1WSGA

Co-crystal structure of e.coli rnase hi active site mutant (e48a/d134n*) with mn2+
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
155
structure length
155
Chain Sequence
MLKQVEIFTDGSCLGNPGPGGYGAILRYRGREKTFSAGYTRTTNNRMALMAAIVALEALKEHCEVILSTDSQYVRQGITQWIHNWKARGWKTADKKPVKNVDLWQRLDAALGQHQIKWEWVKGHAGHPENERCNELARAAAMNPTLEDTGYQVEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Identification of Single Mn(2+) Binding Sites Required for Activation of the Mutant Proteins of E.coli RNase HI at Glu48 and/or Asp134 by X-ray Crystallography
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
molecule keywords Ribonuclease HI
total genus 48
structure length 155
sequence length 155
chains with identical sequence B, C, D
ec nomenclature ec 3.1.26.4: Ribonuclease H.
pdb deposition date 2004-11-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1wsgA00
1FK9A 4FLTA 2HHXA 3OYAA 4DMNA 2HVHA 1BIUA 4NYNA 1FKOA 3AVGA 5HRRA 2VG7A 3NGIA 1D5AA 1L5UA 3TABA 1C0UA 2OPRA 1Q9YA 1HRHA 3UIQA 2D5RA 4AHCA 3WNHA 4YNQA 1L3VA 5J2QA 3MEDA 5EU7A 3PX4A 3PO5A 3DYAA 4N47A 4CJLA 2OPPA 4DQQA 1ZBUA 2GUIA 1GOCA 2YNGA 4MFBA 4DWIA 2DTUA 4Z4HA 4I2QA 4E7KA 3M8QA 5HRNA 1C1CA 1TGOA 5KGXA 4CF2A 4FLYA 1T03A 4Q5VA 1CLQA 1UAXA 4CF0A 4KI4A 3LDSA 1GOBA 3HO1A 4CGJA 3OS1A 3V9ZA 3U3YA 1VSKA 1SKRA 1KVAA 4AHVA 4YFUA 5FRNA 3RRHA 3TI0A 2G8UA 3T19A 2HNYA 1HMVA 4I9QA 4FJ9A 4PUOA 4NYFA 2XY8A 2YHAA 4FJXA 1WSEA 3DI6A 3K5MA 4KHUA 4G1QA 4CEAA 4KB0A 2PY5A 4CECA 3QEWA 1XHXA 3AVMA 1KFDA 3ASMA 4ELUA 3QNOA 4CEDA 4C8NA 2BANA 3B6OA 3IG1A 3HXMA 4C8OA 2ATQA 1S1UA 3O4QA 4LH4A 1BI4A 2LSNA 3OS2A 4OKEA 4CJTA 2Y1JA 1VK0A 1QS4A 3ZSQA 3ZSWA 2OA8A 2RKIA 3ZSXA 3QEPA 3V9XA 3QESA 4E89A 3NDKA 1YVUA 3AA4A 1QTMA 2DY4A 1WNSA 1TL3A 3SYZA 3P5JA 4E7LA 3V81A 3C94A 3HP9A 4DTPA 3M8PA 1RT3A 4CIGA 1KVBA 2E6LA 3SNNA 1NJYA 1TKZA 5FROA 3SZ2A 1IG9A 4FK0A 4M45A 3T1AA 4CJ5A 3KK2A 2B6AA 3VQ9A 4ELVA 5D3GA 1U04A 1RBUA 4CGFA 2IS3A 3KLFA 1TK5A 2G8HA 1IH7A 1LW0A 3NF6A 3RRGA 4KAZA 1C1BA 4CHQA 5J1EA 4KPYA 3P1GA 1RDAA 3VQAA 3VA0A 4DF8A 1HQUA 3NH0A 3OYIA 4FJ7A 4BACA 5C25A 3LPTA 4I7FA 3CQ8A 3VA3A 1SL0A 4HUGA 3NBPA 4DG1A 5KGWA 5J2MA 4M3TA 4C8KA 1XWLA 4KO0A 4E1NA 4DTRA 5K14A 5CYQA 3AVNA 3L2VA 2VWJA 3LZJA 4NCBA 2XHBA 3AVJA 1JLFA 2VG5A 4AHRA 4FCYA 3OJUA 2D0AA 2QK9A 3OYBA 3V4IA 4DS5A 4B9MA 3TR8A 4E7JA 4LD0A 1VSHA 1KLNA 4FM0A 4O4GA 4RW6A 1RILA 2IDOA 4E1MA 3QEIA 2PYLA 1HJRA 3O3GA 1B92A 2YHBA 1JXEA 3ULDA 3DLGA 4CJUA 5SZTA 4OVLA 3LAKA 1VSEA 1IKYA 3AO2A 3WNGA 4FJMA 3ITHA 4DQSA 4DSKA 4DU1A 1NK8A 2GBZA 2KQ2A 5CZ2A 1KVCA 4O5BA 2QKKA 1N5YA 4I2PA 4FXDA 4N41A 1BL3A 2ETJA 3MXJA 4C8LA 4N56A 4FVMA 1RDBA 3HYFA 2PYJA 4CCHA 4N5SA 4B3OA 1O1WA 5HP1A 3AO4A 1VSMA 2DFFA 2B5JA 1WLJA 1RCHA 3K57A 4XIUA 1XI1A 4M42A 3NFAA 3NHGA 1XHZA 4CESA 4DSEA 4FK2A 4MQ3A 3I0SA 1WSFA 1NK6A 1W0HA 2B4JA 1BCMA 3OYCA 1F21A 5T7BA 4CGIA 1QSYA 1DLOA 1JLBA 3VQ8A 3EZ5A 4DU3A 3TAPA 3BDPA 4KHNA 4IFYA 1LW2A 4FW1A 3QLHA 4O0JA 3VQCA 4JRQA 4E0DA 2P5GA 3AA3A 1U48A 1U47A 4B9TA 4IBNA 3MEGA 4KTZA 4AH9A 5KI6A 3AO1A 3KKRA 4H4OA 3D0PA 1WSJA 2HHSA 3DOLA 4J2DA 3OYGA 4B9SA 1FKPA 2HNDA 3L3UA 3B6PA 1KRPA 1W9HA 4J2EA 1D8YA 1JL2A 3DLEA 4HUEA 1S1WA 4CHNA 3SUNA 2F96A 1QSSA 3DLBA 2ITGA 4AHUA 4CJKA 4DFKA 3IS9A 3K2PA 4FZXC 1ZBIA 3HVTA 3PX6A 1ZBLA 3AVHA 3LWLA 1BHLA 4JLHA 2X78A 3ZSRA 3V1QA 3HP6A 3MAQA 4H8KA 3L2WA 2HNZA 3V9WA 2AJQA 3L8BA 1ZBFA 2EX3A 1RTHA 3F73A 2XY7A 4DFJA 3AVKA 1NJWA 2Z1HA 1NJXA 2OPSA 5DK5A 1TK0A 4KHQA 5J2PA 3SQ0A 3U3GA 1SL1A 5HRPA 4EZ9A 1VRUA 4BDPA 1X9MA 4M3UA 2BGGA 1I39A 4I9LA 1LAVA 2HHQA 3DM2A 4HVJA 3MECA 4W5NA 3HPHA 5J2NA 4KV8A 4FZZA 1UOCA 4O0IA 4DLGA 3RMCA 1MU2A 3V9SA 3DLHA 4F8RA 4KHWA 3SV4A 4Z4GA 3VQBA 3V6DA 3PO4A 5CZ1A 3LP3A 3SI6A 3OY9A 3M8RA 3OYKA 2X6NA 4H4MA 4CJSA 2HW3A 3EYZA 2HVIA 1NOYA 3DMJA 3HPGA 4W5RA 2OYQA 3NE6A 4LSNA 2P5OA 2G8IA 4CGGA 2O4GA 4QCLA 1RT2A 3WNFA 3O4NA 2HB5A 3RMBA 1WAJA 1SKWA 3SQ2A 1WSIA 2YNIA 4B9UA 1KCFA 2IC3A 3QINA 1RT6A 4DU4A 3MEEA 2Y1IA 3SQ4A 1JLEA 4HUFA 1L3TA 2P51A 4BE2A 1U49A 3NGYA 1S9GA 2OPQA 2Z1GA 4W5QA 3C95A 1IKXA 1EETA 1BIZA 1C6VA 1Q8IA 2GV9A 4CFAA 4CJ3A 4KHYA 3HK2A 2EHGA 1LV5A 3S3MA 1HYZA 2XY6A 5CY4A 1NK9A 1RT7A 3VQEA 1D9FA 4E7IA 1ZYQA 4B08A 4CGDA 4F2SA 1TAQA 3CYMA 3HT3A 3VQDA 2YKNA 3OJSA 3QERA 3K59A 1RNHA 1QHTA 3JSMA 1SUQA 3FFIA 3AVLA 2IAJA 2YV0X 4GW6A 5HBMA 3OYJA 2BDPA 4KI6A 2YNHA 4OGEA 4HCBA 3KKSA 2KZMA 2G8VA 1RBRA 2Z1JA 2D0BA 1CZBA 4CF8A 1Q9XA 1JLGA 1EXQA 1RTJA 1C1AA 1X9WA 4BWJA 4E19A 4CK1A 5KTQA 2FC0A 2W42A 4J2AA 1C0TA 1J9AA 3SJJA 2FBVA 4TSXA 5KRSA 4BDZA 3LP0A 4CJFA 3M8SA 3CFPA 1J53A 4FJNA 3LALA 3VQ7A 3KK3A 4DSLA 1RT1A 2XRIA 3KD1E 1U45A 2QXFA 2OZMA 1TL1A 4DTNA 3ZSZA 2P1JA 3EY1A 2WOMA 4W5TA 4N76A 4FM2A 3HJFA 2HHVA 1T05A 3O3FA 3RR8A 1JL1A 1HYVA 2XY5A 4HHTA 1NK7A 3OS0A 2HHUA 4CJQA 2IOCA 1RDCA 2FBYA 3QETA 3LANA 4ICLA 1WSGA 4FLZA 4B9LA 3ZSYA 4IFVA 4CGHA 4HTUA 2HHTA 4M3RA 5C42A 1J54A 1EKEA 1LWFA 4DTOA 4K8XA 4CHPA 3AA5X 3RTVA 1SKSA 4OLBA 4Y1CA 4J2BA 5JS1A 1X9SA 1ZBHA 4OGCA 1NKEA 1TKXA 3ZT1A 1RBVA 4FLVA 3SUPA 2G8KA 4F2RA 4EP4A 1KSPA 2KFZA 1HYSA 2RF2A 4M3XA 4ID1A 3K5LA 1YTAA 4CJRA 1NOZA 1TKDA 4OPJA 2X6SA 4CF9A 3DOKA 1C0MA 3ZSVA 2G8WA 5HLFA 4OPKA 2KTQA 3V9UA 5DMRA 2XO7A 3CFRA 3P83D 2JLEA 3NAEA 4BDYA 4FLUA 3DRRA 1WSHA 3OYFA 3LP2A 4FJ5A 4QOZB 3OVNA 4FW2A 4RW4A 4FJHA 4OJRA 4QAGA 4PA1A 3AVCA 3K5OA 4O44A 4CFBA 2A1SA 3SPZA 4PQUA 1HQEA 4FJLA 1N6QA 3I0RA 3LWMA 4F4KA 3E01A 2BE2A 3CG7A 3QIOA 3NF7A 4NCGA 4CERA 3SV3A 2YKMA 4FM1A 4RW7A 5SWMA 4KFBA 1IO2A 4F3OA 3ALYA 3HPOA 2D0CA 1I3AA 3HL8A 3KJVA 4FJ8A 2F8SA 4Q0BA 3SCXA 1S1XA 4RW9A 3OYMA 3PX0A 1Z26A 4UQGA 3L2UA 1LAWA 4DTSA 4DFMA 1ASVA 2A1RA 3NH1A 2Z1IA 1D9DA 4OKJA 4W5OA 2RN2A 1BQMA 3HVRA 1KFSA 4DTUA 3DRSA 3QEVA 4KTQA 3LP1A 3KIOA 3OYDA 4CEOA 1HPZA 1S6PA 3ZT2A 4CJ4A 1FXXA 4L8RB 4CEBA 1A5VA 2IGIA 3CM5A 4CEFA 3TARA 4B8AB 3K5NA 4F3TA 4CFCA 4KREA 5E41A 4ZTJA 3SQ1A 3KK1A 1BGXT 2YNFA 4FJKA 2E6MA 3V1RA 3OYEA 1RBSA 2ZD1A 1A5WA 5I42A 2VWKA 1X1PA 1RTIA 3AO5A 1CXQA 4IG0A 1JLAA 1YT3A 3WNEA 2E4LA 1VSJA 3AV9A 3TWHA 3ZCMA 3LAMA 5HROA 4FYDA 4ZTFA 5FRMA 3VN5A 3MXMA 4CHYA 1RTDA 4Y1DA 3KLEA 4EP5A 2NUBA 4CFDA 1UWBA 3BGRA 4WE1A 3O3HA 3TANA 3ZT3A 4DS4A 4Z4IA 3C6UA 1JKHA 5CYMA 4FZYA 2KZZA 3TAMA 4CK3A 1HNVA 4JRPA 3QIPA 4FLXA 3PY8A 1RBTA 2Q3SA 3RMAA 4E7HA 1NKCA 3H08A 3NGZA 4K8ZA 3QEXA 3NH2A 3TAQA 1BI4B 3MXIA 4CE9A 4PY5A 2KFNA 4RG8A 4RW8A 4IKFA 2KW4A 1EX4A 1GOAA 3OYLA 1CXUA 4E3SA 1K6YA 3VQQA 3LPUA 1IKWA 2FBTA 2RPIA 3KLIA 1HNIA 1REVA 3G10A 4BE1A 1VSIA 4DSJA 1VSLA 3ZT4A 4O55A 3ISNC 4R5PA 4DQRA 1WN7A 4KHSA 1TV6A 3A2FA 4DTJA 4C8MA 3QNNA 3I8DA 2G8FA 1TKTA 3OYHA 2HMIA 3ZSOA 4PWDA 2DFEA 4DLEA 4HCCA 4CEEA 1BQNA 3VQ6A 4CJEA 4JS4A 2WONA 1RDDA 1S1VA 3K58A 3RMDA 3CFOA 4LY7A 1A5XA 3L2RA 4M3ZA 1ITGA 4LSLA 3KTQA 2I5JA 4CJPA 1WAFA 1QQCA 4Z4CA 3TAEA 4KB1A 4CHZA 4GVMA 1TVRA 4KTWA 1VRTA 1JLCA 1LWEA 4DTXA 1NK4A 4B8CA 1B9DA 3L2QA 1TK8A 4IDKA 3PUFA 4ZHRA 4IG3A 3PV8A 4AHTA 3F9KA 1RT4A 3C6TA 5KRTA 3AVIA 4M3YA 3LZIA 1UA0A 1QSLA 3NCIA 4KKOA 3ZT0A 1CZ9A 4CEZA 3RWUA 4B9VA 1YTUA 3S9HA 4FJJA 3AO3A 1EP4A 2OZSA 5JS2A 3KLGA 3KLHA 1T7PA 3S3NA 3L3VA 1XC9A 4JS5A 4DQIA 3U6FA 4Z4FA 3AA2A 1QE1A 2JGUA 1RT5A 1S5JA 4LH5A 3IRXA 4BE0A 1BISA 3AVFA 3NF8A 2FBXA 4CHOA 4DSIA 4Z4EA 2O4IA 4BWMA 3HSTB 4FLWA 2X74A 3TAFA 3CM6A 1Z25A 4CF1A 1NK5A 4M3WA 3AVBA 2F8TA 3QO9A 2QKBA 4CK2A 3S3OA 1S9EA 4M41A 1DTTA 3VQPA 3OYNA 2PZSA 4CJWA 1LWCA 3V1OA 1ASWA 4AILC 1L3UA 1U4BA 3THVA 3RR7A 3SPYA 3VQ4A 4FJGA 1UA1A 4OLAA 1J5OA 1G15A 1JXBA 1ASUA 5FDLA 4B9NA 1DTQA 4CIFA 3IAYA 4ELTA 1T8EA 1KTQA 5I3UA 4FK4A 5C24A 3DRPA 1NK0A 3DLRA 4CEQA 4NCAA 1IKVA 2R7YA 2DFHA 1S1TA 4OKKA 1L3SA 3D45A 3HM9A 4GMJB 1BCOA 1VSDA 1R0AA 1SV5A 2VG6A 3G0ZA 4DSFA 1TAUA 1JLQA 4AHSA 2ZE2A 4FJIA 3NF9A 1S6QA 1VSFA 4Z0UA 4CJVA 1SL2A 2HHWA 1NKBA 4DF4A 3SUQA 1B9FA 4DQPA 4DTMA 4CIEA 3SUOA 4EZ6A 4ID5A 3JYTA 4DFPA 1NJZA 4KRFA 5HRSA 3DLKA 3VQ5A 1KLMA 3AVAA 1Y97A 3KD5E 3TAGA 2ZQBA 3T3FA
chains in the Genus database with same CATH superfamily
2HHXA 2QM1A 4H5WA 4DR6K 3R8EA 4NYNA 1NNEA 3AVGA 1GLLO 4JN4A 3NGIA 5AQMA 1QQNA 2D5RA 2YHYA 3MEDA 2WUSA 4JHDB 2NZTA 2OPPA 5AQOA 2GUIA 1GOCA 2O8DA 2DTUA 4I2QA 3M8QA 5HRNA 1QQMA 4PKIA 1TGOA 2UYTA 4JKGA 4JI2K 4CF2A 1UAXA 5F0XA 1KVAA 3WQUA 3K0SA 1HMVA 1VQMN 2XY8A 2YHAA 3UKRA 4FJXA 1YXQA 3DI6A 3LDLA 4H0OA 1KAZA 4MDAA 1KFDA 3L6QA 3B6OA 3H1QA 4XH5A 5M1KA 3ZLJA 4LF4K 4C8OA 2V7YA 1S1UA 3O4QA 2LSNA 1GLJO 4OKEA 3UKUA 2BUPA 4DCHA 2RKIA 3QEPA 3AA4A 3VGKA 5FPNA 2DY4A 3V81A 3P5JA 4JI5K 3C94A 4DTPA 4K43A 3EE8A 3M8PA 1KVBA 2E6LA 5GIOA 5JMVA 2P9IA 3SNNA 1TKZA 5FROA 3SZ2A 1IG9A 3T1AA 3KK2A 2G8HA 3CXCM 3RRGA 2Q31A 1C1BA 3WXJA 4CHQA 3VA0A 1HQUA 4BACA 5C25A 3CMEN 4BRAA 3SMPA 2P9NA 4H5RA 4JI7K 2WFBA 5F2RA 5K14A 3L2VA 2VWJA 3LZJA 4NCBA 1JLFA 4FCYA 3N4QA 5GIPA 3K9JA 2ZGZA 2QK9A 1KLNA 2P9KA 1VSHA 4FM0A 1XQSC 4WQ4A 2IDOA 4E1MA 1HJRA 3O3GA 2YHBA 4DV5K 4NO7A 3DLGA 1YJWN 4CZGA 3CMAN 4DQSA 4DU1A 1NK8A 2GBZA 2W41A 4DUYK 4FXDA 2QWNA 2D4WA 4FVMA 4CCHA 3AO4A 2B5JA 1WLJA 1NG9A 4M42A 3NFAA 4K42A 5AQLA 4MQ3A 1WSFA 2B4JA 3OYCA 1QSYA 4JV5K 1DLOA 3E9OA 3BDPA 4IFYA 3F2KA 1VQNN 3VQCA 1U48A 2A42A 4AH9A 4IJNA 4H0YB 3AO1A 4H4OA 1QZ6A 2HHSA 2HNDA 4O5FA 5LMUK 1KRPA 1W9HA 3IUCA 1HNXK 3TSPA 4CJKA 3GBTA 4DQ8A 1ZBIA 5BRHA 1RDWX 5CE3A 2PY5A 3CIPA 1ZBFA 3VTHA 3F73A 2XY7A 2OPSA 4EZ9A 1VRUA 4DV0K 4FWLA 1W7AA 2ASMA 1I39A 2VGNA 4FWQA 1VQLN 5J2NA 1SAZA 4O0IA 2Q36A 4EFHA 3V9SA 3DLHA 4JKAA 1D4XA 3FZMA 3LP3A 3SI6A 3VEVA 3TPQA 3M8RA 4CJSA 4BREA 4EHUA 4HTLA 4H0XB 2P5OA 1ATNA 2QTDA 3ZX3A 2IVNA 4BRCA 2O8DB 4CZEA 1KCFA 2IC3A 4GV3A 3MEEA 2CGLA 2HOEA 2P51A 3BEXA 2O8EA 2Z1GA 4FLVA 1EETA 2YI1A 1VQ9N 3H3NO 4LF5K 3HK2A 3S3MA 1EWRA 5AR0A 2NRZA 2QEXN 4CGDA 3CYMA 3VQDA 2YKNA 3NVMA 1ZBSA 3FFIA 2IAJA 2YNHA 3DXKB 3SMSA 1RBRA 2Z1JA 3DXMB 1CZBA 1N32K 1XC3A 4BWJA 4E19A 2FC0A 1C0TA 3SJJA 4IJAA 2CH5A 3M8SA 4WCEL 3KK3A 2O8FA 4F9OA 2QXLA 3ID6A 5ADXA 2P1JA 4FM2A 1JL1A 4R79A 4BVPA 2HHUA 2CH6A 2FBYA 2E5LK 3LANA 1DT9A 4FLZA 4B9LA 1SS6A 1LWFA 4IXCA 3CCQN 3BF3A 3MWTA 1X9SA 4OGCA 1NKEA 1RBVA 3ZYYX 2G8KA 4RWTA 1VQ5N 3KVGA 2RF2A 3K5LA 5FLXO 4OPJA 2FSNA 2WC9A 3QICA 4CF9A 2G8WA 5M1FA 4B9QA 4B1VA 2XO7A 1LCUA 3DRRA 1KC8O 4LFCK 3IDHA 4PA1A 3QFPA 3K5OA 4JI4K 3MMVA 1HQEA 3VOVA 1XNQK 2OTLN 5JVHL 3LWMA 5EY4A 4BC5A 3NF7A 4CERA 1E3MA 3HBTA 4H5NA 3VEOA 4IWVA 4RW7A 4FM1A 2V51B 5SWMA 4OO1J 3ALYA 3HPOA 2D0CA 1S72N 3CC2N 1I3AA 4H0PA 4FJ8A 4FSVA 3Q7BA 3SCXA 1S1XA 3PX0A 5KQ8A 3WXKA 1ASVA 1D9DA 2Z1IA 2RN2A 4KHPK 3H3OB 3HVRA 1YITN 3QEVA 4JI1K 4FOEA 4B3RK 4L8RB 1JCEA 4CEBA 3TARA 4CEFA 4B8AB 1YF5L 3O8MA 3RSEA 4F3TA 4CFCA 1X9JA 2VYPA 5E41A 3KK1A 2YHWA 4JYAK 2E6MA 3OYEA 1HPMA 1RBSA 3LM9A 1RTIA 3AO5A 1CXQA 3TWHA 3VN5A 1Z05A 3U8XA 4B1XB 3TANA 3VGMA 3O3HA 3ZT3A 2J4RA 3E9PA 4J8FA 3TAMA 4JRPA 3QIPA 1RBTA 3L0QA 2Q3SA 3NGZA 1OH7A 3HOTA 3WQTA 4E3SA 1CXUA 3ZETB 3ZETA 4BE1A 3O9QA 1IKWA 2FBTA 1YJNN 1HNIA 1REVA 3G10A 2OCEA 1VSIA 5AQNA 2V52B 4O55A 4R5PA 1WN7A 2ASOA 4C23A 4HCCA 1BQNA 4A62A 1RDDA 4H5VA 1V4SA 1BA0A 4LSLA 3KTQA 5AQKA 4Z4CA 2VQEK 5JVGL 3PLAA 1TVRA 4KTWA 1JLCA 1LWEA 3J7YP 3L2QA 4ZHRA 4BRNA 4AHTA 3AGKA 4ISFA 4K25A 5KRTA 3BP8A 3LZIA 1UA0A 1CZ9A 4LF7K 2RHKA 3E66A 3AO3A 4RTFD 2OZSA 3KLGA 3DAWA 4JS5A 3ATUA 2HBKA 3EL2A 1GLCG 1BISA 3AVFA 4BRIA 4BWMA 4FLWA 3M6GA 4CK2A 4M41A 3VQPA 1EQYA 2UUAK 1YIJN 3V1OA 4AILC 1L3UA 3SPYA 4BC2A 1J5OA 1KAYA 1OVQA 1KQSM 4I6MA 1BOTO 5I3UA 3L4QA 1NWKA 3K9KA 2R7YA 4NCAA 1S1TA 2QI2A 3HM9A 4GMJB 1VSDA 1SV5A 2VG6A 1TAUA 4YDUC 4FJIA 5BPNA 4NXNK 4FO0A 3SUQA 4DQPA 4DTMA 3DXMA 4O8UA 5HRSA 4KRFA 3WUHA 3VQ5A 2E8AA 2E20A 3TAGA 3T3FA 3OYAA 4DMNA 3CJ9A 4BR4A 3O80A 5HRRA 2AA4A 5F1XA 3UIQA 4QS9A 5M1OA 3RVCA 4CJLA 2CGKA 4GKJK 1ZBUA 4DWIA 4DV3K 2YNGA 4MFBA 1C1CA 2P9PB 4A2AA 4BRLA 1HUXA 5KGXA 2NRTA 4FLYA 4CGJA 4JK7A 4JI6K 4V19S 1VSKA 1HJOA 3ENHA 2HNYA 4JEPA 4I9QA 4FJ9A 4NYFA 3R9PA 3DLLL 5KPTA 1WSEA 1S3XA 4CD1A 3K5MA 2O8EB 1HKBA 4C8NA 3HXMA 3IG1A 4BRQA 5M1PA 4CJTA 3ZSQA 3FFKB 3QESA 4H0VB 4E89A 3NDKA 5AFUA 4PL7A 4X66K 3SYZA 1N36K 1IBMK 1HX1A 3HP9A 5C2DA 1E4GT 3ZX2A 4ELVA 4BR2A 1U04A 1RBUA 4CGFA 2IS3A 3KLFA 1IH7A 3GDQA 4BG8A 3NF6A 4KPYA 3VQAA 4H5TA 4B1WB 2ASPA 3CQ8A 4BR5A 2ZJQL 1BO5O 1VQ7N 5AQIA 2A6AA 3D2EB 4MDBA 5KGWA 5J2MA 1ZC6A 4DTRA 5CYQA 2XHBA 1MWMA 5GAHP 1O13A 3OYBA 4B9MA 4DS5A 4JKDA 3TR8A 5C2FA 5E26A 3QDKA 2Q0RA 3F5TA 3MDQA 4CJUA 5SZTA 1GLAG 3WNGA 4FJMA 4DSKA 4JI3K 2KQ2A 3J7AP 5CZ2A 1KVCA 2YCHA 1N5YA 4N41A 3UKRB 1T44A 1BL3A 4NB4A 2P9LA 3O9TA 2VCPA 1W2BM 1VSMA 4LF6K 1RCHA 4BRGA 4DSEA 4M63C 3BY5A 1F21A 5T7BA 1KD1O 2E1YA 2YHXA 4DU3A 3R3LA 4JKCA 3QBXA 4O0JA 4JRQA 3EKSA 1N34K 4BY9C 3C0BA 2YJFA 3KKRA 4LF8K 3D0PA 1WSJA 4J2DA 3VMFB 4B9SA 1BDGA 2H3GX 3P31A 1JL2A 3PSIA 3SUNA 2P9KB 2F96A 3DXKA 2GX9A 3DLBA 1MDUB 3U9ZA 3VETA 5AQUA 3VEYA 4DFKA 1BHLA 2AJQA 4CZHA 3V9WA 2EX3A 1NJWA 3AVKA 3J8AA 5DK5A 1YHQN 4KHQA 5J2PA 5AQZA 3ATVA 4ILHA 2BGGA 1NBWA 1LAVA 3DM2A 4WYBA 3CCLN 4W5NA 3HPHA 4DV7K 4JHDA 4DR1K 3PO4A 2ZJPL 4B1UB 1KAXA 3OY9A 3OYKA 3HTVA 4H4MA 3ZEUB 4CW7B 2HVIA 3HPGA 2OYQA 1WUAA 4M7XA 1J6ZA 3WNFA 4DUZK 3O4NA 4A5AA 2GTDA 3RMBA 4BC4A 1WAJA 2KHOA 3SQ4A 5C15A 5HL7L 3IKMA 2OPQA 4W5QA 4FJJA 1IKXA 2GV9A 1Q8IA 4JI8K 4KHYA 5I9EB 4FVUA 2QWQA 1IV0A 1RT7A 3VQEA 3CJ7A 1ZYQA 4BQLA 3OJSA 3K59A 4A5BA 3JS6A 2BH1A 2BDPA 3OYJA 5HBMA 3QMLA 4PKGA 4OGEA 4KI6A 3CERA 4BRKA 4AM6A 4CF8A 3G25A 1JLGA 1RTJA 4IOAL 1X9WA 2FF6A 5MLCQ 1QZ5A 2W42A 1J9AA 4BRPA 1K9MO 3LP0A 4IFEA 3CFPA 3CQYA 3CCUN 4FJNA 3I33A 4DR4K 3EKUA 3BZCA 2QXFA 1TL1A 3ZSZA 3EY1A 2HHVA 2E1ZA 1T05A 3O3FA 1NK7A 4X62K 5AQWA 5ADXH 1NGJA 3CC7N 4GVEA 4IFVA 3RSEB 4CGHA 4M3RA 1J54A 2E2OA 4DTOA 4CHPA 1T3VA 3GG4A 5JLHA 1DKGD 4OLBA 4Y1CA 5JS1A 1ZBHA 3ZT1A 4L3QA 4RCHA 4F2RA 1KSPA 5FPEA 2PBDA 2KFZA 1HYSA 2HBJA 3CPEA 2Q1NA 4FWSA 2WBNA 4MO4A 5HLFA 3V9UA 4FLUA 3P83D 4WFBL 1TYQB 3VF4A 3KZBA 3OVNA 1I94K 4O44A 5TKWA 4PQUA 3THWB 3KHYA 1N6QA 2HBLA 4F4KA 3CG7A 3QIOA 3SV3A 3VERA 3F9MA 3MCAB 1IO2A 4JKHA 4CZMA 3FE1A 3ENBA 3KJVA 4Q0BA 3H1VX 3OYMA 2KLAA 2PAVA 4YDUA 4DFMA 3MK6A 1IBKK 3JAMO 3NH1A 4OKJA 1KFSA 5BREA 4YOWA 4EAHD 1N8RO 4DHYA 1FXXA 4HWIA 2IGIA 3CM5A 4WQ5A 1TUUA 4ZTJA 3SQ1A 2YNFA 1ATSA 3V1RA 1WBBA 3T1HK 5I42A 2ZD1A 5CR4A 2IVPA 2E4LA 1VSJA 3AV9A 5FRMA 4CHYA 4CFDA 1Z6RA 3W0LA 3M3ZA 5ELZA 4DS4A 4FZYA 4YORA 2QA4N 1NGEA 4CK3A 3O6WA 3RMAA 2HF3A 3H08A 4K8ZA 3NH2A 3MXIA 4RW8A 1QQOA 4IKFA 2KW4A 1GOAA 5EX5A 3OYLA 3VF6A 2JWLA 3ZT4A 3O5BA 3TSUA 4Y0WA 3A2FA 3I8DA 3OYHA 4IOCL 3WEEB 2WONA 1VQ6N 4LY7A 3L2RA 3G71N 2D0PA 2I5JA 4BRMA 4GVMA 5C12A 1NK4A 1J5EK 1LOTB 5E84A 4IDKA 3KK7A 4NLCA 5FPDA 1EWQA 3D7EO 4CEZA 5AFUH 4BG9A 4B9VA 1Q81O 3S9HA 3TSQA 1XNRK 1E4FT 5JS2A 1Y64A 3KLHA 3L3VA 1XC9A 1VQON 1YJ9N 2HF4A 3AA2A 1QE1A 2JGUA 1BA1A 1S5JA 4LH5A 4LFBK 4CHOA 3LDOA 2X74A 1Z25A 4CF1A 4M3WA 2P9SB 2F8TA 3QO9A 3MWPA 3S3OA 1S9EA 3OYNA 1DTTA 3G4SN 4A59A 4LF9K 3MN6A 4ISEA 4XH4A 1G15A 4B9NA 3IAYA 1KTQA 5LMNK 4FK4A 3DRPA 1NK0A 4CEQA 1IKVA 3CJBA 4OKKA 1L3SA 2ZM6K 3D45A 3CETA 3GE1A 3ULEB 4DSFA 1YVNA 3NF9A 5M1QA 1SL2A 4FPBA 1NMNA 2GWKA 3SJHA 2Q0UA 2P9NB 3CPWM 2O8CA 3EO3A 4BRHA 3AVAA 3KD5E 4BGBA 2HVHA 1BIUA 4BRDA 4FWMA 1FKOA 2VG7A 1D5AA 1NJIO 3TABA 1WB9A 1Q9YA 4AHCA 3WNHA 4DR3K 4YNQA 1L3VA 5J2QA 3Q7CA 4C1NI 3PX4A 1K73O 3DYAA 1N33K 4N47A 4WFNL 4DQQA 2HW3A 5AQPA 3LL3A 5HOOA 1HLUA 3KWIA 1CLQA 5BN9A 3LDSA 4BC3A 3HO1A 3OS1A 4JK9A 1M1KO 1SKRA 4I6MB 3W3DA 5FRNA 3RRHA 3TI0A 2G8UA 3T19A 4PUOA 4OPAA 4AM7A 4KHUA 4G1QA 4KB0A 4ELUA 3AVMA 3QNOA 4CEDA 2BANA 2A5XA 4LH4A 3OS2A 2Y1JA 3ZSWA 4GKKK 3ZSXA 1K8AO 3V9XA 2QWOA 1Q82O 3D2FB 1WNSA 3AAQA 3CCSN 2KKZA 4CIGA 4E1JA 4B3TK 1VQ4N 1NJYA 3VGLA 3VQ9A 3WXMB 1TK5A 4WQ5C 3OW2M 3THXB 4KAZA 2FLOA 5EOYA 5J1EA 4CBWA 1RDAA 5AZJB 2UUBK 3LDPA 1GLDG 1SL0A 4HUGA 1TYQA 4GY2B 1XWLA 4E1NA 2ITMA 2VG5A 4AHRA 2D0AA 1Q86O 3V4IA 1R59O 4O4GA 4RW6A 1RILA 3CCEN 3QEIA 1BG3A 1B92A 1NGBA 4FPAA 1VSEA 1IKYA 1JCFA 4OX9K 4O5BA 2QKKA 4I2PA 3VENA 3P38A 4K41A 2UUCK 3MXJA 2I7NA 3TTCA 4C8LA 2PYJA 4N5SA 1O1WA 2JWKA 5HP1A 2DFFA 2A41A 2IIRA 1VQPN 3OHRA 3EE9A 3S41A 3CJCA 3VEZA 3NHGA 1XHZA 4FK2A 1NK6A 3I0SA 4PHTX 1BCMA 3WT0A 3TAPA 4YOXA 4NLBA 1LW2A 2NRHA 4MLHA 4E0DA 2P5GA 4LC9B 1U47A 5IWAK 4IBNA 4WF9L 2NRRA 3MEGA 4KTZA 3E1YA 4H0TB 3FZHA 3B6PA 5KQDA 1D8YA 4J2EA 2P9IB 4HUEA 1S1WA 4BR7A 4CHNA 4LFAK 1QSSA 4WFAL 2E2PA 5AQSA 2ITGA 4DKWA 3IS9A 3K2PA 3C7NA 1U2VB 3HVTA 1ZBLA 3AVHA 3MAQA 1XMQK 4JLHA 3ZSRA 3HP6A 3V1QA 2HNZA 3L8BA 3NMUA 1RTHA 4DV4K 2W6LA 1Q7YO 5GADP 1SL1A 2NRWA 5HRPA 2E2NA 2FXUA 4BDPA 4M3UA 4HVJA 3MECA 4KV8A 1UOCA 4DLGA 3RMCA 4F8RA 3V6DA 3LDNA 3CCMN 2QWPA 2FSKA 1NOYA 1VHXA 3DMJA 4W5RA 4CBUA 2P9UA 3PIOL 2O4GA 4QCLA 1RT2A 1WOQA 2HB5A 3DWLA 1NU0A 1WSIA 3OTOK 4B9UA 4FOIA 3QINA 1RT6A 1JLEA 4HUFA 4A61A 3SBTA 4BE2A 3NGYA 4XEIA 4FK0A 3AY9A 4CFAA 4CJ3A 1BIZA 4BROA 4CZLA 1HYZA 2QWRA 3CI5A 1NK9A 3OBYA 1D9FA 4F2SA 5AQJA 1RNHA 1QHTA 3AVLA 2KZMA 4HCBA 3KKSA 2QWMA 1NGFA 2UU9K 1EXQA 4WQ4C 3H46O 2FSJA 5AQQA 4CK1A 5KTQA 3CJAA 4KH6A 2FBVA 4B3SK 4BDZA 4CJFA 1J53A 4DSLA 1RT1A 4B3MK 1U45A 4YOTA 3TTFA 3RR8A 1HYVA 2PFUA 3R6MA 3OS0A 2IOCA 5GINA 3QETA 3HSCA 1WSGA 1OVYA 5C42A 1FJGK 4K8XA 4JD2B 3O1BA 3RTVA 2HMIA 1SKSA 3A5NC 4ID1A 1YTAA 3D2FA 4CJRA 3VF2A 1ESVA 3DOKA 1C0MA 3ZSVA 4OPKA 2KTQA 3CFRA 2JLEA 4JAXA 2UXCK 4RW4A 4OJRA 4QAGA 4CFBA 3SPZA 3SAGA 3PSFA 2V7ZA 4FJLA 4NCGA 2HBMA 3A0IX 3T7ZA 4F3OA 2ZWHA 2F8SA 5AZIA 4UQGA 1NGCA 1LAWA 4DB3A 1GLEG 4H03B 4DV6K 5LY3A 3OA9A 3O9SA 1JJ2M 1BQMA 3WXLA 4DTUA 3DRSA 5AQFA 3KIOA 4CEOA 1HPZA 2GUPA 1OH6A 3K5NA 1BGXT 4FJKA 3CC4N 1A5WA 3CQXA 1TUYA 4IG0A 4BR9A 1JLAA 1VAZA 1YT3A 1IG8A 5JICA 4FYDA 3ZCMA 5HROA 4ZTFA 3MXMA 1RTDA 4Y1DA 3KLEA 2NUBA 3PIPL 1H1VA 1S22A 3C6UA 3HM8A 1HNVA 2QW9A 3PY8A 1NKCA 1C0GA 3UKUB 4PY5A 3O1WA 4RG8A 3J81O 3A5OC 3LM2A 3EZWA 1K6YA 3VQQA 3KLIA 3VPZA 2OANA 2HSTA 3AGRA 4DSJA 3H6EA 3ISNC 4DQRA 5AQVA 4DTJA 3FZLA 4C8MA 3QNNA 1QVGM 1JCGA 2CGJA 5BPLA 3ZSOA 3UE5A 2DFEA 4ILGB 4DLEA 1IBLK 4PWDA 4CJEA 4JS4A 4YY3K 5EVZA 1S1VA 3K58A 4DV2K 1NGDA 3CFOA 3ENOA 4U67L 3MN7A 1ITGA 1DGKN 1XMOK 1QQCA 3TAEA 5EXWA 4CHZA 2Q97A 3IMXA 1VRTA 5BPMA 5GAEP 2VGMA 3VESA 4JKBA 3CD6N 4IG3A 5CHIA 1RT4A 5AZJA 3AVIA 4M7YA 1QSLA 4EIAA 4CZFA 1QVFM 5AZIB 1YTUA 1EP4A 1HKGA 3S3NA 1BU6O 4ILJA 2D1KA 4IOXA 1RT5A 3EEQA 1XUPO 2F4VK 4DSIA 3FZFA 2O8BB 3HSTB 3TAFA 3CM6A 3THWA 1NK5A 3C6HA 1Q18A 2PZSA 4DR5K 1LWCA 3ULEA 1ASWA 1U4BA 3THVA 2GWJA 3VQ4A 1UA1A 1JXBA 1ASUA 3MX5A 4JK8A 4YOVA 4GV6A 5C24A 3P4IA 5LJWA 4A2BA 4QS7A 1BCOA 1R0AA 3G0ZA 1HR0K 1JLQA 4AHSA 2ZE2A 4A57A 1S6QA 1VSFA 3J80O 2HHWA 1IJJA 4AF1A 1NKBA 4DF4A 3HRGA 1NM1A 4FWOA 4CIEA 3SUOA 4CI6A 2W6KA 2EWSA 3DLKA 4GNIA 2HMPA 4FL9A 3A5LC 4B1ZA 1Y97A 4B8CA 1FK9A 4FLTA 1GLBG 1WBDA 5KPRA 1HKCA 2FF3B 1L5UA 1C0UA 2OPRA 1HRHA 3MN9A 2AP1A 5EU7A 3PO5A 1X3NA 4Z4HA 4E7KA 1YUWA 4DR7K 1SQKA 1T03A 1MWKA 4Q5VA 4CF0A 4KI4A 1GOBA 2W40A 3V9ZA 5AQGA 3U3YA 3DJCA 4AHVA 4YFUA 1P8ZA 2YJEA 1FW6A 5BR8K 4OPHA 3HOSA 1C0FA 4CEAA 4CECA 3QEWA 1XHXA 3ASMA 4EHTA 2ATQA 1BI4A 1OH8A 2OA8A 1VK0A 1QS4A 5DM6L 3T1YK 3A8YA 3CJ1A 2P9PA 1YVUA 4FWNA 4X65K 1QTMA 4G9ZA 1TL3A 4E7LA 3VEXA 1RT3A 2BTFA 4M45A 4CJ5A 2B6AA 3IFRA 3QFUA 5D3GA 4AQYK 5TKYA 1LW0A 3P1GA 4DF8A 3HI0A 3NH0A 3OYIA 4FJ7A 3LPTA 1M90O 4I7FA 3VA3A 3J7ZO 3NBPA 4DG1A 4M3TA 3ID8A 4C8KA 1ZXOA 4KO0A 1HNZK 4KH4A 3AVNA 3OBWA 4KH5A 3AVJA 3C7NB 3OJUA 3FGUA 1QHAA 4E7JA 4LD0A 5M1NA 4MLEA 2PYLA 1P90A 1JXEA 3M5RA 3ULDA 1MA9B 4IDHA 3LAKA 4OVLA 3SAHA 3AO2A 3I8BA 3ITHA 4BR0A 2NRXA 4Z94A 1EO1A 3D2EA 2ETJA 4N56A 1RDBA 3HYFA 4GV9A 4B3OA 3CHWA 1HNWK 5C10A 3K57A 4XIUA 1XI1A 3C6AA 4CESA 2E2QA 2QWLA 1W0HA 4CGIA 1JLBA 3VQ8A 4QS8A 3EZ5A 4KHNA 1BWFO 5DM7L 4FW1A 3QLHA 3AA3A 4JNEA 4CVNE 4B9TA 5KI6A 1NGIA 3UB5A 5JLFA 5H1SQ 3DOLA 5KPZA 2D0OA 3OYGA 1FKPA 2ZF5O 3AARA 3L3UA 3U4LA 4BRFA 3DLEA 5C0YA 2NNWA 2Q2RA 4ISGA 4U7BA 4AHUA 3VTIA 3AAPA 3GOIA 5AQHA 4FZXC 2O8CB 3MCPA 3PX6A 3LWLA 3MX2A 2X78A 4H8KA 3L2WA 1BUPA 1NJXA 4DFJA 2Z1HA 1TK0A 3SQ0A 3U3GA 1K8KA 3I56N 1X9MA 4I9LA 2HHQA 4JKGB 2P9UB 3SLCA 4FZZA 1MU2A 4KHWA 3SV4A 4Z4GA 3VQBA 3SAFA 5CZ1A 2X6NA 2O8FB 4BQZA 3EYZA 4PL8A 5AQXA 3VEWA 3B8AX 3NE6A 4LSNA 2G8IA 4CGGA 1SKWA 4O8KA 3SQ2A 2YNIA 4DU4A 3BZKA 2Y1IA 2F7TA 3CF5L 1L3TA 4CZKA 2O8BA 1U49A 1S9GA 3C95A 1C6VA 3TU5A 2EHGA 1LV5A 2XY6A 5CY4A 3CCVN 4E7IA 4B08A 1TAQA 3HT3A 3QERA 3O9RA 4DR2K 3JSMA 1SUQA 4GW6A 2YV0X 1DEJA 2ZGYA 2G8VA 2D0BA 1Q9XA 1C1AA 3EN9A 1OKJA 4J2AA 3CCJN 4TSXA 5KRSA 3U9DA 3N4PA 4K0KK 3LALA 3VQ7A 3THYA 2XRIA 3KD1E 2OZMA 2RE2A 4DTNA 2WOMA 4W5TA 4N76A 3HJFA 3TTDA 2XY5A 4HHTA 1YAGA 4CJQA 5AQYA 1RDCA 4NXMK 4ICLA 2GEMA 3ZSYA 4HTUA 2HHTA 1EKEA 1K8KB 5LJVA 2P9LB 2I7PA 1G99A 4IEEA 1SZ2A 3AA5X 4J2BA 1TKXA 4YHHK 3SUPA 5A2QO 4EP4A 5LL6Z 2IVOA 1ILYA 1NOZA 1TKDA 2X6SA 5DMRA 4MO5A 3O9UA 3NAEA 4BDYA 5IT9O 1X3MA 3QB0A 5GAGP 1WSHA 3FZKA 3OYFA 3LP2A 4FJ5A 3WXIA 4QOZB 4FJHA 4FW2A 3L4IA 5FPMA 5AJ3K 2P9SA 2YX6A 3A5MC 3AVCA 2A1SA 2A40A 1NGGA 3C65A 4CZJA 3I0RA 2HHHK 3E01A 2BE2A 1KXPA 3THYB 5AQTA 4B1YB 2YKMA 1NMDA 4KFBA 3THXA 3HL8A 3P39A 4RW9A 1Z26A 4BGAA 3L2UA 4DTSA 2A1RA 4W5OA 3O4WA 2VQFK 1W97L 4FWKA 4KTQA 3LP1A 3OYDA 3BF1A 1S6PA 3ZT2A 4CJ4A 4BVOA 4CJ7A 3CCRN 1A5VA 1RDUA 3HZ6A 4KREA 4CZIA 2VWKA 1X1PA 3R1XA 4C1NK 1NGAA 3WNEA 3LAMA 2A3ZA 1NLVA 4EP5A 4Z4IA 3O08A 1UWBA 3BGRA 4WE1A 2NLXA 1JKHA 5CYMA 4DV1K 2KZZA 3D6RA 3T69A 1CZAN 4FLXA 4E7HA 1VQKN 3QEXA 3TAQA 2KFNA 1BI4B 4JKEA 4CE9A 5BR9A 3ZEUA 4YOYA 4FWPA 1EX4A 3LPUA 2RPIA 4UY8O 3BUZB 1VSLA 2UXDK 4JKFA 2E88A 4KHSA 1TV6A 2G8FA 4CBXA 4M3XA 1TKTA 4IO8A 4CD3A 2WTUA 2OTJN 4CEEA 3VQ6A 4XH1A 3H45C 2F9WA 3RMDA 3M1FA 1A5XA 4M3ZA 3LDQA 4CJPA 1U6ZA 3GL1A 1WAFA 4YOUA 4KB1A 4DTXA 1B9DA 3KWGA 1TK8A 3PUFA 4KBOA 3PV8A 3F9KA 5B8HA 3C6TA 4M3YA 2F9TA 3NCIA 3ZT0A 3RWUA 1V4TA 2NRVA 1T6CA 1T7PA 2GELA 3MN5A 4DQIA 3U6FA 4Z4FA 4FWRA 3JXUA 3ZX0A 3SBGA 3IRXA 3QBWA 5BN8A 4BE0A 3NF8A 2FBXA 1OH5A 4Z4EA 2O4IA 4PKHA 5BRFA 1VQ8N 1ATRA 3FLCO 2VWBA 3AVBA 5BRDA 4JD2A 2QKBA 3SK3A 4CJWA 3E9LA 1RFQA 3I55N 3RR7A 2UXBK 4FJGA 4OLAA 4X64K 2ZJRL 5FDLA 1DTQA 1NGHA 4CIFA 4ELTA 1T8EA 1YI2N 3DLRA 2DFHA 5AQRA 4IO9L 1RGIA 3FR0A 1GLFO 4CJVA 4Z0UA 1T6DA 4IEIA 1B9FA 4JI0K 4EZ6A 4ID5A 3JYTA 4DFPA 1NJZA 3G6EN 4IZ9A 1U2VA 2DPNA 3NVKA 1KLMA 4KKOA 3WEEA 2ZQBA
chains in the Genus database with same CATH topology
1FK9A 4FLTA 2HHXA 3OYAA 4DMNA 2HVHA 1BIUA 4NYNA 1FKOA 3AVGA 5HRRA 2VG7A 3NGIA 1D5AA 1L5UA 3TABA 1C0UA 2OPRA 1Q9YA 1HRHA 3UIQA 2D5RA 4AHCA 3WNHA 4YNQA 1L3VA 5J2QA 3MEDA 5EU7A 3PX4A 3PO5A 3DYAA 4N47A 4CJLA 2OPPA 4DQQA 1ZBUA 2GUIA 1GOCA 2YNGA 4MFBA 4DWIA 2DTUA 4Z4HA 4I2QA 4E7KA 3M8QA 5HRNA 1C1CA 1TGOA 5KGXA 4CF2A 4FLYA 1T03A 4Q5VA 1CLQA 1UAXA 4CF0A 4KI4A 3LDSA 1GOBA 3HO1A 4CGJA 3OS1A 3V9ZA 3U3YA 1VSKA 1SKRA 1KVAA 4AHVA 4YFUA 5FRNA 3RRHA 3TI0A 2G8UA 3T19A 2HNYA 1HMVA 4I9QA 4FJ9A 4PUOA 4NYFA 2XY8A 2YHAA 4FJXA 1WSEA 3DI6A 3K5MA 4KHUA 4G1QA 4CEAA 4KB0A 2PY5A 4CECA 3QEWA 1XHXA 3AVMA 1KFDA 3ASMA 4ELUA 3QNOA 4CEDA 4C8NA 2BANA 3B6OA 3IG1A 3HXMA 4C8OA 2ATQA 1S1UA 3O4QA 4LH4A 1BI4A 2LSNA 3OS2A 4OKEA 4CJTA 2Y1JA 1VK0A 1QS4A 3ZSQA 3ZSWA 2OA8A 2RKIA 3ZSXA 3QEPA 3V9XA 3QESA 4E89A 3NDKA 1YVUA 3AA4A 1QTMA 2DY4A 1WNSA 1TL3A 3SYZA 3P5JA 4E7LA 3V81A 3C94A 3HP9A 4DTPA 3M8PA 1RT3A 4CIGA 1KVBA 2E6LA 3SNNA 1NJYA 1TKZA 5FROA 3SZ2A 1IG9A 4FK0A 4M45A 3T1AA 4CJ5A 3KK2A 2B6AA 3VQ9A 4ELVA 5D3GA 1U04A 1RBUA 4CGFA 2IS3A 3KLFA 1TK5A 2G8HA 1IH7A 1LW0A 3NF6A 3RRGA 4KAZA 1C1BA 4CHQA 5J1EA 4KPYA 3P1GA 1RDAA 3VQAA 3VA0A 4DF8A 1HQUA 3NH0A 3OYIA 4FJ7A 4BACA 5C25A 3LPTA 4I7FA 3CQ8A 3VA3A 1SL0A 4HUGA 3NBPA 4DG1A 5KGWA 5J2MA 4M3TA 4C8KA 1XWLA 4KO0A 4E1NA 4DTRA 5K14A 5CYQA 3AVNA 3L2VA 2VWJA 3LZJA 4NCBA 2XHBA 3AVJA 1JLFA 2VG5A 4AHRA 4FCYA 3OJUA 2D0AA 2QK9A 3OYBA 3V4IA 4DS5A 4B9MA 3TR8A 4E7JA 4LD0A 1VSHA 1KLNA 4FM0A 4O4GA 4RW6A 1RILA 2IDOA 4E1MA 3QEIA 2PYLA 1HJRA 3O3GA 1B92A 2YHBA 1JXEA 3ULDA 3DLGA 4CJUA 5SZTA 4OVLA 3LAKA 1VSEA 1IKYA 3AO2A 3WNGA 4FJMA 3ITHA 4DQSA 4DSKA 4DU1A 1NK8A 2GBZA 2KQ2A 5CZ2A 1KVCA 4O5BA 2QKKA 1N5YA 4I2PA 4FXDA 4N41A 1BL3A 2ETJA 3MXJA 4C8LA 4N56A 4FVMA 1RDBA 3HYFA 2PYJA 4CCHA 4N5SA 4B3OA 1O1WA 5HP1A 3AO4A 1VSMA 2DFFA 2B5JA 1WLJA 1RCHA 3K57A 4XIUA 1XI1A 4M42A 3NFAA 3NHGA 1XHZA 4CESA 4DSEA 4FK2A 4MQ3A 3I0SA 1WSFA 1NK6A 1W0HA 2B4JA 1BCMA 3OYCA 1F21A 5T7BA 4CGIA 1QSYA 1DLOA 1JLBA 3VQ8A 3EZ5A 4DU3A 3TAPA 3BDPA 4KHNA 4IFYA 1LW2A 4FW1A 3QLHA 4O0JA 3VQCA 4JRQA 4E0DA 2P5GA 3AA3A 1U48A 1U47A 4B9TA 4IBNA 3MEGA 4KTZA 4AH9A 5KI6A 3AO1A 3KKRA 4H4OA 3D0PA 1WSJA 2HHSA 3DOLA 4J2DA 3OYGA 4B9SA 1FKPA 2HNDA 3L3UA 3B6PA 1KRPA 1W9HA 4J2EA 1D8YA 1JL2A 3DLEA 4HUEA 1S1WA 4CHNA 3SUNA 2F96A 1QSSA 3DLBA 2ITGA 4AHUA 4CJKA 4DFKA 3IS9A 3K2PA 4FZXC 1ZBIA 3HVTA 3PX6A 1ZBLA 3AVHA 3LWLA 1BHLA 4JLHA 2X78A 3ZSRA 3V1QA 3HP6A 3MAQA 4H8KA 3L2WA 2HNZA 3V9WA 2AJQA 3L8BA 1ZBFA 2EX3A 1RTHA 3F73A 2XY7A 4DFJA 3AVKA 1NJWA 2Z1HA 1NJXA 2OPSA 5DK5A 1TK0A 4KHQA 5J2PA 3SQ0A 3U3GA 1SL1A 5HRPA 4EZ9A 1VRUA 4BDPA 1X9MA 4M3UA 2BGGA 1I39A 4I9LA 1LAVA 2HHQA 3DM2A 4HVJA 3MECA 4W5NA 3HPHA 5J2NA 4KV8A 4FZZA 1UOCA 4O0IA 4DLGA 3RMCA 1MU2A 3V9SA 3DLHA 4F8RA 4KHWA 3SV4A 4Z4GA 3VQBA 3V6DA 3PO4A 5CZ1A 3LP3A 3SI6A 3OY9A 3M8RA 3OYKA 2X6NA 4H4MA 4CJSA 2HW3A 3EYZA 2HVIA 1NOYA 3DMJA 3HPGA 4W5RA 2OYQA 3NE6A 4LSNA 2P5OA 2G8IA 4CGGA 2O4GA 4QCLA 1RT2A 3WNFA 3O4NA 2HB5A 3RMBA 1WAJA 1SKWA 3SQ2A 1WSIA 2YNIA 4B9UA 1KCFA 2IC3A 3QINA 1RT6A 4DU4A 3MEEA 2Y1IA 3SQ4A 1JLEA 4HUFA 1L3TA 2P51A 4BE2A 1U49A 3NGYA 1S9GA 2OPQA 2Z1GA 4W5QA 3C95A 1IKXA 1EETA 1BIZA 1C6VA 1Q8IA 2GV9A 4CFAA 4CJ3A 4KHYA 3HK2A 2EHGA 1LV5A 3S3MA 1HYZA 2XY6A 5CY4A 1NK9A 1RT7A 3VQEA 1D9FA 4E7IA 1ZYQA 4B08A 4CGDA 4F2SA 1TAQA 3CYMA 3HT3A 3VQDA 2YKNA 3OJSA 3QERA 3K59A 1RNHA 1QHTA 3JSMA 1SUQA 3FFIA 3AVLA 2IAJA 2YV0X 4GW6A 5HBMA 3OYJA 2BDPA 4KI6A 2YNHA 4OGEA 4HCBA 3KKSA 2KZMA 2G8VA 1RBRA 2Z1JA 2D0BA 1CZBA 4CF8A 1Q9XA 1JLGA 1EXQA 1RTJA 1C1AA 1X9WA 4BWJA 4E19A 4CK1A 5KTQA 2FC0A 2W42A 4J2AA 1C0TA 1J9AA 3SJJA 2FBVA 4TSXA 5KRSA 4BDZA 3LP0A 4CJFA 3M8SA 3CFPA 1J53A 4FJNA 3LALA 3VQ7A 3KK3A 4DSLA 1RT1A 2XRIA 3KD1E 1U45A 2QXFA 2OZMA 1TL1A 4DTNA 3ZSZA 2P1JA 3EY1A 2WOMA 4W5TA 4N76A 4FM2A 3HJFA 2HHVA 1T05A 3O3FA 3RR8A 1JL1A 1HYVA 2XY5A 4HHTA 1NK7A 3OS0A 2HHUA 4CJQA 2IOCA 1RDCA 2FBYA 3QETA 3LANA 4ICLA 1WSGA 4FLZA 4B9LA 3ZSYA 4IFVA 4CGHA 4HTUA 2HHTA 4M3RA 5C42A 1J54A 1EKEA 1LWFA 4DTOA 4K8XA 4CHPA 3AA5X 3RTVA 1SKSA 4OLBA 4Y1CA 4J2BA 5JS1A 1X9SA 1ZBHA 4OGCA 1NKEA 1TKXA 3ZT1A 1RBVA 4FLVA 3SUPA 2G8KA 4F2RA 4EP4A 1KSPA 2KFZA 1HYSA 2RF2A 4M3XA 4ID1A 3K5LA 1YTAA 4CJRA 1NOZA 1TKDA 4OPJA 2X6SA 4CF9A 3DOKA 1C0MA 3ZSVA 2G8WA 5HLFA 4OPKA 2KTQA 3V9UA 5DMRA 2XO7A 3CFRA 3P83D 2JLEA 3NAEA 4BDYA 4FLUA 3DRRA 1WSHA 3OYFA 3LP2A 4FJ5A 4QOZB 3OVNA 4FW2A 4RW4A 4FJHA 4OJRA 4QAGA 4PA1A 3AVCA 3K5OA 4O44A 4CFBA 2A1SA 3SPZA 4PQUA 1HQEA 4FJLA 1N6QA 3I0RA 3LWMA 4F4KA 3E01A 2BE2A 3CG7A 3QIOA 3NF7A 4NCGA 4CERA 3SV3A 2YKMA 4FM1A 4RW7A 5SWMA 4KFBA 1IO2A 4F3OA 3ALYA 3HPOA 2D0CA 1I3AA 3HL8A 3KJVA 4FJ8A 2F8SA 4Q0BA 3SCXA 1S1XA 4RW9A 3OYMA 3PX0A 1Z26A 4UQGA 3L2UA 1LAWA 4DTSA 4DFMA 1ASVA 2A1RA 3NH1A 2Z1IA 1D9DA 4OKJA 4W5OA 2RN2A 1BQMA 3HVRA 1KFSA 4DTUA 3DRSA 3QEVA 4KTQA 3LP1A 3KIOA 3OYDA 4CEOA 1HPZA 1S6PA 3ZT2A 4CJ4A 1FXXA 4L8RB 4CEBA 1A5VA 2IGIA 3CM5A 4CEFA 3TARA 4B8AB 3K5NA 4F3TA 4CFCA 4KREA 5E41A 4ZTJA 3SQ1A 3KK1A 1BGXT 2YNFA 4FJKA 2E6MA 3V1RA 3OYEA 1RBSA 2ZD1A 1A5WA 5I42A 2VWKA 1X1PA 1RTIA 3AO5A 1CXQA 4IG0A 1JLAA 1YT3A 3WNEA 2E4LA 1VSJA 3AV9A 3TWHA 3ZCMA 3LAMA 5HROA 4FYDA 4ZTFA 5FRMA 3VN5A 3MXMA 4CHYA 1RTDA 4Y1DA 3KLEA 4EP5A 2NUBA 4CFDA 1UWBA 3BGRA 4WE1A 3O3HA 3TANA 3ZT3A 4DS4A 4Z4IA 3C6UA 1JKHA 5CYMA 4FZYA 2KZZA 3TAMA 4CK3A 1HNVA 4JRPA 3QIPA 4FLXA 3PY8A 1RBTA 2Q3SA 3RMAA 4E7HA 1NKCA 3H08A 3NGZA 4K8ZA 3QEXA 3NH2A 3TAQA 1BI4B 3MXIA 4CE9A 4PY5A 2KFNA 4RG8A 4RW8A 4IKFA 2KW4A 1EX4A 1GOAA 3OYLA 1CXUA 4E3SA 1K6YA 3VQQA 3LPUA 1IKWA 2FBTA 2RPIA 3KLIA 1HNIA 1REVA 3G10A 4BE1A 1VSIA 4DSJA 1VSLA 3ZT4A 4O55A 3ISNC 4R5PA 4DQRA 1WN7A 4KHSA 1TV6A 3A2FA 4DTJA 4C8MA 3QNNA 3I8DA 2G8FA 1TKTA 3OYHA 2HMIA 3ZSOA 4PWDA 2DFEA 4DLEA 4HCCA 4CEEA 1BQNA 3VQ6A 4CJEA 4JS4A 2WONA 1RDDA 1S1VA 3K58A 3RMDA 3CFOA 4LY7A 1A5XA 3L2RA 4M3ZA 1ITGA 4LSLA 3KTQA 2I5JA 4CJPA 1WAFA 1QQCA 4Z4CA 3TAEA 4KB1A 4CHZA 4GVMA 1TVRA 4KTWA 1VRTA 1JLCA 1LWEA 4DTXA 1NK4A 4B8CA 1B9DA 3L2QA 1TK8A 4IDKA 3PUFA 4ZHRA 4IG3A 3PV8A 4AHTA 3F9KA 1RT4A 3C6TA 5KRTA 3AVIA 4M3YA 3LZIA 1UA0A 1QSLA 3NCIA 4KKOA 3ZT0A 1CZ9A 4CEZA 3RWUA 4B9VA 1YTUA 3S9HA 4FJJA 3AO3A 1EP4A 2OZSA 5JS2A 3KLGA 3KLHA 1T7PA 3S3NA 3L3VA 1XC9A 4JS5A 4DQIA 3U6FA 4Z4FA 3AA2A 1QE1A 2JGUA 1RT5A 1S5JA 4LH5A 3IRXA 4BE0A 1BISA 3AVFA 3NF8A 2FBXA 4CHOA 4DSIA 4Z4EA 2O4IA 4BWMA 3HSTB 4FLWA 2X74A 3TAFA 3CM6A 1Z25A 4CF1A 1NK5A 4M3WA 3AVBA 2F8TA 3QO9A 2QKBA 4CK2A 3S3OA 1S9EA 4M41A 1DTTA 3VQPA 3OYNA 2PZSA 4CJWA 1LWCA 3V1OA 1ASWA 4AILC 1L3UA 1U4BA 3THVA 3RR7A 3SPYA 3VQ4A 4FJGA 1UA1A 4OLAA 1J5OA 1G15A 1JXBA 1ASUA 5FDLA 4B9NA 1DTQA 4CIFA 3IAYA 4ELTA 1T8EA 1KTQA 5I3UA 4FK4A 5C24A 3DRPA 1NK0A 3DLRA 4CEQA 4NCAA 1IKVA 2R7YA 2DFHA 1S1TA 4OKKA 1L3SA 3D45A 3HM9A 4GMJB 1BCOA 1VSDA 1R0AA 1SV5A 2VG6A 3G0ZA 4DSFA 1TAUA 1JLQA 4AHSA 2ZE2A 4FJIA 3NF9A 1S6QA 1VSFA 4Z0UA 4CJVA 1SL2A 2HHWA 1NKBA 4DF4A 3SUQA 1B9FA 4DQPA 4DTMA 4CIEA 3SUOA 4EZ6A 4ID5A 3JYTA 4DFPA 1NJZA 4KRFA 5HRSA 3DLKA 3VQ5A 1KLMA 3AVAA 1Y97A 3KD5E 3TAGA 2ZQBA 3T3FA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FK9 A;  4FLT A;  2HHX A;  3OYA A;  4DMN A;  2HVH A;  1BIU A;  4NYN A;  1FKO A;  3AVG A;  5HRR A;  2VG7 A;  3NGI A;  1D5A A;  1L5U A;  3TAB A;  1C0U A;  2OPR A;  1Q9Y A;  1HRH A;  3UIQ A;  2D5R A;  4AHC A;  3WNH A;  4YNQ A;  1L3V A;  5J2Q A;  3MED A;  5EU7 A;  3PX4 A;  3PO5 A;  3DYA A;  4N47 A;  4CJL A;  2OPP A;  4DQQ A;  1ZBU A;  2GUI A;  1GOC A;  2YNG A;  4MFB A;  4DWI A;  2DTU A;  4Z4H A;  4I2Q A;  4E7K A;  3M8Q A;  5HRN A;  1C1C A;  1TGO A;  5KGX A;  4CF2 A;  4FLY A;  1T03 A;  4Q5V A;  1CLQ A;  1UAX A;  4CF0 A;  4KI4 A;  3LDS A;  1GOB A;  3HO1 A;  4CGJ A;  3OS1 A;  3V9Z A;  3U3Y A;  1VSK A;  1SKR A;  1KVA A;  4AHV A;  4YFU A;  5FRN A;  3RRH A;  3TI0 A;  2G8U A;  3T19 A;  2HNY A;  1HMV A;  4I9Q A;  4FJ9 A;  4PUO A;  4NYF A;  2XY8 A;  2YHA A;  4FJX A;  1WSE A;  3DI6 A;  3K5M A;  4KHU A;  4G1Q A;  4CEA A;  4KB0 A;  2PY5 A;  4CEC A;  3QEW A;  1XHX A;  3AVM A;  1KFD A;  3ASM A;  4ELU A;  3QNO A;  4CED A;  4C8N A;  2BAN A;  3B6O A;  3IG1 A;  3HXM A;  4C8O A;  2ATQ A;  1S1U A;  3O4Q A;  4LH4 A;  1BI4 A;  2LSN A;  3OS2 A;  4OKE A;  4CJT A;  2Y1J A;  1VK0 A;  1QS4 A;  3ZSQ A;  3ZSW A;  2OA8 A;  2RKI A;  3ZSX A;  3QEP A;  3V9X A;  3QES A;  4E89 A;  3NDK A;  1YVU A;  3AA4 A;  1QTM A;  2DY4 A;  1WNS A;  1TL3 A;  3SYZ A;  3P5J A;  4E7L A;  3V81 A;  3C94 A;  3HP9 A;  4DTP A;  3M8P A;  1RT3 A;  4CIG A;  1KVB A;  2E6L A;  3SNN A;  1NJY A;  1TKZ A;  5FRO A;  3SZ2 A;  1IG9 A;  4FK0 A;  4M45 A;  3T1A A;  4CJ5 A;  3KK2 A;  2B6A A;  3VQ9 A;  4ELV A;  5D3G A;  1U04 A;  1RBU A;  4CGF A;  2IS3 A;  3KLF A;  1TK5 A;  2G8H A;  1IH7 A;  1LW0 A;  3NF6 A;  3RRG A;  4KAZ A;  1C1B A;  4CHQ A;  5J1E A;  4KPY A;  3P1G A;  1RDA A;  3VQA A;  3VA0 A;  4DF8 A;  1HQU A;  3NH0 A;  3OYI A;  4FJ7 A;  4BAC A;  5C25 A;  3LPT A;  4I7F A;  3CQ8 A;  3VA3 A;  1SL0 A;  4HUG A;  3NBP A;  4DG1 A;  5KGW A;  5J2M A;  4M3T A;  4C8K A;  1XWL A;  4KO0 A;  4E1N A;  4DTR A;  5K14 A;  5CYQ A;  3AVN A;  3L2V A;  2VWJ A;  3LZJ A;  4NCB A;  2XHB A;  3AVJ A;  1JLF A;  2VG5 A;  4AHR A;  4FCY A;  3OJU A;  2D0A A;  2QK9 A;  3OYB A;  3V4I A;  4DS5 A;  4B9M A;  3TR8 A;  4E7J A;  4LD0 A;  1VSH A;  1KLN A;  4FM0 A;  4O4G A;  4RW6 A;  1RIL A;  2IDO A;  4E1M A;  3QEI A;  2PYL A;  1HJR A;  3O3G A;  1B92 A;  2YHB A;  1JXE A;  3ULD A;  3DLG A;  4CJU A;  5SZT A;  4OVL A;  3LAK A;  1VSE A;  1IKY A;  3AO2 A;  3WNG A;  4FJM A;  3ITH A;  4DQS A;  4DSK A;  4DU1 A;  1NK8 A;  2GBZ A;  2KQ2 A;  5CZ2 A;  1KVC A;  4O5B A;  2QKK A;  1N5Y A;  4I2P A;  4FXD A;  4N41 A;  1BL3 A;  2ETJ A;  3MXJ A;  4C8L A;  4N56 A;  4FVM A;  1RDB A;  3HYF A;  2PYJ A;  4CCH A;  4N5S A;  4B3O A;  1O1W A;  5HP1 A;  3AO4 A;  1VSM A;  2DFF A;  2B5J A;  1WLJ A;  1RCH A;  3K57 A;  4XIU A;  1XI1 A;  4M42 A;  3NFA A;  3NHG A;  1XHZ A;  4CES A;  4DSE A;  4FK2 A;  4MQ3 A;  3I0S A;  1WSF A;  1NK6 A;  1W0H A;  2B4J A;  1BCM A;  3OYC A;  1F21 A;  5T7B A;  4CGI A;  1QSY A;  1DLO A;  1JLB A;  3VQ8 A;  3EZ5 A;  4DU3 A;  3TAP A;  3BDP A;  4KHN A;  4IFY A;  1LW2 A;  4FW1 A;  3QLH A;  4O0J A;  3VQC A;  4JRQ A;  4E0D A;  2P5G A;  3AA3 A;  1U48 A;  1U47 A;  4B9T A;  4IBN A;  3MEG A;  4KTZ A;  4AH9 A;  5KI6 A;  3AO1 A;  3KKR A;  4H4O A;  3D0P A;  1WSJ A;  2HHS A;  3DOL A;  4J2D A;  3OYG A;  4B9S A;  1FKP A;  2HND A;  3L3U A;  3B6P A;  1KRP A;  1W9H A;  4J2E A;  1D8Y A;  1JL2 A;  3DLE A;  4HUE A;  1S1W A;  4CHN A;  3SUN A;  2F96 A;  1QSS A;  3DLB A;  2ITG A;  4AHU A;  4CJK A;  4DFK A;  3IS9 A;  3K2P A;  4FZX C;  1ZBI A;  3HVT A;  3PX6 A;  1ZBL A;  3AVH A;  3LWL A;  1BHL A;  4JLH A;  2X78 A;  3ZSR A;  3V1Q A;  3HP6 A;  3MAQ A;  4H8K A;  3L2W A;  2HNZ A;  3V9W A;  2AJQ A;  3L8B A;  1ZBF A;  2EX3 A;  1RTH A;  3F73 A;  2XY7 A;  4DFJ A;  3AVK A;  1NJW A;  2Z1H A;  1NJX A;  2OPS A;  5DK5 A;  1TK0 A;  4KHQ A;  5J2P A;  3SQ0 A;  3U3G A;  1SL1 A;  5HRP A;  4EZ9 A;  1VRU A;  4BDP A;  1X9M A;  4M3U A;  2BGG A;  1I39 A;  4I9L A;  1LAV A;  2HHQ A;  3DM2 A;  4HVJ A;  3MEC A;  4W5N A;  3HPH A;  5J2N A;  4KV8 A;  4FZZ A;  1UOC A;  4O0I A;  4DLG A;  3RMC A;  1MU2 A;  3V9S A;  3DLH A;  4F8R A;  4KHW A;  3SV4 A;  4Z4G A;  3VQB A;  3V6D A;  3PO4 A;  5CZ1 A;  3LP3 A;  3SI6 A;  3OY9 A;  3M8R A;  3OYK A;  2X6N A;  4H4M A;  4CJS A;  2HW3 A;  3EYZ A;  2HVI A;  1NOY A;  3DMJ A;  3HPG A;  4W5R A;  2OYQ A;  3NE6 A;  4LSN A;  2P5O A;  2G8I A;  4CGG A;  2O4G A;  4QCL A;  1RT2 A;  3WNF A;  3O4N A;  2HB5 A;  3RMB A;  1WAJ A;  1SKW A;  3SQ2 A;  1WSI A;  2YNI A;  4B9U A;  1KCF A;  2IC3 A;  3QIN A;  1RT6 A;  4DU4 A;  3MEE A;  2Y1I A;  3SQ4 A;  1JLE A;  4HUF A;  1L3T A;  2P51 A;  4BE2 A;  1U49 A;  3NGY A;  1S9G A;  2OPQ A;  2Z1G A;  4W5Q A;  3C95 A;  1IKX A;  1EET A;  1BIZ A;  1C6V A;  1Q8I A;  2GV9 A;  4CFA A;  4CJ3 A;  4KHY A;  3HK2 A;  2EHG A;  1LV5 A;  3S3M A;  1HYZ A;  2XY6 A;  5CY4 A;  1NK9 A;  1RT7 A;  3VQE A;  1D9F A;  4E7I A;  1ZYQ A;  4B08 A;  4CGD A;  4F2S A;  1TAQ A;  3CYM A;  3HT3 A;  3VQD A;  2YKN A;  3OJS A;  3QER A;  3K59 A;  1RNH A;  1QHT A;  3JSM A;  1SUQ A;  3FFI A;  3AVL A;  2IAJ A;  2YV0 X;  4GW6 A;  5HBM A;  3OYJ A;  2BDP A;  4KI6 A;  2YNH A;  4OGE A;  4HCB A;  3KKS A;  2KZM A;  2G8V A;  1RBR A;  2Z1J A;  2D0B A;  1CZB A;  4CF8 A;  1Q9X A;  1JLG A;  1EXQ A;  1RTJ A;  1C1A A;  1X9W A;  4BWJ A;  4E19 A;  4CK1 A;  5KTQ A;  2FC0 A;  2W42 A;  4J2A A;  1C0T A;  1J9A A;  3SJJ A;  2FBV A;  4TSX A;  5KRS A;  4BDZ A;  3LP0 A;  4CJF A;  3M8S A;  3CFP A;  1J53 A;  4FJN A;  3LAL A;  3VQ7 A;  3KK3 A;  4DSL A;  1RT1 A;  2XRI A;  3KD1 E;  1U45 A;  2QXF A;  2OZM A;  1TL1 A;  4DTN A;  3ZSZ A;  2P1J A;  3EY1 A;  2WOM A;  4W5T A;  4N76 A;  4FM2 A;  3HJF A;  2HHV A;  1T05 A;  3O3F A;  3RR8 A;  1JL1 A;  1HYV A;  2XY5 A;  4HHT A;  1NK7 A;  3OS0 A;  2HHU A;  4CJQ A;  2IOC A;  1RDC A;  2FBY A;  3QET A;  3LAN A;  4ICL A;  1WSG A;  4FLZ A;  4B9L A;  3ZSY A;  4IFV A;  4CGH A;  4HTU A;  2HHT A;  4M3R A;  5C42 A;  1J54 A;  1EKE A;  1LWF A;  4DTO A;  4K8X A;  4CHP A;  3AA5 X;  3RTV A;  1SKS A;  4OLB A;  4Y1C A;  4J2B A;  5JS1 A;  1X9S A;  1ZBH A;  4OGC A;  1NKE A;  1TKX A;  3ZT1 A;  1RBV A;  4FLV A;  3SUP A;  2G8K A;  4F2R A;  4EP4 A;  1KSP A;  2KFZ A;  1HYS A;  2RF2 A;  4M3X A;  4ID1 A;  3K5L A;  1YTA A;  4CJR A;  1NOZ A;  1TKD A;  4OPJ A;  2X6S A;  4CF9 A;  3DOK A;  1C0M A;  3ZSV A;  2G8W A;  5HLF A;  4OPK A;  2KTQ A;  3V9U A;  5DMR A;  2XO7 A;  3CFR A;  3P83 D;  2JLE A;  3NAE A;  4BDY A;  4FLU A;  3DRR A;  1WSH A;  3OYF A;  3LP2 A;  4FJ5 A;  4QOZ B;  3OVN A;  4FW2 A;  4RW4 A;  4FJH A;  4OJR A;  4QAG A;  4PA1 A;  3AVC A;  3K5O A;  4O44 A;  4CFB A;  2A1S A;  3SPZ A;  4PQU A;  1HQE A;  4FJL A;  1N6Q A;  3I0R A;  3LWM A;  4F4K A;  3E01 A;  2BE2 A;  3CG7 A;  3QIO A;  3NF7 A;  4NCG A;  4CER A;  3SV3 A;  2YKM A;  4FM1 A;  4RW7 A;  5SWM A;  4KFB A;  1IO2 A;  4F3O A;  3ALY A;  3HPO A;  2D0C A;  1I3A A;  3HL8 A;  3KJV A;  4FJ8 A;  2F8S A;  4Q0B A;  3SCX A;  1S1X A;  4RW9 A;  3OYM A;  3PX0 A;  1Z26 A;  4UQG A;  3L2U A;  1LAW A;  4DTS A;  4DFM A;  1ASV A;  2A1R A;  3NH1 A;  2Z1I A;  1D9D A;  4OKJ A;  4W5O A;  2RN2 A;  1BQM A;  3HVR A;  1KFS A;  4DTU A;  3DRS A;  3QEV A;  4KTQ A;  3LP1 A;  3KIO A;  3OYD A;  4CEO A;  1HPZ A;  1S6P A;  3ZT2 A;  4CJ4 A;  1FXX A;  4L8R B;  4CEB A;  1A5V A;  2IGI A;  3CM5 A;  4CEF A;  3TAR A;  4B8A B;  3K5N A;  4F3T A;  4CFC A;  4KRE A;  5E41 A;  4ZTJ A;  3SQ1 A;  3KK1 A;  1BGX T;  2YNF A;  4FJK A;  2E6M A;  3V1R A;  3OYE A;  1RBS A;  2ZD1 A;  1A5W A;  5I42 A;  2VWK A;  1X1P A;  1RTI A;  3AO5 A;  1CXQ A;  4IG0 A;  1JLA A;  1YT3 A;  3WNE A;  2E4L A;  1VSJ A;  3AV9 A;  3TWH A;  3ZCM A;  3LAM A;  5HRO A;  4FYD A;  4ZTF A;  5FRM A;  3VN5 A;  3MXM A;  4CHY A;  1RTD A;  4Y1D A;  3KLE A;  4EP5 A;  2NUB A;  4CFD A;  1UWB A;  3BGR A;  4WE1 A;  3O3H A;  3TAN A;  3ZT3 A;  4DS4 A;  4Z4I A;  3C6U A;  1JKH A;  5CYM A;  4FZY A;  2KZZ A;  3TAM A;  4CK3 A;  1HNV A;  4JRP A;  3QIP A;  4FLX A;  3PY8 A;  1RBT A;  2Q3S A;  3RMA A;  4E7H A;  1NKC A;  3H08 A;  3NGZ A;  4K8Z A;  3QEX A;  3NH2 A;  3TAQ A;  1BI4 B;  3MXI A;  4CE9 A;  4PY5 A;  2KFN A;  4RG8 A;  4RW8 A;  4IKF A;  2KW4 A;  1EX4 A;  1GOA A;  3OYL A;  1CXU A;  4E3S A;  1K6Y A;  3VQQ A;  3LPU A;  1IKW A;  2FBT A;  2RPI A;  3KLI A;  1HNI A;  1REV A;  3G10 A;  4BE1 A;  1VSI A;  4DSJ A;  1VSL A;  3ZT4 A;  4O55 A;  3ISN C;  4R5P A;  4DQR A;  1WN7 A;  4KHS A;  1TV6 A;  3A2F A;  4DTJ A;  4C8M A;  3QNN A;  3I8D A;  2G8F A;  1TKT A;  3OYH A;  2HMI A;  3ZSO A;  4PWD A;  2DFE A;  4DLE A;  4HCC A;  4CEE A;  1BQN A;  3VQ6 A;  4CJE A;  4JS4 A;  2WON A;  1RDD A;  1S1V A;  3K58 A;  3RMD A;  3CFO A;  4LY7 A;  1A5X A;  3L2R A;  4M3Z A;  1ITG A;  4LSL A;  3KTQ A;  2I5J A;  4CJP A;  1WAF A;  1QQC A;  4Z4C A;  3TAE A;  4KB1 A;  4CHZ A;  4GVM A;  1TVR A;  4KTW A;  1VRT A;  1JLC A;  1LWE A;  4DTX A;  1NK4 A;  4B8C A;  1B9D A;  3L2Q A;  1TK8 A;  4IDK A;  3PUF A;  4ZHR A;  4IG3 A;  3PV8 A;  4AHT A;  3F9K A;  1RT4 A;  3C6T A;  5KRT A;  3AVI A;  4M3Y A;  3LZI A;  1UA0 A;  1QSL A;  3NCI A;  4KKO A;  3ZT0 A;  1CZ9 A;  4CEZ A;  3RWU A;  4B9V A;  1YTU A;  3S9H A;  4FJJ A;  3AO3 A;  1EP4 A;  2OZS A;  5JS2 A;  3KLG A;  3KLH A;  1T7P A;  3S3N A;  3L3V A;  1XC9 A;  4JS5 A;  4DQI A;  3U6F A;  4Z4F A;  3AA2 A;  1QE1 A;  2JGU A;  1RT5 A;  1S5J A;  4LH5 A;  3IRX A;  4BE0 A;  1BIS A;  3AVF A;  3NF8 A;  2FBX A;  4CHO A;  4DSI A;  4Z4E A;  2O4I A;  4BWM A;  3HST B;  4FLW A;  2X74 A;  3TAF A;  3CM6 A;  1Z25 A;  4CF1 A;  1NK5 A;  4M3W A;  3AVB A;  2F8T A;  3QO9 A;  2QKB A;  4CK2 A;  3S3O A;  1S9E A;  4M41 A;  1DTT A;  3VQP A;  3OYN A;  2PZS A;  4CJW A;  1LWC A;  3V1O A;  1ASW A;  4AIL C;  1L3U A;  1U4B A;  3THV A;  3RR7 A;  3SPY A;  3VQ4 A;  4FJG A;  1UA1 A;  4OLA A;  1J5O A;  1G15 A;  1JXB A;  1ASU A;  5FDL A;  4B9N A;  1DTQ A;  4CIF A;  3IAY A;  4ELT A;  1T8E A;  1KTQ A;  5I3U A;  4FK4 A;  5C24 A;  3DRP A;  1NK0 A;  3DLR A;  4CEQ A;  4NCA A;  1IKV A;  2R7Y A;  2DFH A;  1S1T A;  4OKK A;  1L3S A;  3D45 A;  3HM9 A;  4GMJ B;  1BCO A;  1VSD A;  1R0A A;  1SV5 A;  2VG6 A;  3G0Z A;  4DSF A;  1TAU A;  1JLQ A;  4AHS A;  2ZE2 A;  4FJI A;  3NF9 A;  1S6Q A;  1VSF A;  4Z0U A;  4CJV A;  1SL2 A;  2HHW A;  1NKB A;  4DF4 A;  3SUQ A;  1B9F A;  4DQP A;  4DTM A;  4CIE A;  3SUO A;  4EZ6 A;  4ID5 A;  3JYT A;  4DFP A;  1NJZ A;  4KRF A;  5HRS A;  3DLK A;  3VQ5 A;  1KLM A;  3AVA A;  1Y97 A;  3KD5 E;  3TAG A;  2ZQB A;  3T3F A; 
#chains in the Genus database with same CATH topology
 2HHX A;  2QM1 A;  4H5W A;  4DR6 K;  3R8E A;  4NYN A;  1NNE A;  3AVG A;  1GLL O;  4JN4 A;  3NGI A;  5AQM A;  1QQN A;  2D5R A;  2YHY A;  3MED A;  2WUS A;  4JHD B;  2NZT A;  2OPP A;  5AQO A;  2GUI A;  1GOC A;  2O8D A;  2DTU A;  4I2Q A;  3M8Q A;  5HRN A;  1QQM A;  4PKI A;  1TGO A;  2UYT A;  4JKG A;  4JI2 K;  4CF2 A;  1UAX A;  5F0X A;  1KVA A;  3WQU A;  3K0S A;  1HMV A;  1VQM N;  2XY8 A;  2YHA A;  3UKR A;  4FJX A;  1YXQ A;  3DI6 A;  3LDL A;  4H0O A;  1KAZ A;  4MDA A;  1KFD A;  3L6Q A;  3B6O A;  3H1Q A;  4XH5 A;  5M1K A;  3ZLJ A;  4LF4 K;  4C8O A;  2V7Y A;  1S1U A;  3O4Q A;  2LSN A;  1GLJ O;  4OKE A;  3UKU A;  2BUP A;  4DCH A;  2RKI A;  3QEP A;  3AA4 A;  3VGK A;  5FPN A;  2DY4 A;  3V81 A;  3P5J A;  4JI5 K;  3C94 A;  4DTP A;  4K43 A;  3EE8 A;  3M8P A;  1KVB A;  2E6L A;  5GIO A;  5JMV A;  2P9I A;  3SNN A;  1TKZ A;  5FRO A;  3SZ2 A;  1IG9 A;  3T1A A;  3KK2 A;  2G8H A;  3CXC M;  3RRG A;  2Q31 A;  1C1B A;  3WXJ A;  4CHQ A;  3VA0 A;  1HQU A;  4BAC A;  5C25 A;  3CME N;  4BRA A;  3SMP A;  2P9N A;  4H5R A;  4JI7 K;  2WFB A;  5F2R A;  5K14 A;  3L2V A;  2VWJ A;  3LZJ A;  4NCB A;  1JLF A;  4FCY A;  3N4Q A;  5GIP A;  3K9J A;  2ZGZ A;  2QK9 A;  1KLN A;  2P9K A;  1VSH A;  4FM0 A;  1XQS C;  4WQ4 A;  2IDO A;  4E1M A;  1HJR A;  3O3G A;  2YHB A;  4DV5 K;  4NO7 A;  3DLG A;  1YJW N;  4CZG A;  3CMA N;  4DQS A;  4DU1 A;  1NK8 A;  2GBZ A;  2W41 A;  4DUY K;  4FXD A;  2QWN A;  2D4W A;  4FVM A;  4CCH A;  3AO4 A;  2B5J A;  1WLJ A;  1NG9 A;  4M42 A;  3NFA A;  4K42 A;  5AQL A;  4MQ3 A;  1WSF A;  2B4J A;  3OYC A;  1QSY A;  4JV5 K;  1DLO A;  3E9O A;  3BDP A;  4IFY A;  3F2K A;  1VQN N;  3VQC A;  1U48 A;  2A42 A;  4AH9 A;  4IJN A;  4H0Y B;  3AO1 A;  4H4O A;  1QZ6 A;  2HHS A;  2HND A;  4O5F A;  5LMU K;  1KRP A;  1W9H A;  3IUC A;  1HNX K;  3TSP A;  4CJK A;  3GBT A;  4DQ8 A;  1ZBI A;  5BRH A;  1RDW X;  5CE3 A;  2PY5 A;  3CIP A;  1ZBF A;  3VTH A;  3F73 A;  2XY7 A;  2OPS A;  4EZ9 A;  1VRU A;  4DV0 K;  4FWL A;  1W7A A;  2ASM A;  1I39 A;  2VGN A;  4FWQ A;  1VQL N;  5J2N A;  1SAZ A;  4O0I A;  2Q36 A;  4EFH A;  3V9S A;  3DLH A;  4JKA A;  1D4X A;  3FZM A;  3LP3 A;  3SI6 A;  3VEV A;  3TPQ A;  3M8R A;  4CJS A;  4BRE A;  4EHU A;  4HTL A;  4H0X B;  2P5O A;  1ATN A;  2QTD A;  3ZX3 A;  2IVN A;  4BRC A;  2O8D B;  4CZE A;  1KCF A;  2IC3 A;  4GV3 A;  3MEE A;  2CGL A;  2HOE A;  2P51 A;  3BEX A;  2O8E A;  2Z1G A;  4FLV A;  1EET A;  2YI1 A;  1VQ9 N;  3H3N O;  4LF5 K;  3HK2 A;  3S3M A;  1EWR A;  5AR0 A;  2NRZ A;  2QEX N;  4CGD A;  3CYM A;  3VQD A;  2YKN A;  3NVM A;  1ZBS A;  3FFI A;  2IAJ A;  2YNH A;  3DXK B;  3SMS A;  1RBR A;  2Z1J A;  3DXM B;  1CZB A;  1N32 K;  1XC3 A;  4BWJ A;  4E19 A;  2FC0 A;  1C0T A;  3SJJ A;  4IJA A;  2CH5 A;  3M8S A;  4WCE L;  3KK3 A;  2O8F A;  4F9O A;  2QXL A;  3ID6 A;  5ADX A;  2P1J A;  4FM2 A;  1JL1 A;  4R79 A;  4BVP A;  2HHU A;  2CH6 A;  2FBY A;  2E5L K;  3LAN A;  1DT9 A;  4FLZ A;  4B9L A;  1SS6 A;  1LWF A;  4IXC A;  3CCQ N;  3BF3 A;  3MWT A;  1X9S A;  4OGC A;  1NKE A;  1RBV A;  3ZYY X;  2G8K A;  4RWT A;  1VQ5 N;  3KVG A;  2RF2 A;  3K5L A;  5FLX O;  4OPJ A;  2FSN A;  2WC9 A;  3QIC A;  4CF9 A;  2G8W A;  5M1F A;  4B9Q A;  4B1V A;  2XO7 A;  1LCU A;  3DRR A;  1KC8 O;  4LFC K;  3IDH A;  4PA1 A;  3QFP A;  3K5O A;  4JI4 K;  3MMV A;  1HQE A;  3VOV A;  1XNQ K;  2OTL N;  5JVH L;  3LWM A;  5EY4 A;  4BC5 A;  3NF7 A;  4CER A;  1E3M A;  3HBT A;  4H5N A;  3VEO A;  4IWV A;  4RW7 A;  4FM1 A;  2V51 B;  5SWM A;  4OO1 J;  3ALY A;  3HPO A;  2D0C A;  1S72 N;  3CC2 N;  1I3A A;  4H0P A;  4FJ8 A;  4FSV A;  3Q7B A;  3SCX A;  1S1X A;  3PX0 A;  5KQ8 A;  3WXK A;  1ASV A;  1D9D A;  2Z1I A;  2RN2 A;  4KHP K;  3H3O B;  3HVR A;  1YIT N;  3QEV A;  4JI1 K;  4FOE A;  4B3R K;  4L8R B;  1JCE A;  4CEB A;  3TAR A;  4CEF A;  4B8A B;  1YF5 L;  3O8M A;  3RSE A;  4F3T A;  4CFC A;  1X9J A;  2VYP A;  5E41 A;  3KK1 A;  2YHW A;  4JYA K;  2E6M A;  3OYE A;  1HPM A;  1RBS A;  3LM9 A;  1RTI A;  3AO5 A;  1CXQ A;  3TWH A;  3VN5 A;  1Z05 A;  3U8X A;  4B1X B;  3TAN A;  3VGM A;  3O3H A;  3ZT3 A;  2J4R A;  3E9P A;  4J8F A;  3TAM A;  4JRP A;  3QIP A;  1RBT A;  3L0Q A;  2Q3S A;  3NGZ A;  1OH7 A;  3HOT A;  3WQT A;  4E3S A;  1CXU A;  3ZET B;  3ZET A;  4BE1 A;  3O9Q A;  1IKW A;  2FBT A;  1YJN N;  1HNI A;  1REV A;  3G10 A;  2OCE A;  1VSI A;  5AQN A;  2V52 B;  4O55 A;  4R5P A;  1WN7 A;  2ASO A;  4C23 A;  4HCC A;  1BQN A;  4A62 A;  1RDD A;  4H5V A;  1V4S A;  1BA0 A;  4LSL A;  3KTQ A;  5AQK A;  4Z4C A;  2VQE K;  5JVG L;  3PLA A;  1TVR A;  4KTW A;  1JLC A;  1LWE A;  3J7Y P;  3L2Q A;  4ZHR A;  4BRN A;  4AHT A;  3AGK A;  4ISF A;  4K25 A;  5KRT A;  3BP8 A;  3LZI A;  1UA0 A;  1CZ9 A;  4LF7 K;  2RHK A;  3E66 A;  3AO3 A;  4RTF D;  2OZS A;  3KLG A;  3DAW A;  4JS5 A;  3ATU A;  2HBK A;  3EL2 A;  1GLC G;  1BIS A;  3AVF A;  4BRI A;  4BWM A;  4FLW A;  3M6G A;  4CK2 A;  4M41 A;  3VQP A;  1EQY A;  2UUA K;  1YIJ N;  3V1O A;  4AIL C;  1L3U A;  3SPY A;  4BC2 A;  1J5O A;  1KAY A;  1OVQ A;  1KQS M;  4I6M A;  1BOT O;  5I3U A;  3L4Q A;  1NWK A;  3K9K A;  2R7Y A;  4NCA A;  1S1T A;  2QI2 A;  3HM9 A;  4GMJ B;  1VSD A;  1SV5 A;  2VG6 A;  1TAU A;  4YDU C;  4FJI A;  5BPN A;  4NXN K;  4FO0 A;  3SUQ A;  4DQP A;  4DTM A;  3DXM A;  4O8U A;  5HRS A;  4KRF A;  3WUH A;  3VQ5 A;  2E8A A;  2E20 A;  3TAG A;  3T3F A;  3OYA A;  4DMN A;  3CJ9 A;  4BR4 A;  3O80 A;  5HRR A;  2AA4 A;  5F1X A;  3UIQ A;  4QS9 A;  5M1O A;  3RVC A;  4CJL A;  2CGK A;  4GKJ K;  1ZBU A;  4DWI A;  4DV3 K;  2YNG A;  4MFB A;  1C1C A;  2P9P B;  4A2A A;  4BRL A;  1HUX A;  5KGX A;  2NRT A;  4FLY A;  4CGJ A;  4JK7 A;  4JI6 K;  4V19 S;  1VSK A;  1HJO A;  3ENH A;  2HNY A;  4JEP A;  4I9Q A;  4FJ9 A;  4NYF A;  3R9P A;  3DLL L;  5KPT A;  1WSE A;  1S3X A;  4CD1 A;  3K5M A;  2O8E B;  1HKB A;  4C8N A;  3HXM A;  3IG1 A;  4BRQ A;  5M1P A;  4CJT A;  3ZSQ A;  3FFK B;  3QES A;  4H0V B;  4E89 A;  3NDK A;  5AFU A;  4PL7 A;  4X66 K;  3SYZ A;  1N36 K;  1IBM K;  1HX1 A;  3HP9 A;  5C2D A;  1E4G T;  3ZX2 A;  4ELV A;  4BR2 A;  1U04 A;  1RBU A;  4CGF A;  2IS3 A;  3KLF A;  1IH7 A;  3GDQ A;  4BG8 A;  3NF6 A;  4KPY A;  3VQA A;  4H5T A;  4B1W B;  2ASP A;  3CQ8 A;  4BR5 A;  2ZJQ L;  1BO5 O;  1VQ7 N;  5AQI A;  2A6A A;  3D2E B;  4MDB A;  5KGW A;  5J2M A;  1ZC6 A;  4DTR A;  5CYQ A;  2XHB A;  1MWM A;  5GAH P;  1O13 A;  3OYB A;  4B9M A;  4DS5 A;  4JKD A;  3TR8 A;  5C2F A;  5E26 A;  3QDK A;  2Q0R A;  3F5T A;  3MDQ A;  4CJU A;  5SZT A;  1GLA G;  3WNG A;  4FJM A;  4DSK A;  4JI3 K;  2KQ2 A;  3J7A P;  5CZ2 A;  1KVC A;  2YCH A;  1N5Y A;  4N41 A;  3UKR B;  1T44 A;  1BL3 A;  4NB4 A;  2P9L A;  3O9T A;  2VCP A;  1W2B M;  1VSM A;  4LF6 K;  1RCH A;  4BRG A;  4DSE A;  4M63 C;  3BY5 A;  1F21 A;  5T7B A;  1KD1 O;  2E1Y A;  2YHX A;  4DU3 A;  3R3L A;  4JKC A;  3QBX A;  4O0J A;  4JRQ A;  3EKS A;  1N34 K;  4BY9 C;  3C0B A;  2YJF A;  3KKR A;  4LF8 K;  3D0P A;  1WSJ A;  4J2D A;  3VMF B;  4B9S A;  1BDG A;  2H3G X;  3P31 A;  1JL2 A;  3PSI A;  3SUN A;  2P9K B;  2F96 A;  3DXK A;  2GX9 A;  3DLB A;  1MDU B;  3U9Z A;  3VET A;  5AQU A;  3VEY A;  4DFK A;  1BHL A;  2AJQ A;  4CZH A;  3V9W A;  2EX3 A;  1NJW A;  3AVK A;  3J8A A;  5DK5 A;  1YHQ N;  4KHQ A;  5J2P A;  5AQZ A;  3ATV A;  4ILH A;  2BGG A;  1NBW A;  1LAV A;  3DM2 A;  4WYB A;  3CCL N;  4W5N A;  3HPH A;  4DV7 K;  4JHD A;  4DR1 K;  3PO4 A;  2ZJP L;  4B1U B;  1KAX A;  3OY9 A;  3OYK A;  3HTV A;  4H4M A;  3ZEU B;  4CW7 B;  2HVI A;  3HPG A;  2OYQ A;  1WUA A;  4M7X A;  1J6Z A;  3WNF A;  4DUZ K;  3O4N A;  4A5A A;  2GTD A;  3RMB A;  4BC4 A;  1WAJ A;  2KHO A;  3SQ4 A;  5C15 A;  5HL7 L;  3IKM A;  2OPQ A;  4W5Q A;  4FJJ A;  1IKX A;  2GV9 A;  1Q8I A;  4JI8 K;  4KHY A;  5I9E B;  4FVU A;  2QWQ A;  1IV0 A;  1RT7 A;  3VQE A;  3CJ7 A;  1ZYQ A;  4BQL A;  3OJS A;  3K59 A;  4A5B A;  3JS6 A;  2BH1 A;  2BDP A;  3OYJ A;  5HBM A;  3QML A;  4PKG A;  4OGE A;  4KI6 A;  3CER A;  4BRK A;  4AM6 A;  4CF8 A;  3G25 A;  1JLG A;  1RTJ A;  4IOA L;  1X9W A;  2FF6 A;  5MLC Q;  1QZ5 A;  2W42 A;  1J9A A;  4BRP A;  1K9M O;  3LP0 A;  4IFE A;  3CFP A;  3CQY A;  3CCU N;  4FJN A;  3I33 A;  4DR4 K;  3EKU A;  3BZC A;  2QXF A;  1TL1 A;  3ZSZ A;  3EY1 A;  2HHV A;  2E1Z A;  1T05 A;  3O3F A;  1NK7 A;  4X62 K;  5AQW A;  5ADX H;  1NGJ A;  3CC7 N;  4GVE A;  4IFV A;  3RSE B;  4CGH A;  4M3R A;  1J54 A;  2E2O A;  4DTO A;  4CHP A;  1T3V A;  3GG4 A;  5JLH A;  1DKG D;  4OLB A;  4Y1C A;  5JS1 A;  1ZBH A;  3ZT1 A;  4L3Q A;  4RCH A;  4F2R A;  1KSP A;  5FPE A;  2PBD A;  2KFZ A;  1HYS A;  2HBJ A;  3CPE A;  2Q1N A;  4FWS A;  2WBN A;  4MO4 A;  5HLF A;  3V9U A;  4FLU A;  3P83 D;  4WFB L;  1TYQ B;  3VF4 A;  3KZB A;  3OVN A;  1I94 K;  4O44 A;  5TKW A;  4PQU A;  3THW B;  3KHY A;  1N6Q A;  2HBL A;  4F4K A;  3CG7 A;  3QIO A;  3SV3 A;  3VER A;  3F9M A;  3MCA B;  1IO2 A;  4JKH A;  4CZM A;  3FE1 A;  3ENB A;  3KJV A;  4Q0B A;  3H1V X;  3OYM A;  2KLA A;  2PAV A;  4YDU A;  4DFM A;  3MK6 A;  1IBK K;  3JAM O;  3NH1 A;  4OKJ A;  1KFS A;  5BRE A;  4YOW A;  4EAH D;  1N8R O;  4DHY A;  1FXX A;  4HWI A;  2IGI A;  3CM5 A;  4WQ5 A;  1TUU A;  4ZTJ A;  3SQ1 A;  2YNF A;  1ATS A;  3V1R A;  1WBB A;  3T1H K;  5I42 A;  2ZD1 A;  5CR4 A;  2IVP A;  2E4L A;  1VSJ A;  3AV9 A;  5FRM A;  4CHY A;  4CFD A;  1Z6R A;  3W0L A;  3M3Z A;  5ELZ A;  4DS4 A;  4FZY A;  4YOR A;  2QA4 N;  1NGE A;  4CK3 A;  3O6W A;  3RMA A;  2HF3 A;  3H08 A;  4K8Z A;  3NH2 A;  3MXI A;  4RW8 A;  1QQO A;  4IKF A;  2KW4 A;  1GOA A;  5EX5 A;  3OYL A;  3VF6 A;  2JWL A;  3ZT4 A;  3O5B A;  3TSU A;  4Y0W A;  3A2F A;  3I8D A;  3OYH A;  4IOC L;  3WEE B;  2WON A;  1VQ6 N;  4LY7 A;  3L2R A;  3G71 N;  2D0P A;  2I5J A;  4BRM A;  4GVM A;  5C12 A;  1NK4 A;  1J5E K;  1LOT B;  5E84 A;  4IDK A;  3KK7 A;  4NLC A;  5FPD A;  1EWQ A;  3D7E O;  4CEZ A;  5AFU H;  4BG9 A;  4B9V A;  1Q81 O;  3S9H A;  3TSQ A;  1XNR K;  1E4F T;  5JS2 A;  1Y64 A;  3KLH A;  3L3V A;  1XC9 A;  1VQO N;  1YJ9 N;  2HF4 A;  3AA2 A;  1QE1 A;  2JGU A;  1BA1 A;  1S5J A;  4LH5 A;  4LFB K;  4CHO A;  3LDO A;  2X74 A;  1Z25 A;  4CF1 A;  4M3W A;  2P9S B;  2F8T A;  3QO9 A;  3MWP A;  3S3O A;  1S9E A;  3OYN A;  1DTT A;  3G4S N;  4A59 A;  4LF9 K;  3MN6 A;  4ISE A;  4XH4 A;  1G15 A;  4B9N A;  3IAY A;  1KTQ A;  5LMN K;  4FK4 A;  3DRP A;  1NK0 A;  4CEQ A;  1IKV A;  3CJB A;  4OKK A;  1L3S A;  2ZM6 K;  3D45 A;  3CET A;  3GE1 A;  3ULE B;  4DSF A;  1YVN A;  3NF9 A;  5M1Q A;  1SL2 A;  4FPB A;  1NMN A;  2GWK A;  3SJH A;  2Q0U A;  2P9N B;  3CPW M;  2O8C A;  3EO3 A;  4BRH A;  3AVA A;  3KD5 E;  4BGB A;  2HVH A;  1BIU A;  4BRD A;  4FWM A;  1FKO A;  2VG7 A;  1D5A A;  1NJI O;  3TAB A;  1WB9 A;  1Q9Y A;  4AHC A;  3WNH A;  4DR3 K;  4YNQ A;  1L3V A;  5J2Q A;  3Q7C A;  4C1N I;  3PX4 A;  1K73 O;  3DYA A;  1N33 K;  4N47 A;  4WFN L;  4DQQ A;  2HW3 A;  5AQP A;  3LL3 A;  5HOO A;  1HLU A;  3KWI A;  1CLQ A;  5BN9 A;  3LDS A;  4BC3 A;  3HO1 A;  3OS1 A;  4JK9 A;  1M1K O;  1SKR A;  4I6M B;  3W3D A;  5FRN A;  3RRH A;  3TI0 A;  2G8U A;  3T19 A;  4PUO A;  4OPA A;  4AM7 A;  4KHU A;  4G1Q A;  4KB0 A;  4ELU A;  3AVM A;  3QNO A;  4CED A;  2BAN A;  2A5X A;  4LH4 A;  3OS2 A;  2Y1J A;  3ZSW A;  4GKK K;  3ZSX A;  1K8A O;  3V9X A;  2QWO A;  1Q82 O;  3D2F B;  1WNS A;  3AAQ A;  3CCS N;  2KKZ A;  4CIG A;  4E1J A;  4B3T K;  1VQ4 N;  1NJY A;  3VGL A;  3VQ9 A;  3WXM B;  1TK5 A;  4WQ5 C;  3OW2 M;  3THX B;  4KAZ A;  2FLO A;  5EOY A;  5J1E A;  4CBW A;  1RDA A;  5AZJ B;  2UUB K;  3LDP A;  1GLD G;  1SL0 A;  4HUG A;  1TYQ A;  4GY2 B;  1XWL A;  4E1N A;  2ITM A;  2VG5 A;  4AHR A;  2D0A A;  1Q86 O;  3V4I A;  1R59 O;  4O4G A;  4RW6 A;  1RIL A;  3CCE N;  3QEI A;  1BG3 A;  1B92 A;  1NGB A;  4FPA A;  1VSE A;  1IKY A;  1JCF A;  4OX9 K;  4O5B A;  2QKK A;  4I2P A;  3VEN A;  3P38 A;  4K41 A;  2UUC K;  3MXJ A;  2I7N A;  3TTC A;  4C8L A;  2PYJ A;  4N5S A;  1O1W A;  2JWK A;  5HP1 A;  2DFF A;  2A41 A;  2IIR A;  1VQP N;  3OHR A;  3EE9 A;  3S41 A;  3CJC A;  3VEZ A;  3NHG A;  1XHZ A;  4FK2 A;  1NK6 A;  3I0S A;  4PHT X;  1BCM A;  3WT0 A;  3TAP A;  4YOX A;  4NLB A;  1LW2 A;  2NRH A;  4MLH A;  4E0D A;  2P5G A;  4LC9 B;  1U47 A;  5IWA K;  4IBN A;  4WF9 L;  2NRR A;  3MEG A;  4KTZ A;  3E1Y A;  4H0T B;  3FZH A;  3B6P A;  5KQD A;  1D8Y A;  4J2E A;  2P9I B;  4HUE A;  1S1W A;  4BR7 A;  4CHN A;  4LFA K;  1QSS A;  4WFA L;  2E2P A;  5AQS A;  2ITG A;  4DKW A;  3IS9 A;  3K2P A;  3C7N A;  1U2V B;  3HVT A;  1ZBL A;  3AVH A;  3MAQ A;  1XMQ K;  4JLH A;  3ZSR A;  3HP6 A;  3V1Q A;  2HNZ A;  3L8B A;  3NMU A;  1RTH A;  4DV4 K;  2W6L A;  1Q7Y O;  5GAD P;  1SL1 A;  2NRW A;  5HRP A;  2E2N A;  2FXU A;  4BDP A;  4M3U A;  4HVJ A;  3MEC A;  4KV8 A;  1UOC A;  4DLG A;  3RMC A;  4F8R A;  3V6D A;  3LDN A;  3CCM N;  2QWP A;  2FSK A;  1NOY A;  1VHX A;  3DMJ A;  4W5R A;  4CBU A;  2P9U A;  3PIO L;  2O4G A;  4QCL A;  1RT2 A;  1WOQ A;  2HB5 A;  3DWL A;  1NU0 A;  1WSI A;  3OTO K;  4B9U A;  4FOI A;  3QIN A;  1RT6 A;  1JLE A;  4HUF A;  4A61 A;  3SBT A;  4BE2 A;  3NGY A;  4XEI A;  4FK0 A;  3AY9 A;  4CFA A;  4CJ3 A;  1BIZ A;  4BRO A;  4CZL A;  1HYZ A;  2QWR A;  3CI5 A;  1NK9 A;  3OBY A;  1D9F A;  4F2S A;  5AQJ A;  1RNH A;  1QHT A;  3AVL A;  2KZM A;  4HCB A;  3KKS A;  2QWM A;  1NGF A;  2UU9 K;  1EXQ A;  4WQ4 C;  3H46 O;  2FSJ A;  5AQQ A;  4CK1 A;  5KTQ A;  3CJA A;  4KH6 A;  2FBV A;  4B3S K;  4BDZ A;  4CJF A;  1J53 A;  4DSL A;  1RT1 A;  4B3M K;  1U45 A;  4YOT A;  3TTF A;  3RR8 A;  1HYV A;  2PFU A;  3R6M A;  3OS0 A;  2IOC A;  5GIN A;  3QET A;  3HSC A;  1WSG A;  1OVY A;  5C42 A;  1FJG K;  4K8X A;  4JD2 B;  3O1B A;  3RTV A;  2HMI A;  1SKS A;  3A5N C;  4ID1 A;  1YTA A;  3D2F A;  4CJR A;  3VF2 A;  1ESV A;  3DOK A;  1C0M A;  3ZSV A;  4OPK A;  2KTQ A;  3CFR A;  2JLE A;  4JAX A;  2UXC K;  4RW4 A;  4OJR A;  4QAG A;  4CFB A;  3SPZ A;  3SAG A;  3PSF A;  2V7Z A;  4FJL A;  4NCG A;  2HBM A;  3A0I X;  3T7Z A;  4F3O A;  2ZWH A;  2F8S A;  5AZI A;  4UQG A;  1NGC A;  1LAW A;  4DB3 A;  1GLE G;  4H03 B;  4DV6 K;  5LY3 A;  3OA9 A;  3O9S A;  1JJ2 M;  1BQM A;  3WXL A;  4DTU A;  3DRS A;  5AQF A;  3KIO A;  4CEO A;  1HPZ A;  2GUP A;  1OH6 A;  3K5N A;  1BGX T;  4FJK A;  3CC4 N;  1A5W A;  3CQX A;  1TUY A;  4IG0 A;  4BR9 A;  1JLA A;  1VAZ A;  1YT3 A;  1IG8 A;  5JIC A;  4FYD A;  3ZCM A;  5HRO A;  4ZTF A;  3MXM A;  1RTD A;  4Y1D A;  3KLE A;  2NUB A;  3PIP L;  1H1V A;  1S22 A;  3C6U A;  3HM8 A;  1HNV A;  2QW9 A;  3PY8 A;  1NKC A;  1C0G A;  3UKU B;  4PY5 A;  3O1W A;  4RG8 A;  3J81 O;  3A5O C;  3LM2 A;  3EZW A;  1K6Y A;  3VQQ A;  3KLI A;  3VPZ A;  2OAN A;  2HST A;  3AGR A;  4DSJ A;  3H6E A;  3ISN C;  4DQR A;  5AQV A;  4DTJ A;  3FZL A;  4C8M A;  3QNN A;  1QVG M;  1JCG A;  2CGJ A;  5BPL A;  3ZSO A;  3UE5 A;  2DFE A;  4ILG B;  4DLE A;  1IBL K;  4PWD A;  4CJE A;  4JS4 A;  4YY3 K;  5EVZ A;  1S1V A;  3K58 A;  4DV2 K;  1NGD A;  3CFO A;  3ENO A;  4U67 L;  3MN7 A;  1ITG A;  1DGK N;  1XMO K;  1QQC A;  3TAE A;  5EXW A;  4CHZ A;  2Q97 A;  3IMX A;  1VRT A;  5BPM A;  5GAE P;  2VGM A;  3VES A;  4JKB A;  3CD6 N;  4IG3 A;  5CHI A;  1RT4 A;  5AZJ A;  3AVI A;  4M7Y A;  1QSL A;  4EIA A;  4CZF A;  1QVF M;  5AZI B;  1YTU A;  1EP4 A;  1HKG A;  3S3N A;  1BU6 O;  4ILJ A;  2D1K A;  4IOX A;  1RT5 A;  3EEQ A;  1XUP O;  2F4V K;  4DSI A;  3FZF A;  2O8B B;  3HST B;  3TAF A;  3CM6 A;  3THW A;  1NK5 A;  3C6H A;  1Q18 A;  2PZS A;  4DR5 K;  1LWC A;  3ULE A;  1ASW A;  1U4B A;  3THV A;  2GWJ A;  3VQ4 A;  1UA1 A;  1JXB A;  1ASU A;  3MX5 A;  4JK8 A;  4YOV A;  4GV6 A;  5C24 A;  3P4I A;  5LJW A;  4A2B A;  4QS7 A;  1BCO A;  1R0A A;  3G0Z A;  1HR0 K;  1JLQ A;  4AHS A;  2ZE2 A;  4A57 A;  1S6Q A;  1VSF A;  3J80 O;  2HHW A;  1IJJ A;  4AF1 A;  1NKB A;  4DF4 A;  3HRG A;  1NM1 A;  4FWO A;  4CIE A;  3SUO A;  4CI6 A;  2W6K A;  2EWS A;  3DLK A;  4GNI A;  2HMP A;  4FL9 A;  3A5L C;  4B1Z A;  1Y97 A;  4B8C A;  1FK9 A;  4FLT A;  1GLB G;  1WBD A;  5KPR A;  1HKC A;  2FF3 B;  1L5U A;  1C0U A;  2OPR A;  1HRH A;  3MN9 A;  2AP1 A;  5EU7 A;  3PO5 A;  1X3N A;  4Z4H A;  4E7K A;  1YUW A;  4DR7 K;  1SQK A;  1T03 A;  1MWK A;  4Q5V A;  4CF0 A;  4KI4 A;  1GOB A;  2W40 A;  3V9Z A;  5AQG A;  3U3Y A;  3DJC A;  4AHV A;  4YFU A;  1P8Z A;  2YJE A;  1FW6 A;  5BR8 K;  4OPH A;  3HOS A;  1C0F A;  4CEA A;  4CEC A;  3QEW A;  1XHX A;  3ASM A;  4EHT A;  2ATQ A;  1BI4 A;  1OH8 A;  2OA8 A;  1VK0 A;  1QS4 A;  5DM6 L;  3T1Y K;  3A8Y A;  3CJ1 A;  2P9P A;  1YVU A;  4FWN A;  4X65 K;  1QTM A;  4G9Z A;  1TL3 A;  4E7L A;  3VEX A;  1RT3 A;  2BTF A;  4M45 A;  4CJ5 A;  2B6A A;  3IFR A;  3QFU A;  5D3G A;  4AQY K;  5TKY A;  1LW0 A;  3P1G A;  4DF8 A;  3HI0 A;  3NH0 A;  3OYI A;  4FJ7 A;  3LPT A;  1M90 O;  4I7F A;  3VA3 A;  3J7Z O;  3NBP A;  4DG1 A;  4M3T A;  3ID8 A;  4C8K A;  1ZXO A;  4KO0 A;  1HNZ K;  4KH4 A;  3AVN A;  3OBW A;  4KH5 A;  3AVJ A;  3C7N B;  3OJU A;  3FGU A;  1QHA A;  4E7J A;  4LD0 A;  5M1N A;  4MLE A;  2PYL A;  1P90 A;  1JXE A;  3M5R A;  3ULD A;  1MA9 B;  4IDH A;  3LAK A;  4OVL A;  3SAH A;  3AO2 A;  3I8B A;  3ITH A;  4BR0 A;  2NRX A;  4Z94 A;  1EO1 A;  3D2E A;  2ETJ A;  4N56 A;  1RDB A;  3HYF A;  4GV9 A;  4B3O A;  3CHW A;  1HNW K;  5C10 A;  3K57 A;  4XIU A;  1XI1 A;  3C6A A;  4CES A;  2E2Q A;  2QWL A;  1W0H A;  4CGI A;  1JLB A;  3VQ8 A;  4QS8 A;  3EZ5 A;  4KHN A;  1BWF O;  5DM7 L;  4FW1 A;  3QLH A;  3AA3 A;  4JNE A;  4CVN E;  4B9T A;  5KI6 A;  1NGI A;  3UB5 A;  5JLF A;  5H1S Q;  3DOL A;  5KPZ A;  2D0O A;  3OYG A;  1FKP A;  2ZF5 O;  3AAR A;  3L3U A;  3U4L A;  4BRF A;  3DLE A;  5C0Y A;  2NNW A;  2Q2R A;  4ISG A;  4U7B A;  4AHU A;  3VTI A;  3AAP A;  3GOI A;  5AQH A;  4FZX C;  2O8C B;  3MCP A;  3PX6 A;  3LWL A;  3MX2 A;  2X78 A;  4H8K A;  3L2W A;  1BUP A;  1NJX A;  4DFJ A;  2Z1H A;  1TK0 A;  3SQ0 A;  3U3G A;  1K8K A;  3I56 N;  1X9M A;  4I9L A;  2HHQ A;  4JKG B;  2P9U B;  3SLC A;  4FZZ A;  1MU2 A;  4KHW A;  3SV4 A;  4Z4G A;  3VQB A;  3SAF A;  5CZ1 A;  2X6N A;  2O8F B;  4BQZ A;  3EYZ A;  4PL8 A;  5AQX A;  3VEW A;  3B8A X;  3NE6 A;  4LSN A;  2G8I A;  4CGG A;  1SKW A;  4O8K A;  3SQ2 A;  2YNI A;  4DU4 A;  3BZK A;  2Y1I A;  2F7T A;  3CF5 L;  1L3T A;  4CZK A;  2O8B A;  1U49 A;  1S9G A;  3C95 A;  1C6V A;  3TU5 A;  2EHG A;  1LV5 A;  2XY6 A;  5CY4 A;  3CCV N;  4E7I A;  4B08 A;  1TAQ A;  3HT3 A;  3QER A;  3O9R A;  4DR2 K;  3JSM A;  1SUQ A;  4GW6 A;  2YV0 X;  1DEJ A;  2ZGY A;  2G8V A;  2D0B A;  1Q9X A;  1C1A A;  3EN9 A;  1OKJ A;  4J2A A;  3CCJ N;  4TSX A;  5KRS A;  3U9D A;  3N4P A;  4K0K K;  3LAL A;  3VQ7 A;  3THY A;  2XRI A;  3KD1 E;  2OZM A;  2RE2 A;  4DTN A;  2WOM A;  4W5T A;  4N76 A;  3HJF A;  3TTD A;  2XY5 A;  4HHT A;  1YAG A;  4CJQ A;  5AQY A;  1RDC A;  4NXM K;  4ICL A;  2GEM A;  3ZSY A;  4HTU A;  2HHT A;  1EKE A;  1K8K B;  5LJV A;  2P9L B;  2I7P A;  1G99 A;  4IEE A;  1SZ2 A;  3AA5 X;  4J2B A;  1TKX A;  4YHH K;  3SUP A;  5A2Q O;  4EP4 A;  5LL6 Z;  2IVO A;  1ILY A;  1NOZ A;  1TKD A;  2X6S A;  5DMR A;  4MO5 A;  3O9U A;  3NAE A;  4BDY A;  5IT9 O;  1X3M A;  3QB0 A;  5GAG P;  1WSH A;  3FZK A;  3OYF A;  3LP2 A;  4FJ5 A;  3WXI A;  4QOZ B;  4FJH A;  4FW2 A;  3L4I A;  5FPM A;  5AJ3 K;  2P9S A;  2YX6 A;  3A5M C;  3AVC A;  2A1S A;  2A40 A;  1NGG A;  3C65 A;  4CZJ A;  3I0R A;  2HHH K;  3E01 A;  2BE2 A;  1KXP A;  3THY B;  5AQT A;  4B1Y B;  2YKM A;  1NMD A;  4KFB A;  3THX A;  3HL8 A;  3P39 A;  4RW9 A;  1Z26 A;  4BGA A;  3L2U A;  4DTS A;  2A1R A;  4W5O A;  3O4W A;  2VQF K;  1W97 L;  4FWK A;  4KTQ A;  3LP1 A;  3OYD A;  3BF1 A;  1S6P A;  3ZT2 A;  4CJ4 A;  4BVO A;  4CJ7 A;  3CCR N;  1A5V A;  1RDU A;  3HZ6 A;  4KRE A;  4CZI A;  2VWK A;  1X1P A;  3R1X A;  4C1N K;  1NGA A;  3WNE A;  3LAM A;  2A3Z A;  1NLV A;  4EP5 A;  4Z4I A;  3O08 A;  1UWB A;  3BGR A;  4WE1 A;  2NLX A;  1JKH A;  5CYM A;  4DV1 K;  2KZZ A;  3D6R A;  3T69 A;  1CZA N;  4FLX A;  4E7H A;  1VQK N;  3QEX A;  3TAQ A;  2KFN A;  1BI4 B;  4JKE A;  4CE9 A;  5BR9 A;  3ZEU A;  4YOY A;  4FWP A;  1EX4 A;  3LPU A;  2RPI A;  4UY8 O;  3BUZ B;  1VSL A;  2UXD K;  4JKF A;  2E88 A;  4KHS A;  1TV6 A;  2G8F A;  4CBX A;  4M3X A;  1TKT A;  4IO8 A;  4CD3 A;  2WTU A;  2OTJ N;  4CEE A;  3VQ6 A;  4XH1 A;  3H45 C;  2F9W A;  3RMD A;  3M1F A;  1A5X A;  4M3Z A;  3LDQ A;  4CJP A;  1U6Z A;  3GL1 A;  1WAF A;  4YOU A;  4KB1 A;  4DTX A;  1B9D A;  3KWG A;  1TK8 A;  3PUF A;  4KBO A;  3PV8 A;  3F9K A;  5B8H A;  3C6T A;  4M3Y A;  2F9T A;  3NCI A;  3ZT0 A;  3RWU A;  1V4T A;  2NRV A;  1T6C A;  1T7P A;  2GEL A;  3MN5 A;  4DQI A;  3U6F A;  4Z4F A;  4FWR A;  3JXU A;  3ZX0 A;  3SBG A;  3IRX A;  3QBW A;  5BN8 A;  4BE0 A;  3NF8 A;  2FBX A;  1OH5 A;  4Z4E A;  2O4I A;  4PKH A;  5BRF A;  1VQ8 N;  1ATR A;  3FLC O;  2VWB A;  3AVB A;  5BRD A;  4JD2 A;  2QKB A;  3SK3 A;  4CJW A;  3E9L A;  1RFQ A;  3I55 N;  3RR7 A;  2UXB K;  4FJG A;  4OLA A;  4X64 K;  2ZJR L;  5FDL A;  1DTQ A;  1NGH A;  4CIF A;  4ELT A;  1T8E A;  1YI2 N;  3DLR A;  2DFH A;  5AQR A;  4IO9 L;  1RGI A;  3FR0 A;  1GLF O;  4CJV A;  4Z0U A;  1T6D A;  4IEI A;  1B9F A;  4JI0 K;  4EZ6 A;  4ID5 A;  3JYT A;  4DFP A;  1NJZ A;  3G6E N;  4IZ9 A;  1U2V A;  2DPN A;  3NVK A;  1KLM A;  4KKO A;  3WEE A;  2ZQB A; 
#chains in the Genus database with same CATH homology
 1FK9 A;  4FLT A;  2HHX A;  3OYA A;  4DMN A;  2HVH A;  1BIU A;  4NYN A;  1FKO A;  3AVG A;  5HRR A;  2VG7 A;  3NGI A;  1D5A A;  1L5U A;  3TAB A;  1C0U A;  2OPR A;  1Q9Y A;  1HRH A;  3UIQ A;  2D5R A;  4AHC A;  3WNH A;  4YNQ A;  1L3V A;  5J2Q A;  3MED A;  5EU7 A;  3PX4 A;  3PO5 A;  3DYA A;  4N47 A;  4CJL A;  2OPP A;  4DQQ A;  1ZBU A;  2GUI A;  1GOC A;  2YNG A;  4MFB A;  4DWI A;  2DTU A;  4Z4H A;  4I2Q A;  4E7K A;  3M8Q A;  5HRN A;  1C1C A;  1TGO A;  5KGX A;  4CF2 A;  4FLY A;  1T03 A;  4Q5V A;  1CLQ A;  1UAX A;  4CF0 A;  4KI4 A;  3LDS A;  1GOB A;  3HO1 A;  4CGJ A;  3OS1 A;  3V9Z A;  3U3Y A;  1VSK A;  1SKR A;  1KVA A;  4AHV A;  4YFU A;  5FRN A;  3RRH A;  3TI0 A;  2G8U A;  3T19 A;  2HNY A;  1HMV A;  4I9Q A;  4FJ9 A;  4PUO A;  4NYF A;  2XY8 A;  2YHA A;  4FJX A;  1WSE A;  3DI6 A;  3K5M A;  4KHU A;  4G1Q A;  4CEA A;  4KB0 A;  2PY5 A;  4CEC A;  3QEW A;  1XHX A;  3AVM A;  1KFD A;  3ASM A;  4ELU A;  3QNO A;  4CED A;  4C8N A;  2BAN A;  3B6O A;  3IG1 A;  3HXM A;  4C8O A;  2ATQ A;  1S1U A;  3O4Q A;  4LH4 A;  1BI4 A;  2LSN A;  3OS2 A;  4OKE A;  4CJT A;  2Y1J A;  1VK0 A;  1QS4 A;  3ZSQ A;  3ZSW A;  2OA8 A;  2RKI A;  3ZSX A;  3QEP A;  3V9X A;  3QES A;  4E89 A;  3NDK A;  1YVU A;  3AA4 A;  1QTM A;  2DY4 A;  1WNS A;  1TL3 A;  3SYZ A;  3P5J A;  4E7L A;  3V81 A;  3C94 A;  3HP9 A;  4DTP A;  3M8P A;  1RT3 A;  4CIG A;  1KVB A;  2E6L A;  3SNN A;  1NJY A;  1TKZ A;  5FRO A;  3SZ2 A;  1IG9 A;  4FK0 A;  4M45 A;  3T1A A;  4CJ5 A;  3KK2 A;  2B6A A;  3VQ9 A;  4ELV A;  5D3G A;  1U04 A;  1RBU A;  4CGF A;  2IS3 A;  3KLF A;  1TK5 A;  2G8H A;  1IH7 A;  1LW0 A;  3NF6 A;  3RRG A;  4KAZ A;  1C1B A;  4CHQ A;  5J1E A;  4KPY A;  3P1G A;  1RDA A;  3VQA A;  3VA0 A;  4DF8 A;  1HQU A;  3NH0 A;  3OYI A;  4FJ7 A;  4BAC A;  5C25 A;  3LPT A;  4I7F A;  3CQ8 A;  3VA3 A;  1SL0 A;  4HUG A;  3NBP A;  4DG1 A;  5KGW A;  5J2M A;  4M3T A;  4C8K A;  1XWL A;  4KO0 A;  4E1N A;  4DTR A;  5K14 A;  5CYQ A;  3AVN A;  3L2V A;  2VWJ A;  3LZJ A;  4NCB A;  2XHB A;  3AVJ A;  1JLF A;  2VG5 A;  4AHR A;  4FCY A;  3OJU A;  2D0A A;  2QK9 A;  3OYB A;  3V4I A;  4DS5 A;  4B9M A;  3TR8 A;  4E7J A;  4LD0 A;  1VSH A;  1KLN A;  4FM0 A;  4O4G A;  4RW6 A;  1RIL A;  2IDO A;  4E1M A;  3QEI A;  2PYL A;  1HJR A;  3O3G A;  1B92 A;  2YHB A;  1JXE A;  3ULD A;  3DLG A;  4CJU A;  5SZT A;  4OVL A;  3LAK A;  1VSE A;  1IKY A;  3AO2 A;  3WNG A;  4FJM A;  3ITH A;  4DQS A;  4DSK A;  4DU1 A;  1NK8 A;  2GBZ A;  2KQ2 A;  5CZ2 A;  1KVC A;  4O5B A;  2QKK A;  1N5Y A;  4I2P A;  4FXD A;  4N41 A;  1BL3 A;  2ETJ A;  3MXJ A;  4C8L A;  4N56 A;  4FVM A;  1RDB A;  3HYF A;  2PYJ A;  4CCH A;  4N5S A;  4B3O A;  1O1W A;  5HP1 A;  3AO4 A;  1VSM A;  2DFF A;  2B5J A;  1WLJ A;  1RCH A;  3K57 A;  4XIU A;  1XI1 A;  4M42 A;  3NFA A;  3NHG A;  1XHZ A;  4CES A;  4DSE A;  4FK2 A;  4MQ3 A;  3I0S A;  1WSF A;  1NK6 A;  1W0H A;  2B4J A;  1BCM A;  3OYC A;  1F21 A;  5T7B A;  4CGI A;  1QSY A;  1DLO A;  1JLB A;  3VQ8 A;  3EZ5 A;  4DU3 A;  3TAP A;  3BDP A;  4KHN A;  4IFY A;  1LW2 A;  4FW1 A;  3QLH A;  4O0J A;  3VQC A;  4JRQ A;  4E0D A;  2P5G A;  3AA3 A;  1U48 A;  1U47 A;  4B9T A;  4IBN A;  3MEG A;  4KTZ A;  4AH9 A;  5KI6 A;  3AO1 A;  3KKR A;  4H4O A;  3D0P A;  1WSJ A;  2HHS A;  3DOL A;  4J2D A;  3OYG A;  4B9S A;  1FKP A;  2HND A;  3L3U A;  3B6P A;  1KRP A;  1W9H A;  4J2E A;  1D8Y A;  1JL2 A;  3DLE A;  4HUE A;  1S1W A;  4CHN A;  3SUN A;  2F96 A;  1QSS A;  3DLB A;  2ITG A;  4AHU A;  4CJK A;  4DFK A;  3IS9 A;  3K2P A;  4FZX C;  1ZBI A;  3HVT A;  3PX6 A;  1ZBL A;  3AVH A;  3LWL A;  1BHL A;  4JLH A;  2X78 A;  3ZSR A;  3V1Q A;  3HP6 A;  3MAQ A;  4H8K A;  3L2W A;  2HNZ A;  3V9W A;  2AJQ A;  3L8B A;  1ZBF A;  2EX3 A;  1RTH A;  3F73 A;  2XY7 A;  4DFJ A;  3AVK A;  1NJW A;  2Z1H A;  1NJX A;  2OPS A;  5DK5 A;  1TK0 A;  4KHQ A;  5J2P A;  3SQ0 A;  3U3G A;  1SL1 A;  5HRP A;  4EZ9 A;  1VRU A;  4BDP A;  1X9M A;  4M3U A;  2BGG A;  1I39 A;  4I9L A;  1LAV A;  2HHQ A;  3DM2 A;  4HVJ A;  3MEC A;  4W5N A;  3HPH A;  5J2N A;  4KV8 A;  4FZZ A;  1UOC A;  4O0I A;  4DLG A;  3RMC A;  1MU2 A;  3V9S A;  3DLH A;  4F8R A;  4KHW A;  3SV4 A;  4Z4G A;  3VQB A;  3V6D A;  3PO4 A;  5CZ1 A;  3LP3 A;  3SI6 A;  3OY9 A;  3M8R A;  3OYK A;  2X6N A;  4H4M A;  4CJS A;  2HW3 A;  3EYZ A;  2HVI A;  1NOY A;  3DMJ A;  3HPG A;  4W5R A;  2OYQ A;  3NE6 A;  4LSN A;  2P5O A;  2G8I A;  4CGG A;  2O4G A;  4QCL A;  1RT2 A;  3WNF A;  3O4N A;  2HB5 A;  3RMB A;  1WAJ A;  1SKW A;  3SQ2 A;  1WSI A;  2YNI A;  4B9U A;  1KCF A;  2IC3 A;  3QIN A;  1RT6 A;  4DU4 A;  3MEE A;  2Y1I A;  3SQ4 A;  1JLE A;  4HUF A;  1L3T A;  2P51 A;  4BE2 A;  1U49 A;  3NGY A;  1S9G A;  2OPQ A;  2Z1G A;  4W5Q A;  3C95 A;  1IKX A;  1EET A;  1BIZ A;  1C6V A;  1Q8I A;  2GV9 A;  4CFA A;  4CJ3 A;  4KHY A;  3HK2 A;  2EHG A;  1LV5 A;  3S3M A;  1HYZ A;  2XY6 A;  5CY4 A;  1NK9 A;  1RT7 A;  3VQE A;  1D9F A;  4E7I A;  1ZYQ A;  4B08 A;  4CGD A;  4F2S A;  1TAQ A;  3CYM A;  3HT3 A;  3VQD A;  2YKN A;  3OJS A;  3QER A;  3K59 A;  1RNH A;  1QHT A;  3JSM A;  1SUQ A;  3FFI A;  3AVL A;  2IAJ A;  2YV0 X;  4GW6 A;  5HBM A;  3OYJ A;  2BDP A;  4KI6 A;  2YNH A;  4OGE A;  4HCB A;  3KKS A;  2KZM A;  2G8V A;  1RBR A;  2Z1J A;  2D0B A;  1CZB A;  4CF8 A;  1Q9X A;  1JLG A;  1EXQ A;  1RTJ A;  1C1A A;  1X9W A;  4BWJ A;  4E19 A;  4CK1 A;  5KTQ A;  2FC0 A;  2W42 A;  4J2A A;  1C0T A;  1J9A A;  3SJJ A;  2FBV A;  4TSX A;  5KRS A;  4BDZ A;  3LP0 A;  4CJF A;  3M8S A;  3CFP A;  1J53 A;  4FJN A;  3LAL A;  3VQ7 A;  3KK3 A;  4DSL A;  1RT1 A;  2XRI A;  3KD1 E;  1U45 A;  2QXF A;  2OZM A;  1TL1 A;  4DTN A;  3ZSZ A;  2P1J A;  3EY1 A;  2WOM A;  4W5T A;  4N76 A;  4FM2 A;  3HJF A;  2HHV A;  1T05 A;  3O3F A;  3RR8 A;  1JL1 A;  1HYV A;  2XY5 A;  4HHT A;  1NK7 A;  3OS0 A;  2HHU A;  4CJQ A;  2IOC A;  1RDC A;  2FBY A;  3QET A;  3LAN A;  4ICL A;  1WSG A;  4FLZ A;  4B9L A;  3ZSY A;  4IFV A;  4CGH A;  4HTU A;  2HHT A;  4M3R A;  5C42 A;  1J54 A;  1EKE A;  1LWF A;  4DTO A;  4K8X A;  4CHP A;  3AA5 X;  3RTV A;  1SKS A;  4OLB A;  4Y1C A;  4J2B A;  5JS1 A;  1X9S A;  1ZBH A;  4OGC A;  1NKE A;  1TKX A;  3ZT1 A;  1RBV A;  4FLV A;  3SUP A;  2G8K A;  4F2R A;  4EP4 A;  1KSP A;  2KFZ A;  1HYS A;  2RF2 A;  4M3X A;  4ID1 A;  3K5L A;  1YTA A;  4CJR A;  1NOZ A;  1TKD A;  4OPJ A;  2X6S A;  4CF9 A;  3DOK A;  1C0M A;  3ZSV A;  2G8W A;  5HLF A;  4OPK A;  2KTQ A;  3V9U A;  5DMR A;  2XO7 A;  3CFR A;  3P83 D;  2JLE A;  3NAE A;  4BDY A;  4FLU A;  3DRR A;  1WSH A;  3OYF A;  3LP2 A;  4FJ5 A;  4QOZ B;  3OVN A;  4FW2 A;  4RW4 A;  4FJH A;  4OJR A;  4QAG A;  4PA1 A;  3AVC A;  3K5O A;  4O44 A;  4CFB A;  2A1S A;  3SPZ A;  4PQU A;  1HQE A;  4FJL A;  1N6Q A;  3I0R A;  3LWM A;  4F4K A;  3E01 A;  2BE2 A;  3CG7 A;  3QIO A;  3NF7 A;  4NCG A;  4CER A;  3SV3 A;  2YKM A;  4FM1 A;  4RW7 A;  5SWM A;  4KFB A;  1IO2 A;  4F3O A;  3ALY A;  3HPO A;  2D0C A;  1I3A A;  3HL8 A;  3KJV A;  4FJ8 A;  2F8S A;  4Q0B A;  3SCX A;  1S1X A;  4RW9 A;  3OYM A;  3PX0 A;  1Z26 A;  4UQG A;  3L2U A;  1LAW A;  4DTS A;  4DFM A;  1ASV A;  2A1R A;  3NH1 A;  2Z1I A;  1D9D A;  4OKJ A;  4W5O A;  2RN2 A;  1BQM A;  3HVR A;  1KFS A;  4DTU A;  3DRS A;  3QEV A;  4KTQ A;  3LP1 A;  3KIO A;  3OYD A;  4CEO A;  1HPZ A;  1S6P A;  3ZT2 A;  4CJ4 A;  1FXX A;  4L8R B;  4CEB A;  1A5V A;  2IGI A;  3CM5 A;  4CEF A;  3TAR A;  4B8A B;  3K5N A;  4F3T A;  4CFC A;  4KRE A;  5E41 A;  4ZTJ A;  3SQ1 A;  3KK1 A;  1BGX T;  2YNF A;  4FJK A;  2E6M A;  3V1R A;  3OYE A;  1RBS A;  2ZD1 A;  1A5W A;  5I42 A;  2VWK A;  1X1P A;  1RTI A;  3AO5 A;  1CXQ A;  4IG0 A;  1JLA A;  1YT3 A;  3WNE A;  2E4L A;  1VSJ A;  3AV9 A;  3TWH A;  3ZCM A;  3LAM A;  5HRO A;  4FYD A;  4ZTF A;  5FRM A;  3VN5 A;  3MXM A;  4CHY A;  1RTD A;  4Y1D A;  3KLE A;  4EP5 A;  2NUB A;  4CFD A;  1UWB A;  3BGR A;  4WE1 A;  3O3H A;  3TAN A;  3ZT3 A;  4DS4 A;  4Z4I A;  3C6U A;  1JKH A;  5CYM A;  4FZY A;  2KZZ A;  3TAM A;  4CK3 A;  1HNV A;  4JRP A;  3QIP A;  4FLX A;  3PY8 A;  1RBT A;  2Q3S A;  3RMA A;  4E7H A;  1NKC A;  3H08 A;  3NGZ A;  4K8Z A;  3QEX A;  3NH2 A;  3TAQ A;  1BI4 B;  3MXI A;  4CE9 A;  4PY5 A;  2KFN A;  4RG8 A;  4RW8 A;  4IKF A;  2KW4 A;  1EX4 A;  1GOA A;  3OYL A;  1CXU A;  4E3S A;  1K6Y A;  3VQQ A;  3LPU A;  1IKW A;  2FBT A;  2RPI A;  3KLI A;  1HNI A;  1REV A;  3G10 A;  4BE1 A;  1VSI A;  4DSJ A;  1VSL A;  3ZT4 A;  4O55 A;  3ISN C;  4R5P A;  4DQR A;  1WN7 A;  4KHS A;  1TV6 A;  3A2F A;  4DTJ A;  4C8M A;  3QNN A;  3I8D A;  2G8F A;  1TKT A;  3OYH A;  2HMI A;  3ZSO A;  4PWD A;  2DFE A;  4DLE A;  4HCC A;  4CEE A;  1BQN A;  3VQ6 A;  4CJE A;  4JS4 A;  2WON A;  1RDD A;  1S1V A;  3K58 A;  3RMD A;  3CFO A;  4LY7 A;  1A5X A;  3L2R A;  4M3Z A;  1ITG A;  4LSL A;  3KTQ A;  2I5J A;  4CJP A;  1WAF A;  1QQC A;  4Z4C A;  3TAE A;  4KB1 A;  4CHZ A;  4GVM A;  1TVR A;  4KTW A;  1VRT A;  1JLC A;  1LWE A;  4DTX A;  1NK4 A;  4B8C A;  1B9D A;  3L2Q A;  1TK8 A;  4IDK A;  3PUF A;  4ZHR A;  4IG3 A;  3PV8 A;  4AHT A;  3F9K A;  1RT4 A;  3C6T A;  5KRT A;  3AVI A;  4M3Y A;  3LZI A;  1UA0 A;  1QSL A;  3NCI A;  4KKO A;  3ZT0 A;  1CZ9 A;  4CEZ A;  3RWU A;  4B9V A;  1YTU A;  3S9H A;  4FJJ A;  3AO3 A;  1EP4 A;  2OZS A;  5JS2 A;  3KLG A;  3KLH A;  1T7P A;  3S3N A;  3L3V A;  1XC9 A;  4JS5 A;  4DQI A;  3U6F A;  4Z4F A;  3AA2 A;  1QE1 A;  2JGU A;  1RT5 A;  1S5J A;  4LH5 A;  3IRX A;  4BE0 A;  1BIS A;  3AVF A;  3NF8 A;  2FBX A;  4CHO A;  4DSI A;  4Z4E A;  2O4I A;  4BWM A;  3HST B;  4FLW A;  2X74 A;  3TAF A;  3CM6 A;  1Z25 A;  4CF1 A;  1NK5 A;  4M3W A;  3AVB A;  2F8T A;  3QO9 A;  2QKB A;  4CK2 A;  3S3O A;  1S9E A;  4M41 A;  1DTT A;  3VQP A;  3OYN A;  2PZS A;  4CJW A;  1LWC A;  3V1O A;  1ASW A;  4AIL C;  1L3U A;  1U4B A;  3THV A;  3RR7 A;  3SPY A;  3VQ4 A;  4FJG A;  1UA1 A;  4OLA A;  1J5O A;  1G15 A;  1JXB A;  1ASU A;  5FDL A;  4B9N A;  1DTQ A;  4CIF A;  3IAY A;  4ELT A;  1T8E A;  1KTQ A;  5I3U A;  4FK4 A;  5C24 A;  3DRP A;  1NK0 A;  3DLR A;  4CEQ A;  4NCA A;  1IKV A;  2R7Y A;  2DFH A;  1S1T A;  4OKK A;  1L3S A;  3D45 A;  3HM9 A;  4GMJ B;  1BCO A;  1VSD A;  1R0A A;  1SV5 A;  2VG6 A;  3G0Z A;  4DSF A;  1TAU A;  1JLQ A;  4AHS A;  2ZE2 A;  4FJI A;  3NF9 A;  1S6Q A;  1VSF A;  4Z0U A;  4CJV A;  1SL2 A;  2HHW A;  1NKB A;  4DF4 A;  3SUQ A;  1B9F A;  4DQP A;  4DTM A;  4CIE A;  3SUO A;  4EZ6 A;  4ID5 A;  3JYT A;  4DFP A;  1NJZ A;  4KRF A;  5HRS A;  3DLK A;  3VQ5 A;  1KLM A;  3AVA A;  1Y97 A;  3KD5 E;  3TAG A;  2ZQB A;  3T3F A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...