1WSTA

Crystal structure of multiple substrate aminotransferase (msat) from thermococcus profundus
Total Genus 142
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
142
sequence length
403
structure length
403
Chain Sequence
b'INFDSFFSEKAMLMKASEVRELLKLVETSDVISLAGGLPAPETFPVETIKKIAVEVLEEHADKALQYGTTKGFTPLRLALARWMEKRYDIPMSKVEIMTVAGSQQALDLIGRVFLNPGDPIVVEAPTYLAAIQAFKYYDPEFISIPLDDKGMRVDLLEEKLEELRKQGKRVKIVYTVSTFQNPAGVTMSVDRRKKLLELANEYDFLIVEDGPYSELRYSGEPTPPIKHFDDYGRVIYLGTFSKILAPGFRIGWVAAHPHLIRKMEIAKQSIDLCTNTFGQAIAWKYVENGYLDEHIPKIIEFYKPRRDAMLEALEEYMPEGVEWTKPEGGMFVRVTLPEGIDTKLMMERAVAKGVAYVPGEAFFVHRDKKNTMRLNFTYVPEETIREGVRRLAETIKEEMKRV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords multiple substrate aminotransferase
publication title Crystal structure of multiple substrate aminotransferase (MsAT) from Thermococcus profundus
rcsb
source organism Thermococcus profundus
molecule tags Transferase
total genus 142
structure length 403
sequence length 403
ec nomenclature ec 2.6.1.-:
pdb deposition date 2004-11-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00155 Aminotran_1_2 Aminotransferase class I and II
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.640.10 Alpha Beta 3-Layer(aba) Sandwich Aspartate Aminotransferase; domain 2 Type I PLP-dependent aspartate aminotransferase-like (Major domain) 1wstA02
3.90.1150.10 Alpha Beta Alpha-Beta Complex Aspartate Aminotransferase, domain 1 Aspartate Aminotransferase, domain 1 1wstA01
2VIBA 2YKYA 2ZUKA 1V2FA 1TOEA 1LK9A 1BS0A 3BS8A 3E2FA 2HOZA 4MQQA 4PVFA 2DKJA 3IF2A 2YCNA 3AELA 4WXFA 5K8BA 4RITA 1MDZA 3BCBA 1RVYA 1UU2A 4IYOB 3ZZKA 2BWPA 3B1CA 3FDBA 4EU1A 4F5HA 1TOGA 1KL2A 2W7LA 2YCTA 4OBVA 5EUEA 3WKRA 3FTBA 2X5FA 8AATA 1Z7DA 2YRRA 2W8VA 4WLHA 3CBFA 5EUNA 1OATA 4M2KA 1YAAA 1AHYA 3BN1A 3PGYA 1IAYA 2Z1YA 1PG8A 1ASMA 1M0OA 3PDBA 4PFNA 1AMSA 3HT4A 4ATPA 4ATQA 1D7UA 2VMWA 1AMQA 1SVVA 4MKKA 1ASGA 1GC3A 2O7CA 3GETA 1X0MA 3HL2A 3NYUA 1X29A 1IJIA 4CVQA 4I8AA 4FFCA 3A9XA 3M5UA 1ASEA 3MC6A 4M2MA 4ZWMA 4LNLA 5I92A 4F4EA 4WYGA 3RQ1A 1JS6A 2YKVA 3RCHB 3CQ4A 1WYTB 2W7DA 2Z9XA 4AZJA 2AY1A 2PO3A 1TARA 2ZSLA 7AATA 1VJOA 4PIWA 1VP4A 1YOOA 3JZLA 2BI3A 4W1VA 4N0WA 4ZAHA 5EFSA 4RJYA 3QM2A 1CQ6A 2CTZA 1ZODA 3AV7A 3JWBA 2NMPA 1JG8A 3ZZJA 3ELPA 1WKHA 3I5TA 3CAIA 1FG3A 4A0FA 2YRIA 4JE5A 1XEYA 3NUIA 9AATA 4Y0IA 2EZ2A 2VMSA 2BWOA 1S09A 3W1IA 1YJSA 4HVKA 1AMAA 1ASDA 1ARGA 2VLFA 2GMSA 4ZSYA 1C0NA 1BQAA 2VMPA 2BI2A 2HUUA 1DTYA 3F0HA 4W8IA 2ZY4A 2BYJA 2OQXA 2VGTA 1S08A 2VMYA 3FZ6A 3EIBA 2JG2A 4ADDA 2AY5A 1AKCA 2CJGA 1QGNA 1CS1A 2BIAA 2OKKA 4CXRA 1AIAA 1E5EA 2ZJGA 2VMZA 2EH6A 3NUBA 2ZSMA 4M2JA 1WYVA 4ZDLA 4GEBA 4F5LA 2C81A 3ISLA 2W7JA 1D2FA 3DXVA 3AATA 3RI6A 2QA3A 4MY5A 1ASNA 4JF0A 4XK1A 2G6WA 3B1EA 4AH3A 1LS3A 1WYUB 4MGRA 1GEXA 2VMXA 2W7KA 3LWSA 3FQ8A 4Q6RA 4GE9A 3GR9A 4GDYA 1ARTA 2CJDA 3JTXA 2D65A 3N5MA 1TASA 2AY6A 3NYSA 3MAUA 2QB3A 2WKAA 4DGTA 2Z9UA 1G7WA 4F5KA 2AY4A 3E77A 4W1WA 4WP0A 3AENB 2RFVA 2W7MA 1ZOBA 2FQ6A 1IX6A 3FDDA 2FN6A 3AEOA 1AJSB 1Z3ZA 4JEYA 3A8UX 4R5FA 1MDOA 2YOBA 3K28A 3MKJA 2D61A 1ELUA 3LY1A 4F5GA 1BJ4A 4U2HA 4F5MA 2W8WA 2Z20A 4ISYA 4W1XA 3JU7A 2CFBA 3FVUA 2VGSA 4MQRA 3DXWA 2HP1A 3WCNA 2QBTA 4NOGA 4E3QA 3B46A 2HORA 4Q75A 3E2ZB 3FCRA 3DC1A 3FD0A 5DJ1A 1LC5A 1ASAA 1C4KA 1PMMA 3GZDC 2HUFA 2Q7WA 1RV3A 5F8VA 2QB2A 3AEJC 3AEPA 1CZCA 1J04A 3LVMA 4A0RA 1ELQA 1B5PA 4LW4A 2D7ZA 4K2IA 3K40A 5DX5A 1DKAA 2EPJA 3USFA 2ZY2A 3BCAA 4A72A 3JWAA 2X8UA 1MLZA 3AOWA 3LG0A 2FYFA 1C7GA 1N2TA 4E3RA 4F5FA 1JS3A 2V0YA 4ZM4A 2FNIA 5FT6A 1GCKA 1GC2A 1FG7A 1N8PA 4UQVA 3WZFA 5E3KA 4JEWA 5M49A 3GJUA 5EUDA 4CBSA 2OGEA 4WB0A 3WX9A 1D7RA 1ECXA 3EUCA 1AHXA 1G4VA 2D7YA 3I16A 4Y0DA 4CBRA 2GSAA 3BWOA 5G09A 4IX8A 4H51A 3F6TA 1ARIA 2BKWA 3AENA 1OHVA 3PDXA 1UU1A 2BIEA 5F9SA 3HBXA 2AATA 1AX4A 1ASBA 3FQ7A 3QBOA 1ZC9A 4F5JA 1KKJA 3BCXA 1GDEA 2YHKA 4E77A 5D5SA 1BKGA 4OYTA 1QJ5A 1IX7A 1MDXA 3LVJA 2VMTA 1O69A 4IXOA 2F8JA 3UWCA 4J8LA 1BJOB 2VMRA 4OBUA 5AX8A 2TPLA 4L0OA 3GZCA 2R5CB 2Z9WA 3GZDA 4WXBA 2W8JA 3PD6A 5TF5A 3EZSA 4ZSWA 2E7IA 1W7MA 2W8UA 3AEJA 3DRDA 5E4ZA 1RV4A 1DGDA 3A9ZA 4JEZA 3FVXA 3ACZA 4A0HA 4JEXA 1ARHA 4J5UA 1O4SA 4EB5A 2GB3A 5EIGB 1M4NA 3E2YA 2WK7A 1CL2A 4JF1A 1GD9A 4UHNA 4TMRA 1M7YA 3OP7A 1BJNA 2ZYJA 3DZZA 4R8DA 4RJ0A 4E1OA 1KMKA 4WLJA 2VLHA 3NTJA 4Q31A 3AOVA 4WYAA 1AMRA 4IYOA 2CJHA 4PFFA 2Z67A 1OHWA 2BWNA 2DR1A 2PB0A 1ASLA 1B5OA 2VMQA 3WY7A 2W7IA 4ZM3A 1AICA 1SF2A 2O1BA 2YKUA 1IX8A 3B8XA 1GEYA 4O6ZA 1DFOA 2QMAA 4A6UA 4A6RA 5JAYA 4MKJA 1GC0A 2BHXA 1M0NA 2EGYA 4ADBA 3D6KA 3VOMA 1TOIA 2EO5A 2D5YA 3COGA 3PIUA 5EQCA 4XQ2A 1YIZA 2AEVA 2AY7A 2E7JA 2VI8A 1OXOA 4KAMA 1AHGA 1AIBA 1DJUA 3QI6A 4RKDA 1M0QA 3HDOA 5DB5A 4GSAA 4K2BA 4ITGA 2ZY5A 2VIAA 4AZKA 3II0A 1O61A 3KE3A 4IXZA 3KGWA 4ADCA 2ZC0A 1IBJA 4WYDA 5G4JA 1AAWA 3T32A 1AY5A 3DR4A 1Y4IA 2R5CA 2WK9A 2D63A 2EZ1A 3VK3A 2VGVA 3P1TA 4B9BA 4AO4A 3FZ8A 1CJ0A 3RCHA 4ADEA 1WYTA 1VEFA 4DQ6A 4OCAA 3CQ6A 2VI9A 1EQBA 2ORDA 5IWQA 3N0LA 2WK8A 4WBTA 2BI5A 2W7HA 3MAFB 3HLMA 1SPAA 1LW4A 3HMUA 3ZRPA 1CL1A 4WYEA 1ARSA 2PB2A 2Z61A 1X28A 1AJRA 2DKBA 1B8GA 1ASCA 1TOKA 3N75A 1U08A 4EFFA 1QIRA 2GQNA 1S07A 1SZUA 3PA9A 3EI8A 1LW5A 3TATA 4LC3A 1DGEA 4XEWA 1RVUA 1S06A 2JJHA 1SZSA 1W7NA 1C7NA 2DGKA 2HOXA 2VGUA 3ASAA 3L8AA 5HHYA 5BJ3A 1G4XA 3AEMC 1TOJA 3EIAA 3G0TA 3NU8A 3WCOA 3DR7A 2JJGA 3PDBB 3G8MA 4RM1A 4BA5A 4IY7A 2CINA 4AOAA 3DODA 5HDMA 4XJMA 2DGMA 4R2NA 4LNMA 1I48A 1KMJA 1V2EA 5E5IA 4Y0HA 3MEBA 4F5IA 3QHXA 1GBNA 4Q76A 3WGBA 1YJZA 3TFTA 5FT5A 4GRXA 4CXQA 2C7TA 3MC6C 3UE8A 1WYUA 1B9IA 4A6TA 1AKAA 4TV7A 3LVKA 3ZRRA 5M46A 1C7OA 3FRKA 4K2MA 4XJLA 3VK2A 3FVSA 1H1CA 5EAAA 2O0RA 5HXXA 4FL0A 3NDNA 5C6UA 1MGVA 1S0AA 3NX3A 4A00A 1FC4A 2OATA 3ELEA 1H0CA 3TCMA 1AHFA 1AY4A 2W8TA 1UU0A 2VMOA 3EZ1A 1B9HA 1GEWA 3NNKA 4IXSA 4GE4A 3P6KA 1AJSA 1DJEA 3MAFA 4OTLA 3NU7A 5FT4A 1ASFA 1BJWA 2AY8A 3DU4A 3BWNC 3VAXA 2OGAA 4LNJA 5G2PA 4BMKA 1QITA 3FFRA 4RAEA 4UHMA 5M4BA 1LC8A 2E7UA 3ECDA 3L44A 1MAQA 3B1DA 1W7LA 3FSLA 4UHOA 5J8QA 3W1JA 1T3IA 4JE5D 1SZKA 3E2ZA 3EI5A 3GWPA 3R4TA 2JISA 3KKIA 2XBNA 2W7EA 4RKCA 3Q8NA 1W3UA 4N0BA 3I4JA 3LV2A 3DYDA 1QISA 1EJIA 4W91A 3TFUA 4B98A 1BQDA 2CSTA 3AEMA 2JGTA 1IAXA 2HUIA 3QPGA 2CANA 1IUGA 4AO9A 3FFHA 3QN6A 1WYVB 4DBCA 3FKDA 3F9TA 2R2NA 5FT8A 2R5EA 2AY2A 3G7QA 3VK4A 2FNUA 1AY8A 3HVYA 3RBFA 1AKBA 2Z1ZA 1N31A 2AY3A 1PFFA 2BI9A 3BV0A 3MADA 4P7YA 3EI7A 1G7XA 4KYOA 4A0GA 1BW0A 4ITXA 1B4XA 2W7GA 1P3WA 4XJOA 3WGCA 1GC4A 4LW2A 4XAUA 1OHYA 3VP6A 3W1HA 3E6GA 2VMVA 1D7VA 2D64A 2CH1A 4WXGA 2ZY3A 1TPLA 3PPLA 4RLGA 1I41A 3GBXA 2QLRA 1O62A 3A9YA 2JJFA 4WD2A 4WYCA 4EB7A 1MAPA 3GSBA 3QGUA 3OKSA 2ZP7A 3BWNA 2XH1A 1C9CA 3ZRQA 1X2AA 1BT4A 3PJ0A 4OMAA 2AY9A 2R0TA 2VMUA 4UOYA 2CH2A 1JF9A 3ATHA 1KKPA 5EAVA 3EI6A 3RUYA 1V72A 2JJEA 5G2QA 4QGRA 1BJOA 3TQXA 3BB8A 5DJ9A 1TATA 4OT8A 2X3LA 5LH9A 4EMYA 2W7FA 3ASBA 5D95A 2BI1A 1LKCA 2D66A 4JEVA 1CQ7A 4KXKA 4W5KA 1YNUA 2GMUA 2VYCA 1I43A 4BQ0A 3BC8A 5G0AA 3WLXA 5BJ4A 5G4IA 4ZWVA 1DJ9A 2CY8A 3FZ7A 2YKXA 4MQPA 1D7SA 2HZPA 5EIGA 3E9KA 2VGZA 1OXPA 2YCPA 3K7YA 1WSTA 4HF8A 1LC7A 4XJPA 3HQTA 4ZDOA 2AEUA 2C0RA 1M0PA 1YIYA 3MBBA 1I29A 4WYFA 1ORDA 4WB0B 3FQAA 4IW7A 3LVLB 2C44A 1CQ8A 4GE7A 4MSOA 4BHDA 2VMNA 1M6SA 1IVRA 4ZLVA 1J32A 1QJ3A 2DGLA 2V1PA 4RIZA 4TN4A 1QZ9A 3CQ5A 5LHAA 1XI9A 4ZASA 1V2DA 1PMOA 2X5DA 2Z9VA 1M32A 2HOYA 3IHJA 1UKJA 4U1TA 1KL1A 1YJYA 3NRAA 1WKGA 3KGXA 2BYLA 4OC9A 1CZEA 3A2BA 3PAAA 2HP2A 1E5FA 1MLYA 3UAKA 3JW9A 3R9AA 2OKJA 2FM1A 3H14A 4ZDPA 4BA4A 3EI9A 3H7FA 3PD6B 2DOUA 2E54A 2VGWA 1EG5A 3WKSA 4P3MA 1SFFA 4R5ZA 1AAMA 2CB1A 2BIGA 1AHEA 1W23A 3RBLA 5M4DA 3NYTA
chains in the Genus database with same CATH superfamily
2VIBA 2YKYA 2ZUKA 1V2FA 1TOEA 1LK9A 1BS0A 3BS8A 3E2FA 2HOZA 4MQQA 4PVFA 2DKJA 3IF2A 2YCNA 3AELA 4WXFA 5K8BA 4RITA 1MDZA 5KTBA 3BCBA 1RVYA 1KAFA 1UU2A 4IYOB 3ZZKA 2BWPA 3B1CA 3FDBA 4EU1A 4F5HA 1TOGA 1KL2A 3N4SA 2W7LA 2YCTA 4OBVA 5EUEA 3WKRA 3FTBA 2X5FA 8AATA 1Z7DA 2YRRA 2W8VA 4WLHA 3CBFA 5EUNA 1OATA 4M2KA 1YAAA 1AHYA 3BN1A 3PGYA 1IAYA 2Z1YA 1PG8A 1ASMA 1M0OA 3PDBA 4PFNA 1AMSA 3HT4A 4ATPA 4ATQA 1D7UA 2VMWA 1AMQA 1SVVA 4MKKA 1ASGA 1GC3A 2O7CA 3GETA 1X0MA 3HL2A 3NYUA 1X29A 1IJIA 4CVQA 4I8AA 4FFCA 3A9XA 3M5UA 1ASEA 3MC6A 4M2MA 4ZWMA 4LNLA 5I92A 4F4EA 4WYGA 3RQ1A 1JS6A 2YKVA 3RCHB 3CQ4A 1WYTB 2W7DA 2Z9XA 4AZJA 2AY1A 2PO3A 1TARA 2ZSLA 7AATA 1VJOA 4PIWA 1VP4A 1YOOA 3JZLA 2BI3A 4W1VA 4N0WA 4ZAHA 5EFSA 4RJYA 3QM2A 1CQ6A 2CTZA 1ZODA 3AV7A 3JWBA 2NMPA 1JG8A 3ZZJA 3ELPA 1WKHA 3I5TA 3CAIA 1FG3A 4A0FA 2YRIA 4JE5A 1XEYA 3NUIA 9AATA 4Y0IA 2EZ2A 2VMSA 2BWOA 1S09A 3W1IA 1YJSA 4HVKA 1AMAA 1ASDA 1ARGA 2VLFA 2GMSA 4ZSYA 1C0NA 1BQAA 2VMPA 2BI2A 2HUUA 1DTYA 3F0HA 4W8IA 2ZY4A 2BYJA 2OQXA 2VGTA 1S08A 2VMYA 3FZ6A 3EIBA 2JG2A 4ADDA 2AY5A 1AKCA 2CJGA 1QGNA 1CS1A 2BIAA 2OKKA 4CXRA 1AIAA 1E5EA 2ZJGA 2VMZA 2EH6A 3NUBA 3H9XA 2ZSMA 4M2JA 1WYVA 4ZDLA 4GEBA 4F5LA 2C81A 3ISLA 2W7JA 1D2FA 3DXVA 3AATA 3RI6A 2QA3A 4MY5A 1ASNA 4JF0A 4XK1A 2G6WA 3B1EA 4AH3A 1LS3A 1WYUB 4MGRA 1GEXA 2VMXA 2W7KA 3LWSA 3FQ8A 4Q6RA 4GE9A 3GR9A 4GDYA 1ARTA 2CJDA 3JTXA 2D65A 3N5MA 1TASA 2AY6A 3NYSA 3MAUA 2QB3A 2WKAA 4DGTA 2Z9UA 1G7WA 4F5KA 2AY4A 3E77A 4W1WA 4WP0A 3AENB 2RFVA 2W7MA 1ZOBA 2FQ6A 1IX6A 3FDDA 2FN6A 3AEOA 1AJSB 1Z3ZA 4JEYA 3A8UX 4R5FA 1MDOA 2YOBA 3K28A 3MKJA 2D61A 1ELUA 3LY1A 4F5GA 1BJ4A 4U2HA 4F5MA 2W8WA 2Z20A 4ISYA 4K05A 4W1XA 3JU7A 2CFBA 3FVUA 2VGSA 4MQRA 2FKIA 3DXWA 2HP1A 3WCNA 2QBTA 4NOGA 4E3QA 3B46A 2HORA 4Q75A 3E2ZB 3FCRA 3DC1A 3FD0A 5DJ1A 1LC5A 1ASAA 1C4KA 1PMMA 3GZDC 2HUFA 2Q7WA 1RV3A 5F8VA 2QB2A 3AEJC 3AEPA 1CZCA 1J04A 3LVMA 4A0RA 1ELQA 1B5PA 4LW4A 2D7ZA 4K2IA 3K40A 5DX5A 1DKAA 2EPJA 3USFA 2ZY2A 3BCAA 4A72A 3JWAA 2X8UA 1MLZA 3AOWA 3LG0A 2FYFA 1C7GA 1N2TA 4E3RA 4F5FA 1JS3A 2V0YA 4ZM4A 2FNIA 5FT6A 1GCKA 1GC2A 1FG7A 1N8PA 4UQVA 3WZFA 5E3KA 4JEWA 5M49A 3GJUA 5EUDA 4CBSA 2OGEA 4WB0A 3WX9A 1D7RA 1ECXA 3EUCA 1AHXA 1G4VA 2D7YA 3I16A 4Y0DA 4CBRA 2GSAA 3BWOA 5G09A 4IX8A 4H51A 3F6TA 1ARIA 2BKWA 3AENA 1OHVA 3PDXA 1UU1A 2BIEA 5F9SA 3HBXA 2AATA 1AX4A 1ASBA 3FQ7A 3QBOA 1ZC9A 4F5JA 1KKJA 3BCXA 1GDEA 2YHKA 4E77A 5D5SA 1BKGA 4OYTA 1QJ5A 1IX7A 1MDXA 3LVJA 2VMTA 1O69A 4IXOA 2F8JA 3UWCA 4J8LA 1BJOB 2VMRA 4OBUA 5AX8A 2TPLA 4L0OA 3GZCA 2R5CB 2Z9WA 3GZDA 4WXBA 2W8JA 3PD6A 5TF5A 3EZSA 4ZSWA 2E7IA 1W7MA 2W8UA 3AEJA 3DRDA 5E4ZA 1RV4A 1DGDA 3A9ZA 4JEZA 3FVXA 3ACZA 4A0HA 4JEXA 1ARHA 4J5UA 1O4SA 4EB5A 3N4RA 2GB3A 5EIGB 1M4NA 3E2YA 2WK7A 1CL2A 4JF1A 1GD9A 4UHNA 4TMRA 1M7YA 3OP7A 1BJNA 2ZYJA 3DZZA 4R8DA 4RJ0A 4E1OA 1KMKA 4WLJA 2VLHA 3NTJA 4Q31A 3AOVA 4WYAA 1AMRA 4IYOA 2CJHA 4PFFA 2Z67A 1OHWA 2BWNA 2DR1A 2PB0A 1ASLA 1B5OA 2VMQA 3WY7A 2W7IA 4ZM3A 1AICA 1SF2A 2O1BA 2YKUA 1IX8A 3B8XA 1GEYA 4O6ZA 1DFOA 2QMAA 4A6UA 4A6RA 5JAYA 4MKJA 1GC0A 2BHXA 1M0NA 2EGYA 4ADBA 3D6KA 3VOMA 1TOIA 2EO5A 2D5YA 3COGA 3PIUA 5EQCA 2A1VA 4XQ2A 3N7NA 1YIZA 2AEVA 2AY7A 2E7JA 2VI8A 1OXOA 4KAMA 1AHGA 1AIBA 1DJUA 3QI6A 4RKDA 1M0QA 3HDOA 5DB5A 4GSAA 4K2BA 4ITGA 2ZY5A 2VIAA 4AZKA 3II0A 1O61A 3KE3A 4IXZA 3KGWA 4ADCA 2ZC0A 1IBJA 4WYDA 5G4JA 1AAWA 3T32A 1AY5A 3DR4A 1Y4IA 2R5CA 2WK9A 2D63A 2EZ1A 3VK3A 2VGVA 3P1TA 4B9BA 4AO4A 3FZ8A 1CJ0A 3RCHA 4ADEA 1WYTA 1VEFA 4DQ6A 4OCAA 3CQ6A 2VI9A 1EQBA 2ORDA 5IWQA 3N0LA 2WK8A 4WBTA 2BI5A 2W7HA 3MAFB 3HLMA 1SPAA 1LW4A 3HMUA 3ZRPA 1CL1A 4WYEA 1ARSA 2PB2A 2Z61A 1X28A 4H63Q 1AJRA 2DKBA 1B8GA 1ASCA 1TOKA 3N75A 1U08A 4EFFA 1QIRA 2GQNA 1S07A 1SZUA 3PA9A 3EI8A 1LW5A 3TATA 4LC3A 1DGEA 4XEWA 1RVUA 1S06A 2JJHA 1SZSA 1W7NA 1C7NA 2DGKA 2HOXA 2VGUA 3ASAA 3L8AA 5HHYA 5BJ3A 1G4XA 3AEMC 1TOJA 3EIAA 3G0TA 3NU8A 3WCOA 3DR7A 2JJGA 3PDBB 3G8MA 2EYQA 4RM1A 4BA5A 4IY7A 2CINA 4AOAA 3DODA 5HDMA 4XJMA 2DGMA 4R2NA 4LNMA 1I48A 1KMJA 1V2EA 5E5IA 4Y0HA 3MEBA 4F5IA 3QHXA 1GBNA 4Q76A 3WGBA 1YJZA 3TFTA 5FT5A 4GRXA 4CXQA 2C7TA 3MC6C 3UE8A 1WYUA 1B9IA 4A6TA 1AKAA 4TV7A 3LVKA 3ZRRA 5M46A 1C7OA 3FRKA 4K2MA 4XJLA 3VK2A 3FVSA 1H1CA 5EAAA 2O0RA 5HXXA 4FL0A 3NDNA 5C6UA 1MGVA 1S0AA 3NX3A 4A00A 1FC4A 2OATA 3ELEA 1H0CA 3TCMA 1AHFA 3N4XA 1AY4A 2W8TA 1UU0A 2VMOA 3EZ1A 1B9HA 1GEWA 3NNKA 4IXSA 4GE4A 3P6KA 1AJSA 1DJEA 3MAFA 4OTLA 3NU7A 5FT4A 1ASFA 1BJWA 2AY8A 3DU4A 3BWNC 3VAXA 2OGAA 4LNJA 5G2PA 4BMKA 1QITA 3FFRA 4RAEA 4UHMA 5M4BA 1LC8A 2E7UA 3ECDA 3L44A 1MAQA 3B1DA 1W7LA 3FSLA 2WB6A 4UHOA 5J8QA 3W1JA 1T3IA 4JE5D 1SZKA 3E2ZA 3EI5A 3GWPA 3R4TA 2JISA 3KKIA 2XBNA 2W7EA 4RKCA 3Q8NA 1W3UA 4N0BA 3I4JA 3LV2A 3DYDA 1QISA 1EJIA 4W91A 3TFUA 4B98A 1BQDA 2CSTA 3AEMA 2JGTA 1IAXA 2HUIA 3QPGA 2CANA 1IUGA 4AO9A 3FFHA 3QN6A 1WYVB 4DBCA 3FKDA 3F9TA 2R2NA 5FT8A 2R5EA 2AY2A 3G7QA 3VK4A 2FNUA 1AY8A 3HVYA 3RBFA 1AKBA 2Z1ZA 1N31A 2AY3A 1PFFA 2BI9A 3BV0A 3MADA 4P7YA 3EI7A 1G7XA 4KYOA 4A0GA 1BW0A 4ITXA 1B4XA 2W7GA 1P3WA 4XJOA 3WGCA 1GC4A 4LW2A 4XAUA 1OHYA 3VP6A 3W1HA 3E6GA 2VMVA 1D7VA 2D64A 2CH1A 4WXGA 2ZY3A 1TPLA 3PPLA 4RLGA 1I41A 3GBXA 2KFPA 2QLRA 1O62A 3A9YA 2JJFA 4WD2A 4WYCA 4EB7A 1MAPA 3GSBA 3QGUA 3OKSA 2ZP7A 3BWNA 2XH1A 1C9CA 3ZRQA 1X2AA 1BT4A 3PJ0A 4OMAA 2AY9A 2R0TA 2VMUA 4UOYA 2CH2A 1JF9A 3ATHA 1KKPA 5EAVA 3EI6A 3RUYA 1V72A 2JJEA 5G2QA 4QGRA 2G7JA 1BJOA 3TQXA 3BB8A 5DJ9A 1TATA 4OT8A 2X3LA 5LH9A 4EMYA 2W7FA 3ASBA 5D95A 2BI1A 1LKCA 2D66A 4JEVA 1CQ7A 4KXKA 4W5KA 1YNUA 2GMUA 2VYCA 1I43A 2QSRA 4BQ0A 3BC8A 5G0AA 3WLXA 5BJ4A 5G4IA 4ZWVA 1DJ9A 2CY8A 3FZ7A 2YKXA 4MQPA 1D7SA 2HZPA 5EIGA 3E9KA 2VGZA 1OXPA 2YCPA 3K7YA 1WSTA 4HF8A 1LC7A 4XJPA 3HQTA 4ZDOA 2AEUA 2C0RA 1M0PA 1YIYA 3MBBA 1I29A 4WYFA 1ORDA 4WB0B 3FQAA 4IW7A 3LVLB 2C44A 1CQ8A 4GE7A 4MSOA 4BHDA 2VMNA 1M6SA 1IVRA 4ZLVA 1J32A 1QJ3A 2DGLA 2V1PA 4RIZA 4TN4A 1QZ9A 3CQ5A 5LHAA 1XI9A 4ZASA 1V2DA 1PMOA 2X5DA 2Z9VA 1M32A 2HOYA 3IHJA 1UKJA 4U1TA 1KL1A 1YJYA 3NRAA 1WKGA 3KGXA 2BYLA 4OC9A 1CZEA 3A2BA 3PAAA 2HP2A 1E5FA 1MLYA 3UAKA 3JW9A 3R9AA 2OKJA 2FM1A 3H14A 4ZDPA 4BA4A 3EI9A 3H7FA 3PD6B 2DOUA 2E54A 2VGWA 1EG5A 3WKSA 4P3MA 1SFFA 4R5ZA 1AAMA 2CB1A 2BIGA 1AHEA 1W23A 3RBLA 5M4DA 3NYTA
chains in the Genus database with same CATH topology
2VIBA 2YKYA 2ZUKA 1V2FA 1TOEA 1LK9A 1BS0A 3BS8A 3E2FA 2HOZA 4MQQA 4PVFA 2DKJA 3IF2A 2YCNA 3AELA 4WXFA 5K8BA 4RITA 1MDZA 5KTBA 3BCBA 1RVYA 1UU2A 4IYOB 3ZZKA 2BWPA 3B1CA 3FDBA 4EU1A 4F5HA 1TOGA 1KL2A 3N4SA 2W7LA 2YCTA 4OBVA 5EUEA 3WKRA 3FTBA 2X5FA 8AATA 1Z7DA 2YRRA 2W8VA 4WLHA 3CBFA 5EUNA 1OATA 4M2KA 1YAAA 1AHYA 3BN1A 3PGYA 1IAYA 2Z1YA 1PG8A 1ASMA 1M0OA 3PDBA 4PFNA 1AMSA 3HT4A 4ATPA 4ATQA 1D7UA 2VMWA 1AMQA 1SVVA 4MKKA 1ASGA 1GC3A 2O7CA 3GETA 1X0MA 3HL2A 3NYUA 1X29A 1IJIA 4CVQA 4I8AA 4FFCA 3A9XA 3M5UA 1ASEA 3MC6A 4M2MA 4ZWMA 4LNLA 5I92A 4F4EA 4WYGA 3RQ1A 1JS6A 2YKVA 3RCHB 3CQ4A 1WYTB 2W7DA 2Z9XA 4AZJA 2AY1A 2PO3A 1TARA 2ZSLA 7AATA 1VJOA 4PIWA 1VP4A 1YOOA 3JZLA 2BI3A 4W1VA 4N0WA 4ZAHA 5EFSA 4RJYA 3QM2A 1CQ6A 2CTZA 1ZODA 3AV7A 3JWBA 2NMPA 1JG8A 3ZZJA 3ELPA 1WKHA 3I5TA 3CAIA 1FG3A 4A0FA 2YRIA 4JE5A 1XEYA 3NUIA 9AATA 4Y0IA 2EZ2A 2VMSA 2BWOA 1S09A 3W1IA 1YJSA 4HVKA 1AMAA 1ASDA 1ARGA 2VLFA 2GMSA 4ZSYA 1C0NA 1BQAA 2VMPA 2BI2A 2HUUA 1DTYA 3F0HA 4W8IA 2ZY4A 2BYJA 2OQXA 2VGTA 1S08A 2VMYA 3FZ6A 3EIBA 2JG2A 4ADDA 2AY5A 1AKCA 2CJGA 1QGNA 1CS1A 2BIAA 2OKKA 4CXRA 1AIAA 1E5EA 2ZJGA 2VMZA 2EH6A 3NUBA 3H9XA 2ZSMA 4M2JA 1WYVA 4ZDLA 4GEBA 4F5LA 2C81A 3ISLA 2W7JA 1D2FA 3DXVA 3AATA 3RI6A 2QA3A 4MY5A 1ASNA 4JF0A 4XK1A 2G6WA 3B1EA 4AH3A 1LS3A 1WYUB 4MGRA 1GEXA 2VMXA 2W7KA 3LWSA 3FQ8A 4Q6RA 4GE9A 3GR9A 4GDYA 1ARTA 2CJDA 3JTXA 2D65A 3N5MA 1TASA 2AY6A 3NYSA 3MAUA 2QB3A 2WKAA 4DGTA 2Z9UA 1G7WA 4F5KA 2AY4A 3E77A 4W1WA 4WP0A 3AENB 2RFVA 2W7MA 1ZOBA 2FQ6A 1IX6A 3FDDA 2FN6A 3AEOA 1AJSB 1Z3ZA 4JEYA 3A8UX 4R5FA 1MDOA 2YOBA 3K28A 3MKJA 2D61A 1ELUA 3LY1A 4F5GA 1BJ4A 4U2HA 4F5MA 2W8WA 2Z20A 4ISYA 4K05A 4W1XA 3JU7A 2CFBA 3FVUA 2VGSA 4MQRA 2FKIA 3DXWA 2HP1A 3WCNA 2QBTA 4NOGA 4E3QA 3B46A 2HORA 4Q75A 3E2ZB 3FCRA 3DC1A 3FD0A 5DJ1A 1LC5A 1ASAA 1C4KA 1PMMA 3GZDC 2HUFA 2Q7WA 1RV3A 5F8VA 2QB2A 3AEJC 3AEPA 1CZCA 1J04A 3LVMA 4A0RA 1ELQA 1B5PA 4LW4A 2D7ZA 4K2IA 3K40A 5DX5A 1DKAA 2EPJA 3USFA 2ZY2A 3BCAA 4A72A 3JWAA 2X8UA 1MLZA 3AOWA 3LG0A 2FYFA 1C7GA 1N2TA 4E3RA 4F5FA 1JS3A 2V0YA 4ZM4A 2FNIA 5FT6A 1GCKA 1GC2A 1FG7A 1N8PA 4UQVA 3WZFA 5E3KA 4JEWA 5M49A 3GJUA 5EUDA 4CBSA 2OGEA 4WB0A 3WX9A 1D7RA 1ECXA 3EUCA 1AHXA 1G4VA 2D7YA 3I16A 4Y0DA 4CBRA 2GSAA 3BWOA 5G09A 4IX8A 4H51A 3F6TA 1ARIA 2BKWA 3AENA 1OHVA 3PDXA 1UU1A 2BIEA 5F9SA 3HBXA 2AATA 1AX4A 1ASBA 3FQ7A 3QBOA 1ZC9A 4F5JA 1KKJA 3BCXA 1GDEA 2YHKA 4E77A 5D5SA 1BKGA 4OYTA 1QJ5A 1IX7A 1MDXA 3LVJA 2VMTA 1O69A 4IXOA 2F8JA 3UWCA 4J8LA 1BJOB 2VMRA 4OBUA 5AX8A 2TPLA 4L0OA 3GZCA 2R5CB 2Z9WA 3GZDA 4WXBA 2W8JA 3PD6A 5TF5A 3EZSA 4ZSWA 2E7IA 1W7MA 2W8UA 3AEJA 3DRDA 5E4ZA 1RV4A 1DGDA 3A9ZA 4JEZA 3FVXA 3ACZA 4A0HA 4JEXA 1ARHA 4J5UA 1O4SA 4EB5A 3N4RA 2GB3A 5EIGB 1M4NA 3E2YA 2WK7A 1CL2A 4JF1A 1GD9A 4UHNA 4TMRA 1M7YA 3OP7A 1BJNA 2ZYJA 3DZZA 4R8DA 4RJ0A 4E1OA 1KMKA 4WLJA 2VLHA 3NTJA 4Q31A 3AOVA 4WYAA 1AMRA 4IYOA 2CJHA 4PFFA 2Z67A 1OHWA 2BWNA 2DR1A 2PB0A 1ASLA 1B5OA 2VMQA 3WY7A 2W7IA 4ZM3A 1AICA 1SF2A 2O1BA 2YKUA 1IX8A 3B8XA 1GEYA 4O6ZA 1DFOA 2QMAA 4A6UA 4A6RA 5JAYA 4MKJA 1GC0A 2BHXA 1M0NA 2EGYA 4ADBA 3D6KA 3VOMA 1TOIA 2EO5A 2D5YA 3COGA 3PIUA 5EQCA 2A1VA 4XQ2A 3N7NA 1YIZA 2AEVA 2AY7A 2E7JA 2VI8A 1OXOA 4KAMA 1AHGA 1AIBA 1DJUA 3QI6A 4RKDA 1M0QA 3HDOA 5DB5A 4GSAA 4K2BA 4ITGA 2ZY5A 2VIAA 4AZKA 3II0A 1O61A 3KE3A 4IXZA 3KGWA 4ADCA 2ZC0A 1IBJA 4WYDA 5G4JA 1AAWA 3T32A 1AY5A 3DR4A 1Y4IA 2R5CA 2WK9A 2D63A 2EZ1A 3VK3A 2VGVA 3P1TA 4B9BA 4AO4A 3FZ8A 1CJ0A 3RCHA 4ADEA 1WYTA 1VEFA 4DQ6A 4OCAA 3CQ6A 2VI9A 1EQBA 2ORDA 5IWQA 3N0LA 2WK8A 4WBTA 2BI5A 2W7HA 3MAFB 3HLMA 1SPAA 1LW4A 3HMUA 3ZRPA 1CL1A 4WYEA 1ARSA 2PB2A 2Z61A 1X28A 4H63Q 1AJRA 2DKBA 1B8GA 1ASCA 1TOKA 3N75A 1U08A 4EFFA 1QIRA 2GQNA 1S07A 1SZUA 3PA9A 3EI8A 1LW5A 3TATA 4LC3A 1DGEA 4XEWA 1RVUA 1S06A 2JJHA 1SZSA 1W7NA 1C7NA 2DGKA 2HOXA 2VGUA 3ASAA 3L8AA 5HHYA 5BJ3A 1G4XA 3AEMC 1TOJA 3EIAA 3G0TA 3NU8A 3WCOA 3DR7A 2JJGA 3PDBB 3G8MA 2EYQA 4RM1A 4BA5A 4IY7A 2CINA 4AOAA 3DODA 5HDMA 4XJMA 2DGMA 4R2NA 4LNMA 1I48A 1KMJA 1V2EA 5E5IA 4Y0HA 3MEBA 4F5IA 3QHXA 1GBNA 4Q76A 3WGBA 1YJZA 3TFTA 5FT5A 4GRXA 4CXQA 2C7TA 3MC6C 3UE8A 1WYUA 1B9IA 4A6TA 1AKAA 4TV7A 3LVKA 3ZRRA 5M46A 1C7OA 3FRKA 4K2MA 4XJLA 3VK2A 3FVSA 1H1CA 5EAAA 2O0RA 5HXXA 4FL0A 3NDNA 5C6UA 1MGVA 1S0AA 3NX3A 4A00A 1FC4A 2OATA 3ELEA 1H0CA 3TCMA 1AHFA 3N4XA 1AY4A 2W8TA 1UU0A 2VMOA 3EZ1A 1B9HA 1GEWA 3NNKA 4IXSA 4GE4A 3P6KA 1AJSA 1DJEA 3MAFA 4OTLA 3NU7A 5FT4A 1ASFA 1BJWA 2AY8A 3DU4A 3BWNC 3VAXA 2OGAA 4LNJA 5G2PA 4BMKA 1QITA 3FFRA 4RAEA 4UHMA 5M4BA 1LC8A 2E7UA 3ECDA 3L44A 1MAQA 3B1DA 1W7LA 3FSLA 2WB6A 4UHOA 5J8QA 3W1JA 1T3IA 4JE5D 1SZKA 3E2ZA 3EI5A 3GWPA 3R4TA 2JISA 3KKIA 2XBNA 2W7EA 4RKCA 3Q8NA 1W3UA 4N0BA 3I4JA 3LV2A 3DYDA 1QISA 1EJIA 4W91A 3TFUA 4B98A 1BQDA 2CSTA 3AEMA 2JGTA 1IAXA 2HUIA 3QPGA 2CANA 1IUGA 4AO9A 3FFHA 3QN6A 1WYVB 4DBCA 3FKDA 3F9TA 2R2NA 5FT8A 2R5EA 2AY2A 3G7QA 3VK4A 2FNUA 1AY8A 3HVYA 3RBFA 1AKBA 2Z1ZA 1N31A 2AY3A 1PFFA 2BI9A 3BV0A 3MADA 4P7YA 3EI7A 1G7XA 4KYOA 4A0GA 1BW0A 4ITXA 1B4XA 2W7GA 1P3WA 4XJOA 3WGCA 1GC4A 4LW2A 4XAUA 1OHYA 3VP6A 3W1HA 3E6GA 2VMVA 1D7VA 2D64A 2CH1A 4WXGA 2ZY3A 1TPLA 3PPLA 4RLGA 1I41A 3GBXA 2KFPA 2QLRA 1O62A 3A9YA 2JJFA 4WD2A 4WYCA 4EB7A 1MAPA 3GSBA 3QGUA 3OKSA 2ZP7A 3BWNA 2XH1A 1C9CA 3ZRQA 1X2AA 1BT4A 3PJ0A 4OMAA 2AY9A 2R0TA 2VMUA 4UOYA 2CH2A 1JF9A 3ATHA 1KKPA 5EAVA 3EI6A 3RUYA 1V72A 2JJEA 5G2QA 4QGRA 2G7JA 1BJOA 3TQXA 3BB8A 5DJ9A 1TATA 4OT8A 2X3LA 5LH9A 4EMYA 2W7FA 3ASBA 5D95A 2BI1A 1LKCA 2D66A 4JEVA 1CQ7A 4KXKA 4W5KA 1YNUA 2GMUA 2VYCA 1I43A 2QSRA 4BQ0A 3BC8A 5G0AA 3WLXA 5BJ4A 5G4IA 4ZWVA 1DJ9A 2CY8A 3FZ7A 2YKXA 4MQPA 1D7SA 2HZPA 5EIGA 3E9KA 2VGZA 1OXPA 2YCPA 3K7YA 1WSTA 4HF8A 1LC7A 4XJPA 3HQTA 4ZDOA 2AEUA 2C0RA 1M0PA 1YIYA 3MBBA 1I29A 4WYFA 1ORDA 4WB0B 3FQAA 4IW7A 3LVLB 2C44A 1CQ8A 4GE7A 4MSOA 4BHDA 2VMNA 1M6SA 1IVRA 4ZLVA 1J32A 1QJ3A 2DGLA 2V1PA 4RIZA 4TN4A 1QZ9A 3CQ5A 5LHAA 1XI9A 4ZASA 1V2DA 1PMOA 2X5DA 2Z9VA 1M32A 2HOYA 3IHJA 1UKJA 4U1TA 1KL1A 1YJYA 3NRAA 1WKGA 3KGXA 2BYLA 4OC9A 1CZEA 3A2BA 3PAAA 2HP2A 1E5FA 1MLYA 3UAKA 3JW9A 3R9AA 2OKJA 2FM1A 3H14A 4ZDPA 4BA4A 3EI9A 3H7FA 3PD6B 2DOUA 2E54A 2VGWA 1EG5A 3WKSA 4P3MA 1SFFA 4R5ZA 1AAMA 2CB1A 2BIGA 1AHEA 1W23A 3RBLA 5M4DA 3NYTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VIB A;  2YKY A;  2ZUK A;  1V2F A;  1TOE A;  1LK9 A;  1BS0 A;  3BS8 A;  3E2F A;  2HOZ A;  4MQQ A;  4PVF A;  2DKJ A;  3IF2 A;  2YCN A;  3AEL A;  4WXF A;  5K8B A;  4RIT A;  1MDZ A;  3BCB A;  1RVY A;  1UU2 A;  4IYO B;  3ZZK A;  2BWP A;  3B1C A;  3FDB A;  4EU1 A;  4F5H A;  1TOG A;  1KL2 A;  2W7L A;  2YCT A;  4OBV A;  5EUE A;  3WKR A;  3FTB A;  2X5F A;  8AAT A;  1Z7D A;  2YRR A;  2W8V A;  4WLH A;  3CBF A;  5EUN A;  1OAT A;  4M2K A;  1YAA A;  1AHY A;  3BN1 A;  3PGY A;  1IAY A;  2Z1Y A;  1PG8 A;  1ASM A;  1M0O A;  3PDB A;  4PFN A;  1AMS A;  3HT4 A;  4ATP A;  4ATQ A;  1D7U A;  2VMW A;  1AMQ A;  1SVV A;  4MKK A;  1ASG A;  1GC3 A;  2O7C A;  3GET A;  1X0M A;  3HL2 A;  3NYU A;  1X29 A;  1IJI A;  4CVQ A;  4I8A A;  4FFC A;  3A9X A;  3M5U A;  1ASE A;  3MC6 A;  4M2M A;  4ZWM A;  4LNL A;  5I92 A;  4F4E A;  4WYG A;  3RQ1 A;  1JS6 A;  2YKV A;  3RCH B;  3CQ4 A;  1WYT B;  2W7D A;  2Z9X A;  4AZJ A;  2AY1 A;  2PO3 A;  1TAR A;  2ZSL A;  7AAT A;  1VJO A;  4PIW A;  1VP4 A;  1YOO A;  3JZL A;  2BI3 A;  4W1V A;  4N0W A;  4ZAH A;  5EFS A;  4RJY A;  3QM2 A;  1CQ6 A;  2CTZ A;  1ZOD A;  3AV7 A;  3JWB A;  2NMP A;  1JG8 A;  3ZZJ A;  3ELP A;  1WKH A;  3I5T A;  3CAI A;  1FG3 A;  4A0F A;  2YRI A;  4JE5 A;  1XEY A;  3NUI A;  9AAT A;  4Y0I A;  2EZ2 A;  2VMS A;  2BWO A;  1S09 A;  3W1I A;  1YJS A;  4HVK A;  1AMA A;  1ASD A;  1ARG A;  2VLF A;  2GMS A;  4ZSY A;  1C0N A;  1BQA A;  2VMP A;  2BI2 A;  2HUU A;  1DTY A;  3F0H A;  4W8I A;  2ZY4 A;  2BYJ A;  2OQX A;  2VGT A;  1S08 A;  2VMY A;  3FZ6 A;  3EIB A;  2JG2 A;  4ADD A;  2AY5 A;  1AKC A;  2CJG A;  1QGN A;  1CS1 A;  2BIA A;  2OKK A;  4CXR A;  1AIA A;  1E5E A;  2ZJG A;  2VMZ A;  2EH6 A;  3NUB A;  2ZSM A;  4M2J A;  1WYV A;  4ZDL A;  4GEB A;  4F5L A;  2C81 A;  3ISL A;  2W7J A;  1D2F A;  3DXV A;  3AAT A;  3RI6 A;  2QA3 A;  4MY5 A;  1ASN A;  4JF0 A;  4XK1 A;  2G6W A;  3B1E A;  4AH3 A;  1LS3 A;  1WYU B;  4MGR A;  1GEX A;  2VMX A;  2W7K A;  3LWS A;  3FQ8 A;  4Q6R A;  4GE9 A;  3GR9 A;  4GDY A;  1ART A;  2CJD A;  3JTX A;  2D65 A;  3N5M A;  1TAS A;  2AY6 A;  3NYS A;  3MAU A;  2QB3 A;  2WKA A;  4DGT A;  2Z9U A;  1G7W A;  4F5K A;  2AY4 A;  3E77 A;  4W1W A;  4WP0 A;  3AEN B;  2RFV A;  2W7M A;  1ZOB A;  2FQ6 A;  1IX6 A;  3FDD A;  2FN6 A;  3AEO A;  1AJS B;  1Z3Z A;  4JEY A;  3A8U X;  4R5F A;  1MDO A;  2YOB A;  3K28 A;  3MKJ A;  2D61 A;  1ELU A;  3LY1 A;  4F5G A;  1BJ4 A;  4U2H A;  4F5M A;  2W8W A;  2Z20 A;  4ISY A;  4W1X A;  3JU7 A;  2CFB A;  3FVU A;  2VGS A;  4MQR A;  3DXW A;  2HP1 A;  3WCN A;  2QBT A;  4NOG A;  4E3Q A;  3B46 A;  2HOR A;  4Q75 A;  3E2Z B;  3FCR A;  3DC1 A;  3FD0 A;  5DJ1 A;  1LC5 A;  1ASA A;  1C4K A;  1PMM A;  3GZD C;  2HUF A;  2Q7W A;  1RV3 A;  5F8V A;  2QB2 A;  3AEJ C;  3AEP A;  1CZC A;  1J04 A;  3LVM A;  4A0R A;  1ELQ A;  1B5P A;  4LW4 A;  2D7Z A;  4K2I A;  3K40 A;  5DX5 A;  1DKA A;  2EPJ A;  3USF A;  2ZY2 A;  3BCA A;  4A72 A;  3JWA A;  2X8U A;  1MLZ A;  3AOW A;  3LG0 A;  2FYF A;  1C7G A;  1N2T A;  4E3R A;  4F5F A;  1JS3 A;  2V0Y A;  4ZM4 A;  2FNI A;  5FT6 A;  1GCK A;  1GC2 A;  1FG7 A;  1N8P A;  4UQV A;  3WZF A;  5E3K A;  4JEW A;  5M49 A;  3GJU A;  5EUD A;  4CBS A;  2OGE A;  4WB0 A;  3WX9 A;  1D7R A;  1ECX A;  3EUC A;  1AHX A;  1G4V A;  2D7Y A;  3I16 A;  4Y0D A;  4CBR A;  2GSA A;  3BWO A;  5G09 A;  4IX8 A;  4H51 A;  3F6T A;  1ARI A;  2BKW A;  3AEN A;  1OHV A;  3PDX A;  1UU1 A;  2BIE A;  5F9S A;  3HBX A;  2AAT A;  1AX4 A;  1ASB A;  3FQ7 A;  3QBO A;  1ZC9 A;  4F5J A;  1KKJ A;  3BCX A;  1GDE A;  2YHK A;  4E77 A;  5D5S A;  1BKG A;  4OYT A;  1QJ5 A;  1IX7 A;  1MDX A;  3LVJ A;  2VMT A;  1O69 A;  4IXO A;  2F8J A;  3UWC A;  4J8L A;  1BJO B;  2VMR A;  4OBU A;  5AX8 A;  2TPL A;  4L0O A;  3GZC A;  2R5C B;  2Z9W A;  3GZD A;  4WXB A;  2W8J A;  3PD6 A;  5TF5 A;  3EZS A;  4ZSW A;  2E7I A;  1W7M A;  2W8U A;  3AEJ A;  3DRD A;  5E4Z A;  1RV4 A;  1DGD A;  3A9Z A;  4JEZ A;  3FVX A;  3ACZ A;  4A0H A;  4JEX A;  1ARH A;  4J5U A;  1O4S A;  4EB5 A;  2GB3 A;  5EIG B;  1M4N A;  3E2Y A;  2WK7 A;  1CL2 A;  4JF1 A;  1GD9 A;  4UHN A;  4TMR A;  1M7Y A;  3OP7 A;  1BJN A;  2ZYJ A;  3DZZ A;  4R8D A;  4RJ0 A;  4E1O A;  1KMK A;  4WLJ A;  2VLH A;  3NTJ A;  4Q31 A;  3AOV A;  4WYA A;  1AMR A;  4IYO A;  2CJH A;  4PFF A;  2Z67 A;  1OHW A;  2BWN A;  2DR1 A;  2PB0 A;  1ASL A;  1B5O A;  2VMQ A;  3WY7 A;  2W7I A;  4ZM3 A;  1AIC A;  1SF2 A;  2O1B A;  2YKU A;  1IX8 A;  3B8X A;  1GEY A;  4O6Z A;  1DFO A;  2QMA A;  4A6U A;  4A6R A;  5JAY A;  4MKJ A;  1GC0 A;  2BHX A;  1M0N A;  2EGY A;  4ADB A;  3D6K A;  3VOM A;  1TOI A;  2EO5 A;  2D5Y A;  3COG A;  3PIU A;  5EQC A;  4XQ2 A;  1YIZ A;  2AEV A;  2AY7 A;  2E7J A;  2VI8 A;  1OXO A;  4KAM A;  1AHG A;  1AIB A;  1DJU A;  3QI6 A;  4RKD A;  1M0Q A;  3HDO A;  5DB5 A;  4GSA A;  4K2B A;  4ITG A;  2ZY5 A;  2VIA A;  4AZK A;  3II0 A;  1O61 A;  3KE3 A;  4IXZ A;  3KGW A;  4ADC A;  2ZC0 A;  1IBJ A;  4WYD A;  5G4J A;  1AAW A;  3T32 A;  1AY5 A;  3DR4 A;  1Y4I A;  2R5C A;  2WK9 A;  2D63 A;  2EZ1 A;  3VK3 A;  2VGV A;  3P1T A;  4B9B A;  4AO4 A;  3FZ8 A;  1CJ0 A;  3RCH A;  4ADE A;  1WYT A;  1VEF A;  4DQ6 A;  4OCA A;  3CQ6 A;  2VI9 A;  1EQB A;  2ORD A;  5IWQ A;  3N0L A;  2WK8 A;  4WBT A;  2BI5 A;  2W7H A;  3MAF B;  3HLM A;  1SPA A;  1LW4 A;  3HMU A;  3ZRP A;  1CL1 A;  4WYE A;  1ARS A;  2PB2 A;  2Z61 A;  1X28 A;  1AJR A;  2DKB A;  1B8G A;  1ASC A;  1TOK A;  3N75 A;  1U08 A;  4EFF A;  1QIR A;  2GQN A;  1S07 A;  1SZU A;  3PA9 A;  3EI8 A;  1LW5 A;  3TAT A;  4LC3 A;  1DGE A;  4XEW A;  1RVU A;  1S06 A;  2JJH A;  1SZS A;  1W7N A;  1C7N A;  2DGK A;  2HOX A;  2VGU A;  3ASA A;  3L8A A;  5HHY A;  5BJ3 A;  1G4X A;  3AEM C;  1TOJ A;  3EIA A;  3G0T A;  3NU8 A;  3WCO A;  3DR7 A;  2JJG A;  3PDB B;  3G8M A;  4RM1 A;  4BA5 A;  4IY7 A;  2CIN A;  4AOA A;  3DOD A;  5HDM A;  4XJM A;  2DGM A;  4R2N A;  4LNM A;  1I48 A;  1KMJ A;  1V2E A;  5E5I A;  4Y0H A;  3MEB A;  4F5I A;  3QHX A;  1GBN A;  4Q76 A;  3WGB A;  1YJZ A;  3TFT A;  5FT5 A;  4GRX A;  4CXQ A;  2C7T A;  3MC6 C;  3UE8 A;  1WYU A;  1B9I A;  4A6T A;  1AKA A;  4TV7 A;  3LVK A;  3ZRR A;  5M46 A;  1C7O A;  3FRK A;  4K2M A;  4XJL A;  3VK2 A;  3FVS A;  1H1C A;  5EAA A;  2O0R A;  5HXX A;  4FL0 A;  3NDN A;  5C6U A;  1MGV A;  1S0A A;  3NX3 A;  4A00 A;  1FC4 A;  2OAT A;  3ELE A;  1H0C A;  3TCM A;  1AHF A;  1AY4 A;  2W8T A;  1UU0 A;  2VMO A;  3EZ1 A;  1B9H A;  1GEW A;  3NNK A;  4IXS A;  4GE4 A;  3P6K A;  1AJS A;  1DJE A;  3MAF A;  4OTL A;  3NU7 A;  5FT4 A;  1ASF A;  1BJW A;  2AY8 A;  3DU4 A;  3BWN C;  3VAX A;  2OGA A;  4LNJ A;  5G2P A;  4BMK A;  1QIT A;  3FFR A;  4RAE A;  4UHM A;  5M4B A;  1LC8 A;  2E7U A;  3ECD A;  3L44 A;  1MAQ A;  3B1D A;  1W7L A;  3FSL A;  4UHO A;  5J8Q A;  3W1J A;  1T3I A;  4JE5 D;  1SZK A;  3E2Z A;  3EI5 A;  3GWP A;  3R4T A;  2JIS A;  3KKI A;  2XBN A;  2W7E A;  4RKC A;  3Q8N A;  1W3U A;  4N0B A;  3I4J A;  3LV2 A;  3DYD A;  1QIS A;  1EJI A;  4W91 A;  3TFU A;  4B98 A;  1BQD A;  2CST A;  3AEM A;  2JGT A;  1IAX A;  2HUI A;  3QPG A;  2CAN A;  1IUG A;  4AO9 A;  3FFH A;  3QN6 A;  1WYV B;  4DBC A;  3FKD A;  3F9T A;  2R2N A;  5FT8 A;  2R5E A;  2AY2 A;  3G7Q A;  3VK4 A;  2FNU A;  1AY8 A;  3HVY A;  3RBF A;  1AKB A;  2Z1Z A;  1N31 A;  2AY3 A;  1PFF A;  2BI9 A;  3BV0 A;  3MAD A;  4P7Y A;  3EI7 A;  1G7X A;  4KYO A;  4A0G A;  1BW0 A;  4ITX A;  1B4X A;  2W7G A;  1P3W A;  4XJO A;  3WGC A;  1GC4 A;  4LW2 A;  4XAU A;  1OHY A;  3VP6 A;  3W1H A;  3E6G A;  2VMV A;  1D7V A;  2D64 A;  2CH1 A;  4WXG A;  2ZY3 A;  1TPL A;  3PPL A;  4RLG A;  1I41 A;  3GBX A;  2QLR A;  1O62 A;  3A9Y A;  2JJF A;  4WD2 A;  4WYC A;  4EB7 A;  1MAP A;  3GSB A;  3QGU A;  3OKS A;  2ZP7 A;  3BWN A;  2XH1 A;  1C9C A;  3ZRQ A;  1X2A A;  1BT4 A;  3PJ0 A;  4OMA A;  2AY9 A;  2R0T A;  2VMU A;  4UOY A;  2CH2 A;  1JF9 A;  3ATH A;  1KKP A;  5EAV A;  3EI6 A;  3RUY A;  1V72 A;  2JJE A;  5G2Q A;  4QGR A;  1BJO A;  3TQX A;  3BB8 A;  5DJ9 A;  1TAT A;  4OT8 A;  2X3L A;  5LH9 A;  4EMY A;  2W7F A;  3ASB A;  5D95 A;  2BI1 A;  1LKC A;  2D66 A;  4JEV A;  1CQ7 A;  4KXK A;  4W5K A;  1YNU A;  2GMU A;  2VYC A;  1I43 A;  4BQ0 A;  3BC8 A;  5G0A A;  3WLX A;  5BJ4 A;  5G4I A;  4ZWV A;  1DJ9 A;  2CY8 A;  3FZ7 A;  2YKX A;  4MQP A;  1D7S A;  2HZP A;  5EIG A;  3E9K A;  2VGZ A;  1OXP A;  2YCP A;  3K7Y A;  1WST A;  4HF8 A;  1LC7 A;  4XJP A;  3HQT A;  4ZDO A;  2AEU A;  2C0R A;  1M0P A;  1YIY A;  3MBB A;  1I29 A;  4WYF A;  1ORD A;  4WB0 B;  3FQA A;  4IW7 A;  3LVL B;  2C44 A;  1CQ8 A;  4GE7 A;  4MSO A;  4BHD A;  2VMN A;  1M6S A;  1IVR A;  4ZLV A;  1J32 A;  1QJ3 A;  2DGL A;  2V1P A;  4RIZ A;  4TN4 A;  1QZ9 A;  3CQ5 A;  5LHA A;  1XI9 A;  4ZAS A;  1V2D A;  1PMO A;  2X5D A;  2Z9V A;  1M32 A;  2HOY A;  3IHJ A;  1UKJ A;  4U1T A;  1KL1 A;  1YJY A;  3NRA A;  1WKG A;  3KGX A;  2BYL A;  4OC9 A;  1CZE A;  3A2B A;  3PAA A;  2HP2 A;  1E5F A;  1MLY A;  3UAK A;  3JW9 A;  3R9A A;  2OKJ A;  2FM1 A;  3H14 A;  4ZDP A;  4BA4 A;  3EI9 A;  3H7F A;  3PD6 B;  2DOU A;  2E54 A;  2VGW A;  1EG5 A;  3WKS A;  4P3M A;  1SFF A;  4R5Z A;  1AAM A;  2CB1 A;  2BIG A;  1AHE A;  1W23 A;  3RBL A;  5M4D A;  3NYT A; 
#chains in the Genus database with same CATH topology
 2VIB A;  2YKY A;  2ZUK A;  1V2F A;  1TOE A;  1LK9 A;  1BS0 A;  3BS8 A;  3E2F A;  2HOZ A;  4MQQ A;  4PVF A;  2DKJ A;  3IF2 A;  2YCN A;  3AEL A;  4WXF A;  5K8B A;  4RIT A;  1MDZ A;  5KTB A;  3BCB A;  1RVY A;  1KAF A;  1UU2 A;  4IYO B;  3ZZK A;  2BWP A;  3B1C A;  3FDB A;  4EU1 A;  4F5H A;  1TOG A;  1KL2 A;  3N4S A;  2W7L A;  2YCT A;  4OBV A;  5EUE A;  3WKR A;  3FTB A;  2X5F A;  8AAT A;  1Z7D A;  2YRR A;  2W8V A;  4WLH A;  3CBF A;  5EUN A;  1OAT A;  4M2K A;  1YAA A;  1AHY A;  3BN1 A;  3PGY A;  1IAY A;  2Z1Y A;  1PG8 A;  1ASM A;  1M0O A;  3PDB A;  4PFN A;  1AMS A;  3HT4 A;  4ATP A;  4ATQ A;  1D7U A;  2VMW A;  1AMQ A;  1SVV A;  4MKK A;  1ASG A;  1GC3 A;  2O7C A;  3GET A;  1X0M A;  3HL2 A;  3NYU A;  1X29 A;  1IJI A;  4CVQ A;  4I8A A;  4FFC A;  3A9X A;  3M5U A;  1ASE A;  3MC6 A;  4M2M A;  4ZWM A;  4LNL A;  5I92 A;  4F4E A;  4WYG A;  3RQ1 A;  1JS6 A;  2YKV A;  3RCH B;  3CQ4 A;  1WYT B;  2W7D A;  2Z9X A;  4AZJ A;  2AY1 A;  2PO3 A;  1TAR A;  2ZSL A;  7AAT A;  1VJO A;  4PIW A;  1VP4 A;  1YOO A;  3JZL A;  2BI3 A;  4W1V A;  4N0W A;  4ZAH A;  5EFS A;  4RJY A;  3QM2 A;  1CQ6 A;  2CTZ A;  1ZOD A;  3AV7 A;  3JWB A;  2NMP A;  1JG8 A;  3ZZJ A;  3ELP A;  1WKH A;  3I5T A;  3CAI A;  1FG3 A;  4A0F A;  2YRI A;  4JE5 A;  1XEY A;  3NUI A;  9AAT A;  4Y0I A;  2EZ2 A;  2VMS A;  2BWO A;  1S09 A;  3W1I A;  1YJS A;  4HVK A;  1AMA A;  1ASD A;  1ARG A;  2VLF A;  2GMS A;  4ZSY A;  1C0N A;  1BQA A;  2VMP A;  2BI2 A;  2HUU A;  1DTY A;  3F0H A;  4W8I A;  2ZY4 A;  2BYJ A;  2OQX A;  2VGT A;  1S08 A;  2VMY A;  3FZ6 A;  3EIB A;  2JG2 A;  4ADD A;  2AY5 A;  1AKC A;  2CJG A;  1QGN A;  1CS1 A;  2BIA A;  2OKK A;  4CXR A;  1AIA A;  1E5E A;  2ZJG A;  2VMZ A;  2EH6 A;  3NUB A;  3H9X A;  2ZSM A;  4M2J A;  1WYV A;  4ZDL A;  4GEB A;  4F5L A;  2C81 A;  3ISL A;  2W7J A;  1D2F A;  3DXV A;  3AAT A;  3RI6 A;  2QA3 A;  4MY5 A;  1ASN A;  4JF0 A;  4XK1 A;  2G6W A;  3B1E A;  4AH3 A;  1LS3 A;  1WYU B;  4MGR A;  1GEX A;  2VMX A;  2W7K A;  3LWS A;  3FQ8 A;  4Q6R A;  4GE9 A;  3GR9 A;  4GDY A;  1ART A;  2CJD A;  3JTX A;  2D65 A;  3N5M A;  1TAS A;  2AY6 A;  3NYS A;  3MAU A;  2QB3 A;  2WKA A;  4DGT A;  2Z9U A;  1G7W A;  4F5K A;  2AY4 A;  3E77 A;  4W1W A;  4WP0 A;  3AEN B;  2RFV A;  2W7M A;  1ZOB A;  2FQ6 A;  1IX6 A;  3FDD A;  2FN6 A;  3AEO A;  1AJS B;  1Z3Z A;  4JEY A;  3A8U X;  4R5F A;  1MDO A;  2YOB A;  3K28 A;  3MKJ A;  2D61 A;  1ELU A;  3LY1 A;  4F5G A;  1BJ4 A;  4U2H A;  4F5M A;  2W8W A;  2Z20 A;  4ISY A;  4K05 A;  4W1X A;  3JU7 A;  2CFB A;  3FVU A;  2VGS A;  4MQR A;  2FKI A;  3DXW A;  2HP1 A;  3WCN A;  2QBT A;  4NOG A;  4E3Q A;  3B46 A;  2HOR A;  4Q75 A;  3E2Z B;  3FCR A;  3DC1 A;  3FD0 A;  5DJ1 A;  1LC5 A;  1ASA A;  1C4K A;  1PMM A;  3GZD C;  2HUF A;  2Q7W A;  1RV3 A;  5F8V A;  2QB2 A;  3AEJ C;  3AEP A;  1CZC A;  1J04 A;  3LVM A;  4A0R A;  1ELQ A;  1B5P A;  4LW4 A;  2D7Z A;  4K2I A;  3K40 A;  5DX5 A;  1DKA A;  2EPJ A;  3USF A;  2ZY2 A;  3BCA A;  4A72 A;  3JWA A;  2X8U A;  1MLZ A;  3AOW A;  3LG0 A;  2FYF A;  1C7G A;  1N2T A;  4E3R A;  4F5F A;  1JS3 A;  2V0Y A;  4ZM4 A;  2FNI A;  5FT6 A;  1GCK A;  1GC2 A;  1FG7 A;  1N8P A;  4UQV A;  3WZF A;  5E3K A;  4JEW A;  5M49 A;  3GJU A;  5EUD A;  4CBS A;  2OGE A;  4WB0 A;  3WX9 A;  1D7R A;  1ECX A;  3EUC A;  1AHX A;  1G4V A;  2D7Y A;  3I16 A;  4Y0D A;  4CBR A;  2GSA A;  3BWO A;  5G09 A;  4IX8 A;  4H51 A;  3F6T A;  1ARI A;  2BKW A;  3AEN A;  1OHV A;  3PDX A;  1UU1 A;  2BIE A;  5F9S A;  3HBX A;  2AAT A;  1AX4 A;  1ASB A;  3FQ7 A;  3QBO A;  1ZC9 A;  4F5J A;  1KKJ A;  3BCX A;  1GDE A;  2YHK A;  4E77 A;  5D5S A;  1BKG A;  4OYT A;  1QJ5 A;  1IX7 A;  1MDX A;  3LVJ A;  2VMT A;  1O69 A;  4IXO A;  2F8J A;  3UWC A;  4J8L A;  1BJO B;  2VMR A;  4OBU A;  5AX8 A;  2TPL A;  4L0O A;  3GZC A;  2R5C B;  2Z9W A;  3GZD A;  4WXB A;  2W8J A;  3PD6 A;  5TF5 A;  3EZS A;  4ZSW A;  2E7I A;  1W7M A;  2W8U A;  3AEJ A;  3DRD A;  5E4Z A;  1RV4 A;  1DGD A;  3A9Z A;  4JEZ A;  3FVX A;  3ACZ A;  4A0H A;  4JEX A;  1ARH A;  4J5U A;  1O4S A;  4EB5 A;  3N4R A;  2GB3 A;  5EIG B;  1M4N A;  3E2Y A;  2WK7 A;  1CL2 A;  4JF1 A;  1GD9 A;  4UHN A;  4TMR A;  1M7Y A;  3OP7 A;  1BJN A;  2ZYJ A;  3DZZ A;  4R8D A;  4RJ0 A;  4E1O A;  1KMK A;  4WLJ A;  2VLH A;  3NTJ A;  4Q31 A;  3AOV A;  4WYA A;  1AMR A;  4IYO A;  2CJH A;  4PFF A;  2Z67 A;  1OHW A;  2BWN A;  2DR1 A;  2PB0 A;  1ASL A;  1B5O A;  2VMQ A;  3WY7 A;  2W7I A;  4ZM3 A;  1AIC A;  1SF2 A;  2O1B A;  2YKU A;  1IX8 A;  3B8X A;  1GEY A;  4O6Z A;  1DFO A;  2QMA A;  4A6U A;  4A6R A;  5JAY A;  4MKJ A;  1GC0 A;  2BHX A;  1M0N A;  2EGY A;  4ADB A;  3D6K A;  3VOM A;  1TOI A;  2EO5 A;  2D5Y A;  3COG A;  3PIU A;  5EQC A;  2A1V A;  4XQ2 A;  3N7N A;  1YIZ A;  2AEV A;  2AY7 A;  2E7J A;  2VI8 A;  1OXO A;  4KAM A;  1AHG A;  1AIB A;  1DJU A;  3QI6 A;  4RKD A;  1M0Q A;  3HDO A;  5DB5 A;  4GSA A;  4K2B A;  4ITG A;  2ZY5 A;  2VIA A;  4AZK A;  3II0 A;  1O61 A;  3KE3 A;  4IXZ A;  3KGW A;  4ADC A;  2ZC0 A;  1IBJ A;  4WYD A;  5G4J A;  1AAW A;  3T32 A;  1AY5 A;  3DR4 A;  1Y4I A;  2R5C A;  2WK9 A;  2D63 A;  2EZ1 A;  3VK3 A;  2VGV A;  3P1T A;  4B9B A;  4AO4 A;  3FZ8 A;  1CJ0 A;  3RCH A;  4ADE A;  1WYT A;  1VEF A;  4DQ6 A;  4OCA A;  3CQ6 A;  2VI9 A;  1EQB A;  2ORD A;  5IWQ A;  3N0L A;  2WK8 A;  4WBT A;  2BI5 A;  2W7H A;  3MAF B;  3HLM A;  1SPA A;  1LW4 A;  3HMU A;  3ZRP A;  1CL1 A;  4WYE A;  1ARS A;  2PB2 A;  2Z61 A;  1X28 A;  4H63 Q;  1AJR A;  2DKB A;  1B8G A;  1ASC A;  1TOK A;  3N75 A;  1U08 A;  4EFF A;  1QIR A;  2GQN A;  1S07 A;  1SZU A;  3PA9 A;  3EI8 A;  1LW5 A;  3TAT A;  4LC3 A;  1DGE A;  4XEW A;  1RVU A;  1S06 A;  2JJH A;  1SZS A;  1W7N A;  1C7N A;  2DGK A;  2HOX A;  2VGU A;  3ASA A;  3L8A A;  5HHY A;  5BJ3 A;  1G4X A;  3AEM C;  1TOJ A;  3EIA A;  3G0T A;  3NU8 A;  3WCO A;  3DR7 A;  2JJG A;  3PDB B;  3G8M A;  2EYQ A;  4RM1 A;  4BA5 A;  4IY7 A;  2CIN A;  4AOA A;  3DOD A;  5HDM A;  4XJM A;  2DGM A;  4R2N A;  4LNM A;  1I48 A;  1KMJ A;  1V2E A;  5E5I A;  4Y0H A;  3MEB A;  4F5I A;  3QHX A;  1GBN A;  4Q76 A;  3WGB A;  1YJZ A;  3TFT A;  5FT5 A;  4GRX A;  4CXQ A;  2C7T A;  3MC6 C;  3UE8 A;  1WYU A;  1B9I A;  4A6T A;  1AKA A;  4TV7 A;  3LVK A;  3ZRR A;  5M46 A;  1C7O A;  3FRK A;  4K2M A;  4XJL A;  3VK2 A;  3FVS A;  1H1C A;  5EAA A;  2O0R A;  5HXX A;  4FL0 A;  3NDN A;  5C6U A;  1MGV A;  1S0A A;  3NX3 A;  4A00 A;  1FC4 A;  2OAT A;  3ELE A;  1H0C A;  3TCM A;  1AHF A;  3N4X A;  1AY4 A;  2W8T A;  1UU0 A;  2VMO A;  3EZ1 A;  1B9H A;  1GEW A;  3NNK A;  4IXS A;  4GE4 A;  3P6K A;  1AJS A;  1DJE A;  3MAF A;  4OTL A;  3NU7 A;  5FT4 A;  1ASF A;  1BJW A;  2AY8 A;  3DU4 A;  3BWN C;  3VAX A;  2OGA A;  4LNJ A;  5G2P A;  4BMK A;  1QIT A;  3FFR A;  4RAE A;  4UHM A;  5M4B A;  1LC8 A;  2E7U A;  3ECD A;  3L44 A;  1MAQ A;  3B1D A;  1W7L A;  3FSL A;  2WB6 A;  4UHO A;  5J8Q A;  3W1J A;  1T3I A;  4JE5 D;  1SZK A;  3E2Z A;  3EI5 A;  3GWP A;  3R4T A;  2JIS A;  3KKI A;  2XBN A;  2W7E A;  4RKC A;  3Q8N A;  1W3U A;  4N0B A;  3I4J A;  3LV2 A;  3DYD A;  1QIS A;  1EJI A;  4W91 A;  3TFU A;  4B98 A;  1BQD A;  2CST A;  3AEM A;  2JGT A;  1IAX A;  2HUI A;  3QPG A;  2CAN A;  1IUG A;  4AO9 A;  3FFH A;  3QN6 A;  1WYV B;  4DBC A;  3FKD A;  3F9T A;  2R2N A;  5FT8 A;  2R5E A;  2AY2 A;  3G7Q A;  3VK4 A;  2FNU A;  1AY8 A;  3HVY A;  3RBF A;  1AKB A;  2Z1Z A;  1N31 A;  2AY3 A;  1PFF A;  2BI9 A;  3BV0 A;  3MAD A;  4P7Y A;  3EI7 A;  1G7X A;  4KYO A;  4A0G A;  1BW0 A;  4ITX A;  1B4X A;  2W7G A;  1P3W A;  4XJO A;  3WGC A;  1GC4 A;  4LW2 A;  4XAU A;  1OHY A;  3VP6 A;  3W1H A;  3E6G A;  2VMV A;  1D7V A;  2D64 A;  2CH1 A;  4WXG A;  2ZY3 A;  1TPL A;  3PPL A;  4RLG A;  1I41 A;  3GBX A;  2KFP A;  2QLR A;  1O62 A;  3A9Y A;  2JJF A;  4WD2 A;  4WYC A;  4EB7 A;  1MAP A;  3GSB A;  3QGU A;  3OKS A;  2ZP7 A;  3BWN A;  2XH1 A;  1C9C A;  3ZRQ A;  1X2A A;  1BT4 A;  3PJ0 A;  4OMA A;  2AY9 A;  2R0T A;  2VMU A;  4UOY A;  2CH2 A;  1JF9 A;  3ATH A;  1KKP A;  5EAV A;  3EI6 A;  3RUY A;  1V72 A;  2JJE A;  5G2Q A;  4QGR A;  2G7J A;  1BJO A;  3TQX A;  3BB8 A;  5DJ9 A;  1TAT A;  4OT8 A;  2X3L A;  5LH9 A;  4EMY A;  2W7F A;  3ASB A;  5D95 A;  2BI1 A;  1LKC A;  2D66 A;  4JEV A;  1CQ7 A;  4KXK A;  4W5K A;  1YNU A;  2GMU A;  2VYC A;  1I43 A;  2QSR A;  4BQ0 A;  3BC8 A;  5G0A A;  3WLX A;  5BJ4 A;  5G4I A;  4ZWV A;  1DJ9 A;  2CY8 A;  3FZ7 A;  2YKX A;  4MQP A;  1D7S A;  2HZP A;  5EIG A;  3E9K A;  2VGZ A;  1OXP A;  2YCP A;  3K7Y A;  1WST A;  4HF8 A;  1LC7 A;  4XJP A;  3HQT A;  4ZDO A;  2AEU A;  2C0R A;  1M0P A;  1YIY A;  3MBB A;  1I29 A;  4WYF A;  1ORD A;  4WB0 B;  3FQA A;  4IW7 A;  3LVL B;  2C44 A;  1CQ8 A;  4GE7 A;  4MSO A;  4BHD A;  2VMN A;  1M6S A;  1IVR A;  4ZLV A;  1J32 A;  1QJ3 A;  2DGL A;  2V1P A;  4RIZ A;  4TN4 A;  1QZ9 A;  3CQ5 A;  5LHA A;  1XI9 A;  4ZAS A;  1V2D A;  1PMO A;  2X5D A;  2Z9V A;  1M32 A;  2HOY A;  3IHJ A;  1UKJ A;  4U1T A;  1KL1 A;  1YJY A;  3NRA A;  1WKG A;  3KGX A;  2BYL A;  4OC9 A;  1CZE A;  3A2B A;  3PAA A;  2HP2 A;  1E5F A;  1MLY A;  3UAK A;  3JW9 A;  3R9A A;  2OKJ A;  2FM1 A;  3H14 A;  4ZDP A;  4BA4 A;  3EI9 A;  3H7F A;  3PD6 B;  2DOU A;  2E54 A;  2VGW A;  1EG5 A;  3WKS A;  4P3M A;  1SFF A;  4R5Z A;  1AAM A;  2CB1 A;  2BIG A;  1AHE A;  1W23 A;  3RBL A;  5M4D A;  3NYT A; 
#chains in the Genus database with same CATH homology
 2VIB A;  2YKY A;  2ZUK A;  1V2F A;  1TOE A;  1LK9 A;  1BS0 A;  3BS8 A;  3E2F A;  2HOZ A;  4MQQ A;  4PVF A;  2DKJ A;  3IF2 A;  2YCN A;  3AEL A;  4WXF A;  5K8B A;  4RIT A;  1MDZ A;  5KTB A;  3BCB A;  1RVY A;  1UU2 A;  4IYO B;  3ZZK A;  2BWP A;  3B1C A;  3FDB A;  4EU1 A;  4F5H A;  1TOG A;  1KL2 A;  3N4S A;  2W7L A;  2YCT A;  4OBV A;  5EUE A;  3WKR A;  3FTB A;  2X5F A;  8AAT A;  1Z7D A;  2YRR A;  2W8V A;  4WLH A;  3CBF A;  5EUN A;  1OAT A;  4M2K A;  1YAA A;  1AHY A;  3BN1 A;  3PGY A;  1IAY A;  2Z1Y A;  1PG8 A;  1ASM A;  1M0O A;  3PDB A;  4PFN A;  1AMS A;  3HT4 A;  4ATP A;  4ATQ A;  1D7U A;  2VMW A;  1AMQ A;  1SVV A;  4MKK A;  1ASG A;  1GC3 A;  2O7C A;  3GET A;  1X0M A;  3HL2 A;  3NYU A;  1X29 A;  1IJI A;  4CVQ A;  4I8A A;  4FFC A;  3A9X A;  3M5U A;  1ASE A;  3MC6 A;  4M2M A;  4ZWM A;  4LNL A;  5I92 A;  4F4E A;  4WYG A;  3RQ1 A;  1JS6 A;  2YKV A;  3RCH B;  3CQ4 A;  1WYT B;  2W7D A;  2Z9X A;  4AZJ A;  2AY1 A;  2PO3 A;  1TAR A;  2ZSL A;  7AAT A;  1VJO A;  4PIW A;  1VP4 A;  1YOO A;  3JZL A;  2BI3 A;  4W1V A;  4N0W A;  4ZAH A;  5EFS A;  4RJY A;  3QM2 A;  1CQ6 A;  2CTZ A;  1ZOD A;  3AV7 A;  3JWB A;  2NMP A;  1JG8 A;  3ZZJ A;  3ELP A;  1WKH A;  3I5T A;  3CAI A;  1FG3 A;  4A0F A;  2YRI A;  4JE5 A;  1XEY A;  3NUI A;  9AAT A;  4Y0I A;  2EZ2 A;  2VMS A;  2BWO A;  1S09 A;  3W1I A;  1YJS A;  4HVK A;  1AMA A;  1ASD A;  1ARG A;  2VLF A;  2GMS A;  4ZSY A;  1C0N A;  1BQA A;  2VMP A;  2BI2 A;  2HUU A;  1DTY A;  3F0H A;  4W8I A;  2ZY4 A;  2BYJ A;  2OQX A;  2VGT A;  1S08 A;  2VMY A;  3FZ6 A;  3EIB A;  2JG2 A;  4ADD A;  2AY5 A;  1AKC A;  2CJG A;  1QGN A;  1CS1 A;  2BIA A;  2OKK A;  4CXR A;  1AIA A;  1E5E A;  2ZJG A;  2VMZ A;  2EH6 A;  3NUB A;  3H9X A;  2ZSM A;  4M2J A;  1WYV A;  4ZDL A;  4GEB A;  4F5L A;  2C81 A;  3ISL A;  2W7J A;  1D2F A;  3DXV A;  3AAT A;  3RI6 A;  2QA3 A;  4MY5 A;  1ASN A;  4JF0 A;  4XK1 A;  2G6W A;  3B1E A;  4AH3 A;  1LS3 A;  1WYU B;  4MGR A;  1GEX A;  2VMX A;  2W7K A;  3LWS A;  3FQ8 A;  4Q6R A;  4GE9 A;  3GR9 A;  4GDY A;  1ART A;  2CJD A;  3JTX A;  2D65 A;  3N5M A;  1TAS A;  2AY6 A;  3NYS A;  3MAU A;  2QB3 A;  2WKA A;  4DGT A;  2Z9U A;  1G7W A;  4F5K A;  2AY4 A;  3E77 A;  4W1W A;  4WP0 A;  3AEN B;  2RFV A;  2W7M A;  1ZOB A;  2FQ6 A;  1IX6 A;  3FDD A;  2FN6 A;  3AEO A;  1AJS B;  1Z3Z A;  4JEY A;  3A8U X;  4R5F A;  1MDO A;  2YOB A;  3K28 A;  3MKJ A;  2D61 A;  1ELU A;  3LY1 A;  4F5G A;  1BJ4 A;  4U2H A;  4F5M A;  2W8W A;  2Z20 A;  4ISY A;  4K05 A;  4W1X A;  3JU7 A;  2CFB A;  3FVU A;  2VGS A;  4MQR A;  2FKI A;  3DXW A;  2HP1 A;  3WCN A;  2QBT A;  4NOG A;  4E3Q A;  3B46 A;  2HOR A;  4Q75 A;  3E2Z B;  3FCR A;  3DC1 A;  3FD0 A;  5DJ1 A;  1LC5 A;  1ASA A;  1C4K A;  1PMM A;  3GZD C;  2HUF A;  2Q7W A;  1RV3 A;  5F8V A;  2QB2 A;  3AEJ C;  3AEP A;  1CZC A;  1J04 A;  3LVM A;  4A0R A;  1ELQ A;  1B5P A;  4LW4 A;  2D7Z A;  4K2I A;  3K40 A;  5DX5 A;  1DKA A;  2EPJ A;  3USF A;  2ZY2 A;  3BCA A;  4A72 A;  3JWA A;  2X8U A;  1MLZ A;  3AOW A;  3LG0 A;  2FYF A;  1C7G A;  1N2T A;  4E3R A;  4F5F A;  1JS3 A;  2V0Y A;  4ZM4 A;  2FNI A;  5FT6 A;  1GCK A;  1GC2 A;  1FG7 A;  1N8P A;  4UQV A;  3WZF A;  5E3K A;  4JEW A;  5M49 A;  3GJU A;  5EUD A;  4CBS A;  2OGE A;  4WB0 A;  3WX9 A;  1D7R A;  1ECX A;  3EUC A;  1AHX A;  1G4V A;  2D7Y A;  3I16 A;  4Y0D A;  4CBR A;  2GSA A;  3BWO A;  5G09 A;  4IX8 A;  4H51 A;  3F6T A;  1ARI A;  2BKW A;  3AEN A;  1OHV A;  3PDX A;  1UU1 A;  2BIE A;  5F9S A;  3HBX A;  2AAT A;  1AX4 A;  1ASB A;  3FQ7 A;  3QBO A;  1ZC9 A;  4F5J A;  1KKJ A;  3BCX A;  1GDE A;  2YHK A;  4E77 A;  5D5S A;  1BKG A;  4OYT A;  1QJ5 A;  1IX7 A;  1MDX A;  3LVJ A;  2VMT A;  1O69 A;  4IXO A;  2F8J A;  3UWC A;  4J8L A;  1BJO B;  2VMR A;  4OBU A;  5AX8 A;  2TPL A;  4L0O A;  3GZC A;  2R5C B;  2Z9W A;  3GZD A;  4WXB A;  2W8J A;  3PD6 A;  5TF5 A;  3EZS A;  4ZSW A;  2E7I A;  1W7M A;  2W8U A;  3AEJ A;  3DRD A;  5E4Z A;  1RV4 A;  1DGD A;  3A9Z A;  4JEZ A;  3FVX A;  3ACZ A;  4A0H A;  4JEX A;  1ARH A;  4J5U A;  1O4S A;  4EB5 A;  3N4R A;  2GB3 A;  5EIG B;  1M4N A;  3E2Y A;  2WK7 A;  1CL2 A;  4JF1 A;  1GD9 A;  4UHN A;  4TMR A;  1M7Y A;  3OP7 A;  1BJN A;  2ZYJ A;  3DZZ A;  4R8D A;  4RJ0 A;  4E1O A;  1KMK A;  4WLJ A;  2VLH A;  3NTJ A;  4Q31 A;  3AOV A;  4WYA A;  1AMR A;  4IYO A;  2CJH A;  4PFF A;  2Z67 A;  1OHW A;  2BWN A;  2DR1 A;  2PB0 A;  1ASL A;  1B5O A;  2VMQ A;  3WY7 A;  2W7I A;  4ZM3 A;  1AIC A;  1SF2 A;  2O1B A;  2YKU A;  1IX8 A;  3B8X A;  1GEY A;  4O6Z A;  1DFO A;  2QMA A;  4A6U A;  4A6R A;  5JAY A;  4MKJ A;  1GC0 A;  2BHX A;  1M0N A;  2EGY A;  4ADB A;  3D6K A;  3VOM A;  1TOI A;  2EO5 A;  2D5Y A;  3COG A;  3PIU A;  5EQC A;  2A1V A;  4XQ2 A;  3N7N A;  1YIZ A;  2AEV A;  2AY7 A;  2E7J A;  2VI8 A;  1OXO A;  4KAM A;  1AHG A;  1AIB A;  1DJU A;  3QI6 A;  4RKD A;  1M0Q A;  3HDO A;  5DB5 A;  4GSA A;  4K2B A;  4ITG A;  2ZY5 A;  2VIA A;  4AZK A;  3II0 A;  1O61 A;  3KE3 A;  4IXZ A;  3KGW A;  4ADC A;  2ZC0 A;  1IBJ A;  4WYD A;  5G4J A;  1AAW A;  3T32 A;  1AY5 A;  3DR4 A;  1Y4I A;  2R5C A;  2WK9 A;  2D63 A;  2EZ1 A;  3VK3 A;  2VGV A;  3P1T A;  4B9B A;  4AO4 A;  3FZ8 A;  1CJ0 A;  3RCH A;  4ADE A;  1WYT A;  1VEF A;  4DQ6 A;  4OCA A;  3CQ6 A;  2VI9 A;  1EQB A;  2ORD A;  5IWQ A;  3N0L A;  2WK8 A;  4WBT A;  2BI5 A;  2W7H A;  3MAF B;  3HLM A;  1SPA A;  1LW4 A;  3HMU A;  3ZRP A;  1CL1 A;  4WYE A;  1ARS A;  2PB2 A;  2Z61 A;  1X28 A;  4H63 Q;  1AJR A;  2DKB A;  1B8G A;  1ASC A;  1TOK A;  3N75 A;  1U08 A;  4EFF A;  1QIR A;  2GQN A;  1S07 A;  1SZU A;  3PA9 A;  3EI8 A;  1LW5 A;  3TAT A;  4LC3 A;  1DGE A;  4XEW A;  1RVU A;  1S06 A;  2JJH A;  1SZS A;  1W7N A;  1C7N A;  2DGK A;  2HOX A;  2VGU A;  3ASA A;  3L8A A;  5HHY A;  5BJ3 A;  1G4X A;  3AEM C;  1TOJ A;  3EIA A;  3G0T A;  3NU8 A;  3WCO A;  3DR7 A;  2JJG A;  3PDB B;  3G8M A;  2EYQ A;  4RM1 A;  4BA5 A;  4IY7 A;  2CIN A;  4AOA A;  3DOD A;  5HDM A;  4XJM A;  2DGM A;  4R2N A;  4LNM A;  1I48 A;  1KMJ A;  1V2E A;  5E5I A;  4Y0H A;  3MEB A;  4F5I A;  3QHX A;  1GBN A;  4Q76 A;  3WGB A;  1YJZ A;  3TFT A;  5FT5 A;  4GRX A;  4CXQ A;  2C7T A;  3MC6 C;  3UE8 A;  1WYU A;  1B9I A;  4A6T A;  1AKA A;  4TV7 A;  3LVK A;  3ZRR A;  5M46 A;  1C7O A;  3FRK A;  4K2M A;  4XJL A;  3VK2 A;  3FVS A;  1H1C A;  5EAA A;  2O0R A;  5HXX A;  4FL0 A;  3NDN A;  5C6U A;  1MGV A;  1S0A A;  3NX3 A;  4A00 A;  1FC4 A;  2OAT A;  3ELE A;  1H0C A;  3TCM A;  1AHF A;  3N4X A;  1AY4 A;  2W8T A;  1UU0 A;  2VMO A;  3EZ1 A;  1B9H A;  1GEW A;  3NNK A;  4IXS A;  4GE4 A;  3P6K A;  1AJS A;  1DJE A;  3MAF A;  4OTL A;  3NU7 A;  5FT4 A;  1ASF A;  1BJW A;  2AY8 A;  3DU4 A;  3BWN C;  3VAX A;  2OGA A;  4LNJ A;  5G2P A;  4BMK A;  1QIT A;  3FFR A;  4RAE A;  4UHM A;  5M4B A;  1LC8 A;  2E7U A;  3ECD A;  3L44 A;  1MAQ A;  3B1D A;  1W7L A;  3FSL A;  2WB6 A;  4UHO A;  5J8Q A;  3W1J A;  1T3I A;  4JE5 D;  1SZK A;  3E2Z A;  3EI5 A;  3GWP A;  3R4T A;  2JIS A;  3KKI A;  2XBN A;  2W7E A;  4RKC A;  3Q8N A;  1W3U A;  4N0B A;  3I4J A;  3LV2 A;  3DYD A;  1QIS A;  1EJI A;  4W91 A;  3TFU A;  4B98 A;  1BQD A;  2CST A;  3AEM A;  2JGT A;  1IAX A;  2HUI A;  3QPG A;  2CAN A;  1IUG A;  4AO9 A;  3FFH A;  3QN6 A;  1WYV B;  4DBC A;  3FKD A;  3F9T A;  2R2N A;  5FT8 A;  2R5E A;  2AY2 A;  3G7Q A;  3VK4 A;  2FNU A;  1AY8 A;  3HVY A;  3RBF A;  1AKB A;  2Z1Z A;  1N31 A;  2AY3 A;  1PFF A;  2BI9 A;  3BV0 A;  3MAD A;  4P7Y A;  3EI7 A;  1G7X A;  4KYO A;  4A0G A;  1BW0 A;  4ITX A;  1B4X A;  2W7G A;  1P3W A;  4XJO A;  3WGC A;  1GC4 A;  4LW2 A;  4XAU A;  1OHY A;  3VP6 A;  3W1H A;  3E6G A;  2VMV A;  1D7V A;  2D64 A;  2CH1 A;  4WXG A;  2ZY3 A;  1TPL A;  3PPL A;  4RLG A;  1I41 A;  3GBX A;  2KFP A;  2QLR A;  1O62 A;  3A9Y A;  2JJF A;  4WD2 A;  4WYC A;  4EB7 A;  1MAP A;  3GSB A;  3QGU A;  3OKS A;  2ZP7 A;  3BWN A;  2XH1 A;  1C9C A;  3ZRQ A;  1X2A A;  1BT4 A;  3PJ0 A;  4OMA A;  2AY9 A;  2R0T A;  2VMU A;  4UOY A;  2CH2 A;  1JF9 A;  3ATH A;  1KKP A;  5EAV A;  3EI6 A;  3RUY A;  1V72 A;  2JJE A;  5G2Q A;  4QGR A;  2G7J A;  1BJO A;  3TQX A;  3BB8 A;  5DJ9 A;  1TAT A;  4OT8 A;  2X3L A;  5LH9 A;  4EMY A;  2W7F A;  3ASB A;  5D95 A;  2BI1 A;  1LKC A;  2D66 A;  4JEV A;  1CQ7 A;  4KXK A;  4W5K A;  1YNU A;  2GMU A;  2VYC A;  1I43 A;  2QSR A;  4BQ0 A;  3BC8 A;  5G0A A;  3WLX A;  5BJ4 A;  5G4I A;  4ZWV A;  1DJ9 A;  2CY8 A;  3FZ7 A;  2YKX A;  4MQP A;  1D7S A;  2HZP A;  5EIG A;  3E9K A;  2VGZ A;  1OXP A;  2YCP A;  3K7Y A;  1WST A;  4HF8 A;  1LC7 A;  4XJP A;  3HQT A;  4ZDO A;  2AEU A;  2C0R A;  1M0P A;  1YIY A;  3MBB A;  1I29 A;  4WYF A;  1ORD A;  4WB0 B;  3FQA A;  4IW7 A;  3LVL B;  2C44 A;  1CQ8 A;  4GE7 A;  4MSO A;  4BHD A;  2VMN A;  1M6S A;  1IVR A;  4ZLV A;  1J32 A;  1QJ3 A;  2DGL A;  2V1P A;  4RIZ A;  4TN4 A;  1QZ9 A;  3CQ5 A;  5LHA A;  1XI9 A;  4ZAS A;  1V2D A;  1PMO A;  2X5D A;  2Z9V A;  1M32 A;  2HOY A;  3IHJ A;  1UKJ A;  4U1T A;  1KL1 A;  1YJY A;  3NRA A;  1WKG A;  3KGX A;  2BYL A;  4OC9 A;  1CZE A;  3A2B A;  3PAA A;  2HP2 A;  1E5F A;  1MLY A;  3UAK A;  3JW9 A;  3R9A A;  2OKJ A;  2FM1 A;  3H14 A;  4ZDP A;  4BA4 A;  3EI9 A;  3H7F A;  3PD6 B;  2DOU A;  2E54 A;  2VGW A;  1EG5 A;  3WKS A;  4P3M A;  1SFF A;  4R5Z A;  1AAM A;  2CB1 A;  2BIG A;  1AHE A;  1W23 A;  3RBL A;  5M4D A;  3NYT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...