1WSGA

Co-crystal structure of e.coli rnase hi active site mutant (e48a/d134n*) with mn2+
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
155
structure length
155
Chain Sequence
MLKQVEIFTDGSCLGNPGPGGYGAILRYRGREKTFSAGYTRTTNNRMALMAAIVALEALKEHCEVILSTDSQYVRQGITQWIHNWKARGWKTADKKPVKNVDLWQRLDAALGQHQIKWEWVKGHAGHPENERCNELARAAAMNPTLEDTGYQVEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ribonuclease HI
publication title Identification of Single Mn(2+) Binding Sites Required for Activation of the Mutant Proteins of E.coli RNase HI at Glu48 and/or Asp134 by X-ray Crystallography
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
total genus 48
structure length 155
sequence length 155
chains with identical sequence B, C, D
ec nomenclature ec 3.1.26.4: Ribonuclease H.
pdb deposition date 2004-11-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1wsgA00
1RNHA 3UIQA 4LH5A 4NYFA 4FLVA 4BE2A 5CY4A 4M3RA 3AA5X 3S3NA 1C0MA 2BDPA 2F96A 3K57A 1VSFA 2D5RA 1TKXA 4E1NA 4FK2A 4CJQA 5HRSA 3CM5A 3THVA 3PO4A 4FJ7A 4M3TA 4OGCA 3QEVA 2FBXA 3RRGA 4CEZA 1JLGA 3ULDA 1A5VA 2IS3A 2HB5A 4WE1A 4LY7A 2NUBA 1HJRA 4CF9A 3LANA 4K8ZA 4DQQA 5JS2A 3AO1A 4DTMA 4DTNA 1JLCA 2XHBA 1DLOA 4CEOA 3VQ5A 4DSKA 5EU7A 3KK2A 3HXMA 3RMDA 2FBVA 1IKXA 1KVCA 4KRFA 3ISNC 4DU1A 3I0SA 3DLKA 3EZ5A 4FLZA 3MAQA 4E7LA 2YNGA 4B8CA 1WSHA 1A5XA 2JLEA 3V4IA 1X9SA 1D9DA 2HW3A 3SUOA 3A2FA 1EETA 3MXMA 1FXXA 3KKRA 3ZSRA 3ZT3A 1QSSA 1DTTA 4BDYA 2G8HA 3SI6A 3SQ4A 5HRRA 2WOMA 1SKSA 2X78A 4ZTFA 4CFAA 3NF6A 1S9EA 3AVNA 4K8XA 1KCFA 4M3XA 1HNIA 3L2RA 2YHBA 1JXBA 2PYLA 1JXEA 1B9DA 1YVUA 3HP9A 3QLHA 4MFBA 1L3VA 4KI4A 2KFZA 1SL1A 3LP2A 3VQ9A 1TKTA 1LV5A 3DYAA 3LPTA 3DRSA 4JS4A 1TK5A 4DLGA 3BGRA 3L2UA 1RT7A 4CGFA 1N5YA 1VSLA 1RILA 4FW1A 3O3FA 3DRRA 3AVHA 3EY1A 1UOCA 1J54A 3PX0A 3AVLA 4DQRA 5KGWA 3VQ8A 1C1CA 3ZCMA 3NF9A 2OA8A 1J5OA 2FBYA 1NOZA 3AO5A 4CHYA 4NCAA 1BCMA 4CJVA 3ZT1A 1L3TA 3IG1A 4ZHRA 2G8FA 2BE2A 3P83D 5CZ1A 1BQNA 2LSNA 4OVLA 3ZSZA 3KIOA 3LP3A 3HK2A 4CECA 3V9WA 3TARA 1NKBA 4B9LA 3QNNA 3CG7A 4KTQA 2HNDA 5SWMA 1R0AA 4FJNA 1KVBA 4DTUA 4QCLA 3IS9A 5C24A 2YNIA 3AVIA 1JL2A 3OVNA 3KJVA 3AO3A 4Z0UA 1UA0A 5HBMA 3O4NA 3LWMA 3QERA 1RTJA 3NH1A 2HHXA 3RTVA 1QHTA 3HM9A 5CYQA 3OYCA 3SQ2A 4Z4FA 3WNFA 3SPYA 1JLFA 4W5RA 3F9KA 1JLBA 4RW7A 2A1RA 4FJLA 1G15A 2E4LA 3OYNA 3K5MA 3VQBA 1VRTA 4HVJA 1XWLA 1D9FA 2G8KA 3BDPA 3TWHA 1RBSA 3TAFA 1IO2A 2Z1IA 1TK0A 1NK5A 4KPYA 4C8MA 1ASVA 1J9AA 4RW8A 4OPKA 3NCIA 2OZMA 1SL2A 1ZBIA 3SQ0A 4CE9A 1RDBA 5KI6A 4DTPA 2ATQA 3I0RA 4O0JA 3F73A 3V9SA 1TKDA 1WSIA 4IG0A 4CJRA 3PX6A 2HVIA 2YKMA 3CFOA 4YFUA 1L5UA 3EYZA 3QIOA 1IG9A 2OYQA 3CQ8A 4F3OA 4HCCA 3NE6A 4DTJA 1JL1A 1BI4B 1GOAA 1REVA 2Y1IA 4FJ9A 3P1GA 1Q9YA 2HHTA 4DFJA 1WLJA 4Q0BA 4OKJA 4B8AB 4Z4CA 4ELTA 2ZQBA 3HL8A 1TL3A 4FK4A 4AILC 3V81A 4HTUA 3HO1A 3NF7A 4FJHA 3ZT2A 4CIEA 4ICLA 4DTRA 3OS1A 4CJFA 4H8KA 4CJWA 3S3MA 1NKEA 3KD1E 5HLFA 3AV9A 3VQEA 3I8DA 1U4BA 4EP5A 2R7YA 3QINA 5HROA 1CLQA 4JLHA 4HUGA 4KHYA 1TVRA 4J2EA 1KTQA 1WN7A 1VSHA 2X6SA 1Z26A 1VSJA 4BDZA 1WNSA 4BE1A 3SV4A 1LAWA 3QEPA 3B6PA 1NJZA 4Q5VA 1RTHA 2Z1HA 3MEDA 4OKEA 3LWLA 3TAGA 4PUOA 3V9ZA 2OPPA 4CJKA 1WSGA 1TL1A 5KTQA 1TAUA 2IC3A 4ZTJA 5SZTA 1VK0A 4DSFA 4B9UA 3CYMA 4FW2A 3VQ7A 4AHSA 1NJWA 1U49A 3DLHA 4Z4EA 3VQ6A 4CEBA 5J2PA 3VQ4A 1TKZA 3NH2A 2WONA 3AO2A 1RCHA 3O3HA 3G0ZA 3S3OA 1QSYA 3ASMA 4M45A 3DM2A 4C8OA 4JRQA 2HHUA 4KHQA 4CERA 4OPJA 4G1QA 1KSPA 1GOBA 3HP6A 2FBTA 4FZYA 4GMJB 1C6VA 1SUQA 3PUFA 1EP4A 4CEEA 1T03A 3G10A 2OPQA 3QNOA 3CFRA 2XY6A 2OPSA 3ZSXA 1ITGA 4CK2A 4E7IA 4DWIA 1HQUA 2B6AA 4CF8A 1X9MA 5FDLA 5HRPA 5DMRA 4CGJA 4DTOA 1BHLA 3LPUA 1ZBLA 2YV0X 1VRUA 3OS2A 2D0AA 4CJ3A 4AHCA 4CJEA 2G8WA 4KB0A 4CIGA 4CEQA 2XY5A 4O5BA 4DFMA 4FJKA 2DTUA 4CHPA 2QKBA 3T19A 3OYFA 4OLAA 3ALYA 1WAJA 4LSNA 4FM1A 4E89A 3MEEA 4EP4A 4FLXA 5FROA 4NYNA 4JS5A 2G8UA 1HYZA 3AVMA 4HUFA 2AJQA 3L2VA 4BACA 4FJIA 3D0PA 1GOCA 2IAJA 5E41A 3QESA 5T7BA 3P5JA 1ZBUA 4IFVA 1K6YA 1I3AA 4DFPA 4DTSA 4KV8A 4O4GA 4RW6A 1VSKA 3HJFA 1IKYA 4M3YA 4PQUA 3L3VA 2QK9A 1LWFA 3AVJA 2W42A 4UQGA 4CGHA 1ZYQA 2KZMA 1EX4A 4KHUA 4AHUA 4Y1CA 3ZSOA 1S6PA 1D8YA 2F8TA 3DLBA 3QO9A 2O4GA 2D0BA 2P51A 4I2PA 3VQPA 4DQSA 3LDSA 4E7HA 4IKFA 4M3WA 2ETJA 4ELVA 4BE0A 4CHQA 2RPIA 4AHRA 2IDOA 1BL3A 5HRNA 1NOYA 1QE1A 3H08A 2VG5A 4IBNA 1WSJA 4KO0A 1KVAA 5C42A 2YKNA 1S1TA 3L2QA 1HMVA 2HNYA 4KI6A 2XY7A 4ELUA 4E19A 3LZIA 1RT3A 3WNGA 3M8RA 2DFHA 2ITGA 3QETA 1HYSA 1U48A 4Z4HA 1CXQA 4DLEA 3VA3A 1F21A 3HVRA 2VWJA 2Q3SA 2XO7A 4CEDA 3LZJA 4I9QA 3V9XA 3OYBA 1JLAA 1RT5A 1YTUA 4FXDA 3MXIA 1O1WA 2E6LA 4F4KA 1UWBA 4FLYA 2JGUA 5J1EA 3RMBA 3C6UA 4CHZA 1W0HA 3SJJA 1MU2A 4CJ5A 3QEWA 2VG7A 1U45A 3KD5E 5CYMA 1UA1A 4CJPA 2DY4A 1NKCA 4DF4A 1LW0A 2ZE2A 5I3UA 4C8LA 2HVHA 3QIPA 1C0UA 1YTAA 3OYMA 3C94A 1C1AA 3DOKA 4W5OA 3VQQA 3AA2A 4YNQA 1TK8A 3NFAA 4HCBA 4DQIA 1RBVA 4KHNA 1L3SA 3NGIA 1NK9A 1B9FA 4CHOA 4B9SA 4CFBA 3SQ1A 1QQCA 1TV6A 3LP1A 3T1AA 2E6MA 2P5OA 1TGOA 2RF2A 4IDKA 5K14A 4FLUA 3K59A 4QOZB 4AH9A 5HP1A 4OLBA 2XY8A 4IG3A 4AHTA 4CF0A 4N56A 1RT4A 4CF2A 3OYKA 3NDKA 5J2QA 2Y1JA 3WNEA 4E1MA 1UAXA 1XHZA 4CJ4A 2D0CA 1CZ9A 1FK9A 4DFKA 3SZ2A 3LALA 4BDPA 3KK1A 1Q8IA 3DMJA 5JS1A 3V1QA 2I5JA 1W9HA 1IH7A 3HYFA 1VSEA 4I7FA 4W5TA 1Z25A 3ZT0A 2Z1JA 3AA3A 4OJRA 1X1PA 4F2SA 4B9MA 4DQPA 4KHSA 2G8IA 2KZZA 3LP0A 2F8SA 3RR7A 4DSJA 1T7PA 3OYIA 3HVTA 2KTQA 5J2MA 3VQDA 1XC9A 4DS4A 4FJXA 4CK3A 1RT2A 2EX3A 2GV9A 4NCGA 3ITHA 4CHNA 3AVKA 3K5LA 3ZSYA 4FLTA 1KFSA 1KFDA 3V6DA 2GBZA 2XRIA 4CEAA 2YHAA 4FM2A 1HNVA 4W5NA 2OPRA 2PY5A 4FVMA 1NK7A 1FKOA 4KTWA 4DSLA 2QKKA 2EHGA 3C6TA 1BIZA 5KRTA 4FM0A 1U04A 1XI1A 1SL0A 1Y97A 4CGGA 3KK3A 4RW4A 1QSLA 1C0TA 1NJYA 2OZSA 4KKOA 3SUQA 3OYAA 1ASUA 2HHSA 1RBRA 4W5QA 1FKPA 3MEGA 4DU3A 1J53A 4GVMA 3KKSA 1RTIA 1LWCA 3TR8A 3TAEA 3SNNA 4CGIA 3KLFA 3OYJA 4OKKA 1DTQA 4BWJA 2VG6A 4CJSA 2GUIA 3DRPA 1BQMA 1BGXT 4I9LA 1A5WA 3DOLA 3QEIA 4B9VA 4F2RA 3CM6A 3U3YA 3TAQA 4M3ZA 1IKWA 4Y1DA 3TI0A 4B9TA 4FJMA 3DLEA 3U6FA 1VSIA 3MECA 5J2NA 4C8KA 4AHVA 3OY9A 4FZXC 3KTQA 3V1RA 4DTXA 2ZD1A 4CJUA 4B3OA 3AVFA 3HPOA 2Z1GA 4FJGA 3V1OA 4M3UA 3SPZA 4CJLA 4EZ9A 3OJSA 2KQ2A 4F8RA 2X6NA 1L3UA 4J2BA 3U3GA 3AVBA 2BGGA 3AVCA 1BI4A 1S5JA 3OJUA 4E7KA 4LH4A 4B08A 2X74A 3DLRA 3K2PA 4DMNA 4E3SA 4FJJA 4B9NA 4GW6A 2HMIA 4KREA 4CJTA 1N6QA 1RDCA 3KLIA 3OYLA 3K58A 4FLWA 3VQAA 4FK0A 3M8QA 1CXUA 3SV3A 1S1XA 4O55A 1QTMA 4DSIA 1RBUA 2FC0A 2B5JA 4C8NA 4TSXA 4DSEA 3SUPA 4N41A 5D3GA 3WNHA 1NK0A 5DK5A 3V9UA 1BCOA 1IKVA 1SKRA 4J2DA 4NCBA 4EZ6A 2RKIA 1ZBHA 1NJXA 3IAYA 1XHXA 1T8EA 1CZBA 1I39A 3PY8A 4RW9A 1EXQA 1KLMA 3JYTA 1Q9XA 3C95A 3TAMA 5CZ2A 2G8VA 3RRHA 1LAVA 1KRPA 4KB1A 3NF8A 3DI6A 2KFNA 1D5AA 3OYGA 3HPGA 1RDDA 1RT6A 4KHWA 4Z4IA 4DG1A 3K5NA 4JRPA 2BANA 3JSMA 5I42A 3AVGA 3RR8A 1U47A 1ZBFA 3OS0A 4Z4GA 4I2QA 4CCHA 4O0IA 3K5OA 1S9GA 5C25A 4N76A 3KLGA 3SYZA 4E7JA 3FFIA 3KLEA 3L8BA 4J2AA 3TABA 4L8RB 2QXFA 2HHQA 4FJ8A 1WSFA 4BWMA 3M8PA 1S1UA 1HPZA 4DS5A 3T3FA 4IFYA 1HRHA 4E0DA 2P1JA 4LD0A 1BISA 3NAEA 3NHGA 3DLGA 2P5GA 3SUNA 2VWKA 4PA1A 3B6OA 3HPHA 4QAGA 1JLQA 3M8SA 4CGDA 4DF8A 1C1BA 2PYJA 3VA0A 4ID1A 3ZSQA 3PV8A 1JLEA 3OYDA 5FRNA 4LSLA 2A1SA 3TAPA 1HQEA 3KLHA 4HUEA 4CIFA 5KRSA 1S1VA 1WSEA 2YNFA 3PO5A 4FYDA 4CESA 3L3UA 1VSMA 3RMCA 2HNZA 3IRXA 3LAKA 2YNHA 4KTZA 1NK6A 1LWEA 1T05A 2KW4A 1RBTA 1VSDA 3CFPA 4FZZA 4F3TA 3AA4A 4OGEA 4M42A 3HSTB 1RT1A 1NK8A 3RWUA 3OYEA 4ID5A 3VN5A 4R5PA 3NGZA 4N47A 3RMAA 3ZSWA 5FRMA 3ZT4A 1KLNA 2B4JA 2IGIA 4KFBA 1LW2A 2DFEA 1JKHA 4O44A 3VQCA 3OYHA 1X9WA 4CEFA 3D45A 4M41A 2PZSA 4DU4A 4FJ5A 3AO4A 2HHWA 1S1WA 4KAZA 3AVAA 3QEXA 2RN2A 1RDAA 1NK4A 5KGXA 3NH0A 1HYVA 1B92A 1TAQA 3HT3A 4CFCA 3S9HA 1SKWA 3MXJA 1SV5A 3SCXA 3LAMA 4CK1A 2HHVA 3O3GA 3E01A 4CF1A 4PWDA 3NGYA 2O4IA 1EKEA 3PX4A 1QS4A 1YT3A 4FCYA 2IOCA 4MQ3A 4PY5A 4CFDA 4H4OA 1WAFA 4HHTA 3TANA 1RTDA 2DFFA 3O4QA 1BIUA 4H4MA 4XIUA 1ASWA 1S6QA 4RG8A 4N5SA 3L2WA 3NBPA 3ZSVA
chains in the Genus database with same CATH superfamily
1RNHA 2V52B 2VWBA 3IDHA 4A2AA 1DT9A 4FLVA 4BE2A 3GDQA 3S3NA 1C0MA 4JYAK 2JWLA 2F96A 2ITMA 1VSFA 2D5RA 3THVA 4OGCA 1JLGA 2HB5A 4PL7A 1MWMA 4WF9L 3KK2A 2FBVA 1IKXA 4LFAK 3AAQA 4IZ9A 3LDOA 4BRNA 1D9DA 2JLEA 1SZ2A 2HMPA 3SUOA 1EETA 3MXMA 3CCRN 1DTTA 4BDYA 2G8HA 4A57A 5HRRA 2UUCK 1XMOK 4A59A 4GY2B 2YHBA 1JXBA 2PYLA 5AQSA 3HP9A 3QLHA 1L3VA 4C23A 4KI4A 2ASOA 3THWB 4CGFA 1N5YA 2I7PA 4ILGB 4H03B 4FWOA 3PX0A 4DQRA 2OA8A 3H3NO 4JKFA 3AO5A 2YJEA 4CJVA 3KK7A 2CGKA 4CD3A 1NMDA 4ZHRA 4DR7K 3P83D 2QWMA 4H5NA 5M1FA 1VQPN 4OVLA 2QI2A 3LL3A 3TARA 3WT0A 3C7NB 3DAWA 4FJNA 3AARA 1JL2A 3DXMA 3AO3A 2HOEA 2O8BB 3QERA 3LWMA 2HHXA 2QWOA 3RTVA 2RE2A 2ZGYA 1QHTA 1CZAN 3SQ2A 4Z4FA 4H5VA 4GKJK 2FLOA 1JLFA 3LDLA 3MN7A 2A1RA 4FJLA 1G15A 5GINA 1ATNA 2E4LA 3K5MA 3CMEN 3PIOL 3CCSN 1WUAA 3MMVA 3TAFA 2Z1IA 3CC2N 2QXLA 2VCPA 4JD2B 1QHAA 4DTPA 2ATQA 2QWLA 4O0JA 4IG0A 4CJRA 1GLEG 1NWKA 2YKMA 4YFUA 1L5UA 4HCCA 2OYQA 1IG9A 3CQ8A 3NE6A 4DTJA 1JL1A 1BI4B 1GOAA 1REVA 2Y1IA 2CH5A 3P1GA 4DFJA 1WLJA 4JI7K 4Q0BA 2E2QA 4ELTA 3MCAB 3L6QA 3V81A 5AQFA 3OHRA 3WXJA 4NXNK 4CJFA 1ILYA 4EP5A 2R7YA 1RDUA 3QINA 4HUGA 1HUXA 3O1WA 1TVRA 3VMFB 4B3OA 1VSHA 2QM1A 4BE1A 2G8IA 4BDZA 1LAWA 4JKBA 4OO1J 3V9ZA 3KHYA 4CJKA 3HZ6A 3UKUB 3SAGA 2OTLN 5BN8A 1E4GT 4FWNA 1YIJN 3VQ7A 4AHSA 1NJWA 1QZ5A 2WFBA 2HF4A 4CEBA 1KC8O 3VQ4A 4DV4K 1GLLO 3NH2A 4YY3K 2GX9A 3O3HA 4C8OA 3G0ZA 3ASMA 1ATSA 1K8KA 3HP6A 3O8MA 1G99A 3BZCA 1T03A 3G10A 2OPQA 4KH4A 2WTUA 3CFRA 3ZSXA 4XEIA 2VYPA 4CK2A 4GV6A 2A42A 4CF8A 5FDLA 4LFBK 4CGJA 2YV0X 4BY9C 4QS7A 2D0AA 3HOTA 4CIGA 2XY5A 4DFMA 2DTUA 3CXCM 1GLJO 4DV2K 5AQZA 5C0YA 4FLXA 2ZJRL 2G8UA 4JS5A 4HUFA 1VQ8N 1GOCA 5E41A 3MWTA 3QESA 5T7BA 1ZBUA 1K73O 4BR0A 4O4GA 4RW6A 3HJFA 1IKYA 4PQUA 4EIAA 2J4RA 2E8AA 1LWFA 2HF3A 4DCHA 4BROA 1Y64A 2KZMA 4F9OA 4B1WB 4Y1CA 1D8YA 1XQSC 3VETA 3H45C 2P51A 4I2PA 2ETJA 3WXLA 4CHQA 5C42A 4FWKA 3L2QA 1S1TA 4LF7K 1HMVA 2XY7A 3EN9A 2D4WA 1RT3A 3M8RA 2DFHA 3ENHA 5AZJB 1CXQA 3VA3A 3HVRA 1M90O 2Q3SA 3AGKA 4CEDA 1BU6O 4IOAL 2GWJA 3RVCA 4FLYA 3C6UA 4CHZA 1EO1A 1W0HA 2PAVA 2E2PA 4KH5A 5CYMA 4U67L 2D0OA 2ZE2A 3PSIA 1C1AA 3CPEA 4W5OA 4B3SK 3VESA 1NGBA 3CJ9A 5HL7L 5AQXA 1DEJA 5GIPA 1QQCA 2E6MA 4IDKA 5K14A 5HP1A 2NRVA 4CF0A 3SQ4A 4E1MA 4JI1K 2PBDA 1Q18A 3VERA 3LALA 3T1YK 1Q8IA 3CCQN 3THWA 2I5JA 1W9HA 4I7FA 1P90A 4W5TA 3ZT0A 4OJRA 3ZEUB 3G6EN 4KHSA 3LP0A 2F8SA 3RR7A 1DKGD 4AF1A 4DSJA 1RT2A 4CHNA 3K5LA 3WQTA 5BR9A 2UUBK 4CEAA 2YHAA 4NLCA 4FVMA 1FKOA 4KTWA 4DSLA 3VGLA 5KRTA 3EEQA 3C7NA 1SL0A 1Y97A 2HBMA 4CGGA 4RW4A 2ASMA 3NMUA 4PL8A 3KZBA 4X66K 3SUQA 3OYAA 1ASUA 3MEGA 3KKSA 1LWCA 3BP8A 3D2EB 3RSEB 1XNQK 3TR8A 3SNNA 4CGIA 3CJCA 4BGBA 3OYJA 2VQEK 4OKKA 2NLXA 4JK8A 3QEIA 1BQMA 1BGXT 4M3ZA 1IKWA 3TI0A 3CIPA 3O9UA 4B1VA 4B9QA 4C8KA 4FZXC 3KTQA 4KH6A 3C0BA 3FGUA 3LDQA 4DR3K 4DB3A 3SPZA 4EZ9A 3TSQA 1NG9A 1SAZA 4WQ4C 4ISFA 4CBUA 2X6NA 1HKGA 1BI4A 3C65A 1S5JA 3OBWA 4E3SA 2X74A 3DLRA 4FJJA 4EAHD 5A2QO 3TTCA 3J8AA 3TU5A 1N6QA 4JI2K 3KLIA 3VQAA 4QS9A 2B5JA 3O9TA 3SUPA 4N41A 5BREA 4M7XA 4DV5K 1Q7YO 3VEYA 3V9UA 1SKRA 4NCBA 2RKIA 1NJXA 5H1SQ 1IJJA 1YHQN 3QFPA 4UY8O 1KLMA 3UKUA 1EQYA 5CZ2A 1KRPA 2RHKA 3DI6A 3QFUA 5LMUK 3OYGA 4HTLA 1RDDA 4KHWA 3R3LA 4DG1A 4K0KK 4BRKA 4JRPA 3JSMA 3D2FB 1ZBFA 3DWLA 4O8UA 3N4QA 3ZLJA 3KLGA 3SYZA 4E7JA 3KLEA 3L8BA 2OTJN 4FJ8A 4BRFA 3M8PA 3T3FA 4IFYA 1HRHA 4E0DA 2P1JA 3FZKA 1BISA 3QB0A 3NHGA 1VAZA 2P9IA 2P5GA 4PA1A 1JLEA 4FL9A 5FRNA 4RTFD 1HQEA 1XNRK 5KRSA 3O5BA 3O9RA 1YUWA 3IRXA 3U9DA 4KTZA 1OH7A 1NK6A 4FZZA 4F3TA 4M42A 3HSTB 2HSTA 3RWUA 4ID5A 4M63C 1S72N 2A6AA 5DM6L 5FRMA 3SAFA 1KLNA 3L0QA 2IGIA 1LW2A 3P39A 1JKHA 3WQUA 4AM7A 3D45A 4PKGA 2PZSA 1T44A 4FJ5A 5CHIA 4KAZA 3QEXA 1TAQA 3SLCA 3SCXA 3HRGA 3O3GA 3E01A 1OH8A 4JEPA 2YHYA 4FCYA 4CFDA 4ILHA 5AZJA 1X9JA 2DFFA 4RG8A 3M8SA 1KFSA 3NBPA 4BRAA 4LH5A 1S3XA 2A41A 5AQWA 4LF5K 3ULEB 4NB4A 2BDPA 1TKXA 3ZX3A 2YHXA 3CM5A 3PO4A 1VQKN 4CEZA 2FSJA 4FOEA 4KHUA 3AO1A 1JLCA 1DLOA 5F2RA 4K43A 5EU7A 1S22A 3HXMA 3RMDA 4KRFA 4WQ5C 2ZWHA 4A2BA 3EZ5A 2YNGA 4BRHA 1WSHA 1A5XA 3V4IA 1X9SA 5AQJA 4B3TK 5E84A 3KKRA 3ZSRA 1ZC6A 1KD1O 3OBYA 2E1YA 1GLBG 4CFAA 4CZIA 3AVNA 1TYQA 5AQUA 3L2RA 3ZEUA 1B9DA 4LF4K 4H5RA 1SL1A 4BR9A 5AR0A 4DLGA 3L2UA 3EKSA 3CI5A 1RT7A 1VSLA 1DGKN 4FW1A 3O3FA 4YOXA 5FPDA 4GV3A 3AVHA 3EY1A 1NGEA 5KGWA 4NCAA 1J6ZA 1NOZA 5BRHA 3NVKA 3G25A 1L3TA 3VEOA 2ZGZA 4BC3A 3CCMN 2LSNA 5M1QA 3A0IX 3A5MC 3LP3A 4CECA 3D2EA 3RSEA 3CG7A 4CZJA 1R0AA 1RFQA 4QCLA 1BA1A 3KJVA 4X65K 3VEXA 1UA0A 3HTVA 5HBMA 3NH1A 3R1XA 3HM9A 3HSCA 4IFEA 2F9TA 3F9KA 3H6EA 4CVNE 4IDHA 4BGAA 2W6KA 1X3MA 4ISGA 4HVJA 3CJ1A 1HNZK 4LF8K 4HWIA 3H1VX 4KPYA 1NGAA 1BA0A 3SQ0A 4FOIA 1ZXOA 2CGLA 3F73A 4J8FA 4CZKA 4B1ZA 3PX6A 4AQYK 2A40A 3EYZA 2P9UB 3P31A 4I6MB 3E9PA 1EWRA 5AQRA 3D6RA 1Q81O 2ZQBA 4Y0WA 3HO1A 5BRDA 4CIEA 4ICLA 4FVUA 3S3MA 4H8KA 3F9MA 2KLAA 3AV9A 1U4BA 1CLQA 4JLHA 4W5NA 2HHTA 1WNSA 4FWQA 2Q0RA 1NGCA 2Z1HA 3D2FA 4IOCL 1WSGA 4XH1A 2IC3A 5SZTA 5LJWA 1U2VB 2YI1A 3DLHA 3VQ6A 4DR5K 5J2PA 4K41A 1TKZA 3SMPA 2WONA 3AO2A 1RCHA 3S3OA 2HHUA 4M45A 1YJWN 2QWRA 4FZYA 1SUQA 4WFBL 2OPSA 4E7IA 1ITGA 1HQUA 2B6AA 5GAGP 1X9MA 5HRPA 5DMRA 4DTOA 3GL1A 3LPUA 4CJ3A 4YORA 4CBXA 2CGJA 3T19A 3TSUA 4LSNA 4FM1A 1Q82O 5AQTA 4EP4A 4EHUA 5FROA 4BACA 4FJIA 1YITN 3CCEN 4JI4K 5F1XA 1VSKA 4FO0A 1C0FA 4UQGA 4CGHA 1ZYQA 4AHUA 3ZSOA 1S6PA 1WB9A 2F8TA 1OKJA 1M1KO 3VQPA 4DQSA 1GLCG 4IKFA 2D1KA 3H08A 1W97L 2YKNA 3ULEA 4ELUA 1HYSA 2ITGA 5F0XA 4BVPA 3VTHA 4G9ZA 1F21A 2VWJA 4PHTX 5C2FA 1ZBSA 3OYBA 1JLAA 1KXPA 4YOUA 4CJ5A 1U45A 1D4XA 3LDNA 3KD5E 4CJPA 3CCUN 3J7ZO 4DF4A 1LW0A 2DPNA 3C94A 3TSPA 4A61A 3AA2A 3PIPL 5AQLA 5M1PA 4EHTA 2KKZA 4B1XB 3VTIA 2V7YA 4H0OA 1VQ4N 4B9SA 3T1AA 2CH6A 4JK7A 2E2NA 3IUCA 1VQON 4B1UB 5FPNA 3OYKA 4CF2A 4BQZA 5J2QA 2Y1JA 3FFKB 5AQQA 4CJ4A 5AQIA 2FSNA 4DFKA 4BDPA 5JS1A 1R59O 4IJAA 1MDUB 4F2SA 4B9MA 4DQPA 4JKGA 3UE5A 4DQ8A 3M3ZA 2KTQA 1XC9A 4DS4A 4FJXA 3ID6A 3N4PA 2EX3A 4FLTA 3ZSYA 3CPWM 2UXBK 1V4TA 1BDGA 3C6TA 3WEEB 3KK3A 3FZFA 1QSLA 3L4QA 2AP1A 4JKEA 1FKPA 3UB5A 4GVMA 1N8RO 5GIOA 1ESVA 2FF3B 4CJSA 4YDUC 3CM6A 3U3YA 3TAQA 3U6FA 1VSIA 5J2NA 1FW6A 3V1RA 1NGIA 2ZD1A 4CJUA 3HPOA 3OJSA 4F8RA 3AVBA 3MX5A 4I6MA 3VEWA 3F2KA 4E7KA 3OJUA 4LH4A 4B08A 2P9LB 3E9OA 3ZX0A 2ZJPL 2A3ZA 4LC9B 1RDCA 3OYLA 4FLWA 3J7AP 4CZFA 1Z6RA 3E66A 5EX5A 2FC0A 4C8NA 4RWTA 3Q7BA 2UYTA 3WNHA 1NK0A 3THXB 4J2DA 4EZ6A 1ZBHA 3EL2A 2QW9A 1VQ5N 3FLCO 1GLDG 3DLLL 3IMXA 1I39A 3FR0A 1Q9XA 2G8VA 3VEZA 1NNEA 3RRHA 1LAVA 4EFHA 1D5AA 1U2VA 2A5XA 3SBGA 3K5NA 1OH5A 2BANA 1P8ZA 1U47A 4Z4GA 4O0IA 3K5OA 1N33K 5C25A 2VGNA 4L8RB 4J2AA 3TABA 2HHQA 3CD6N 3I33A 4BWMA 3O6WA 4DS5A 3WXKA 4A62A 2P9NB 3DLGA 3MWPA 4IEIA 4GV9A 3B6OA 2E2OA 4CGDA 1YXQA 1C1BA 2PYJA 2QEXN 1HKCA 4LSLA 4CIFA 4CESA 2QWQA 1GLFO 1QQOA 1T05A 2KW4A 1RBTA 2GTDA 3CFPA 3CJAA 3SBTA 1RT1A 2O8EB 4YOVA 5ADXA 3ZSWA 2DFEA 2O8FB 3AO4A 3THYB 3NH0A 1HYVA 4H5WA 5KQ8A 3S9HA 4XH4A 4CF1A 3P4IA 1EKEA 1NLVA 4BR7A 3J7YP 2YHWA 2QTDA 4H4OA 4HHTA 4XIUA 3L2WA 2O8BA 3ZSVA 3NGZA 3UIQA 2FXUA 5CY4A 3AA5X 2UUAK 1NGGA 4WCEL 1WBDA 2HBKA 3K57A 3BF1A 4E1NA 4FJ7A 1BO5O 3RRGA 1A5VA 4WE1A 4CF9A 1HJRA 4M7YA 5JS2A 4CEOA 3VQ5A 3MN6A 3GOIA 4JD2A 5AZIB 4DSKA 3CMAN 3JS6A 4FWLA 3ISNC 3DLKA 4FLZA 1SQKA 2HW3A 5GADP 2QA4N 3SI6A 4JI3K 4BC4A 2WOMA 5C12A 4DKWA 3G71N 3NF6A 1S9EA 1NGDA 1KCFA 1JXEA 1YVUA 5GAHP 3SK3A 3B8AX 1LV5A 4JKCA 3DRSA 1TK5A 3W0LA 3FZLA 3BGRA 3MX2A 1RILA 1IBKK 1OVYA 5EOYA 3DRRA 1UOCA 3AVLA 3VQ8A 3NF9A 4YOTA 4CHYA 1J5OA 3ZT1A 1C0GA 3AGRA 2G8FA 4NLBA 5CZ1A 3ZSZA 3KIOA 3V9WA 4B9LA 1NJIO 3QNNA 2HNDA 1KVBA 4DTUA 1VQMN 2E88A 1HJOA 3IS9A 3OVNA 4DR6K 1JCEA 3O4NA 1RTJA 5CYQA 3OYCA 3SPYA 4K42A 1O13A 3I55N 4IEEA 3OYNA 2BTFA 5KPZA 1QQMA 4FWPA 3VF4A 1W2BM 1VRTA 5FLXO 1XWLA 2G8KA 3TWHA 1RBSA 1IO2A 1TK0A 1NK5A 4C8MA 1ASVA 1J9AA 2P9LA 5DM7L 3NCIA 4LF9K 3R8EA 4KBOA 1SL2A 1RDBA 3V9SA 4MO5A 1HPMA 2HVIA 3CFOA 2KZZA 4H0YB 3QIOA 3M1FA 4L3QA 2P9SB 4JHDB 1Q9YA 4OKJA 3THXA 2Q97A 1TL3A 3L4IA 4FK4A 5EXWA 4MLEA 4FJHA 4DTRA 3H1QA 3OS1A 1NKEA 2O8DB 3VQEA 2Q0UA 5HROA 1JJ2M 2VQFK 4JI5K 4KHYA 3SAHA 1KTQA 4PKIA 1WN7A 1OVQA 2X6SA 5AQMA 2OZSA 4ILJA 3B6PA 4Q5VA 1RTHA 4OKEA 2W6LA 3TAGA 2OPPA 5ADXH 1Z05A 4ZTJA 4DV6K 1VK0A 4B9UA 2I7NA 2QWPA 4BRIA 4H0TB 4Z4EA 2F7TA 2W40A 3O4WA 4BVOA 5FPMA 1K8AO 5M1KA 1X3NA 2P9NA 3UKRB 3CC4N 1FJGK 1QSYA 1XC3A 3ATUA 4KHQA 4CERA 4G1QA 1KSPA 4GMJB 1C6VA 3H3OB 3PUFA 3QNOA 4GKKK 4DWIA 3A5NC 1VQ7N 4LF6K 1BHLA 1VRUA 3OS2A 4AHCA 3G4SN 1BWFO 4FWMA 4KB0A 4CEQA 5B8HA 4CHPA 3OYFA 4OLAA 2O8EA 3AY9A 3VENA 4DHYA 4OX9K 3O9SA 1HYZA 2AJQA 2O8FA 2YX6A 3D0PA 2IAJA 3THYA 2ZF5O 4CZLA 4DFPA 5AQVA 5M1OA 4M3YA 3L3VA 1IBMK 2W42A 3Q7CA 4E1JA 3S41A 5JVHL 3LDSA 4V19S 4BRGA 1NGFA 4ELVA 3A5OC 2RPIA 4AHRA 2P9KB 1IBLK 1QE1A 2VG5A 4KO0A 1WSJA 1KVAA 2FSKA 3KWGA 4JKAA 4KI6A 3CJBA 3LZIA 3QETA 3W3DA 3E9LA 3IFRA 4DV3K 3M6GA 4JN4A 3T69A 3LZJA 4QS8A 4I9QA 4LFCK 1RT5A 4WQ4A 4FXDA 3MXIA 2E6LA 4F4KA 1UWBA 5ELZA 3C6AA 3SJJA 3CF5L 3QEWA 1UA1A 3VGMA 5AZIA 5I3UA 4C8LA 3QIPA 1U6ZA 3DOKA 3BZKA 4XH5A 3ENOA 3NFAA 4ISEA 1J5EK 4HCBA 1RBVA 1N36K 1NK9A 4X64K 4B3MK 4CHOA 3SQ1A 1TV6A 5AFUA 1TGOA 3ZETB 4FLUA 3K59A 4QOZB 4OLBA 4IG3A 4AHTA 4FJ9A 3O1BA 1RT4A 4N56A 3NDKA 2IVOA 1UAXA 3LM9A 2D0CA 1CZ9A 2O8CB 3V1QA 1IH7A 1VSEA 1Z25A 1JCGA 3AA3A 3HBTA 1X1PA 5AJ3K 4C1NK 1VQLN 5IWAK 3GE1A 4H0XB 1EWQA 3VQDA 4CK3A 5C2DA 2GV9A 5AQPA 1BOTO 1KFDA 2PY5A 3CQYA 2EHGA 1BIZA 2WUSA 3I56N 1XI1A 1C0TA 1NJYA 5KPTA 3K9KA 4KKOA 3JXUA 1JCFA 4BG9A 1RBRA 4W5QA 4DU3A 3TAEA 2UXDK 3KLFA 1MWKA 4BWJA 2NRWA 2VG6A 2GUIA 4BREA 1HKBA 4B9VA 5KQDA 4IOXA 1YI2N 4JKHA 3MECA 4AHVA 3CJ7A 4DTXA 4DR4K 3CHWA 2Z1GA 4M3UA 4JI8K 3ENBA 4CJLA 2KQ2A 4A5AA 1XUPO 4IO9L 1L3UA 1KAXA 2P9SA 3U3GA 4J2BA 2BGGA 3AVCA 4JHDA 3K2PA 3VF6A 3QBWA 4GW6A 2HMIA 4JI6K 3PLAA 4CJTA 3K58A 3OA9A 4FK0A 3OTOK 1S1XA 3SV3A 1RBUA 2O8DA 4DSEA 4TSXA 5MLCQ 1BCOA 4BRLA 2GUPA 3IKMA 3IAYA 4BR5A 1T8EA 1CZBA 3PY8A 4RW9A 1EXQA 2Q1NA 4WQ5A 3NF8A 4BRQA 2KFNA 1LCUA 3HPGA 1RT6A 2NZTA 3TTDA 3BY5A 3RR8A 3AVGA 3OS0A 3MDQA 3ATVA 3QBXA 3UKRA 1HR0K 3K0SA 4O8KA 2QXFA 5E26A 4FWRA 1WSFA 2H3GX 3EE9A 1S1UA 1HPZA 4B1YB 4CZGA 1NU0A 3NAEA 1VQ9N 3WXIA 1JLQA 1YJ9N 4ID1A 4NO7A 3PV8A 2A1SA 3TAPA 4DV0K 1Q86O 3KLHA 4HUEA 1WSEA 2YNFA 3CETA 3BF3A 2HNZA 3LAKA 1VSDA 1N34K 3MCPA 4OGEA 5BPNA 3TTFA 3OYEA 4R5PA 4K25A 3RMAA 2Q36A 3E1YA 3ZT4A 2B4JA 4KFBA 5AQKA 4O44A 1X9WA 2HHWA 3PSFA 3AVAA 2RN2A 5KGXA 1B92A 3HT3A 4CFCA 4CZEA 5LJVA 4MDAA 2IVNA 2P9KA 1SV5A 2NRXA 2HHVA 2YCHA 5AFUH 3HI0A 4PWDA 3PX4A 1QS4A 1TUYA 4MQ3A 5BN9A 4PY5A 3CCVN 3O4QA 4H4MA 5TKWA 1ASWA 1S6QA 3KVGA 3BEXA 5GAEP 4NYFA 4M3RA 4BC2A 1V4SA 4FK2A 4CJQA 5HRSA 4M3TA 3QEVA 2FBXA 3ULDA 2IS3A 4K8ZA 4LY7A 2NUBA 3LANA 4DQQA 4DTNA 4DTMA 2XHBA 2NRRA 3LDPA 3F5TA 1KVCA 4DU1A 1T3VA 1YAGA 3I0SA 2NRZA 2EWSA 2IIRA 4KHPK 3ZETA 3MAQA 4E7LA 4B8CA 2P9UA 3A2FA 5AQYA 1FXXA 2P9IB 3ZT3A 1QSSA 2P9PB 3ZYYX 3TPQA 4FSVA 1SKSA 2X78A 2O8CA 4ZTFA 3KWIA 2W41A 4K8XA 1NBWA 5M1NA 4M3XA 1HNIA 4MFBA 2KFZA 3LP2A 3VQ9A 1TKTA 1HX1A 3DYAA 3LPTA 4JS4A 1QQNA 4DUYK 4JK9A 3MN9A 1J54A 4BG8A 4KTQA 1C1CA 3M5RA 1QZ6A 3ZCMA 4DR1K 2FBYA 1WOQA 1BCMA 2GEMA 4MDBA 3IG1A 2BE2A 5C15A 1BQNA 2BUPA 2ZM6K 3J81O 3HK2A 1IG8A 3P38A 1NKBA 3EKUA 3HOSA 5SWMA 5C24A 2YNIA 3AVIA 4NXMK 4JNEA 4Z0UA 2HBLA 5BRFA 3T7ZA 3R6MA 3WNFA 3U4LA 4W5RA 1JLBA 4IXCA 4RW7A 1YF5L 3GBTA 2GWKA 4R79A 3VQBA 3HM8A 3DJCA 1D9FA 2Q2RA 3BDPA 4IO8A 4RW8A 4OPKA 2OZMA 3U9ZA 1ZBIA 4CE9A 5KI6A 1TKDA 5LMNK 3I0RA 3GG4A 1WSIA 2UU9K 5C10A 4F3OA 1WBBA 3K9JA 2AA4A 4GNIA 4H0PA 5AQNA 3SJHA 5BR8K 4B8AB 4AM6A 4Z4CA 3I8BA 1KQSM 3HL8A 4CBWA 2KHOA 4AILC 4HTUA 4JV5K 3NF7A 1TYQB 2ASPA 2NRHA 4FPBA 3ZT2A 3KD1E 4CJWA 5HLFA 3I8DA 1H1VA 4J2EA 1Z26A 1VSJA 3SV4A 1NJZA 3QEPA 3EE8A 3MEDA 3LWLA 4PUOA 5KTQA 1TL1A 1TAUA 1RDWX 2BH1A 5JICA 4DSFA 3CYMA 4H0VB 4FW2A 1TUUA 4JAXA 1U49A 5AQGA 3DXKB 3DM2A 4JRQA 1GLAG 4OPJA 1NGJA 1GOBA 2FBTA 2NNWA 1EP4A 4CEEA 2XY6A 1VQNN 4BRDA 4X62K 3CCLN 1ZBLA 2IVPA 3VOVA 4CJEA 3A8YA 2G8WA 4FJKA 4O5BA 2PFUA 2QKBA 3BUZB 2NRTA 3C6HA 3ALYA 1WAJA 4E89A 3MEEA 3FZMA 4NYNA 3AVMA 3L2VA 3P5JA 4IFVA 5JLHA 3CERA 1K6YA 1I3AA 4YOWA 4DTSA 4KV8A 3MK6A 1LOTB 5KPRA 4B3RK 2QK9A 1NGHA 4CD1A 3AVJA 4YHHK 4BQLA 1EX4A 3AAPA 3MN5A 2Q31A 3WEEA 3DLBA 1BG3A 3QO9A 2O4GA 2D0BA 4YDUA 5BPMA 4E7HA 5JMVA 4M3WA 4BE0A 3SMSA 1NOYA 2IDOA 1BL3A 5HRNA 4IBNA 5JVGL 4DV7K 2HNYA 4E19A 3WNGA 1U48A 4Z4HA 4DLEA 3JAMO 5CR4A 2XO7A 3U8XA 3O80A 3V9XA 2D0PA 1YTUA 2HBJA 1O1WA 5I9EB 2E20A 2JGUA 5J1EA 3RMBA 1MU2A 2VG7A 5LL6Z 4FWSA 1IV0A 2DY4A 1NKCA 4DR2K 2HVHA 1C0UA 1YTAA 1BUPA 3OYMA 3VQQA 4YNQA 1TK8A 2GELA 4WYBA 4DQIA 2VGMA 4KHNA 1L3SA 2P9PA 5LY3A 3NGIA 1B9FA 1E3MA 2P5OA 4CFBA 4CZHA 4H5TA 3LP1A 2RF2A 4IWVA 2UXCK 4AH9A 1KAZA 2XY8A 4U7BA 3WNEA 1XHZA 2F9WA 4BC5A 1FK9A 1ATRA 3SZ2A 3FZHA 3KK1A 3DMJA 1QVGM 3HYFA 5EY4A 5JLFA 2Z1JA 1T6CA 1SS6A 1T7PA 3OYIA 3HVTA 4BR4A 5J2MA 1I94K 4NCGA 3ITHA 4OPAA 3AVKA 3V6DA 5FPEA 2GBZA 2XRIA 4FM2A 2E5LK 1HNVA 4C1NI 2OPRA 3VGKA 1NK7A 4PKHA 3T1HK 2QKKA 4WFAL 5AQOA 4FM0A 1W7AA 4JI0K 4MO4A 4O5FA 1U04A 2ZJQL 4BRMA 2V51B 1KAYA 2HHSA 5AQHA 4A5BA 1J53A 1RTIA 3ZX2A 2QWNA 1DTQA 3CC7N 3DXMB 1QVFM 1VHXA 3DRPA 4I9LA 4F2RA 1A5WA 3DOLA 2WBNA 1T6DA 3NVMA 1OH6A 4Y1DA 5EVZA 4B9TA 4FJMA 1HNXK 3DLEA 3OY9A 3CQXA 3H46O 3AVFA 4FJGA 3V1OA 4JKDA 1YVNA 4IJNA 4WFNL 4YOYA 2HHHK 4DMNA 4B9NA 1NMNA 4KREA 4CZMA 3WUHA 2OCEA 3M8QA 1CXUA 5BPLA 4O55A 1QTMA 4DSIA 1HNWK 3WXMB 1HLUA 3QICA 5D3GA 3J80O 5HOOA 5DK5A 1IKVA 2F4VK 1XHXA 4DV1K 3ID8A 4RCHA 3CCJN 3JYTA 1MA9B 3C95A 3O9QA 3TAMA 4KB1A 4JKGB 4FPAA 4Z4IA 3LM2A 5I42A 3DXKA 4MLHA 4I2QA 4CCHA 3FE1A 1S9GA 1XMQK 4N76A 3QMLA 3FFIA 3OW2M 3VPZA 4CJ7A 5TKYA 3R9PA 3O08A 3QDKA 4LD0A 4CI6A 2WC9A 2VWKA 3SUNA 3HPHA 4QAGA 1N32K 4DF8A 1YJNN 3VA0A 3ZSQA 1K8KB 2E1ZA 2YJFA 3OYDA 3EO3A 5IT9O 4DUZK 1S1VA 4FYDA 3D7EO 3PO5A 3RMCA 3L3UA 1VSMA 2JWKA 2YNHA 4BRPA 1LWEA 4BR2A 3AA4A 1NK8A 1RGIA 3VN5A 4N47A 5CE3A 1E4FT 2OANA 2FF6A 4Z94A 3VQCA 3OYHA 4CEFA 4M41A 4DU4A 1S1WA 2V7ZA 1RDAA 4GVEA 1NK4A 3VEVA 3VF2A 4BRCA 4CW7B 1SKWA 1VQ6N 1K9MO 3MXJA 1NM1A 4OPHA 3LAMA 4CK1A 3NGYA 2O4IA 3EZWA 1YT3A 2IOCA 3TANA 1WAFA 1RTDA 1BIUA 4N5SA 3A5LC
chains in the Genus database with same CATH topology
1RNHA 3UIQA 4LH5A 4NYFA 4FLVA 4BE2A 5CY4A 4M3RA 3AA5X 3S3NA 1C0MA 2BDPA 2F96A 3K57A 1VSFA 2D5RA 1TKXA 4E1NA 4FK2A 4CJQA 5HRSA 3CM5A 3THVA 3PO4A 4FJ7A 4M3TA 4OGCA 3QEVA 2FBXA 3RRGA 4CEZA 1JLGA 3ULDA 1A5VA 2IS3A 2HB5A 4WE1A 4LY7A 2NUBA 1HJRA 4CF9A 3LANA 4K8ZA 4DQQA 5JS2A 3AO1A 4DTMA 4DTNA 1JLCA 2XHBA 1DLOA 4CEOA 3VQ5A 4DSKA 5EU7A 3KK2A 3HXMA 3RMDA 2FBVA 1IKXA 1KVCA 4KRFA 3ISNC 4DU1A 3I0SA 3DLKA 3EZ5A 4FLZA 3MAQA 4E7LA 2YNGA 4B8CA 1WSHA 1A5XA 2JLEA 3V4IA 1X9SA 1D9DA 2HW3A 3SUOA 3A2FA 1EETA 3MXMA 1FXXA 3KKRA 3ZSRA 3ZT3A 1QSSA 1DTTA 4BDYA 2G8HA 3SI6A 3SQ4A 5HRRA 2WOMA 1SKSA 2X78A 4ZTFA 4CFAA 3NF6A 1S9EA 3AVNA 4K8XA 1KCFA 4M3XA 1HNIA 3L2RA 2YHBA 1JXBA 2PYLA 1JXEA 1B9DA 1YVUA 3HP9A 3QLHA 4MFBA 1L3VA 4KI4A 2KFZA 1SL1A 3LP2A 3VQ9A 1TKTA 1LV5A 3DYAA 3LPTA 3DRSA 4JS4A 1TK5A 4DLGA 3BGRA 3L2UA 1RT7A 4CGFA 1N5YA 1VSLA 1RILA 4FW1A 3O3FA 3DRRA 3AVHA 3EY1A 1UOCA 1J54A 3PX0A 3AVLA 4DQRA 5KGWA 3VQ8A 1C1CA 3ZCMA 3NF9A 2OA8A 1J5OA 2FBYA 1NOZA 3AO5A 4CHYA 4NCAA 1BCMA 4CJVA 3ZT1A 1L3TA 3IG1A 4ZHRA 2G8FA 2BE2A 3P83D 5CZ1A 1BQNA 2LSNA 4OVLA 3ZSZA 3KIOA 3LP3A 3HK2A 4CECA 3V9WA 3TARA 1NKBA 4B9LA 3QNNA 3CG7A 4KTQA 2HNDA 5SWMA 1R0AA 4FJNA 1KVBA 4DTUA 4QCLA 3IS9A 5C24A 2YNIA 3AVIA 1JL2A 3OVNA 3KJVA 3AO3A 4Z0UA 1UA0A 5HBMA 3O4NA 3LWMA 3QERA 1RTJA 3NH1A 2HHXA 3RTVA 1QHTA 3HM9A 5CYQA 3OYCA 3SQ2A 4Z4FA 3WNFA 3SPYA 1JLFA 4W5RA 3F9KA 1JLBA 4RW7A 2A1RA 4FJLA 1G15A 2E4LA 3OYNA 3K5MA 3VQBA 1VRTA 4HVJA 1XWLA 1D9FA 2G8KA 3BDPA 3TWHA 1RBSA 3TAFA 1IO2A 2Z1IA 1TK0A 1NK5A 4KPYA 4C8MA 1ASVA 1J9AA 4RW8A 4OPKA 3NCIA 2OZMA 1SL2A 1ZBIA 3SQ0A 4CE9A 1RDBA 5KI6A 4DTPA 2ATQA 3I0RA 4O0JA 3F73A 3V9SA 1TKDA 1WSIA 4IG0A 4CJRA 3PX6A 2HVIA 2YKMA 3CFOA 4YFUA 1L5UA 3EYZA 3QIOA 1IG9A 2OYQA 3CQ8A 4F3OA 4HCCA 3NE6A 4DTJA 1JL1A 1BI4B 1GOAA 1REVA 2Y1IA 4FJ9A 3P1GA 1Q9YA 2HHTA 4DFJA 1WLJA 4Q0BA 4OKJA 4B8AB 4Z4CA 4ELTA 2ZQBA 3HL8A 1TL3A 4FK4A 4AILC 3V81A 4HTUA 3HO1A 3NF7A 4FJHA 3ZT2A 4CIEA 4ICLA 4DTRA 3OS1A 4CJFA 4H8KA 4CJWA 3S3MA 1NKEA 3KD1E 5HLFA 3AV9A 3VQEA 3I8DA 1U4BA 4EP5A 2R7YA 3QINA 5HROA 1CLQA 4JLHA 4HUGA 4KHYA 1TVRA 4J2EA 1KTQA 1WN7A 1VSHA 2X6SA 1Z26A 1VSJA 4BDZA 1WNSA 4BE1A 3SV4A 1LAWA 3QEPA 3B6PA 1NJZA 4Q5VA 1RTHA 2Z1HA 3MEDA 4OKEA 3LWLA 3TAGA 4PUOA 3V9ZA 2OPPA 4CJKA 1WSGA 1TL1A 5KTQA 1TAUA 2IC3A 4ZTJA 5SZTA 1VK0A 4DSFA 4B9UA 3CYMA 4FW2A 3VQ7A 4AHSA 1NJWA 1U49A 3DLHA 4Z4EA 3VQ6A 4CEBA 5J2PA 3VQ4A 1TKZA 3NH2A 2WONA 3AO2A 1RCHA 3O3HA 3G0ZA 3S3OA 1QSYA 3ASMA 4M45A 3DM2A 4C8OA 4JRQA 2HHUA 4KHQA 4CERA 4OPJA 4G1QA 1KSPA 1GOBA 3HP6A 2FBTA 4FZYA 4GMJB 1C6VA 1SUQA 3PUFA 1EP4A 4CEEA 1T03A 3G10A 2OPQA 3QNOA 3CFRA 2XY6A 2OPSA 3ZSXA 1ITGA 4CK2A 4E7IA 4DWIA 1HQUA 2B6AA 4CF8A 1X9MA 5FDLA 5HRPA 5DMRA 4CGJA 4DTOA 1BHLA 3LPUA 1ZBLA 2YV0X 1VRUA 3OS2A 2D0AA 4CJ3A 4AHCA 4CJEA 2G8WA 4KB0A 4CIGA 4CEQA 2XY5A 4O5BA 4DFMA 4FJKA 2DTUA 4CHPA 2QKBA 3T19A 3OYFA 4OLAA 3ALYA 1WAJA 4LSNA 4FM1A 4E89A 3MEEA 4EP4A 4FLXA 5FROA 4NYNA 4JS5A 2G8UA 1HYZA 3AVMA 4HUFA 2AJQA 3L2VA 4BACA 4FJIA 3D0PA 1GOCA 2IAJA 5E41A 3QESA 5T7BA 3P5JA 1ZBUA 4IFVA 1K6YA 1I3AA 4DFPA 4DTSA 4KV8A 4O4GA 4RW6A 1VSKA 3HJFA 1IKYA 4M3YA 4PQUA 3L3VA 2QK9A 1LWFA 3AVJA 2W42A 4UQGA 4CGHA 1ZYQA 2KZMA 1EX4A 4KHUA 4AHUA 4Y1CA 3ZSOA 1S6PA 1D8YA 2F8TA 3DLBA 3QO9A 2O4GA 2D0BA 2P51A 4I2PA 3VQPA 4DQSA 3LDSA 4E7HA 4IKFA 4M3WA 2ETJA 4ELVA 4BE0A 4CHQA 2RPIA 4AHRA 2IDOA 1BL3A 5HRNA 1NOYA 1QE1A 3H08A 2VG5A 4IBNA 1WSJA 4KO0A 1KVAA 5C42A 2YKNA 1S1TA 3L2QA 1HMVA 2HNYA 4KI6A 2XY7A 4ELUA 4E19A 3LZIA 1RT3A 3WNGA 3M8RA 2DFHA 2ITGA 3QETA 1HYSA 1U48A 4Z4HA 1CXQA 4DLEA 3VA3A 1F21A 3HVRA 2VWJA 2Q3SA 2XO7A 4CEDA 3LZJA 4I9QA 3V9XA 3OYBA 1JLAA 1RT5A 1YTUA 4FXDA 3MXIA 1O1WA 2E6LA 4F4KA 1UWBA 4FLYA 2JGUA 5J1EA 3RMBA 3C6UA 4CHZA 1W0HA 3SJJA 1MU2A 4CJ5A 3QEWA 2VG7A 1U45A 3KD5E 5CYMA 1UA1A 4CJPA 2DY4A 1NKCA 4DF4A 1LW0A 2ZE2A 5I3UA 4C8LA 2HVHA 3QIPA 1C0UA 1YTAA 3OYMA 3C94A 1C1AA 3DOKA 4W5OA 3VQQA 3AA2A 4YNQA 1TK8A 3NFAA 4HCBA 4DQIA 1RBVA 4KHNA 1L3SA 3NGIA 1NK9A 1B9FA 4CHOA 4B9SA 4CFBA 3SQ1A 1QQCA 1TV6A 3LP1A 3T1AA 2E6MA 2P5OA 1TGOA 2RF2A 4IDKA 5K14A 4FLUA 3K59A 4QOZB 4AH9A 5HP1A 4OLBA 2XY8A 4IG3A 4AHTA 4CF0A 4N56A 1RT4A 4CF2A 3OYKA 3NDKA 5J2QA 2Y1JA 3WNEA 4E1MA 1UAXA 1XHZA 4CJ4A 2D0CA 1CZ9A 1FK9A 4DFKA 3SZ2A 3LALA 4BDPA 3KK1A 1Q8IA 3DMJA 5JS1A 3V1QA 2I5JA 1W9HA 1IH7A 3HYFA 1VSEA 4I7FA 4W5TA 1Z25A 3ZT0A 2Z1JA 3AA3A 4OJRA 1X1PA 4F2SA 4B9MA 4DQPA 4KHSA 2G8IA 2KZZA 3LP0A 2F8SA 3RR7A 4DSJA 1T7PA 3OYIA 3HVTA 2KTQA 5J2MA 3VQDA 1XC9A 4DS4A 4FJXA 4CK3A 1RT2A 2EX3A 2GV9A 4NCGA 3ITHA 4CHNA 3AVKA 3K5LA 3ZSYA 4FLTA 1KFSA 1KFDA 3V6DA 2GBZA 2XRIA 4CEAA 2YHAA 4FM2A 1HNVA 4W5NA 2OPRA 2PY5A 4FVMA 1NK7A 1FKOA 4KTWA 4DSLA 2QKKA 2EHGA 3C6TA 1BIZA 5KRTA 4FM0A 1U04A 1XI1A 1SL0A 1Y97A 4CGGA 3KK3A 4RW4A 1QSLA 1C0TA 1NJYA 2OZSA 4KKOA 3SUQA 3OYAA 1ASUA 2HHSA 1RBRA 4W5QA 1FKPA 3MEGA 4DU3A 1J53A 4GVMA 3KKSA 1RTIA 1LWCA 3TR8A 3TAEA 3SNNA 4CGIA 3KLFA 3OYJA 4OKKA 1DTQA 4BWJA 2VG6A 4CJSA 2GUIA 3DRPA 1BQMA 1BGXT 4I9LA 1A5WA 3DOLA 3QEIA 4B9VA 4F2RA 3CM6A 3U3YA 3TAQA 4M3ZA 1IKWA 4Y1DA 3TI0A 4B9TA 4FJMA 3DLEA 3U6FA 1VSIA 3MECA 5J2NA 4C8KA 4AHVA 3OY9A 4FZXC 3KTQA 3V1RA 4DTXA 2ZD1A 4CJUA 4B3OA 3AVFA 3HPOA 2Z1GA 4FJGA 3V1OA 4M3UA 3SPZA 4CJLA 4EZ9A 3OJSA 2KQ2A 4F8RA 2X6NA 1L3UA 4J2BA 3U3GA 3AVBA 2BGGA 3AVCA 1BI4A 1S5JA 3OJUA 4E7KA 4LH4A 4B08A 2X74A 3DLRA 3K2PA 4DMNA 4E3SA 4FJJA 4B9NA 4GW6A 2HMIA 4KREA 4CJTA 1N6QA 1RDCA 3KLIA 3OYLA 3K58A 4FLWA 3VQAA 4FK0A 3M8QA 1CXUA 3SV3A 1S1XA 4O55A 1QTMA 4DSIA 1RBUA 2FC0A 2B5JA 4C8NA 4TSXA 4DSEA 3SUPA 4N41A 5D3GA 3WNHA 1NK0A 5DK5A 3V9UA 1BCOA 1IKVA 1SKRA 4J2DA 4NCBA 4EZ6A 2RKIA 1ZBHA 1NJXA 3IAYA 1XHXA 1T8EA 1CZBA 1I39A 3PY8A 4RW9A 1EXQA 1KLMA 3JYTA 1Q9XA 3C95A 3TAMA 5CZ2A 2G8VA 3RRHA 1LAVA 1KRPA 4KB1A 3NF8A 3DI6A 2KFNA 1D5AA 3OYGA 3HPGA 1RDDA 1RT6A 4KHWA 4Z4IA 4DG1A 3K5NA 4JRPA 2BANA 3JSMA 5I42A 3AVGA 3RR8A 1U47A 1ZBFA 3OS0A 4Z4GA 4I2QA 4CCHA 4O0IA 3K5OA 1S9GA 5C25A 4N76A 3KLGA 3SYZA 4E7JA 3FFIA 3KLEA 3L8BA 4J2AA 3TABA 4L8RB 2QXFA 2HHQA 4FJ8A 1WSFA 4BWMA 3M8PA 1S1UA 1HPZA 4DS5A 3T3FA 4IFYA 1HRHA 4E0DA 2P1JA 4LD0A 1BISA 3NAEA 3NHGA 3DLGA 2P5GA 3SUNA 2VWKA 4PA1A 3B6OA 3HPHA 4QAGA 1JLQA 3M8SA 4CGDA 4DF8A 1C1BA 2PYJA 3VA0A 4ID1A 3ZSQA 3PV8A 1JLEA 3OYDA 5FRNA 4LSLA 2A1SA 3TAPA 1HQEA 3KLHA 4HUEA 4CIFA 5KRSA 1S1VA 1WSEA 2YNFA 3PO5A 4FYDA 4CESA 3L3UA 1VSMA 3RMCA 2HNZA 3IRXA 3LAKA 2YNHA 4KTZA 1NK6A 1LWEA 1T05A 2KW4A 1RBTA 1VSDA 3CFPA 4FZZA 4F3TA 3AA4A 4OGEA 4M42A 3HSTB 1RT1A 1NK8A 3RWUA 3OYEA 4ID5A 3VN5A 4R5PA 3NGZA 4N47A 3RMAA 3ZSWA 5FRMA 3ZT4A 1KLNA 2B4JA 2IGIA 4KFBA 1LW2A 2DFEA 1JKHA 4O44A 3VQCA 3OYHA 1X9WA 4CEFA 3D45A 4M41A 2PZSA 4DU4A 4FJ5A 3AO4A 2HHWA 1S1WA 4KAZA 3AVAA 3QEXA 2RN2A 1RDAA 1NK4A 5KGXA 3NH0A 1HYVA 1B92A 1TAQA 3HT3A 4CFCA 3S9HA 1SKWA 3MXJA 1SV5A 3SCXA 3LAMA 4CK1A 2HHVA 3O3GA 3E01A 4CF1A 4PWDA 3NGYA 2O4IA 1EKEA 3PX4A 1QS4A 1YT3A 4FCYA 2IOCA 4MQ3A 4PY5A 4CFDA 4H4OA 1WAFA 4HHTA 3TANA 1RTDA 2DFFA 3O4QA 1BIUA 4H4MA 4XIUA 1ASWA 1S6QA 4RG8A 4N5SA 3L2WA 3NBPA 3ZSVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1RNH A;  3UIQ A;  4LH5 A;  4NYF A;  4FLV A;  4BE2 A;  5CY4 A;  4M3R A;  3AA5 X;  3S3N A;  1C0M A;  2BDP A;  2F96 A;  3K57 A;  1VSF A;  2D5R A;  1TKX A;  4E1N A;  4FK2 A;  4CJQ A;  5HRS A;  3CM5 A;  3THV A;  3PO4 A;  4FJ7 A;  4M3T A;  4OGC A;  3QEV A;  2FBX A;  3RRG A;  4CEZ A;  1JLG A;  3ULD A;  1A5V A;  2IS3 A;  2HB5 A;  4WE1 A;  4LY7 A;  2NUB A;  1HJR A;  4CF9 A;  3LAN A;  4K8Z A;  4DQQ A;  5JS2 A;  3AO1 A;  4DTM A;  4DTN A;  1JLC A;  2XHB A;  1DLO A;  4CEO A;  3VQ5 A;  4DSK A;  5EU7 A;  3KK2 A;  3HXM A;  3RMD A;  2FBV A;  1IKX A;  1KVC A;  4KRF A;  3ISN C;  4DU1 A;  3I0S A;  3DLK A;  3EZ5 A;  4FLZ A;  3MAQ A;  4E7L A;  2YNG A;  4B8C A;  1WSH A;  1A5X A;  2JLE A;  3V4I A;  1X9S A;  1D9D A;  2HW3 A;  3SUO A;  3A2F A;  1EET A;  3MXM A;  1FXX A;  3KKR A;  3ZSR A;  3ZT3 A;  1QSS A;  1DTT A;  4BDY A;  2G8H A;  3SI6 A;  3SQ4 A;  5HRR A;  2WOM A;  1SKS A;  2X78 A;  4ZTF A;  4CFA A;  3NF6 A;  1S9E A;  3AVN A;  4K8X A;  1KCF A;  4M3X A;  1HNI A;  3L2R A;  2YHB A;  1JXB A;  2PYL A;  1JXE A;  1B9D A;  1YVU A;  3HP9 A;  3QLH A;  4MFB A;  1L3V A;  4KI4 A;  2KFZ A;  1SL1 A;  3LP2 A;  3VQ9 A;  1TKT A;  1LV5 A;  3DYA A;  3LPT A;  3DRS A;  4JS4 A;  1TK5 A;  4DLG A;  3BGR A;  3L2U A;  1RT7 A;  4CGF A;  1N5Y A;  1VSL A;  1RIL A;  4FW1 A;  3O3F A;  3DRR A;  3AVH A;  3EY1 A;  1UOC A;  1J54 A;  3PX0 A;  3AVL A;  4DQR A;  5KGW A;  3VQ8 A;  1C1C A;  3ZCM A;  3NF9 A;  2OA8 A;  1J5O A;  2FBY A;  1NOZ A;  3AO5 A;  4CHY A;  4NCA A;  1BCM A;  4CJV A;  3ZT1 A;  1L3T A;  3IG1 A;  4ZHR A;  2G8F A;  2BE2 A;  3P83 D;  5CZ1 A;  1BQN A;  2LSN A;  4OVL A;  3ZSZ A;  3KIO A;  3LP3 A;  3HK2 A;  4CEC A;  3V9W A;  3TAR A;  1NKB A;  4B9L A;  3QNN A;  3CG7 A;  4KTQ A;  2HND A;  5SWM A;  1R0A A;  4FJN A;  1KVB A;  4DTU A;  4QCL A;  3IS9 A;  5C24 A;  2YNI A;  3AVI A;  1JL2 A;  3OVN A;  3KJV A;  3AO3 A;  4Z0U A;  1UA0 A;  5HBM A;  3O4N A;  3LWM A;  3QER A;  1RTJ A;  3NH1 A;  2HHX A;  3RTV A;  1QHT A;  3HM9 A;  5CYQ A;  3OYC A;  3SQ2 A;  4Z4F A;  3WNF A;  3SPY A;  1JLF A;  4W5R A;  3F9K A;  1JLB A;  4RW7 A;  2A1R A;  4FJL A;  1G15 A;  2E4L A;  3OYN A;  3K5M A;  3VQB A;  1VRT A;  4HVJ A;  1XWL A;  1D9F A;  2G8K A;  3BDP A;  3TWH A;  1RBS A;  3TAF A;  1IO2 A;  2Z1I A;  1TK0 A;  1NK5 A;  4KPY A;  4C8M A;  1ASV A;  1J9A A;  4RW8 A;  4OPK A;  3NCI A;  2OZM A;  1SL2 A;  1ZBI A;  3SQ0 A;  4CE9 A;  1RDB A;  5KI6 A;  4DTP A;  2ATQ A;  3I0R A;  4O0J A;  3F73 A;  3V9S A;  1TKD A;  1WSI A;  4IG0 A;  4CJR A;  3PX6 A;  2HVI A;  2YKM A;  3CFO A;  4YFU A;  1L5U A;  3EYZ A;  3QIO A;  1IG9 A;  2OYQ A;  3CQ8 A;  4F3O A;  4HCC A;  3NE6 A;  4DTJ A;  1JL1 A;  1BI4 B;  1GOA A;  1REV A;  2Y1I A;  4FJ9 A;  3P1G A;  1Q9Y A;  2HHT A;  4DFJ A;  1WLJ A;  4Q0B A;  4OKJ A;  4B8A B;  4Z4C A;  4ELT A;  2ZQB A;  3HL8 A;  1TL3 A;  4FK4 A;  4AIL C;  3V81 A;  4HTU A;  3HO1 A;  3NF7 A;  4FJH A;  3ZT2 A;  4CIE A;  4ICL A;  4DTR A;  3OS1 A;  4CJF A;  4H8K A;  4CJW A;  3S3M A;  1NKE A;  3KD1 E;  5HLF A;  3AV9 A;  3VQE A;  3I8D A;  1U4B A;  4EP5 A;  2R7Y A;  3QIN A;  5HRO A;  1CLQ A;  4JLH A;  4HUG A;  4KHY A;  1TVR A;  4J2E A;  1KTQ A;  1WN7 A;  1VSH A;  2X6S A;  1Z26 A;  1VSJ A;  4BDZ A;  1WNS A;  4BE1 A;  3SV4 A;  1LAW A;  3QEP A;  3B6P A;  1NJZ A;  4Q5V A;  1RTH A;  2Z1H A;  3MED A;  4OKE A;  3LWL A;  3TAG A;  4PUO A;  3V9Z A;  2OPP A;  4CJK A;  1WSG A;  1TL1 A;  5KTQ A;  1TAU A;  2IC3 A;  4ZTJ A;  5SZT A;  1VK0 A;  4DSF A;  4B9U A;  3CYM A;  4FW2 A;  3VQ7 A;  4AHS A;  1NJW A;  1U49 A;  3DLH A;  4Z4E A;  3VQ6 A;  4CEB A;  5J2P A;  3VQ4 A;  1TKZ A;  3NH2 A;  2WON A;  3AO2 A;  1RCH A;  3O3H A;  3G0Z A;  3S3O A;  1QSY A;  3ASM A;  4M45 A;  3DM2 A;  4C8O A;  4JRQ A;  2HHU A;  4KHQ A;  4CER A;  4OPJ A;  4G1Q A;  1KSP A;  1GOB A;  3HP6 A;  2FBT A;  4FZY A;  4GMJ B;  1C6V A;  1SUQ A;  3PUF A;  1EP4 A;  4CEE A;  1T03 A;  3G10 A;  2OPQ A;  3QNO A;  3CFR A;  2XY6 A;  2OPS A;  3ZSX A;  1ITG A;  4CK2 A;  4E7I A;  4DWI A;  1HQU A;  2B6A A;  4CF8 A;  1X9M A;  5FDL A;  5HRP A;  5DMR A;  4CGJ A;  4DTO A;  1BHL A;  3LPU A;  1ZBL A;  2YV0 X;  1VRU A;  3OS2 A;  2D0A A;  4CJ3 A;  4AHC A;  4CJE A;  2G8W A;  4KB0 A;  4CIG A;  4CEQ A;  2XY5 A;  4O5B A;  4DFM A;  4FJK A;  2DTU A;  4CHP A;  2QKB A;  3T19 A;  3OYF A;  4OLA A;  3ALY A;  1WAJ A;  4LSN A;  4FM1 A;  4E89 A;  3MEE A;  4EP4 A;  4FLX A;  5FRO A;  4NYN A;  4JS5 A;  2G8U A;  1HYZ A;  3AVM A;  4HUF A;  2AJQ A;  3L2V A;  4BAC A;  4FJI A;  3D0P A;  1GOC A;  2IAJ A;  5E41 A;  3QES A;  5T7B A;  3P5J A;  1ZBU A;  4IFV A;  1K6Y A;  1I3A A;  4DFP A;  4DTS A;  4KV8 A;  4O4G A;  4RW6 A;  1VSK A;  3HJF A;  1IKY A;  4M3Y A;  4PQU A;  3L3V A;  2QK9 A;  1LWF A;  3AVJ A;  2W42 A;  4UQG A;  4CGH A;  1ZYQ A;  2KZM A;  1EX4 A;  4KHU A;  4AHU A;  4Y1C A;  3ZSO A;  1S6P A;  1D8Y A;  2F8T A;  3DLB A;  3QO9 A;  2O4G A;  2D0B A;  2P51 A;  4I2P A;  3VQP A;  4DQS A;  3LDS A;  4E7H A;  4IKF A;  4M3W A;  2ETJ A;  4ELV A;  4BE0 A;  4CHQ A;  2RPI A;  4AHR A;  2IDO A;  1BL3 A;  5HRN A;  1NOY A;  1QE1 A;  3H08 A;  2VG5 A;  4IBN A;  1WSJ A;  4KO0 A;  1KVA A;  5C42 A;  2YKN A;  1S1T A;  3L2Q A;  1HMV A;  2HNY A;  4KI6 A;  2XY7 A;  4ELU A;  4E19 A;  3LZI A;  1RT3 A;  3WNG A;  3M8R A;  2DFH A;  2ITG A;  3QET A;  1HYS A;  1U48 A;  4Z4H A;  1CXQ A;  4DLE A;  3VA3 A;  1F21 A;  3HVR A;  2VWJ A;  2Q3S A;  2XO7 A;  4CED A;  3LZJ A;  4I9Q A;  3V9X A;  3OYB A;  1JLA A;  1RT5 A;  1YTU A;  4FXD A;  3MXI A;  1O1W A;  2E6L A;  4F4K A;  1UWB A;  4FLY A;  2JGU A;  5J1E A;  3RMB A;  3C6U A;  4CHZ A;  1W0H A;  3SJJ A;  1MU2 A;  4CJ5 A;  3QEW A;  2VG7 A;  1U45 A;  3KD5 E;  5CYM A;  1UA1 A;  4CJP A;  2DY4 A;  1NKC A;  4DF4 A;  1LW0 A;  2ZE2 A;  5I3U A;  4C8L A;  2HVH A;  3QIP A;  1C0U A;  1YTA A;  3OYM A;  3C94 A;  1C1A A;  3DOK A;  4W5O A;  3VQQ A;  3AA2 A;  4YNQ A;  1TK8 A;  3NFA A;  4HCB A;  4DQI A;  1RBV A;  4KHN A;  1L3S A;  3NGI A;  1NK9 A;  1B9F A;  4CHO A;  4B9S A;  4CFB A;  3SQ1 A;  1QQC A;  1TV6 A;  3LP1 A;  3T1A A;  2E6M A;  2P5O A;  1TGO A;  2RF2 A;  4IDK A;  5K14 A;  4FLU A;  3K59 A;  4QOZ B;  4AH9 A;  5HP1 A;  4OLB A;  2XY8 A;  4IG3 A;  4AHT A;  4CF0 A;  4N56 A;  1RT4 A;  4CF2 A;  3OYK A;  3NDK A;  5J2Q A;  2Y1J A;  3WNE A;  4E1M A;  1UAX A;  1XHZ A;  4CJ4 A;  2D0C A;  1CZ9 A;  1FK9 A;  4DFK A;  3SZ2 A;  3LAL A;  4BDP A;  3KK1 A;  1Q8I A;  3DMJ A;  5JS1 A;  3V1Q A;  2I5J A;  1W9H A;  1IH7 A;  3HYF A;  1VSE A;  4I7F A;  4W5T A;  1Z25 A;  3ZT0 A;  2Z1J A;  3AA3 A;  4OJR A;  1X1P A;  4F2S A;  4B9M A;  4DQP A;  4KHS A;  2G8I A;  2KZZ A;  3LP0 A;  2F8S A;  3RR7 A;  4DSJ A;  1T7P A;  3OYI A;  3HVT A;  2KTQ A;  5J2M A;  3VQD A;  1XC9 A;  4DS4 A;  4FJX A;  4CK3 A;  1RT2 A;  2EX3 A;  2GV9 A;  4NCG A;  3ITH A;  4CHN A;  3AVK A;  3K5L A;  3ZSY A;  4FLT A;  1KFS A;  1KFD A;  3V6D A;  2GBZ A;  2XRI A;  4CEA A;  2YHA A;  4FM2 A;  1HNV A;  4W5N A;  2OPR A;  2PY5 A;  4FVM A;  1NK7 A;  1FKO A;  4KTW A;  4DSL A;  2QKK A;  2EHG A;  3C6T A;  1BIZ A;  5KRT A;  4FM0 A;  1U04 A;  1XI1 A;  1SL0 A;  1Y97 A;  4CGG A;  3KK3 A;  4RW4 A;  1QSL A;  1C0T A;  1NJY A;  2OZS A;  4KKO A;  3SUQ A;  3OYA A;  1ASU A;  2HHS A;  1RBR A;  4W5Q A;  1FKP A;  3MEG A;  4DU3 A;  1J53 A;  4GVM A;  3KKS A;  1RTI A;  1LWC A;  3TR8 A;  3TAE A;  3SNN A;  4CGI A;  3KLF A;  3OYJ A;  4OKK A;  1DTQ A;  4BWJ A;  2VG6 A;  4CJS A;  2GUI A;  3DRP A;  1BQM A;  1BGX T;  4I9L A;  1A5W A;  3DOL A;  3QEI A;  4B9V A;  4F2R A;  3CM6 A;  3U3Y A;  3TAQ A;  4M3Z A;  1IKW A;  4Y1D A;  3TI0 A;  4B9T A;  4FJM A;  3DLE A;  3U6F A;  1VSI A;  3MEC A;  5J2N A;  4C8K A;  4AHV A;  3OY9 A;  4FZX C;  3KTQ A;  3V1R A;  4DTX A;  2ZD1 A;  4CJU A;  4B3O A;  3AVF A;  3HPO A;  2Z1G A;  4FJG A;  3V1O A;  4M3U A;  3SPZ A;  4CJL A;  4EZ9 A;  3OJS A;  2KQ2 A;  4F8R A;  2X6N A;  1L3U A;  4J2B A;  3U3G A;  3AVB A;  2BGG A;  3AVC A;  1BI4 A;  1S5J A;  3OJU A;  4E7K A;  4LH4 A;  4B08 A;  2X74 A;  3DLR A;  3K2P A;  4DMN A;  4E3S A;  4FJJ A;  4B9N A;  4GW6 A;  2HMI A;  4KRE A;  4CJT A;  1N6Q A;  1RDC A;  3KLI A;  3OYL A;  3K58 A;  4FLW A;  3VQA A;  4FK0 A;  3M8Q A;  1CXU A;  3SV3 A;  1S1X A;  4O55 A;  1QTM A;  4DSI A;  1RBU A;  2FC0 A;  2B5J A;  4C8N A;  4TSX A;  4DSE A;  3SUP A;  4N41 A;  5D3G A;  3WNH A;  1NK0 A;  5DK5 A;  3V9U A;  1BCO A;  1IKV A;  1SKR A;  4J2D A;  4NCB A;  4EZ6 A;  2RKI A;  1ZBH A;  1NJX A;  3IAY A;  1XHX A;  1T8E A;  1CZB A;  1I39 A;  3PY8 A;  4RW9 A;  1EXQ A;  1KLM A;  3JYT A;  1Q9X A;  3C95 A;  3TAM A;  5CZ2 A;  2G8V A;  3RRH A;  1LAV A;  1KRP A;  4KB1 A;  3NF8 A;  3DI6 A;  2KFN A;  1D5A A;  3OYG A;  3HPG A;  1RDD A;  1RT6 A;  4KHW A;  4Z4I A;  4DG1 A;  3K5N A;  4JRP A;  2BAN A;  3JSM A;  5I42 A;  3AVG A;  3RR8 A;  1U47 A;  1ZBF A;  3OS0 A;  4Z4G A;  4I2Q A;  4CCH A;  4O0I A;  3K5O A;  1S9G A;  5C25 A;  4N76 A;  3KLG A;  3SYZ A;  4E7J A;  3FFI A;  3KLE A;  3L8B A;  4J2A A;  3TAB A;  4L8R B;  2QXF A;  2HHQ A;  4FJ8 A;  1WSF A;  4BWM A;  3M8P A;  1S1U A;  1HPZ A;  4DS5 A;  3T3F A;  4IFY A;  1HRH A;  4E0D A;  2P1J A;  4LD0 A;  1BIS A;  3NAE A;  3NHG A;  3DLG A;  2P5G A;  3SUN A;  2VWK A;  4PA1 A;  3B6O A;  3HPH A;  4QAG A;  1JLQ A;  3M8S A;  4CGD A;  4DF8 A;  1C1B A;  2PYJ A;  3VA0 A;  4ID1 A;  3ZSQ A;  3PV8 A;  1JLE A;  3OYD A;  5FRN A;  4LSL A;  2A1S A;  3TAP A;  1HQE A;  3KLH A;  4HUE A;  4CIF A;  5KRS A;  1S1V A;  1WSE A;  2YNF A;  3PO5 A;  4FYD A;  4CES A;  3L3U A;  1VSM A;  3RMC A;  2HNZ A;  3IRX A;  3LAK A;  2YNH A;  4KTZ A;  1NK6 A;  1LWE A;  1T05 A;  2KW4 A;  1RBT A;  1VSD A;  3CFP A;  4FZZ A;  4F3T A;  3AA4 A;  4OGE A;  4M42 A;  3HST B;  1RT1 A;  1NK8 A;  3RWU A;  3OYE A;  4ID5 A;  3VN5 A;  4R5P A;  3NGZ A;  4N47 A;  3RMA A;  3ZSW A;  5FRM A;  3ZT4 A;  1KLN A;  2B4J A;  2IGI A;  4KFB A;  1LW2 A;  2DFE A;  1JKH A;  4O44 A;  3VQC A;  3OYH A;  1X9W A;  4CEF A;  3D45 A;  4M41 A;  2PZS A;  4DU4 A;  4FJ5 A;  3AO4 A;  2HHW A;  1S1W A;  4KAZ A;  3AVA A;  3QEX A;  2RN2 A;  1RDA A;  1NK4 A;  5KGX A;  3NH0 A;  1HYV A;  1B92 A;  1TAQ A;  3HT3 A;  4CFC A;  3S9H A;  1SKW A;  3MXJ A;  1SV5 A;  3SCX A;  3LAM A;  4CK1 A;  2HHV A;  3O3G A;  3E01 A;  4CF1 A;  4PWD A;  3NGY A;  2O4I A;  1EKE A;  3PX4 A;  1QS4 A;  1YT3 A;  4FCY A;  2IOC A;  4MQ3 A;  4PY5 A;  4CFD A;  4H4O A;  1WAF A;  4HHT A;  3TAN A;  1RTD A;  2DFF A;  3O4Q A;  1BIU A;  4H4M A;  4XIU A;  1ASW A;  1S6Q A;  4RG8 A;  4N5S A;  3L2W A;  3NBP A;  3ZSV A; 
#chains in the Genus database with same CATH topology
 1RNH A;  2V52 B;  2VWB A;  3IDH A;  4A2A A;  1DT9 A;  4FLV A;  4BE2 A;  3GDQ A;  3S3N A;  1C0M A;  4JYA K;  2JWL A;  2F96 A;  2ITM A;  1VSF A;  2D5R A;  3THV A;  4OGC A;  1JLG A;  2HB5 A;  4PL7 A;  1MWM A;  4WF9 L;  3KK2 A;  2FBV A;  1IKX A;  4LFA K;  3AAQ A;  4IZ9 A;  3LDO A;  4BRN A;  1D9D A;  2JLE A;  1SZ2 A;  2HMP A;  3SUO A;  1EET A;  3MXM A;  3CCR N;  1DTT A;  4BDY A;  2G8H A;  4A57 A;  5HRR A;  2UUC K;  1XMO K;  4A59 A;  4GY2 B;  2YHB A;  1JXB A;  2PYL A;  5AQS A;  3HP9 A;  3QLH A;  1L3V A;  4C23 A;  4KI4 A;  2ASO A;  3THW B;  4CGF A;  1N5Y A;  2I7P A;  4ILG B;  4H03 B;  4FWO A;  3PX0 A;  4DQR A;  2OA8 A;  3H3N O;  4JKF A;  3AO5 A;  2YJE A;  4CJV A;  3KK7 A;  2CGK A;  4CD3 A;  1NMD A;  4ZHR A;  4DR7 K;  3P83 D;  2QWM A;  4H5N A;  5M1F A;  1VQP N;  4OVL A;  2QI2 A;  3LL3 A;  3TAR A;  3WT0 A;  3C7N B;  3DAW A;  4FJN A;  3AAR A;  1JL2 A;  3DXM A;  3AO3 A;  2HOE A;  2O8B B;  3QER A;  3LWM A;  2HHX A;  2QWO A;  3RTV A;  2RE2 A;  2ZGY A;  1QHT A;  1CZA N;  3SQ2 A;  4Z4F A;  4H5V A;  4GKJ K;  2FLO A;  1JLF A;  3LDL A;  3MN7 A;  2A1R A;  4FJL A;  1G15 A;  5GIN A;  1ATN A;  2E4L A;  3K5M A;  3CME N;  3PIO L;  3CCS N;  1WUA A;  3MMV A;  3TAF A;  2Z1I A;  3CC2 N;  2QXL A;  2VCP A;  4JD2 B;  1QHA A;  4DTP A;  2ATQ A;  2QWL A;  4O0J A;  4IG0 A;  4CJR A;  1GLE G;  1NWK A;  2YKM A;  4YFU A;  1L5U A;  4HCC A;  2OYQ A;  1IG9 A;  3CQ8 A;  3NE6 A;  4DTJ A;  1JL1 A;  1BI4 B;  1GOA A;  1REV A;  2Y1I A;  2CH5 A;  3P1G A;  4DFJ A;  1WLJ A;  4JI7 K;  4Q0B A;  2E2Q A;  4ELT A;  3MCA B;  3L6Q A;  3V81 A;  5AQF A;  3OHR A;  3WXJ A;  4NXN K;  4CJF A;  1ILY A;  4EP5 A;  2R7Y A;  1RDU A;  3QIN A;  4HUG A;  1HUX A;  3O1W A;  1TVR A;  3VMF B;  4B3O A;  1VSH A;  2QM1 A;  4BE1 A;  2G8I A;  4BDZ A;  1LAW A;  4JKB A;  4OO1 J;  3V9Z A;  3KHY A;  4CJK A;  3HZ6 A;  3UKU B;  3SAG A;  2OTL N;  5BN8 A;  1E4G T;  4FWN A;  1YIJ N;  3VQ7 A;  4AHS A;  1NJW A;  1QZ5 A;  2WFB A;  2HF4 A;  4CEB A;  1KC8 O;  3VQ4 A;  4DV4 K;  1GLL O;  3NH2 A;  4YY3 K;  2GX9 A;  3O3H A;  4C8O A;  3G0Z A;  3ASM A;  1ATS A;  1K8K A;  3HP6 A;  3O8M A;  1G99 A;  3BZC A;  1T03 A;  3G10 A;  2OPQ A;  4KH4 A;  2WTU A;  3CFR A;  3ZSX A;  4XEI A;  2VYP A;  4CK2 A;  4GV6 A;  2A42 A;  4CF8 A;  5FDL A;  4LFB K;  4CGJ A;  2YV0 X;  4BY9 C;  4QS7 A;  2D0A A;  3HOT A;  4CIG A;  2XY5 A;  4DFM A;  2DTU A;  3CXC M;  1GLJ O;  4DV2 K;  5AQZ A;  5C0Y A;  4FLX A;  2ZJR L;  2G8U A;  4JS5 A;  4HUF A;  1VQ8 N;  1GOC A;  5E41 A;  3MWT A;  3QES A;  5T7B A;  1ZBU A;  1K73 O;  4BR0 A;  4O4G A;  4RW6 A;  3HJF A;  1IKY A;  4PQU A;  4EIA A;  2J4R A;  2E8A A;  1LWF A;  2HF3 A;  4DCH A;  4BRO A;  1Y64 A;  2KZM A;  4F9O A;  4B1W B;  4Y1C A;  1D8Y A;  1XQS C;  3VET A;  3H45 C;  2P51 A;  4I2P A;  2ETJ A;  3WXL A;  4CHQ A;  5C42 A;  4FWK A;  3L2Q A;  1S1T A;  4LF7 K;  1HMV A;  2XY7 A;  3EN9 A;  2D4W A;  1RT3 A;  3M8R A;  2DFH A;  3ENH A;  5AZJ B;  1CXQ A;  3VA3 A;  3HVR A;  1M90 O;  2Q3S A;  3AGK A;  4CED A;  1BU6 O;  4IOA L;  2GWJ A;  3RVC A;  4FLY A;  3C6U A;  4CHZ A;  1EO1 A;  1W0H A;  2PAV A;  2E2P A;  4KH5 A;  5CYM A;  4U67 L;  2D0O A;  2ZE2 A;  3PSI A;  1C1A A;  3CPE A;  4W5O A;  4B3S K;  3VES A;  1NGB A;  3CJ9 A;  5HL7 L;  5AQX A;  1DEJ A;  5GIP A;  1QQC A;  2E6M A;  4IDK A;  5K14 A;  5HP1 A;  2NRV A;  4CF0 A;  3SQ4 A;  4E1M A;  4JI1 K;  2PBD A;  1Q18 A;  3VER A;  3LAL A;  3T1Y K;  1Q8I A;  3CCQ N;  3THW A;  2I5J A;  1W9H A;  4I7F A;  1P90 A;  4W5T A;  3ZT0 A;  4OJR A;  3ZEU B;  3G6E N;  4KHS A;  3LP0 A;  2F8S A;  3RR7 A;  1DKG D;  4AF1 A;  4DSJ A;  1RT2 A;  4CHN A;  3K5L A;  3WQT A;  5BR9 A;  2UUB K;  4CEA A;  2YHA A;  4NLC A;  4FVM A;  1FKO A;  4KTW A;  4DSL A;  3VGL A;  5KRT A;  3EEQ A;  3C7N A;  1SL0 A;  1Y97 A;  2HBM A;  4CGG A;  4RW4 A;  2ASM A;  3NMU A;  4PL8 A;  3KZB A;  4X66 K;  3SUQ A;  3OYA A;  1ASU A;  3MEG A;  3KKS A;  1LWC A;  3BP8 A;  3D2E B;  3RSE B;  1XNQ K;  3TR8 A;  3SNN A;  4CGI A;  3CJC A;  4BGB A;  3OYJ A;  2VQE K;  4OKK A;  2NLX A;  4JK8 A;  3QEI A;  1BQM A;  1BGX T;  4M3Z A;  1IKW A;  3TI0 A;  3CIP A;  3O9U A;  4B1V A;  4B9Q A;  4C8K A;  4FZX C;  3KTQ A;  4KH6 A;  3C0B A;  3FGU A;  3LDQ A;  4DR3 K;  4DB3 A;  3SPZ A;  4EZ9 A;  3TSQ A;  1NG9 A;  1SAZ A;  4WQ4 C;  4ISF A;  4CBU A;  2X6N A;  1HKG A;  1BI4 A;  3C65 A;  1S5J A;  3OBW A;  4E3S A;  2X74 A;  3DLR A;  4FJJ A;  4EAH D;  5A2Q O;  3TTC A;  3J8A A;  3TU5 A;  1N6Q A;  4JI2 K;  3KLI A;  3VQA A;  4QS9 A;  2B5J A;  3O9T A;  3SUP A;  4N41 A;  5BRE A;  4M7X A;  4DV5 K;  1Q7Y O;  3VEY A;  3V9U A;  1SKR A;  4NCB A;  2RKI A;  1NJX A;  5H1S Q;  1IJJ A;  1YHQ N;  3QFP A;  4UY8 O;  1KLM A;  3UKU A;  1EQY A;  5CZ2 A;  1KRP A;  2RHK A;  3DI6 A;  3QFU A;  5LMU K;  3OYG A;  4HTL A;  1RDD A;  4KHW A;  3R3L A;  4DG1 A;  4K0K K;  4BRK A;  4JRP A;  3JSM A;  3D2F B;  1ZBF A;  3DWL A;  4O8U A;  3N4Q A;  3ZLJ A;  3KLG A;  3SYZ A;  4E7J A;  3KLE A;  3L8B A;  2OTJ N;  4FJ8 A;  4BRF A;  3M8P A;  3T3F A;  4IFY A;  1HRH A;  4E0D A;  2P1J A;  3FZK A;  1BIS A;  3QB0 A;  3NHG A;  1VAZ A;  2P9I A;  2P5G A;  4PA1 A;  1JLE A;  4FL9 A;  5FRN A;  4RTF D;  1HQE A;  1XNR K;  5KRS A;  3O5B A;  3O9R A;  1YUW A;  3IRX A;  3U9D A;  4KTZ A;  1OH7 A;  1NK6 A;  4FZZ A;  4F3T A;  4M42 A;  3HST B;  2HST A;  3RWU A;  4ID5 A;  4M63 C;  1S72 N;  2A6A A;  5DM6 L;  5FRM A;  3SAF A;  1KLN A;  3L0Q A;  2IGI A;  1LW2 A;  3P39 A;  1JKH A;  3WQU A;  4AM7 A;  3D45 A;  4PKG A;  2PZS A;  1T44 A;  4FJ5 A;  5CHI A;  4KAZ A;  3QEX A;  1TAQ A;  3SLC A;  3SCX A;  3HRG A;  3O3G A;  3E01 A;  1OH8 A;  4JEP A;  2YHY A;  4FCY A;  4CFD A;  4ILH A;  5AZJ A;  1X9J A;  2DFF A;  4RG8 A;  3M8S A;  1KFS A;  3NBP A;  4BRA A;  4LH5 A;  1S3X A;  2A41 A;  5AQW A;  4LF5 K;  3ULE B;  4NB4 A;  2BDP A;  1TKX A;  3ZX3 A;  2YHX A;  3CM5 A;  3PO4 A;  1VQK N;  4CEZ A;  2FSJ A;  4FOE A;  4KHU A;  3AO1 A;  1JLC A;  1DLO A;  5F2R A;  4K43 A;  5EU7 A;  1S22 A;  3HXM A;  3RMD A;  4KRF A;  4WQ5 C;  2ZWH A;  4A2B A;  3EZ5 A;  2YNG A;  4BRH A;  1WSH A;  1A5X A;  3V4I A;  1X9S A;  5AQJ A;  4B3T K;  5E84 A;  3KKR A;  3ZSR A;  1ZC6 A;  1KD1 O;  3OBY A;  2E1Y A;  1GLB G;  4CFA A;  4CZI A;  3AVN A;  1TYQ A;  5AQU A;  3L2R A;  3ZEU A;  1B9D A;  4LF4 K;  4H5R A;  1SL1 A;  4BR9 A;  5AR0 A;  4DLG A;  3L2U A;  3EKS A;  3CI5 A;  1RT7 A;  1VSL A;  1DGK N;  4FW1 A;  3O3F A;  4YOX A;  5FPD A;  4GV3 A;  3AVH A;  3EY1 A;  1NGE A;  5KGW A;  4NCA A;  1J6Z A;  1NOZ A;  5BRH A;  3NVK A;  3G25 A;  1L3T A;  3VEO A;  2ZGZ A;  4BC3 A;  3CCM N;  2LSN A;  5M1Q A;  3A0I X;  3A5M C;  3LP3 A;  4CEC A;  3D2E A;  3RSE A;  3CG7 A;  4CZJ A;  1R0A A;  1RFQ A;  4QCL A;  1BA1 A;  3KJV A;  4X65 K;  3VEX A;  1UA0 A;  3HTV A;  5HBM A;  3NH1 A;  3R1X A;  3HM9 A;  3HSC A;  4IFE A;  2F9T A;  3F9K A;  3H6E A;  4CVN E;  4IDH A;  4BGA A;  2W6K A;  1X3M A;  4ISG A;  4HVJ A;  3CJ1 A;  1HNZ K;  4LF8 K;  4HWI A;  3H1V X;  4KPY A;  1NGA A;  1BA0 A;  3SQ0 A;  4FOI A;  1ZXO A;  2CGL A;  3F73 A;  4J8F A;  4CZK A;  4B1Z A;  3PX6 A;  4AQY K;  2A40 A;  3EYZ A;  2P9U B;  3P31 A;  4I6M B;  3E9P A;  1EWR A;  5AQR A;  3D6R A;  1Q81 O;  2ZQB A;  4Y0W A;  3HO1 A;  5BRD A;  4CIE A;  4ICL A;  4FVU A;  3S3M A;  4H8K A;  3F9M A;  2KLA A;  3AV9 A;  1U4B A;  1CLQ A;  4JLH A;  4W5N A;  2HHT A;  1WNS A;  4FWQ A;  2Q0R A;  1NGC A;  2Z1H A;  3D2F A;  4IOC L;  1WSG A;  4XH1 A;  2IC3 A;  5SZT A;  5LJW A;  1U2V B;  2YI1 A;  3DLH A;  3VQ6 A;  4DR5 K;  5J2P A;  4K41 A;  1TKZ A;  3SMP A;  2WON A;  3AO2 A;  1RCH A;  3S3O A;  2HHU A;  4M45 A;  1YJW N;  2QWR A;  4FZY A;  1SUQ A;  4WFB L;  2OPS A;  4E7I A;  1ITG A;  1HQU A;  2B6A A;  5GAG P;  1X9M A;  5HRP A;  5DMR A;  4DTO A;  3GL1 A;  3LPU A;  4CJ3 A;  4YOR A;  4CBX A;  2CGJ A;  3T19 A;  3TSU A;  4LSN A;  4FM1 A;  1Q82 O;  5AQT A;  4EP4 A;  4EHU A;  5FRO A;  4BAC A;  4FJI A;  1YIT N;  3CCE N;  4JI4 K;  5F1X A;  1VSK A;  4FO0 A;  1C0F A;  4UQG A;  4CGH A;  1ZYQ A;  4AHU A;  3ZSO A;  1S6P A;  1WB9 A;  2F8T A;  1OKJ A;  1M1K O;  3VQP A;  4DQS A;  1GLC G;  4IKF A;  2D1K A;  3H08 A;  1W97 L;  2YKN A;  3ULE A;  4ELU A;  1HYS A;  2ITG A;  5F0X A;  4BVP A;  3VTH A;  4G9Z A;  1F21 A;  2VWJ A;  4PHT X;  5C2F A;  1ZBS A;  3OYB A;  1JLA A;  1KXP A;  4YOU A;  4CJ5 A;  1U45 A;  1D4X A;  3LDN A;  3KD5 E;  4CJP A;  3CCU N;  3J7Z O;  4DF4 A;  1LW0 A;  2DPN A;  3C94 A;  3TSP A;  4A61 A;  3AA2 A;  3PIP L;  5AQL A;  5M1P A;  4EHT A;  2KKZ A;  4B1X B;  3VTI A;  2V7Y A;  4H0O A;  1VQ4 N;  4B9S A;  3T1A A;  2CH6 A;  4JK7 A;  2E2N A;  3IUC A;  1VQO N;  4B1U B;  5FPN A;  3OYK A;  4CF2 A;  4BQZ A;  5J2Q A;  2Y1J A;  3FFK B;  5AQQ A;  4CJ4 A;  5AQI A;  2FSN A;  4DFK A;  4BDP A;  5JS1 A;  1R59 O;  4IJA A;  1MDU B;  4F2S A;  4B9M A;  4DQP A;  4JKG A;  3UE5 A;  4DQ8 A;  3M3Z A;  2KTQ A;  1XC9 A;  4DS4 A;  4FJX A;  3ID6 A;  3N4P A;  2EX3 A;  4FLT A;  3ZSY A;  3CPW M;  2UXB K;  1V4T A;  1BDG A;  3C6T A;  3WEE B;  3KK3 A;  3FZF A;  1QSL A;  3L4Q A;  2AP1 A;  4JKE A;  1FKP A;  3UB5 A;  4GVM A;  1N8R O;  5GIO A;  1ESV A;  2FF3 B;  4CJS A;  4YDU C;  3CM6 A;  3U3Y A;  3TAQ A;  3U6F A;  1VSI A;  5J2N A;  1FW6 A;  3V1R A;  1NGI A;  2ZD1 A;  4CJU A;  3HPO A;  3OJS A;  4F8R A;  3AVB A;  3MX5 A;  4I6M A;  3VEW A;  3F2K A;  4E7K A;  3OJU A;  4LH4 A;  4B08 A;  2P9L B;  3E9O A;  3ZX0 A;  2ZJP L;  2A3Z A;  4LC9 B;  1RDC A;  3OYL A;  4FLW A;  3J7A P;  4CZF A;  1Z6R A;  3E66 A;  5EX5 A;  2FC0 A;  4C8N A;  4RWT A;  3Q7B A;  2UYT A;  3WNH A;  1NK0 A;  3THX B;  4J2D A;  4EZ6 A;  1ZBH A;  3EL2 A;  2QW9 A;  1VQ5 N;  3FLC O;  1GLD G;  3DLL L;  3IMX A;  1I39 A;  3FR0 A;  1Q9X A;  2G8V A;  3VEZ A;  1NNE A;  3RRH A;  1LAV A;  4EFH A;  1D5A A;  1U2V A;  2A5X A;  3SBG A;  3K5N A;  1OH5 A;  2BAN A;  1P8Z A;  1U47 A;  4Z4G A;  4O0I A;  3K5O A;  1N33 K;  5C25 A;  2VGN A;  4L8R B;  4J2A A;  3TAB A;  2HHQ A;  3CD6 N;  3I33 A;  4BWM A;  3O6W A;  4DS5 A;  3WXK A;  4A62 A;  2P9N B;  3DLG A;  3MWP A;  4IEI A;  4GV9 A;  3B6O A;  2E2O A;  4CGD A;  1YXQ A;  1C1B A;  2PYJ A;  2QEX N;  1HKC A;  4LSL A;  4CIF A;  4CES A;  2QWQ A;  1GLF O;  1QQO A;  1T05 A;  2KW4 A;  1RBT A;  2GTD A;  3CFP A;  3CJA A;  3SBT A;  1RT1 A;  2O8E B;  4YOV A;  5ADX A;  3ZSW A;  2DFE A;  2O8F B;  3AO4 A;  3THY B;  3NH0 A;  1HYV A;  4H5W A;  5KQ8 A;  3S9H A;  4XH4 A;  4CF1 A;  3P4I A;  1EKE A;  1NLV A;  4BR7 A;  3J7Y P;  2YHW A;  2QTD A;  4H4O A;  4HHT A;  4XIU A;  3L2W A;  2O8B A;  3ZSV A;  3NGZ A;  3UIQ A;  2FXU A;  5CY4 A;  3AA5 X;  2UUA K;  1NGG A;  4WCE L;  1WBD A;  2HBK A;  3K57 A;  3BF1 A;  4E1N A;  4FJ7 A;  1BO5 O;  3RRG A;  1A5V A;  4WE1 A;  4CF9 A;  1HJR A;  4M7Y A;  5JS2 A;  4CEO A;  3VQ5 A;  3MN6 A;  3GOI A;  4JD2 A;  5AZI B;  4DSK A;  3CMA N;  3JS6 A;  4FWL A;  3ISN C;  3DLK A;  4FLZ A;  1SQK A;  2HW3 A;  5GAD P;  2QA4 N;  3SI6 A;  4JI3 K;  4BC4 A;  2WOM A;  5C12 A;  4DKW A;  3G71 N;  3NF6 A;  1S9E A;  1NGD A;  1KCF A;  1JXE A;  1YVU A;  5GAH P;  3SK3 A;  3B8A X;  1LV5 A;  4JKC A;  3DRS A;  1TK5 A;  3W0L A;  3FZL A;  3BGR A;  3MX2 A;  1RIL A;  1IBK K;  1OVY A;  5EOY A;  3DRR A;  1UOC A;  3AVL A;  3VQ8 A;  3NF9 A;  4YOT A;  4CHY A;  1J5O A;  3ZT1 A;  1C0G A;  3AGR A;  2G8F A;  4NLB A;  5CZ1 A;  3ZSZ A;  3KIO A;  3V9W A;  4B9L A;  1NJI O;  3QNN A;  2HND A;  1KVB A;  4DTU A;  1VQM N;  2E88 A;  1HJO A;  3IS9 A;  3OVN A;  4DR6 K;  1JCE A;  3O4N A;  1RTJ A;  5CYQ A;  3OYC A;  3SPY A;  4K42 A;  1O13 A;  3I55 N;  4IEE A;  3OYN A;  2BTF A;  5KPZ A;  1QQM A;  4FWP A;  3VF4 A;  1W2B M;  1VRT A;  5FLX O;  1XWL A;  2G8K A;  3TWH A;  1RBS A;  1IO2 A;  1TK0 A;  1NK5 A;  4C8M A;  1ASV A;  1J9A A;  2P9L A;  5DM7 L;  3NCI A;  4LF9 K;  3R8E A;  4KBO A;  1SL2 A;  1RDB A;  3V9S A;  4MO5 A;  1HPM A;  2HVI A;  3CFO A;  2KZZ A;  4H0Y B;  3QIO A;  3M1F A;  4L3Q A;  2P9S B;  4JHD B;  1Q9Y A;  4OKJ A;  3THX A;  2Q97 A;  1TL3 A;  3L4I A;  4FK4 A;  5EXW A;  4MLE A;  4FJH A;  4DTR A;  3H1Q A;  3OS1 A;  1NKE A;  2O8D B;  3VQE A;  2Q0U A;  5HRO A;  1JJ2 M;  2VQF K;  4JI5 K;  4KHY A;  3SAH A;  1KTQ A;  4PKI A;  1WN7 A;  1OVQ A;  2X6S A;  5AQM A;  2OZS A;  4ILJ A;  3B6P A;  4Q5V A;  1RTH A;  4OKE A;  2W6L A;  3TAG A;  2OPP A;  5ADX H;  1Z05 A;  4ZTJ A;  4DV6 K;  1VK0 A;  4B9U A;  2I7N A;  2QWP A;  4BRI A;  4H0T B;  4Z4E A;  2F7T A;  2W40 A;  3O4W A;  4BVO A;  5FPM A;  1K8A O;  5M1K A;  1X3N A;  2P9N A;  3UKR B;  3CC4 N;  1FJG K;  1QSY A;  1XC3 A;  3ATU A;  4KHQ A;  4CER A;  4G1Q A;  1KSP A;  4GMJ B;  1C6V A;  3H3O B;  3PUF A;  3QNO A;  4GKK K;  4DWI A;  3A5N C;  1VQ7 N;  4LF6 K;  1BHL A;  1VRU A;  3OS2 A;  4AHC A;  3G4S N;  1BWF O;  4FWM A;  4KB0 A;  4CEQ A;  5B8H A;  4CHP A;  3OYF A;  4OLA A;  2O8E A;  3AY9 A;  3VEN A;  4DHY A;  4OX9 K;  3O9S A;  1HYZ A;  2AJQ A;  2O8F A;  2YX6 A;  3D0P A;  2IAJ A;  3THY A;  2ZF5 O;  4CZL A;  4DFP A;  5AQV A;  5M1O A;  4M3Y A;  3L3V A;  1IBM K;  2W42 A;  3Q7C A;  4E1J A;  3S41 A;  5JVH L;  3LDS A;  4V19 S;  4BRG A;  1NGF A;  4ELV A;  3A5O C;  2RPI A;  4AHR A;  2P9K B;  1IBL K;  1QE1 A;  2VG5 A;  4KO0 A;  1WSJ A;  1KVA A;  2FSK A;  3KWG A;  4JKA A;  4KI6 A;  3CJB A;  3LZI A;  3QET A;  3W3D A;  3E9L A;  3IFR A;  4DV3 K;  3M6G A;  4JN4 A;  3T69 A;  3LZJ A;  4QS8 A;  4I9Q A;  4LFC K;  1RT5 A;  4WQ4 A;  4FXD A;  3MXI A;  2E6L A;  4F4K A;  1UWB A;  5ELZ A;  3C6A A;  3SJJ A;  3CF5 L;  3QEW A;  1UA1 A;  3VGM A;  5AZI A;  5I3U A;  4C8L A;  3QIP A;  1U6Z A;  3DOK A;  3BZK A;  4XH5 A;  3ENO A;  3NFA A;  4ISE A;  1J5E K;  4HCB A;  1RBV A;  1N36 K;  1NK9 A;  4X64 K;  4B3M K;  4CHO A;  3SQ1 A;  1TV6 A;  5AFU A;  1TGO A;  3ZET B;  4FLU A;  3K59 A;  4QOZ B;  4OLB A;  4IG3 A;  4AHT A;  4FJ9 A;  3O1B A;  1RT4 A;  4N56 A;  3NDK A;  2IVO A;  1UAX A;  3LM9 A;  2D0C A;  1CZ9 A;  2O8C B;  3V1Q A;  1IH7 A;  1VSE A;  1Z25 A;  1JCG A;  3AA3 A;  3HBT A;  1X1P A;  5AJ3 K;  4C1N K;  1VQL N;  5IWA K;  3GE1 A;  4H0X B;  1EWQ A;  3VQD A;  4CK3 A;  5C2D A;  2GV9 A;  5AQP A;  1BOT O;  1KFD A;  2PY5 A;  3CQY A;  2EHG A;  1BIZ A;  2WUS A;  3I56 N;  1XI1 A;  1C0T A;  1NJY A;  5KPT A;  3K9K A;  4KKO A;  3JXU A;  1JCF A;  4BG9 A;  1RBR A;  4W5Q A;  4DU3 A;  3TAE A;  2UXD K;  3KLF A;  1MWK A;  4BWJ A;  2NRW A;  2VG6 A;  2GUI A;  4BRE A;  1HKB A;  4B9V A;  5KQD A;  4IOX A;  1YI2 N;  4JKH A;  3MEC A;  4AHV A;  3CJ7 A;  4DTX A;  4DR4 K;  3CHW A;  2Z1G A;  4M3U A;  4JI8 K;  3ENB A;  4CJL A;  2KQ2 A;  4A5A A;  1XUP O;  4IO9 L;  1L3U A;  1KAX A;  2P9S A;  3U3G A;  4J2B A;  2BGG A;  3AVC A;  4JHD A;  3K2P A;  3VF6 A;  3QBW A;  4GW6 A;  2HMI A;  4JI6 K;  3PLA A;  4CJT A;  3K58 A;  3OA9 A;  4FK0 A;  3OTO K;  1S1X A;  3SV3 A;  1RBU A;  2O8D A;  4DSE A;  4TSX A;  5MLC Q;  1BCO A;  4BRL A;  2GUP A;  3IKM A;  3IAY A;  4BR5 A;  1T8E A;  1CZB A;  3PY8 A;  4RW9 A;  1EXQ A;  2Q1N A;  4WQ5 A;  3NF8 A;  4BRQ A;  2KFN A;  1LCU A;  3HPG A;  1RT6 A;  2NZT A;  3TTD A;  3BY5 A;  3RR8 A;  3AVG A;  3OS0 A;  3MDQ A;  3ATV A;  3QBX A;  3UKR A;  1HR0 K;  3K0S A;  4O8K A;  2QXF A;  5E26 A;  4FWR A;  1WSF A;  2H3G X;  3EE9 A;  1S1U A;  1HPZ A;  4B1Y B;  4CZG A;  1NU0 A;  3NAE A;  1VQ9 N;  3WXI A;  1JLQ A;  1YJ9 N;  4ID1 A;  4NO7 A;  3PV8 A;  2A1S A;  3TAP A;  4DV0 K;  1Q86 O;  3KLH A;  4HUE A;  1WSE A;  2YNF A;  3CET A;  3BF3 A;  2HNZ A;  3LAK A;  1VSD A;  1N34 K;  3MCP A;  4OGE A;  5BPN A;  3TTF A;  3OYE A;  4R5P A;  4K25 A;  3RMA A;  2Q36 A;  3E1Y A;  3ZT4 A;  2B4J A;  4KFB A;  5AQK A;  4O44 A;  1X9W A;  2HHW A;  3PSF A;  3AVA A;  2RN2 A;  5KGX A;  1B92 A;  3HT3 A;  4CFC A;  4CZE A;  5LJV A;  4MDA A;  2IVN A;  2P9K A;  1SV5 A;  2NRX A;  2HHV A;  2YCH A;  5AFU H;  3HI0 A;  4PWD A;  3PX4 A;  1QS4 A;  1TUY A;  4MQ3 A;  5BN9 A;  4PY5 A;  3CCV N;  3O4Q A;  4H4M A;  5TKW A;  1ASW A;  1S6Q A;  3KVG A;  3BEX A;  5GAE P;  4NYF A;  4M3R A;  4BC2 A;  1V4S A;  4FK2 A;  4CJQ A;  5HRS A;  4M3T A;  3QEV A;  2FBX A;  3ULD A;  2IS3 A;  4K8Z A;  4LY7 A;  2NUB A;  3LAN A;  4DQQ A;  4DTN A;  4DTM A;  2XHB A;  2NRR A;  3LDP A;  3F5T A;  1KVC A;  4DU1 A;  1T3V A;  1YAG A;  3I0S A;  2NRZ A;  2EWS A;  2IIR A;  4KHP K;  3ZET A;  3MAQ A;  4E7L A;  4B8C A;  2P9U A;  3A2F A;  5AQY A;  1FXX A;  2P9I B;  3ZT3 A;  1QSS A;  2P9P B;  3ZYY X;  3TPQ A;  4FSV A;  1SKS A;  2X78 A;  2O8C A;  4ZTF A;  3KWI A;  2W41 A;  4K8X A;  1NBW A;  5M1N A;  4M3X A;  1HNI A;  4MFB A;  2KFZ A;  3LP2 A;  3VQ9 A;  1TKT A;  1HX1 A;  3DYA A;  3LPT A;  4JS4 A;  1QQN A;  4DUY K;  4JK9 A;  3MN9 A;  1J54 A;  4BG8 A;  4KTQ A;  1C1C A;  3M5R A;  1QZ6 A;  3ZCM A;  4DR1 K;  2FBY A;  1WOQ A;  1BCM A;  2GEM A;  4MDB A;  3IG1 A;  2BE2 A;  5C15 A;  1BQN A;  2BUP A;  2ZM6 K;  3J81 O;  3HK2 A;  1IG8 A;  3P38 A;  1NKB A;  3EKU A;  3HOS A;  5SWM A;  5C24 A;  2YNI A;  3AVI A;  4NXM K;  4JNE A;  4Z0U A;  2HBL A;  5BRF A;  3T7Z A;  3R6M A;  3WNF A;  3U4L A;  4W5R A;  1JLB A;  4IXC A;  4RW7 A;  1YF5 L;  3GBT A;  2GWK A;  4R79 A;  3VQB A;  3HM8 A;  3DJC A;  1D9F A;  2Q2R A;  3BDP A;  4IO8 A;  4RW8 A;  4OPK A;  2OZM A;  3U9Z A;  1ZBI A;  4CE9 A;  5KI6 A;  1TKD A;  5LMN K;  3I0R A;  3GG4 A;  1WSI A;  2UU9 K;  5C10 A;  4F3O A;  1WBB A;  3K9J A;  2AA4 A;  4GNI A;  4H0P A;  5AQN A;  3SJH A;  5BR8 K;  4B8A B;  4AM6 A;  4Z4C A;  3I8B A;  1KQS M;  3HL8 A;  4CBW A;  2KHO A;  4AIL C;  4HTU A;  4JV5 K;  3NF7 A;  1TYQ B;  2ASP A;  2NRH A;  4FPB A;  3ZT2 A;  3KD1 E;  4CJW A;  5HLF A;  3I8D A;  1H1V A;  4J2E A;  1Z26 A;  1VSJ A;  3SV4 A;  1NJZ A;  3QEP A;  3EE8 A;  3MED A;  3LWL A;  4PUO A;  5KTQ A;  1TL1 A;  1TAU A;  1RDW X;  2BH1 A;  5JIC A;  4DSF A;  3CYM A;  4H0V B;  4FW2 A;  1TUU A;  4JAX A;  1U49 A;  5AQG A;  3DXK B;  3DM2 A;  4JRQ A;  1GLA G;  4OPJ A;  1NGJ A;  1GOB A;  2FBT A;  2NNW A;  1EP4 A;  4CEE A;  2XY6 A;  1VQN N;  4BRD A;  4X62 K;  3CCL N;  1ZBL A;  2IVP A;  3VOV A;  4CJE A;  3A8Y A;  2G8W A;  4FJK A;  4O5B A;  2PFU A;  2QKB A;  3BUZ B;  2NRT A;  3C6H A;  3ALY A;  1WAJ A;  4E89 A;  3MEE A;  3FZM A;  4NYN A;  3AVM A;  3L2V A;  3P5J A;  4IFV A;  5JLH A;  3CER A;  1K6Y A;  1I3A A;  4YOW A;  4DTS A;  4KV8 A;  3MK6 A;  1LOT B;  5KPR A;  4B3R K;  2QK9 A;  1NGH A;  4CD1 A;  3AVJ A;  4YHH K;  4BQL A;  1EX4 A;  3AAP A;  3MN5 A;  2Q31 A;  3WEE A;  3DLB A;  1BG3 A;  3QO9 A;  2O4G A;  2D0B A;  4YDU A;  5BPM A;  4E7H A;  5JMV A;  4M3W A;  4BE0 A;  3SMS A;  1NOY A;  2IDO A;  1BL3 A;  5HRN A;  4IBN A;  5JVG L;  4DV7 K;  2HNY A;  4E19 A;  3WNG A;  1U48 A;  4Z4H A;  4DLE A;  3JAM O;  5CR4 A;  2XO7 A;  3U8X A;  3O80 A;  3V9X A;  2D0P A;  1YTU A;  2HBJ A;  1O1W A;  5I9E B;  2E20 A;  2JGU A;  5J1E A;  3RMB A;  1MU2 A;  2VG7 A;  5LL6 Z;  4FWS A;  1IV0 A;  2DY4 A;  1NKC A;  4DR2 K;  2HVH A;  1C0U A;  1YTA A;  1BUP A;  3OYM A;  3VQQ A;  4YNQ A;  1TK8 A;  2GEL A;  4WYB A;  4DQI A;  2VGM A;  4KHN A;  1L3S A;  2P9P A;  5LY3 A;  3NGI A;  1B9F A;  1E3M A;  2P5O A;  4CFB A;  4CZH A;  4H5T A;  3LP1 A;  2RF2 A;  4IWV A;  2UXC K;  4AH9 A;  1KAZ A;  2XY8 A;  4U7B A;  3WNE A;  1XHZ A;  2F9W A;  4BC5 A;  1FK9 A;  1ATR A;  3SZ2 A;  3FZH A;  3KK1 A;  3DMJ A;  1QVG M;  3HYF A;  5EY4 A;  5JLF A;  2Z1J A;  1T6C A;  1SS6 A;  1T7P A;  3OYI A;  3HVT A;  4BR4 A;  5J2M A;  1I94 K;  4NCG A;  3ITH A;  4OPA A;  3AVK A;  3V6D A;  5FPE A;  2GBZ A;  2XRI A;  4FM2 A;  2E5L K;  1HNV A;  4C1N I;  2OPR A;  3VGK A;  1NK7 A;  4PKH A;  3T1H K;  2QKK A;  4WFA L;  5AQO A;  4FM0 A;  1W7A A;  4JI0 K;  4MO4 A;  4O5F A;  1U04 A;  2ZJQ L;  4BRM A;  2V51 B;  1KAY A;  2HHS A;  5AQH A;  4A5B A;  1J53 A;  1RTI A;  3ZX2 A;  2QWN A;  1DTQ A;  3CC7 N;  3DXM B;  1QVF M;  1VHX A;  3DRP A;  4I9L A;  4F2R A;  1A5W A;  3DOL A;  2WBN A;  1T6D A;  3NVM A;  1OH6 A;  4Y1D A;  5EVZ A;  4B9T A;  4FJM A;  1HNX K;  3DLE A;  3OY9 A;  3CQX A;  3H46 O;  3AVF A;  4FJG A;  3V1O A;  4JKD A;  1YVN A;  4IJN A;  4WFN L;  4YOY A;  2HHH K;  4DMN A;  4B9N A;  1NMN A;  4KRE A;  4CZM A;  3WUH A;  2OCE A;  3M8Q A;  1CXU A;  5BPL A;  4O55 A;  1QTM A;  4DSI A;  1HNW K;  3WXM B;  1HLU A;  3QIC A;  5D3G A;  3J80 O;  5HOO A;  5DK5 A;  1IKV A;  2F4V K;  1XHX A;  4DV1 K;  3ID8 A;  4RCH A;  3CCJ N;  3JYT A;  1MA9 B;  3C95 A;  3O9Q A;  3TAM A;  4KB1 A;  4JKG B;  4FPA A;  4Z4I A;  3LM2 A;  5I42 A;  3DXK A;  4MLH A;  4I2Q A;  4CCH A;  3FE1 A;  1S9G A;  1XMQ K;  4N76 A;  3QML A;  3FFI A;  3OW2 M;  3VPZ A;  4CJ7 A;  5TKY A;  3R9P A;  3O08 A;  3QDK A;  4LD0 A;  4CI6 A;  2WC9 A;  2VWK A;  3SUN A;  3HPH A;  4QAG A;  1N32 K;  4DF8 A;  1YJN N;  3VA0 A;  3ZSQ A;  1K8K B;  2E1Z A;  2YJF A;  3OYD A;  3EO3 A;  5IT9 O;  4DUZ K;  1S1V A;  4FYD A;  3D7E O;  3PO5 A;  3RMC A;  3L3U A;  1VSM A;  2JWK A;  2YNH A;  4BRP A;  1LWE A;  4BR2 A;  3AA4 A;  1NK8 A;  1RGI A;  3VN5 A;  4N47 A;  5CE3 A;  1E4F T;  2OAN A;  2FF6 A;  4Z94 A;  3VQC A;  3OYH A;  4CEF A;  4M41 A;  4DU4 A;  1S1W A;  2V7Z A;  1RDA A;  4GVE A;  1NK4 A;  3VEV A;  3VF2 A;  4BRC A;  4CW7 B;  1SKW A;  1VQ6 N;  1K9M O;  3MXJ A;  1NM1 A;  4OPH A;  3LAM A;  4CK1 A;  3NGY A;  2O4I A;  3EZW A;  1YT3 A;  2IOC A;  3TAN A;  1WAF A;  1RTD A;  1BIU A;  4N5S A;  3A5L C; 
#chains in the Genus database with same CATH homology
 1RNH A;  3UIQ A;  4LH5 A;  4NYF A;  4FLV A;  4BE2 A;  5CY4 A;  4M3R A;  3AA5 X;  3S3N A;  1C0M A;  2BDP A;  2F96 A;  3K57 A;  1VSF A;  2D5R A;  1TKX A;  4E1N A;  4FK2 A;  4CJQ A;  5HRS A;  3CM5 A;  3THV A;  3PO4 A;  4FJ7 A;  4M3T A;  4OGC A;  3QEV A;  2FBX A;  3RRG A;  4CEZ A;  1JLG A;  3ULD A;  1A5V A;  2IS3 A;  2HB5 A;  4WE1 A;  4LY7 A;  2NUB A;  1HJR A;  4CF9 A;  3LAN A;  4K8Z A;  4DQQ A;  5JS2 A;  3AO1 A;  4DTM A;  4DTN A;  1JLC A;  2XHB A;  1DLO A;  4CEO A;  3VQ5 A;  4DSK A;  5EU7 A;  3KK2 A;  3HXM A;  3RMD A;  2FBV A;  1IKX A;  1KVC A;  4KRF A;  3ISN C;  4DU1 A;  3I0S A;  3DLK A;  3EZ5 A;  4FLZ A;  3MAQ A;  4E7L A;  2YNG A;  4B8C A;  1WSH A;  1A5X A;  2JLE A;  3V4I A;  1X9S A;  1D9D A;  2HW3 A;  3SUO A;  3A2F A;  1EET A;  3MXM A;  1FXX A;  3KKR A;  3ZSR A;  3ZT3 A;  1QSS A;  1DTT A;  4BDY A;  2G8H A;  3SI6 A;  3SQ4 A;  5HRR A;  2WOM A;  1SKS A;  2X78 A;  4ZTF A;  4CFA A;  3NF6 A;  1S9E A;  3AVN A;  4K8X A;  1KCF A;  4M3X A;  1HNI A;  3L2R A;  2YHB A;  1JXB A;  2PYL A;  1JXE A;  1B9D A;  1YVU A;  3HP9 A;  3QLH A;  4MFB A;  1L3V A;  4KI4 A;  2KFZ A;  1SL1 A;  3LP2 A;  3VQ9 A;  1TKT A;  1LV5 A;  3DYA A;  3LPT A;  3DRS A;  4JS4 A;  1TK5 A;  4DLG A;  3BGR A;  3L2U A;  1RT7 A;  4CGF A;  1N5Y A;  1VSL A;  1RIL A;  4FW1 A;  3O3F A;  3DRR A;  3AVH A;  3EY1 A;  1UOC A;  1J54 A;  3PX0 A;  3AVL A;  4DQR A;  5KGW A;  3VQ8 A;  1C1C A;  3ZCM A;  3NF9 A;  2OA8 A;  1J5O A;  2FBY A;  1NOZ A;  3AO5 A;  4CHY A;  4NCA A;  1BCM A;  4CJV A;  3ZT1 A;  1L3T A;  3IG1 A;  4ZHR A;  2G8F A;  2BE2 A;  3P83 D;  5CZ1 A;  1BQN A;  2LSN A;  4OVL A;  3ZSZ A;  3KIO A;  3LP3 A;  3HK2 A;  4CEC A;  3V9W A;  3TAR A;  1NKB A;  4B9L A;  3QNN A;  3CG7 A;  4KTQ A;  2HND A;  5SWM A;  1R0A A;  4FJN A;  1KVB A;  4DTU A;  4QCL A;  3IS9 A;  5C24 A;  2YNI A;  3AVI A;  1JL2 A;  3OVN A;  3KJV A;  3AO3 A;  4Z0U A;  1UA0 A;  5HBM A;  3O4N A;  3LWM A;  3QER A;  1RTJ A;  3NH1 A;  2HHX A;  3RTV A;  1QHT A;  3HM9 A;  5CYQ A;  3OYC A;  3SQ2 A;  4Z4F A;  3WNF A;  3SPY A;  1JLF A;  4W5R A;  3F9K A;  1JLB A;  4RW7 A;  2A1R A;  4FJL A;  1G15 A;  2E4L A;  3OYN A;  3K5M A;  3VQB A;  1VRT A;  4HVJ A;  1XWL A;  1D9F A;  2G8K A;  3BDP A;  3TWH A;  1RBS A;  3TAF A;  1IO2 A;  2Z1I A;  1TK0 A;  1NK5 A;  4KPY A;  4C8M A;  1ASV A;  1J9A A;  4RW8 A;  4OPK A;  3NCI A;  2OZM A;  1SL2 A;  1ZBI A;  3SQ0 A;  4CE9 A;  1RDB A;  5KI6 A;  4DTP A;  2ATQ A;  3I0R A;  4O0J A;  3F73 A;  3V9S A;  1TKD A;  1WSI A;  4IG0 A;  4CJR A;  3PX6 A;  2HVI A;  2YKM A;  3CFO A;  4YFU A;  1L5U A;  3EYZ A;  3QIO A;  1IG9 A;  2OYQ A;  3CQ8 A;  4F3O A;  4HCC A;  3NE6 A;  4DTJ A;  1JL1 A;  1BI4 B;  1GOA A;  1REV A;  2Y1I A;  4FJ9 A;  3P1G A;  1Q9Y A;  2HHT A;  4DFJ A;  1WLJ A;  4Q0B A;  4OKJ A;  4B8A B;  4Z4C A;  4ELT A;  2ZQB A;  3HL8 A;  1TL3 A;  4FK4 A;  4AIL C;  3V81 A;  4HTU A;  3HO1 A;  3NF7 A;  4FJH A;  3ZT2 A;  4CIE A;  4ICL A;  4DTR A;  3OS1 A;  4CJF A;  4H8K A;  4CJW A;  3S3M A;  1NKE A;  3KD1 E;  5HLF A;  3AV9 A;  3VQE A;  3I8D A;  1U4B A;  4EP5 A;  2R7Y A;  3QIN A;  5HRO A;  1CLQ A;  4JLH A;  4HUG A;  4KHY A;  1TVR A;  4J2E A;  1KTQ A;  1WN7 A;  1VSH A;  2X6S A;  1Z26 A;  1VSJ A;  4BDZ A;  1WNS A;  4BE1 A;  3SV4 A;  1LAW A;  3QEP A;  3B6P A;  1NJZ A;  4Q5V A;  1RTH A;  2Z1H A;  3MED A;  4OKE A;  3LWL A;  3TAG A;  4PUO A;  3V9Z A;  2OPP A;  4CJK A;  1WSG A;  1TL1 A;  5KTQ A;  1TAU A;  2IC3 A;  4ZTJ A;  5SZT A;  1VK0 A;  4DSF A;  4B9U A;  3CYM A;  4FW2 A;  3VQ7 A;  4AHS A;  1NJW A;  1U49 A;  3DLH A;  4Z4E A;  3VQ6 A;  4CEB A;  5J2P A;  3VQ4 A;  1TKZ A;  3NH2 A;  2WON A;  3AO2 A;  1RCH A;  3O3H A;  3G0Z A;  3S3O A;  1QSY A;  3ASM A;  4M45 A;  3DM2 A;  4C8O A;  4JRQ A;  2HHU A;  4KHQ A;  4CER A;  4OPJ A;  4G1Q A;  1KSP A;  1GOB A;  3HP6 A;  2FBT A;  4FZY A;  4GMJ B;  1C6V A;  1SUQ A;  3PUF A;  1EP4 A;  4CEE A;  1T03 A;  3G10 A;  2OPQ A;  3QNO A;  3CFR A;  2XY6 A;  2OPS A;  3ZSX A;  1ITG A;  4CK2 A;  4E7I A;  4DWI A;  1HQU A;  2B6A A;  4CF8 A;  1X9M A;  5FDL A;  5HRP A;  5DMR A;  4CGJ A;  4DTO A;  1BHL A;  3LPU A;  1ZBL A;  2YV0 X;  1VRU A;  3OS2 A;  2D0A A;  4CJ3 A;  4AHC A;  4CJE A;  2G8W A;  4KB0 A;  4CIG A;  4CEQ A;  2XY5 A;  4O5B A;  4DFM A;  4FJK A;  2DTU A;  4CHP A;  2QKB A;  3T19 A;  3OYF A;  4OLA A;  3ALY A;  1WAJ A;  4LSN A;  4FM1 A;  4E89 A;  3MEE A;  4EP4 A;  4FLX A;  5FRO A;  4NYN A;  4JS5 A;  2G8U A;  1HYZ A;  3AVM A;  4HUF A;  2AJQ A;  3L2V A;  4BAC A;  4FJI A;  3D0P A;  1GOC A;  2IAJ A;  5E41 A;  3QES A;  5T7B A;  3P5J A;  1ZBU A;  4IFV A;  1K6Y A;  1I3A A;  4DFP A;  4DTS A;  4KV8 A;  4O4G A;  4RW6 A;  1VSK A;  3HJF A;  1IKY A;  4M3Y A;  4PQU A;  3L3V A;  2QK9 A;  1LWF A;  3AVJ A;  2W42 A;  4UQG A;  4CGH A;  1ZYQ A;  2KZM A;  1EX4 A;  4KHU A;  4AHU A;  4Y1C A;  3ZSO A;  1S6P A;  1D8Y A;  2F8T A;  3DLB A;  3QO9 A;  2O4G A;  2D0B A;  2P51 A;  4I2P A;  3VQP A;  4DQS A;  3LDS A;  4E7H A;  4IKF A;  4M3W A;  2ETJ A;  4ELV A;  4BE0 A;  4CHQ A;  2RPI A;  4AHR A;  2IDO A;  1BL3 A;  5HRN A;  1NOY A;  1QE1 A;  3H08 A;  2VG5 A;  4IBN A;  1WSJ A;  4KO0 A;  1KVA A;  5C42 A;  2YKN A;  1S1T A;  3L2Q A;  1HMV A;  2HNY A;  4KI6 A;  2XY7 A;  4ELU A;  4E19 A;  3LZI A;  1RT3 A;  3WNG A;  3M8R A;  2DFH A;  2ITG A;  3QET A;  1HYS A;  1U48 A;  4Z4H A;  1CXQ A;  4DLE A;  3VA3 A;  1F21 A;  3HVR A;  2VWJ A;  2Q3S A;  2XO7 A;  4CED A;  3LZJ A;  4I9Q A;  3V9X A;  3OYB A;  1JLA A;  1RT5 A;  1YTU A;  4FXD A;  3MXI A;  1O1W A;  2E6L A;  4F4K A;  1UWB A;  4FLY A;  2JGU A;  5J1E A;  3RMB A;  3C6U A;  4CHZ A;  1W0H A;  3SJJ A;  1MU2 A;  4CJ5 A;  3QEW A;  2VG7 A;  1U45 A;  3KD5 E;  5CYM A;  1UA1 A;  4CJP A;  2DY4 A;  1NKC A;  4DF4 A;  1LW0 A;  2ZE2 A;  5I3U A;  4C8L A;  2HVH A;  3QIP A;  1C0U A;  1YTA A;  3OYM A;  3C94 A;  1C1A A;  3DOK A;  4W5O A;  3VQQ A;  3AA2 A;  4YNQ A;  1TK8 A;  3NFA A;  4HCB A;  4DQI A;  1RBV A;  4KHN A;  1L3S A;  3NGI A;  1NK9 A;  1B9F A;  4CHO A;  4B9S A;  4CFB A;  3SQ1 A;  1QQC A;  1TV6 A;  3LP1 A;  3T1A A;  2E6M A;  2P5O A;  1TGO A;  2RF2 A;  4IDK A;  5K14 A;  4FLU A;  3K59 A;  4QOZ B;  4AH9 A;  5HP1 A;  4OLB A;  2XY8 A;  4IG3 A;  4AHT A;  4CF0 A;  4N56 A;  1RT4 A;  4CF2 A;  3OYK A;  3NDK A;  5J2Q A;  2Y1J A;  3WNE A;  4E1M A;  1UAX A;  1XHZ A;  4CJ4 A;  2D0C A;  1CZ9 A;  1FK9 A;  4DFK A;  3SZ2 A;  3LAL A;  4BDP A;  3KK1 A;  1Q8I A;  3DMJ A;  5JS1 A;  3V1Q A;  2I5J A;  1W9H A;  1IH7 A;  3HYF A;  1VSE A;  4I7F A;  4W5T A;  1Z25 A;  3ZT0 A;  2Z1J A;  3AA3 A;  4OJR A;  1X1P A;  4F2S A;  4B9M A;  4DQP A;  4KHS A;  2G8I A;  2KZZ A;  3LP0 A;  2F8S A;  3RR7 A;  4DSJ A;  1T7P A;  3OYI A;  3HVT A;  2KTQ A;  5J2M A;  3VQD A;  1XC9 A;  4DS4 A;  4FJX A;  4CK3 A;  1RT2 A;  2EX3 A;  2GV9 A;  4NCG A;  3ITH A;  4CHN A;  3AVK A;  3K5L A;  3ZSY A;  4FLT A;  1KFS A;  1KFD A;  3V6D A;  2GBZ A;  2XRI A;  4CEA A;  2YHA A;  4FM2 A;  1HNV A;  4W5N A;  2OPR A;  2PY5 A;  4FVM A;  1NK7 A;  1FKO A;  4KTW A;  4DSL A;  2QKK A;  2EHG A;  3C6T A;  1BIZ A;  5KRT A;  4FM0 A;  1U04 A;  1XI1 A;  1SL0 A;  1Y97 A;  4CGG A;  3KK3 A;  4RW4 A;  1QSL A;  1C0T A;  1NJY A;  2OZS A;  4KKO A;  3SUQ A;  3OYA A;  1ASU A;  2HHS A;  1RBR A;  4W5Q A;  1FKP A;  3MEG A;  4DU3 A;  1J53 A;  4GVM A;  3KKS A;  1RTI A;  1LWC A;  3TR8 A;  3TAE A;  3SNN A;  4CGI A;  3KLF A;  3OYJ A;  4OKK A;  1DTQ A;  4BWJ A;  2VG6 A;  4CJS A;  2GUI A;  3DRP A;  1BQM A;  1BGX T;  4I9L A;  1A5W A;  3DOL A;  3QEI A;  4B9V A;  4F2R A;  3CM6 A;  3U3Y A;  3TAQ A;  4M3Z A;  1IKW A;  4Y1D A;  3TI0 A;  4B9T A;  4FJM A;  3DLE A;  3U6F A;  1VSI A;  3MEC A;  5J2N A;  4C8K A;  4AHV A;  3OY9 A;  4FZX C;  3KTQ A;  3V1R A;  4DTX A;  2ZD1 A;  4CJU A;  4B3O A;  3AVF A;  3HPO A;  2Z1G A;  4FJG A;  3V1O A;  4M3U A;  3SPZ A;  4CJL A;  4EZ9 A;  3OJS A;  2KQ2 A;  4F8R A;  2X6N A;  1L3U A;  4J2B A;  3U3G A;  3AVB A;  2BGG A;  3AVC A;  1BI4 A;  1S5J A;  3OJU A;  4E7K A;  4LH4 A;  4B08 A;  2X74 A;  3DLR A;  3K2P A;  4DMN A;  4E3S A;  4FJJ A;  4B9N A;  4GW6 A;  2HMI A;  4KRE A;  4CJT A;  1N6Q A;  1RDC A;  3KLI A;  3OYL A;  3K58 A;  4FLW A;  3VQA A;  4FK0 A;  3M8Q A;  1CXU A;  3SV3 A;  1S1X A;  4O55 A;  1QTM A;  4DSI A;  1RBU A;  2FC0 A;  2B5J A;  4C8N A;  4TSX A;  4DSE A;  3SUP A;  4N41 A;  5D3G A;  3WNH A;  1NK0 A;  5DK5 A;  3V9U A;  1BCO A;  1IKV A;  1SKR A;  4J2D A;  4NCB A;  4EZ6 A;  2RKI A;  1ZBH A;  1NJX A;  3IAY A;  1XHX A;  1T8E A;  1CZB A;  1I39 A;  3PY8 A;  4RW9 A;  1EXQ A;  1KLM A;  3JYT A;  1Q9X A;  3C95 A;  3TAM A;  5CZ2 A;  2G8V A;  3RRH A;  1LAV A;  1KRP A;  4KB1 A;  3NF8 A;  3DI6 A;  2KFN A;  1D5A A;  3OYG A;  3HPG A;  1RDD A;  1RT6 A;  4KHW A;  4Z4I A;  4DG1 A;  3K5N A;  4JRP A;  2BAN A;  3JSM A;  5I42 A;  3AVG A;  3RR8 A;  1U47 A;  1ZBF A;  3OS0 A;  4Z4G A;  4I2Q A;  4CCH A;  4O0I A;  3K5O A;  1S9G A;  5C25 A;  4N76 A;  3KLG A;  3SYZ A;  4E7J A;  3FFI A;  3KLE A;  3L8B A;  4J2A A;  3TAB A;  4L8R B;  2QXF A;  2HHQ A;  4FJ8 A;  1WSF A;  4BWM A;  3M8P A;  1S1U A;  1HPZ A;  4DS5 A;  3T3F A;  4IFY A;  1HRH A;  4E0D A;  2P1J A;  4LD0 A;  1BIS A;  3NAE A;  3NHG A;  3DLG A;  2P5G A;  3SUN A;  2VWK A;  4PA1 A;  3B6O A;  3HPH A;  4QAG A;  1JLQ A;  3M8S A;  4CGD A;  4DF8 A;  1C1B A;  2PYJ A;  3VA0 A;  4ID1 A;  3ZSQ A;  3PV8 A;  1JLE A;  3OYD A;  5FRN A;  4LSL A;  2A1S A;  3TAP A;  1HQE A;  3KLH A;  4HUE A;  4CIF A;  5KRS A;  1S1V A;  1WSE A;  2YNF A;  3PO5 A;  4FYD A;  4CES A;  3L3U A;  1VSM A;  3RMC A;  2HNZ A;  3IRX A;  3LAK A;  2YNH A;  4KTZ A;  1NK6 A;  1LWE A;  1T05 A;  2KW4 A;  1RBT A;  1VSD A;  3CFP A;  4FZZ A;  4F3T A;  3AA4 A;  4OGE A;  4M42 A;  3HST B;  1RT1 A;  1NK8 A;  3RWU A;  3OYE A;  4ID5 A;  3VN5 A;  4R5P A;  3NGZ A;  4N47 A;  3RMA A;  3ZSW A;  5FRM A;  3ZT4 A;  1KLN A;  2B4J A;  2IGI A;  4KFB A;  1LW2 A;  2DFE A;  1JKH A;  4O44 A;  3VQC A;  3OYH A;  1X9W A;  4CEF A;  3D45 A;  4M41 A;  2PZS A;  4DU4 A;  4FJ5 A;  3AO4 A;  2HHW A;  1S1W A;  4KAZ A;  3AVA A;  3QEX A;  2RN2 A;  1RDA A;  1NK4 A;  5KGX A;  3NH0 A;  1HYV A;  1B92 A;  1TAQ A;  3HT3 A;  4CFC A;  3S9H A;  1SKW A;  3MXJ A;  1SV5 A;  3SCX A;  3LAM A;  4CK1 A;  2HHV A;  3O3G A;  3E01 A;  4CF1 A;  4PWD A;  3NGY A;  2O4I A;  1EKE A;  3PX4 A;  1QS4 A;  1YT3 A;  4FCY A;  2IOC A;  4MQ3 A;  4PY5 A;  4CFD A;  4H4O A;  1WAF A;  4HHT A;  3TAN A;  1RTD A;  2DFF A;  3O4Q A;  1BIU A;  4H4M A;  4XIU A;  1ASW A;  1S6Q A;  4RG8 A;  4N5S A;  3L2W A;  3NBP A;  3ZSV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...