LJLA 2EATA 2Z0MA 3IT3A 2FCAA 3OCVA 4OB8A 1SQSA 2EX1A 1QX3A 4XD7D 1C3JA 3V97A 1IZZA 1HT1E 5EE5B 1KDOA 1HE1C 1Y5IA 5KSWB 4ZK6A 3HL0A 1SXQA 1TA9A 2D5IA 1GUFA 4K86A 3IP8A 1ZH8A 3EA5A 4PGFA 2IV7A 2QX4A 3P0FA 1QR2A 4U00A 3RF7A 2PFSA 4W5RA 1G19A 2CGEA 1MV8A 1ZD8A 2CHGA 2AXPA 2WF7A 2IGBA 3BFKA 3QMMA 4HN4B 1R6BX 4PX2A 3S7TA 1CWUA 4H1UA 3DGEC 1LPOA 1QRAA 3WL4A 1FFCA 3RRZA 2GVDC 2JVJA 2OBYA 4QD3A 4DW8A 3ZCPA 1ZBDA 1KP3A 4ACAA 1R0SA 4HO1X 3NBYC 3QF4A 5ULLA 1G2QA 1RPAA 1Y63A 2Q4TA 4EPVA 1JRLA 1BMFD 1HV8A 1NN5A 3FYUA 3FYSA 3I72A 1DWPA 4J8PA 2HK8A 5G1OA 3S2GA 4QUDA 1M33A 1MOPA 2ZJ0A 3CR7A 1RW4A 2ASVA 2AFIE 3HZOA 4XWWA 3IE1A 1F6DA 3EZLA 3PFIA 3NDIA 3LVFO 5DK4A 5IKPA 3GDHA 3TNJA 1B0PA 3WHLA 1GDDA 3GGDA 2H2AA 3FCCA 3WAKA 3NOOA 2FZWA 3L1KA 5CBPB 2A14A 2VQ3A 3ABOB 3DDNA 5CJ2A 3WNDA 4F71A 4CIAA 5KZMB 4KUGA 2HHCA 1Y1RA 2IOYA 5BYBA 3SSMA 1TO6A 3ET4A 4Q9KA 4A6EA 3H4TA 1QKKA 3IH5A 3BWYA 1ZUD1 2W00A 4WCFC 5EWMA 1F0NA 1KEWA 1X86B 1D5WA 5HKKA 4K8OA 2JA2A 3CH5A 1RE0A 3A9UA 3LT1A 3M6AA 2FE1A 2FSGA 4AKEA 4LJRA 3PFBA 1VLHA 1PNVA 3GCDA 4HK4A 1M0TA 5C7YA 4XDYA 1JIIA 3DZIA 1P6UA 3PGXA 4R1LA 3LD9A 4RVDA 3TCNA 4Y1EA 3CXRA 4L4YA 2WJAA 2WQZA 5EQTA 1VL8A 2EVWX 1B23P 2VJKA 4D74A 5KU1A 2ENWA 2I80A 2W2QA 2XUOA 4TMWA 1XPRA 4IHJB 5BWBA 4ZODA 5EVJA 3L7OA 2D2EA 5F9FA 3PDJA 4UXHA 5K7SA 5ALPA 1GZ4A 5D5PA 1NNEA 1UPFA 3U81A 4Q9LA 3ZLTA 2AXQA 1P7CA 1QJ4A 2G4CA 5JDIC 2EXXA 4L0DA 3W0LB 1N77A 4IWYA 2YYSA 5JI3E 1JLHA 5ADWA 5BV1A 4TQAA 2RD2A 2CVFA 4GL2A 2DRIA 1XEXB 1KHTA 1PWEA 2QX8A 4IQGA 1S9HA 5FBWB 2CBXA 1EWTA 3UATA 1Y81A 2P62A 2VKTA 5DLDA 3Q10A 2ZUCA 5FUBA 2JCYA 3HFGA 1NW3A 3WISA 3I2GA 1BW9A 2VSOA 3KTFA 1M34B 5FNVA 1KR5A 2PWAA 4EAAA 3JQ8A 5CDFA 5TE9A 2VSXA 4UUPA 3VPXA 1FUUA 4O6VA 1W29A 3B5IA 3USCS 3KXPA 3KLOA 2OGUA 2REBA 3G5TA 3PHLA 4LMPA 1P62B 4FFOA 3NH6A 2TS1A 1RZUA 1DTEA 3BGOS 3HU5A 4IPTA 1QONA 4Z0PA 3TG8A 2GPNA 5C5DA 1BCSB 1PJZA 1JECA 3W34A 4EY6A 1XRMA 3JYLA 3F7TA 3NETA 1NF8A 4QDOA 2YWBA 3PEFA 4QIHA 5E4JA 3R3HA 4FQ7A 1JAIA 2C04A 2PGIA 2WKRA 2EWMA 1MT0A 2FPRA 4PFKA 5E0OA 5FFFA 1N6RA 2PO7A 2OXFA 2IJGX 2JFBA 4RHCA 3ZE1B 3C8HA 2VSFA 2ETVA 3EISA 2Q5CA 2NQ2C 2AQKA 5EXPA 5DU2A 4YT8A 1NASA 1ZWKA 5LR6A 4BBAA 3DAGA 3LVBA 3MOSA 5EHGA 3NU1A 1X7ZA 3AX6A 4O0MA 1KS9A 5L7YA 1QB8A 4F3CA 1W5TA 3CF2A 1A8UA 1M6VA 2OFFA 3FDZB 1D1TA 1AURA 3UICA 3SEZA 3T1QA 4EENA 4RHYA 1ZD3A 2JGFA 4D6PA 4EMTA 3PR3A 4EB6A 5GTDA 4ZZ0A 2GB4A 1KQGA 2Q45A 2GKSA 3CR3C 3LP6A 4KSCA 1R37A 2IS1A 1DKPA 2PGOA 4JLMA 2I4OA 4DEXA 2ZYAA 4RD2A 3KSRA 4WMLA 4A27A 1SKQA 2P4HX 2IDJA 4ZT7A 2FN3A 4P4TA 4R2XA 3L04A 1ACJA 2J3EA 4NPAA 2CMKA 1PZXA 3T5GA 4UVHA 3JS5A 4B44A 4EG8A 1TYCA 2SECE 4A3SA 4RLHA 5GVSA 4LJ5A 1MEJA 1VJ0A 3KQHA 4AYXA 3TRFA 2NXCA 3MBIA 1XCGB 3NGLA 4GW3A 3UA3A 1Y9AA 4PZ9A 3TIVA 3PNSA 3WFIA 1BVRA 4EKIA 1IOLA 3OFJA 4GYKA 2G9ZA 2G1UA 3EIOA 5CCEA 4TWJA 1F1JA 1BX3A 2OZLA 5E95A 2BGNA 2PL9A 3NBZC 4RIIA 2QMQA 1DVRA 3I8SA 4OYRA 4CLHA 1YH3A 4J7AA 3L4BA 3NDRA 1BDIA 3QFFA 5I47A 2C0PA 3PD7A 4UU1A 4DE5A 5L3SB 4K9DA 4QTXA 3W05A 2B4TO 3EXHA 4BX0A 1EXDA 3ZCQA 2IUUA 4I1YA 3OZIA 1RHUA 1QNLA 4CMGA 3EGDA 4NBKA 1ZESA 4WLOA 1AUQA 3G9TA 5U9CA 5B1IA 1QRRA 5DBFA 2TSYB 4OHPA 3OT5A 1GARA 3VU9A 1Y5MA 5JLAA 1YJ8A 1RTKA 3JD1A 1OF1A 4RELA 5T6MA 5KX5F 1UOPA 2BGIA 3DMYA 4LWQA 5K0FA 1Z5OA 5THKA 4REQB 2O19A 3P2MA 3OBBA 1TF7A 5BWMA 1I1HA 1J99A 2CNWA 3P20A 4MW6A 1I2MA 1PO7A 4EHHA 1DOZA 3BJEA 2WSSD 4KN6A 1U8XX 3AILA 4MCJA 1PR0A 1ECFA 4TRRA 4LQLA 2J4FA 1TD9A 2FZ5A 1I2BA 3EVZA 3FI9A 1K7CA 3WGGA 5BUCA 3NTVA 2J5KA 1L5YA 1VLVA 3FOBA 2X3FA 4KR9A 4ZZ1A 4KIWA 3KOOA 4X65B 4L16A 2DLCX 3D6JA 5KKCA 3U31A 1NE7A 2FK7A 2QQ0A 4FPXA 1QZTA 2DTDA 4GXRA 3MHTA 4RHUA 1TJ4A 3FPCA 5EJ9A 4W1SA 4J7UA 4YRGA 5CG1A 2ZYWX 3ROMA 4QJ3A 3DDSA 4RYLA 4K8RB 3RC2A 3KD3A 3D8BA 4Z4CA 3FWPA 3FLBA 1KZ7B 5EXSA 4GI5A 1CY0A 4GXQA 3D3KA 3ZXYA 1H8ED 4RHXA 1ZGAA 3A4VA 1V35A 1XF9A 2GVNA 3PPXA 5IWCA 1KSJA 5CU7A 3EN0A 1XMPA 2IZOA 2VEDA 2Z2JA 3HPQA 3KUKA 4YJDA 3AEYA 3T94A 5C1DA 5SV2A 5IJ0B 1V4NA 1XLWA 3QF4B 4M1MA 5ECDA 4GLBA 1RWWA 1YASA 2WICA 1IFXA 3FYUB 1E3DA 4FSXA 4J0CA 3L77A 2W6PA 1CUFA 3KJGA 1KY2A 4E3ZA 1SBZA 1HL3A 3KPJA 4Y8VA 5AJWA 4HPJB 5AD1A 1LLFA 4JI5B 5BYJA 3UC5A 5C80A 2XCQA 3SS8A 2HJVA 3DDHA 1NAHA 2E7ZA 3N2ZB 4GOLD 5A5GA 1CVIA 1G7TA 1MB2A 5C32A 2PKRA 4MVJG 1UEIA 3KG2A 1UBUS 1H4VB 1GGEA 1E9FA 1UANA 2P75A 2VSYA 2VHXA 2B98A 4NCXA 2D7DA 1USKA 1U90A 1IDOA 3P97A 4XCXA 3KSZO 1C30A 1GU7A 5EWMB 1M76A 4TYWA 1MN6A 1RQPA 1PF7E 1Q91A 1Y48E 2PL5A 4CQLA 5J43A 1KVUA 1JLKA 3D02A 2C03A 2CLOB 2Z2XA 4KR2A 1WEKA 3DR3A 1Z5PA 1JHPA 5F12A 1QF6A 1Q77A 3L9XA 5AK0A 2IPAB 2FXIA 1UP6A 1AS3A 2O2DA 2JD2A 3F47A 1N0IA 3O4VA 3FMGA 1QG0A 2AZ4A 2P2LA 3M5WA 4LQCA 3DKIA 5LQAA 4ENQA 3T54A 4HBZA 4IDNA 3HJHA 5ARBA 5C51B 1D4ZA 2W11A 2Q3BA 3Q9NA 4N5NA 1UJ2A 1VLMA 2EG9A 3KP1A 3LW7A 4HDQB 5CT6A 5C8YF