1WTBA

Complex structure of the c-terminal rna-binding domain of hnrnp d (auf1) with telomere dna
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
79
structure length
79
Chain Sequence
b'VKKIFVGGLSPDTPEEKIREYFGGFGEVESIELPMDNKTNKRRGFCFITFKEEEPVKKIMEKKYHNVGLSKCEIKVAMS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords 5'-D(P*TP*AP*GP*G)-3'
publication title Structure of hnRNP D complexed with single-stranded telomere DNA and unfolding of the quadruplex by heterogeneous nuclear ribonucleoprotein D
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription/dna
total genus 15
structure length 79
sequence length 79
ec nomenclature
pdb deposition date 2004-11-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1wtbA00
2CPEA 1R8HA 2MKCA 2XS5A 1RKJA 4W90B 1YTYA 2CPZA 1X5PA 3S6EA 2M52A 2DH7A 3CCLS 2DGOA 1UW4A 4IOAQ 2E44A 2DNYA 3UWTA 3BO2A 1U1OA 2VONA 2DK2A 3H2VE 1WF1A 4V19X 1JJHA 3BEGB 1WWHA 2RT3A 1JMTA 3CCRS 2MZSA 3RW7A 2RRAA 5CA5A 2XNRA 1DRZA 2CQDA 3NNAA 3CCVS 2MY7A 2LQ5A 2ERRA 1O0PA 3HI9A 2KM8C 1VQ4S 2YWKA 2CJKA 2M0GB 1DHMA 2DGXA 2MQPA 1DBDA 1FJ7A 3I56S 2GHPA 2L41A 4PR6A 3N9UC 2K8GA 2DO4A 3RW6A 2U2FA 4ZKAA 2UP1A 2M7SA 1QVGR 2DB1A 3MD1A 3MI7X 1KD1T 3G96A 3THPA 1WHYA 3UD4P 1FHTA 2MZ1A 5EN1A 2OSRA 3J7ZT 3VAHA 2KFYA 2KRRA 3Q2SC 2CQBA 1OPIA 3U1MA 2DGWA 5DDRC 2MMYA 1YHQS 1VQKS 1CVJA 5DDPC 2DGSA 2DNLA 1SJ4P 2AYEA 3I55S 1U6FA 1M1KT 5HL7Q 1VBYA 1M5PC 4QU7A 5LJ3Y 2QEXS 2MQQA 4TU7A 2I38A 4A8XA 1UFWA 2FY1A 4RU2A 1WELA 1YJ9S 1WI8A 1N88A 4C0OC 2SXLA 2L9WA 5BJRA 1WHXA 2DHSA 3G4SS 3NMRA 3UCZP 3CCJS 1X5OA 1UP1A 1WF0A 1SJQA 3VAFA 5CYJA 1ZZFA 1N8RT 2MY8A 3DLLQ 1K9MT 5HO4A 2JVRA 2D9PA 2MJUA 3THTA 3NS5A 3K0JA 1X4EA 2MKKA 2BOPA 2M88A 2LECA 5GAHU 2BZ2A 2G1DA 2E5IA 5DDQC 2YKAA 2KI2A 4YUDA 2FPHX 1X5SA 2L08A 2DNZA 2KM8B 3H2UB 3CC7S 1WEYA 2J76E 1VQNS 2DNPA 5JVGQ 2DH8A 2LMIA 2MGZA 4U67Q 3BS9A 2B0GA 5JVHQ 1S72S 2RVJA 1VQ9S 2CPIA 1FT8A 1HA1A 1WG4A 3CC2S 2DNOA 2CPHA 2EVZA 3B4MA 2G0CA 2J0QD 2DITA 2MKIA 1K8AT 3FEYB 1YWXA 2PE8A 4F02A 3SDEA 3CF5Q 1PGZA 1X4AA 1X0FA 2LXUA 2RS2A 2LEAA 2HGLA 2N3OA 1U1RA 1X4GA 2AD9A 4TU8A 2M8HA 1A7GE 3ULHA 2CQ1A 2MSTA 1H6KX 4CH0S 1X4HA 2X1GA 2DGVA 3VAJA 3VAIA 1NO8A 2N7CA 1DZ5A 2DGUA 4QQBA 3IWNC 2CQGA 2K3KA 4UQTA 3SXLA 4WFBQ 1X5TA 3ZZYA 1AUDA 3G8TA 2KT5A 2O3DA 5GVQA 2JX2A 3MUVP 1JJ4A 4TLQA 2RU3A 1VC6A 2EK6A 5H1SV 2HVZA 3MD3A 2NLWA 2DNNA 4LJMA 1FO1A 5IM0B 4QU6A 2DNGA 2YH0A 5GAEU 2KN4A 2DHGA 2MZQA 2LKZA 2AYGA 2RRBA 2CPDA 2KXNB 3G8SA 1H2UX 1S79A 1M90T 1X4CA 2QA4S 4IO9Q 1FNXH 1KQSR 1SXLA 2X1FA 1X4BA 5GAGU 2MQNA 1Q86T 3G6ES 4C4WA 3CUNA 2KG1A 3NNCA 3EX7B 4OZ1A 4W92B 4LMZA 1H2VZ 4QPTA 4IUFA 1N52B 2AYMA 1YIJS 3IRWP 4UY8T 3SMZA 3V4MA 2M2BA 5ITHA 1WF2A 4YB1P 2D3OR 2OSQA 1VC5A 1YJNS 4M5DB 2CQ4A 3CTRA 2DIVA 1WG1A 1VQ6S 1VQ8S 1N54B 4EGLA 1OIAA 2HYIB 3CC4S 1D8ZA 2MSSA 2KRBA 2KXHA 1Q81T 1L3KA 2ADCA 1OO0B 2E5JA 3UCGA 3CCUS 2N82B 2RUGA 5IQQA 2I2YA 2VODA 2X1BA 3VAGA 2OIHA 2MZTA 1QM9A 2LYVA 2MKJA 4IOCQ 3CXCR 2F9JA 2MKSA 1U1QA 4Y00A 3CULA 2DIUA 2DO0A 3UCUP 2HGNA 4ED5A 3CMAS 4WF9Q 1QVFR 3HHNB 3P6YC 1U1NA 3MOJB 1X4FA 4P6QA 2D9OA 1WHWA 1HD1A 3R1LA 2F3JA 4FXWA 1M5OC 3MXHP 1U2FA 5DM6Q 3BO4A 1PO6A 3NNHA 2CPXA 4FXVA 1FJEB 3CCMS 2DISA 2X1AA 1VC0A 3FEXB 4OZ0A 4J5OA 2MZRA 3EGZA 1M5VC 2FHOB 3L3CA 2DNRA 3VAKA 2OJ3A 2LXIA 2MHNA 2XSFA 3LQVA 3UD3P 3Q2TC 2CPJA 2MPUA 1FJCA 4YOEA 1U1LA 3EGNA 4CH1A 4WFNQ 2CQ3A 2DH9A 2E5GA 1SJFA 5DM7Q 2OTJS 2N3LA 2XS2A 2XS7A 1RK8A 1WEXA 2HZCA 3CD6S 1HD0A 2RNEA 1KC8T 4TU9A 3PIPQ 3CMES 1KOHA 3MURP 3UE2A 2VOPA 2J8AA 2YTCA 1VQ5S 2EK1A 1D9AA 2DHAA 4BS2A 1WI6A 1U1KA 4PKDB 1YI2S 3P5TL 2ZJRQ 2YH1A 3CCQS 2FC8A 2AYBA 2ZJPQ 2OTLS 1BY9A 5IFMA 3CPWR 5LSLA 1F9FA 4Z2XA 3MUTP 2KG0A 1JJ2R 1URNA 3U1LA 3VF0B 2PEHA 1NJIT 3P49B 2GO9A 3S8SA 2DHXA 4WFAQ 1A9NB 2MGZB 1HL6A 1Q7YT 1WTBA 4WIIA 2NZ4A 1KOOA 2F9DA 2CQPA 2MJNA 2RQ4A 3B4DA 3S01A 1VQPS 1IQTA 1VQMS 2Q79A 2MB0B 1U6BA 2KU7A 1X4DA 2CQ0A 4ERDA 5LXRA 1M5KC 5D78A 3JB9k 4C7QA 2DNMA 2MXYA 2DGQA 2XNQA 2LEBA 2ADBA 1P27B 3SDEB 2RS8A 1VQOS 2MYFA 1ZH5A 3TO8A 1H2TZ 1R8PA 2A3JA 3ZZZA 1Q82T 2DNKA 1XN9A 2MQLA 3D2WA 2ZJQQ 5LJ5Y 2CQIA 1VBZA 3R27A 2LA6A 4PRFA 1G2EA 2E5HA 2FC9A 4F26A 2DNQA 3MDFA 3CCSS 1W2BR 1B7FA 1WEZA 3S7RA 2M4MA 2KVIA 1OWXA 2WBRA 5FJ4A 2JWNA 4CQ1A 2CQHA 3TP2A 5DETA 2CPFA 1VQLS 2V94A 4WCEQ 5GADU 1VBXA 2MKHA 1YJWS 4WKRA 5D77A 2CPYA 2KH9A 2U1AA 1YITS 5LXYA 2G4BA 1K73T 1WG5A 2KHCA 2LA4A 4Y0FA 3G71S 3LPYA 1U1MA 1SJRA 3VAMA 3R1HA 3P3DA 2DNHA 1WHVA 1U1PA 3J7YU 2RQCA 3OW2R 5MLCV 4CIOA 2JVOA 2MQMA 2KXFA 3DXBA 1FXLA 4LIRA 4F25A 3MUMP 3US5A 3VALA 2VOOA 2JRSA 5LSOA 3CCES 5IM0A 2DGTA 3TYTA 2M70A 2CQCA 1UAWA 2XB2D 2CQ2A 5GMKa 1ZZNA 3NS6A 3BO3A 1VQ7S 1NU4A 1P1TA 2MZJA 3G9CA 5DDOC 1SJ3P 2J0SD 2LCWA 2MQOA 2KYXA 3PIOQ 5CXTA 2M9KA 2QFJA 2M8DB 2HGMA
chains in the Genus database with same CATH superfamily
4TXSA 4NA1A 4GMKA 2GGPB 3WIVA 1IN0A 2ZH5A 2D41A 3MM7A 2CUYA 3TWZA 2VG5B 2DBBA 4TQRA 3NS7B 2RRAA 2XNRA 3H5YA 1Y10A 2GVZA 4XDDA 5JJBA 4G1IA 4UOGA 3L09A 1RAEB 3V4IB 2ZBPA 4GVLA 1JLBA 2V2KA 3BR8A 3KUGA 5AE2A 1BMQB 2X3DA 3MPYA 1LXNA 2QL7B 3I96A 4IRCA 4ILRA 2FJXA 1F9HA 2ZH7A 4USTA 1F1BB 2WRMA 3R9LA 1ULRA 1VBYA 2EC0A 2R7TA 4ZIWA 2CZVC 4K5SA 4C2MA 2JEJA 2BW2A 2B4PA 2J7UA 2RUSA 5D3GA 1N8RT 5IT9U 2ZITA 1Q16B 1IJFB 2Z57B 2E5IA 2VF3A 1TTHB 3IGNA 3I0RA 2R8KA 4ZN1A 1EHWA 2I1RA 1EQMA 5JVGQ 2W9BA 2EW9A 2FGCA 4MIAA 1FK9A 3G6VA 1TU0B 3AD8C 1IWGA 2PE8A 2RS2A 4WFXA 2X7IA 4P75A 2AEJA 5RUBA 4I6WA 5FDLA 4RWWA 1TL1A 3CDAA 3T1HF 3TUJC 3L9ZA 1NO8A 2CKWA 2OD4A 4OI0A 4LRFA 4F3MA 3CE8A 2B51A 3TARA 2C2EA 3TR5A 1Q53A 2K3IA 3C14A 3K59A 2W24A 3O5TB 2XZDB 2OO4A 4B3MJ 4X4SA 2IAJB 3DOMB 3QGGA 1R43A 5HROB 4MIBA 4ATNA 1YIJS 1LNQA 1YQHA 4YB1P 5ITHA 2D3OR 3J7AN 1U49A 4PPDA 1NK6A 3UD5A 4GKJF 4PQAA 2OMLA 2R2SA 4I2QA 3EWGA 2KXHA 2E5JA 2AJ2A 1SI9A 3BQ0A 1QJHA 2QL9B 2Q6CA 2B5JB 2IRUA 1B7YB 5J2NA 1R8CA 1RJJA 2RF2B 3WC2A 1HHSA 4USWA 4ZPDA 1HD1A 1M5OC 4KB7A 4N76A 3KK2A 1K47A 1FESA 3RG6A 1KN6A 2DISA 3FEXB 4OX6A 1IBMF 3EGZA 1WOSA 1H0HB 2UZAA 2OD6A 2VH7A 1HARA 1KQFB 2YNIA 3Q2TC 4ECXA 1U1LA 1NH8A 1NSQA 4Q43A 4YDDB 3U7JA 5JUMA 2ZKTA 4FP9A 5KFTA 1RT3A 3ETOA 2V2QA 3IMQJ 1HNVB 4IRKA 4MKVA 3ZTQA 1FFSB 1Q79A 5HMZA 1SV5A 2D74B 4DV0J 2KO1A 1MROA 1M1GA 2ZNZA 5KFCA 2Q1LA 4NLYA 4IKAA 2Y1LB 2IYIA 2BACA 1A9NB 3AXMA 3KLFB 3C6UB 4CLPA 4F36A 5L1KA 1UJ5A 1XNQJ 4RNHA 2RAQA 2IC3A 3MPVA 1NMEB 1PC4A 3V81A 2G9OA 4X64J 4G3IA 5KG4A 2MQLA 3M2RB 4RW4B 1ZS6A 1RTHA 2RSQA 5L9NA 2GA7A 2HEKA 1W2BR 4OZLA 4IFYA 4JOUA 1SH0A 3S7RA 2M4MA 4PG8A 1VFJA 4CQ1A 5EX3A 1TL7A 4K4TA 1VQLS 3IS9B 3KKFA 1S48A 1E6VB 1V5IB 1Y3JA 1LW2B 4KGVB 4IR9A 1ZETA 2WCXA 3K5PA 2R7WA 3AODA 3X1LB 2AMCB 1SC6A 4I69A 3J7YU 4DX6A 4ECRA 2BVZA 5KFHA 3T1AA 3VR1A 3TW0A 4OZ2A 4LF8F 2HNZA 2V67A 1U0HB 2ZZMA 3HF5A 1T3NA 5KG3A 2CQCA 1DTTA 4DG1A 5HJXA 1CJUA 1NU4A 3PIOQ 1KR4A 3QAUA 1TUVA 4I67A 4P2XA 4MKBA 4UOFA 1OY9A 3AD7C 4G1QB 3BSOA 4C97A 3RW7A 2NSBA 4NYOA 2F4VJ 1QAYA 1PYTA 2WZ1A 3R2CJ 3HI9A 3MEEB 3A13A 2L41A 1TMMA 1FKAF 4I68A 2XCAA 4OX9J 1S9EB 3BGLA 2DTJA 4ZVSB 4A8MP 2ZH8A 3ENAA 5F8LA 2PO4A 3TVYA 1RQ0A 1T95A 2AZ1A 2RILA 2DGSA 5DQHA 2W8LA 5E0OA 2UXDF 3F44A 1RWWB 5LMUF 4TU7A 2I0XA 3GYXB 1FI4A 4H4KC 4KFBB 2DR6A 4JV0A 1X31C 2F7VA 1Y7PA 2OKQA 4WFZA 4KHMA 1A0OB 1S6UA 5FLXY 5DGAA 3IM9A 1ZZFA 1K9MT 4MFBA 3THTA 2NXEA 3NBPA 4KPYA 1X4EA 1QAJA 5KFVA 1VOMA 2KI2A 1L3UA 3HFKA 2Z58B 1X5SA 1ZAVA 2J76E 3M30B 2XLJA 3FNNA 2KYZA 4YHHF 3FDSA 2RVJA 3TX8A 5ETVA 1HA1A 5DG7A 1DLOB 4DBQA 3LP0A 2VHGA 5C42A 1BXNA 4M5LA 4DR1F 3ZZRA 1QSYA 3BKFA 5D4OA 3T9NA 4B3TF 5LOQA 1RSCA 4CNYA 2V9WA 1UJ4A 4RJVA 2XMTA 1D9DA 4PWDA 3HFVA 2MSTA 2A10A 4KHRA 1YJTA 1LWFB 1GMUA 4K4ZA 1FTCA 1EKSA 4JI1J 1HMVA 2HVHA 1SL2A 4KYZA 3G8QA 3IA0A 5GAGI 1QLNA 1JNZB 2NLWA 1T03B 2RRNA 2QG9B 4RLEA 4RNFA 3OR1A 4JI2F 1NDPA 1R6VA 2HS3A 1H7XA 1PCAA 2KG1A 3KG1A 3QZ8A 2LU2A 2M2BA 1WF2A 1S6PA 4BCAA 3T5JA 2I5JA 2HVIA 1VQ6S 5M2UA 5A8RA 2ADCA 5IQQA 2OIHA 2MZTA 3VTIA 4IOCQ 2ASYA 3K7RA 3IO1A 3H2LA 1S0VA 3MMBA 2NPFA 2HNYA 1I51B 3GTYX 4AYBD 3AY0A 4W98A 2FHOB 2GHVC 4X4OA 4IQXA 4F3OA 3M8PA 5ETPA 5HJYA 1N33F 2IBOA 4CH1A 2JL9A 3HZGA 4OJ1A 2YY3A 4TN2A 2QLXA 2DRAA 2YTCA 2DXFA 2EK1A 5HMWA 1FTRA 3MFIA 3RAQA 2XYGB 3OTCA 4DLGA 2JEGA 4KGKA 2BXJA 1RT5B 1QD1A 3ZTRA 1MMLA 2DT9A 5LSLA 4NX9A 2VFVA 2GO9A 1TP7A 1S59A 2HQGA 3EPIA 2C3UA 3SCIE 4DX7A 1F5BA 3H98A 3TI0A 1GXUA 1RWUA 4JI7F 4DR3J 4C8NA 2ZVSA 1M5KC 4NCBA 2XNQA 2Y1RI 2POKA 1R8PA 4DQPA 2N7YA 1N5VA 4CLZA 3ZZTA 1J5OA 3LTOA 3NGSA 5KFIA 4JI3F 1Q8LA 3W5ZA 3CIZA 4I64A 5DS7A 2DHHA 3ZNUA 1BQXA 2IVMA 3DRRB 3SCKE 2BKPA 5DRKA 3JAMY 3FK4A 3K5OA 3BBFA 4PZVA 1UVMA 1PAUB 4X62F 1TK8A 2C2MB 1YJVA 2V4JB 3FQLA 1CJVB 2HBZB 4C11A 2BDPA 4EFAC 2ASJA 4FF4A 2DKOB 3CO9A 2KJWA 3UO0A 1B64A 4M94A 2BA9A 5ETNA 5F3ZA 1GMWA 4FF1A 2KYXA 1WTFA 2FJDB 3DM2B 1YTYA 4NEZA 1B3TA 5DQGA 2ZVIA 1PYSB 4CRJA 3DGPA 2R8GA 4LF5F 4QWDA 4OYIA 4JP8A 1HNIB 4DX8H 1SIZA 2RE1A 1C4AA 4URQU 2WW4A 5A8WA 2VUGA 5J1EB 3HSGA 1AB8A 2CJKA 1KTQA 2UXBF 3D66A 2NXNA 3G6XA 2CAJA 4M5IA 2GHPA 4PXCA 2DO4A 2DPIA 4PXBA 1KD1T 2GQ2A 3HO1A 2OEJA 3KXDA 3M9NB 1FDNA 2BEFA 3PXGa 5KFKA 2BMBA 1IR2A 1CVJA 3FZ2A 4JI5F 1BWEA 2RDDA 1VRTA 4ED2A 3GFXA 3F56A 1XK8A 1UFWA 2XYHB 4R8UA 1RCOB 4OV1A 2WBMA 1D0EA 5E41A 2OFHX 2WSEC 3KMQA 1AZSB 4RUHA 3RR8A 4CWBA 4LSLB 2I9SA 4HHHA 1X9MA 1T9YA 3K0JA 2KT3A 1HQUA 4ZJLA 4B9UA 3HLUA 3FBEA 4CP5A 1YRUA 4OQJA 4JYAJ 4DV1J 4OX7A 2V8GA 3HJFA 2CYYA 2R3VA 2XI3A 1Q0NA 1UPPA 3W2WA 1X7VA 2W2PP 3CJ4A 4FVCA 1WG4A 2VICA 5F0WA 3I5AA 3BM7A 5K14B 5KFUA 3AAWB 2FHJA 1KS2A 4DHVA 4NXMJ 2C2OB 3NGDA 2A2CA 1FKPA 4Y2CA 1RTIB 3HPOA 4F67A 3M9MB 3SXLA 4L75A 3LUYA 5IXUA 3MR3A 2HIYA 4U9RA 3VGUA 1Q8BA 1BQNA 3JSBA 5B0DA 4N8NA 5GAEU 1BE4A 2K06A 6FDRA 3U1NA 1UETA 1ZOTA 2XMAA 3G6ES 3CUNA 1PKUA 4PUOA 4QZVB 3UR0A 4IUFA 1KLMB 1N52B 2AYMA 4UY8T 2D3O1 3OL7A 4PXDA 1F2GA 2YQ1A 4M5DB 3TZYA 2OPRB 3PW4A 1SC4B 1N54B 5KTQA 4HVZA 1N5SA 3DOKB 4YS2A 4C98A 5KOWA 2W8KA 2X1BA 2LQ9A 1JKHA 2J0WA 1XQIA 3T1YJ 4LBPA 1N32F 2DIUA 3A3PB 1QVFR 1UMJA 2HZAA 4F0HA 3OD2A 3VWSA 3KLGB 2QFIA 2J9DE 3NNHA 3BKUA 4MK7A 3CCMS 2VQFF 3J81Y 2MZRA 4ZVFA 3HSDA 2FD2A 2YKMB 3L3CA 4DR7J 4FDFA 3I9V9 2R9LA 3ET6B 4IOBA 1NLKL 2XMMA 2E5GA 1VGYA 5KG2A 5HMXA 1NKEA 2GS8A 5ETOA 3D1OA 1KOHA 3KNGA 4C8MA 3SCLE 1D3WA 1AFJA 3E3XA 5KG0A 2XHCA 3ILJA 4URSA 3DYAB 2XSJB 4TY9A 2OTLS 4DR6J 1VYAA 5HQMA 1HWKA 1CJKA 4B08A 5HQ8A 1I94J 3QYYA 1BUXA 5J2PA 3KHHA 3M6UA 4KTQA 1UVNA 3NAHA 1NH7A 5T7LA 5D78A 2IJRA 2ZM6F 1GXLA 2DGQA 3Q89A 3SDEB 5KT7A 4N47A 2UXCF 1XEZA 3D2WA 3C3LA 2FIUA 2D7SA 2VBZA 2C2ZB 4ZVUB 3MM7B 3HVTA 3W63A 2K1RB 4FN5A 5THWA 2JWNA 5KFMA 3MM9B 2F63A 2R7VA 1KP6A 4NE9C 4KO0A 1RLCL 1JLBB 2VASA 4X4PA 1Y4ZB 2KH9A 3IWXA 4JB8B 2UXDJ 1K73T 1WG5A 2LA4A 1EB0A 2ILZA 4FYVB 1F6TA 4L6V3 3EUNA 1J5EF 3QT6A 4OYMA 3A12A 2JC1A 4FZVA 5J2MA 5I3UA 5IM0A 4K5RA 1TKZB 3CJ0A 3CDUA 4DV4F 2J9CA 4P71A 4X65F 2XGQA 1Y5NB 1REVB 1SB6A 1T3OA 2LCWA 1JXVA 1LKZA 4OYPA 1NNDA 9ATCB 3MFHA 4JV5J 5L1IA 1SL0A 4YHHJ 3EYZA 3PJXA 3I0RB 3RB0A 1FWPA 1FRKA 3T3FA 3RB3A 4YEAA 4MYUA 4Y34A 3WC0A 1I5OB 2A18A 4RUBA 3A3NB 2GIFA 2J6TA 3UD4P 2PMWA 1HI8A 1FRJA 4LBHA 2CQBA 1R0AA 3HM9A 1YHQS 2B9XA 4NPOA 4EWTA 1TL1B 1RXOB 4GC7A 3V6DA 1M1KT 2XO6A 3SSQA 4ZP6A 2QSWA 5F0UA 1WELA 1CS4A 4C8OA 4DV6J 1F5AA 3QFWA 5HK4A 4ID5A 2KZZA 4XPEA 4FF3A 2CWKA 4NLDA 1HW8A 3PNIA 1WF0A 2GVDB 4C8KA 1B0PA 1CJTB 2MY8A 2GQCA 4TYBA 4B3SJ 4DV7F 4PABA 4K4VA 5GAHU 4O3RA 2XO7A 4ZITA 3H2UB 2KVQE 4HDGA 5GMEA 4RW8B 4O3PA 2FLOA 4F04B 3CC2S 4RNOA 4I2QB 3TJ8A 1RT4B 3FEZA 2VA3A 2HFOA 5HLFA 2VPZB 1XMQJ 4PG4A 2VBXA 3PDNA 2R8IA 3I5BA 1Y5LB 3IRXB 1IBKF 5J2NB 5E3RA 1X4GA 2M8HA 3ULHA 4WYLA 3EZOA 4CNZA 3VAIA 3KK2B 3M6VA 1H74A 1VCTA 4WJBA 2K3KA 2OPPA 3IP0A 3UDVA 1FVSA 3D0IE 5IT9Y 2L3MA 3M2UA 1N5QA 2NYHA 1Z1ZA 1WSRA 1HNZJ 1JJ4A 3UFCX 2HVZA 4YR0A 2ZKUA 4X4NA 3D3BJ 3JYTA 2W2NP 3D6FB 4MJKA 5KG1A 2KXNB 4KQZA 4OHWA 1RT3B 1N5TA 2OSQA 5EX0A 4JI7J 3RAMA 1HBOA 2LFVA 5IC4B 1NRKA 2VC0A 3TAMB 4DQQA 3T19A 1MROB 2Q66A 1PILA 4NCAA 2GIRA 1XWLA 4J9SA 2EKYA 2AJ1A 2F9JA 3J7YI 4ECWA 3Q8PB 1UW9A 2GJIA 2IC3B 3KDNA 2W2QP 4N8OA 1NB2A 4E8UA 2JC0A 5EUHA 1PO6A 2AJQA 2BUNA 4FXVA 2HFZA 3O1LA 2QA4G 2WTFA 1JXEA 2WONB 1LWXA 3M9OB 5DM7Q 2XS7A 2JLFA 3OUYB 3CD6S 4KIAA 4J37A 2R8HA 5B0BA 4TU9A 1FE4A 3UVJB 5AE3A 4OI2A 4OYBA 4LQ9A 4O44B 1TKTB 4Z37A 1T05A 3DLEA 5M2PA 1N6QB 3KLHA 1YZ6A 3R5DA 2P9CA 2NSCA 4R25A 3ZC4A 4Q7AA 3HKZD 1IBCB 3VF0B 2W9CA 2HHPA 2BANB 2HNZB 3GCWP 4NA3A 4GKKJ 4GVBA 4EMDA 1S9FA 3A8EA 4JI0F 3AT1B 2VBWA 1CJUB 1NZAA 3CWJA 1F60B 3L7UA 3ZFVA 5LXRA 1RWNB 4UQGA 3OR2A 2G2YA 4FF2A 4DV2J 2CNKB 2UXBJ 1M0SA 5LJ5Y 3HHLB 3OSNA 4F26A 1S1XA 2E7XA 3RBDA 1B7FA 3DRXA 5FJ4A 5DETA 2XMWA 4DLEA 1VQYA 1U8SA 4DDFA 1PIEA 2U1AA 3M8QA 3TVKA 2PI4A 4OV6A 4WTYA 4BLGA 3HVAA 2ASDA 2HQFA 2M70A 3M8RA 3UN5A 2W7OA 3AA8A 4NLWA 3DI6A 3ELHA 1RHKB 1N34F 4AXIA 2B56A 4DU8A 5AXKA 2QFJA 3MTKA 1X5PA 2DR8A 1RHJB 4PG6A 1LWEA 4DPYA 4O3NA 4MFBB 2PMHA 1RLDA 3GIRA 1GH8A 2DK2A 2ZD1A 2B3TB 1KLNA 4NCGA 1N5YB 3NGRA 3FGVA 3DRSA 1RZMA 2M0GB 2MQPA 1RACB 3POTA 3RW6A 3RBXA 5CQGA 4KV8B 2O67A 1Q4RA 2IMWP 1QVGR 4Y6IA 1C0TB 2WB4A 4RW9A 3PW5A 1WHYA 2JH3A 2HHUA 1PG5B 5HMYA 2HHHF 4K50A 1FRXA 3MEGB 2YKOA 1R8BA 4N77A 4PWDB 1SJ4P 1FRLA 3LP1A 1H3DA 4ZK7M 3D3CJ 3ISZA 3MMAB 4AD6A 4WP8A 2MLXA 2HAFA 1Y11A 2C28A 5BJRA 3F73A 4ID8A 1CULA 3G4SS 3DMJA 2BQ3A 4RBTA 3O44A 4A8OA 1Z4UA 2KL8A 3R7SB 1ITPA 2HBYB 1YK9A 2DJWA 2YKAA 4Q0BA 4YUDA 3QT8A 2L08A 1WEYA 2HVDA 3EE3A 1S6PB 2DH8A 4OI1A 4U67Q 2E1MC 2CG4A 3R6GB 1VR6A 3M8ZA 4DUTA 5A8RB 1IKWA 2EVZA 2EBGA 4DZ6A 2YVSA 4LFCF 1RHQB 1DQ8A 1PGZA 2VQFJ 1NM2A 2R8JA 2YNGA 3MMBB 1TK5A 1N56A 2B9EA 4JI4F 3KHGA 3IWNC 2UU9J 1P1LA 4K59A 2GMHA 3L95X 5KT6A 3M8PB 3Q83A 3OVBA 2DNNA 4U8YA 1S4EA 1ELOA 2MZQA 2LKZA 2AYGA 4QWBA 2CPDA 4DFPA 4RW7A 3GV5B 2C3OA 3MAAB 3X3UA 2CZ4A 2HQIA 4JI6J 4RBUA 2NUHA 4X66J 1NDKA 4ZHRA 1HNXF 2F65A 3IBFB 3GIMA 4TY8A 4C8ZA 3KK1B 4OMFG 3D6TB 1TV6B 3KUHA 1FCAA 3EM1A 2BJEA 3GR1A 2VODA 2FZGB 1YSJA 4ED8A 4EZ9A 1IKXB 1QTMA 3OVAA 1VRUB 4DX5A 2CA9A 2RJZA 2HKEA 1UEUA 2HBQB 4IFVA 3VGTA 1EARA 2CJXB 3V6HA 3C46A 3PYEA 3ENVA 2PA3A 3V6JA 2DNRA 3HHLC 3IAM9 3QFHA 1TKXB 3ZZPA 2YKNA 1NHKL 4PYDA 2CQ3A 2VKZG 3GJRB 4L3NA 1N0UA 3BV8A 1KQKA 1CC8A 5HQLA 4N41A 5C25A 3NAIA 1YLXA 3W8GA 1D9AA 2OUGA 2FZCB 2BOAA 4OZ3A 1XBWA 3DLBA 3PX0A 4ZVPB 4USVA 2UV8A 1I6JA 2VV5A 1WKKA 2BRLA 4DR2F 1FKOB 1IM6A 2VFRA 2DD8S 3UQSA 3TJ9A 2PEHA 1NJIT 1RWMB 1S6QB 3ISNC 1RA6A 3RUBL 3H7HB 4BDPA 4ZLPA 2B8PA 3I0SA 1YBUA 2MJNA 3GP9A 2Q79A 4GC6A 3M1VB 2QT7A 4CO1A 1HQEB 1UEKA 2UUBJ 3NXZA 1C1CA 2QLBB 2QV6A 3PHEA 4I0WA 5D0RA 3PJ9A 1L5UA 2O1PA 1KVKA 2VFTA 5A8WB 2NXCA 2AU0A 3KLIB 1CG2A 1NHVA 1U47A 4ZVEA 1YJWS 2HLUA 4M5MA 3C6TB 1RWXB 4BBYA 1HR0F 1KONA 3G71S 4KKOA 3V2UC 4DL7A 2GJ2A 2R42A 2F8HA 4FYYB 5ETMA 4PQUA 1IM4A 2JVOA 1FVQA 1RTJB 2YPZA 3M8YA 5IT0A 2F1FA 3LOUA 4K0KJ 1RHRB 4RUCA 3UW1A 4DN0A 5HVHA 3FBBA 2J0SD 3SBMA 1B4SA 3U02A 4B9TA 3O6QA 4QIEA 3QO9A 4DFJA 1HQUB 5B09A 1OSDA 1WWHA 4CLTA 2ZBIA 3I32A 2ERRA 2R2TA 4K4YA 5GAEI 1IBKJ 4F4XA 2EFQA 3W2WB 4KGXB 4ICLB 2VC1A 1FNMA 1MU2A 4G6VB 3J7ZT 1BD6A 3VAHA 2AT1B 2WW8A 3PO5A 2J6SA 3H90A 5CZVA 4F4YA 3ITHA 2CNOB 5IC6B 5FD1A 4ZP8A 4CT8A 2J6UA 1GTEA 1LK5A 1B0TA 2QTWA 3LAKA 5I42B 2ALZA 2UUTA 3N0VA 3W2VB 2W7AA 4HDHA 3RBEA 2YX7A 2D3UA 3VGSA 3VAFA 4CLKA 3NRBA 5I4MA 1UA0A 2M88A 2F40A 3P45B 3BDPA 1RYRA 1T11A 1VISA 3WX4A 1WD6A 2JFKA 5C24B 2HHTA 2BQRA 2B0GA 5JVHQ 3QZ7A 1NSKL 3M7VA 5CYQA 3UR3C 2FTRA 4NI2A 2JDJA 2QRRA 3JSMA 2LEAA 1JLGB 2OFGX 2VBYA 2V50A 3FFIB 3GSDA 2BBEA 1U7LA 1U02A 4CTAB 2FVPA 1UKUA 2X1GA 1Q8IA 1JWWA 2LXFA 1X5TA 1BGXT 1AUDA 2KZMA 4B3MF 2KT5A 4HEA9 3CJ2A 1DFDA 3MUVP 4DPUA 3LH2S 3CNQP 3VVTA 2G1HA 4DL2A 3OXFA 3QIPA 1VDHA 2AF6A 5GAGU 3BGOP 2MQNA 2CDQA 4IDKB 3VQSA 4O0NA 1TL3A 1HLWA 1R0BG 3LP2A 4CLYA 3MGJA 3ENWA 1MWZA 3M32A 3OLBA 4EGLA 2AX0A 4ECSA 1WDTA 2KRBA 4CLFA 2JEIA 1Q81T 1PJ7A 2HFVA 3CCUS 2NR0A 5J2PB 1JLQA 2I2YA 1WSVA 3CXCR 4J9OA 4URGA 3SFGA 4KJIA 3OL9A 3ZZOA 1HYSA 2Z2LA 1LWCA 4UZCA 4P6QA 3I87A 2K7KA 3W9IA 2KJVA 3IWLA 1O5JA 2VFUA 3HVTB 4KGMA 1ZM4A 3QRQA 2MPUA 1H72C 1EP4A 2EWHA 2PDAA 1DARA 1RT6A 5ETTA 3IAS9 4KO0B 5IWAJ 4AT1B 2DXEA 1HD0A 4DV0F 1FFWB 5CYMB 4JBCA 3KK3A 4BS2A 1WI6A 4CCHA 3W8PA 3CCQS 2YPYA 1FD8A 2GNKA 1NPRA 4F4KA 4P7TA 1BY9A 2XULA 1NCLA 5KFRA 1VLYA 4LF4F 3SCJE 2VZ9A 1XNQF 3GMGA 1EQ0A 1IUJA 1JLAA 4X64F 3CJSA 4UZBA 2MGZB 1TL4A 2KU7A 1CBKA 3KTQA 1RBLA 2MXYA 3THVA 2ADBA 2OMOA 1QUPA 5E3AA 4ZJOA 3D67A 2MYFA 2GC8A 1SKRA 1WACA 2LP4A 2CJQA 4R5PA 3H42A 4PRFA 4H54A 2GV1A 4NRUA 1AYEA 2VDHA 3MWBA 1QE1A 2VIHA 3W9JA 3MEDB 1SKSA 1LW0B 3KYLA 5F3TA 4DQIA 2VJUA 1C1BB 1FWKA 4AL6A 1WKLA 2CPYA 3N79A 4U7UD 3GG0A 1UFKA 2F4FA 2AGQA 2H1YA 3BGRA 3GR0A 2GQQA 2DNHA 3VQTA 5E5NA 2RQCA 1HPZB 2ZE2B 1M5SA 1S49A 4I2PB 1TAQA 2HRTA 1V3RA 4WWSA 3AQPA 2F5GA 5B0AA 4B02A 4OIXA 3LALA 3K5NA 2H5JB 4ZCKA 2V2VA 4ID5B 1JJCB 2MQOA 2ROGA 1AW0A 3R8YA 3KLEB 2F4VF 2MKCA 4PAAA 1Q78A 1U0SA 3FKBA 2VQEJ 4ITSA 4LRDA 4EYHB 5E7OB 4CLWA 4A8YA 4FPRA 3FBCA 3CCRS 5CZXA 4ZJQA 4LFCJ 4OX9F 3GIJA 2MY7A 3HMJG 3BZQA 3ISND 3ZXWA 2ALYB 3N01A 1NPKA 3N9UC 2JJ4D 4DU7A 4YB7A 2WOMB 3J81U 4J9NA 3BDEA 2EG1A 5F8IA 3Q22A 1S1UA 2NPIA 1IKYA 1SUQA 5A6PA 2C22A 4ETZA 1HQ2A 4F2SA 2QEXS 2I38A 3H4BA 2FY1A 1U25A 5IZHA 1DJ0A 1YJ9S 3ADAC 1Q1KA 1R7IA 3DDIA 3TQEA 1RAHB 2IA6A 1UP1A 2HRUA 4HHUA 2HNDA 4LF7J 4BC7A 4Y3CA 2KHDA 3RGIA 4DF8A 3Q24A 3IR6B 3N5BA 5DDQC 3W62A 2QLFB 3HCXA 3DRPB 3DLKA 2H51B 2JSXA 2PSZA 3MECB 4RWXA 4OZ5A 3D68A 1HBOB 1C4CA 3MPWA 2NREA 4RBVA 2R7OA 1PAEX 3CB4A 2DITA 3FEYB 1RT2A 2WAQD 1IWAA 1U4BA 5E3CA 4G65A 3KG0A 1JLCA 2ZEJA 4FVMA 4JI1F 2DPJA 2G2OA 1SH3A 4OYWA 1U1RA 1IKVB 5HBMA 5AT1B 4USIA 4HHJA 2ZHOA 5KT5A 3DOLB 4XAKA 4ZPTR 5H9EK 1C0UA 2YWHA 1S1WA 4QR2A 3IGVA 4CLUA 2L9NA 2GIQA 2LQBA 3SZ2A 3PR5B 4DR5J 3ENQA 3JS9A 2Y1JA 5DG9A 2QN6B 1GFWB 2ILYA 4H4MA 1XR7A 4LSNB 3G82A 2Y1IA 4CM0A 3QPIA 4WFYA 4M63A 1ZPVA 3I5CA 2YNHB 3Q86A 2OH2A 3BH6B 4GVBB 4NEYA 3PEJA 4Y00A 8RUCA 2DO0A 3UCUP 2F8MA 4WF9Q 2Z56B 3GWCA 3BR9A 5IQ6A 3TA2A 3PW2A 2X1AA 5B0FA 4OZ0A 3F41A 4EO6A 1S76D 3RRGA 3E01B 2XTJP 1KEKA 3TRGA 3SYZA 4JI8J 3KMSA 2W4PA 2B4UA 2RNEA 4WU2A 1X60A 3VV2B 3M8QB 4I1TA 2PC6A 5HAOA 2C2RA 2W2OP 1E6YA 1ZA1B 4NA2A 2AYBA 1RBOB 4DR3F 1MMDA 5SZTA 1QSLA 1RAOA 4RL1A 2CJBA 5G4DA 3IC1A 5IT4A 2NZ4A 1KOOA 4RO0A 4RPFA 1VQMS 4QBUA 3R3TA 1WOPA 1MLAA 1HNWJ 2VG6A 4C7QA 2ATCB 3A4TA 1JIHA 2Z8QA 3OTOJ 2ZJQQ 3K17A 2CQIA 2C3YA 1NK9A 3SSRA 4LF9J 3OHBA 1U2CA 1KRPA 2ZD1B 5B0GA 2DNQA 4NCGB 2MLYA 2ZBQA 3OJUA 3NOCA 1TFYA 3IFEA 1OWXA 2CQHA 2XZWA 1PJ5A 2OPQB 4ZCLA 5GADU 2N4CA 1KBRA 5D77A 5K5MA 1GMWD 1T0TV 2YQ0A 5LM7E 4P74A 1KHVA 3M6WA 4H4KA 3P3DA 1FXLA 3LP1B 4LIRA 4TNOA 3MUMP 1P9YA 3US5A 1GNKA 2GO8A 2V6AA 1HWIA 2YX1A 3B54A 1P1TA 4FBUA 2OPSA 2RDIA 2IAJA 3DOMA 1CULB 2AEFA 2E29A 3DHXA 4EBEA 2DH7A 1RU1A 1A6LA 3I6PA 4PPZA 2UUCJ 4LFBJ 2BKNA 3PJWA 3UWTA 3BO2A 1U1OA 2VONA 4V19X 3QIDA 1WF1A 3MCMA 2PT0A 2QMWA 1NDLA 2IM1A 1DAXA 4IO1A 1OYDA 5LMNJ 2YWKA 1DHMA 2DGXA 1DBDA 4USMA 5F8NA 1UFLA 2B5JA 1BWVA 1PBUA 2RIJA 2PD1A 2RF2A 2A6MA 1S77D 1RHUB 4LF6J 3K57A 3AJ1A 5E2QA 3FSXA 3HT0A 1OPIA 5DDRC 2QL5B 4C3KA 2MMYA 4GO5X 4B17A 5A2QU 3AB2B 5AJ3J 2ZZTA 4RZRA 1JLEB 1NUEA 3DNCA 4CYUB 4H4OA 2MQ8A 1IR0A 3R2DJ 4JYAF 1S4FA 4DV1F 1XR5A 1HNVA 1ZTWA 4RW7B 2FHJD 1ROFA 2MJUA 5ETRA 5D0HA 2FVRA 2LU1A 1FX2A 1SL1A 1YZ7A 4R0JA 1S7IA 4LVOP 1WC5A 3KLFA 2XQCA 2ZBCA 2CVIA 3C6UA 2CXEA 4NXMF 1EETB 3MM5B 2EKNA 4P2FA 1X4AA 4I6YA 3GJTB 3M2RA 4RW4A 5JXSA 1Y00A 3HULA 1MN9A 3NKYA 2XM3A 1OJ4A 2N7CA 5KG7A 2CQGA 2V68A 2B9YA 4UQTA 3IS9A 3R7BB 1E6VA 1VC6A 2EK6A 3KHRA 1IBLJ 1M90T 3IR7B 1VJQA 4LF4J 1UWBA 4C4WA 2F8EX 3BBCA 3MMJA 2B6AB 3PY8A 4EBCA 3T1YF 4AL5A 1VQ8S 3CC4S 2V34A 3A8KA 4WP9A 4M5KA 1S1TB 1YX2A 4O3QA 4XIUA 3AD9C 3I0SB 1QM9A 1MSWD 4G1QA 2XMVA 5E3PA 3TNVA 4DR7F 4NYPA 1RT1A 3IR5B 2JOQA 5KFEA 2GMJA 4B9VA 3I4PA 1DY3A 1ICEB 4OHVA 4WZQA 3KFWX 5D4PA 1KNZA 3FRZA 3MR5A 5J2QB 2Y8WA 1DQ9A 1HWLA 4HACB 8AT1B 1RE1B 4P52A 1SIWB 3LA0A 2R7RA 2ZC3A 4ETXA 1S9EA 3PFOA 1LV5A 3DXSX 4WFNQ 5EWFA 4V1Ak 2H5IB 5C5JA 1WEXA 1S9GB 4DR6F 3IG1A 2VOPA 3UE2A 2J8AA 3LWLA 1JNRB 3HJVA 2HK3A 4KKOB 1I94F 4LBIA 2V4RA 3QRPA 4PQUB 2PFDA 3HD1A 4FNIA 3SV3A 1ZAXA 3CJ3A 5CD4A 2DHXA 4DI6A 5B0CA 5A6WA 3PW0A 3SV4A 2CJYB 2BE2B 1U6BA 5ETKA 4A8QA 3KLVA 3Q8RB 1FNOA 5KFXA 2BJ7A 3GB0A 2B7BB 1EAYC 3ILOA 1Q5YA 1HW9A 3TO8A 2IPOB 1URRA 1O51A 3QGIA 1G2EA 4B3OA 3CJKB 4QWEA 2FJBB 3PFEA 4ELVA 1DLOA 1LXJA 3RBZA 3DDKA 1H38A 2JFDA 4YQWA 5LXYA 2G4BA 1RKIA 4KH0B 1CQMA 2RHSB 3UDEA 1ZA2B 4S0MA 5A8KB 2HHWA 1MW7A 1NEEA 2C3PA 1IJEB 2OLWA 3OTBA 5KFYA 3MZIA 2HSEB 4QOTA 3VALA 2JRSA 3PKMA 1T03A 4JV5F 4HLBA 2PA8D 5L1LA 4FS1A 3PX6A 4EU0A 4YY3J 3FMWA 4OHZA 2AJFE 3I4HX 2DR9A 3KJVB 3RB6A 3S6EA 4F4ZA 2IA0A 2XC9A 3E51A 4U95A 3H2VE 3G6YA 2H3EB 1YJUA 1S0MA 2APOA 3WDOA 5CD4H 3LGMA 1DTQA 1YGYA 4DL0C 2UP1A 5CYQB 4DR4J 1VI7A 3FSYA 4OJGA 3JTPA 3G96A 3THPA 5FIIA 5CHCB 1R27B 3NCPA 1SQGA 2KRRA 2CJAA 2RMLA 2DGWA 4DV6F 2QJ3A 3PM9A 3TUPA 7AT1B 2V8VA 2AKWB 1HHQA 1FRMA 2VPXB 2HWIA 2Y8YA 1HBUB 4B3SF 1N88A 4O4GA 3GE9A 2ZHAA 3LPEA 2YNFB 1RT5A 3W7BA 3DLJA 4X4VA 2EG2A 1R89A 1X8DA 2IBKA 4ZVHA 5F9NA 1XMQF 3NLCA 5ETQA 2W4CA 2PMZD 2BQUA 1QTNB 2ASLA 4KHPJ 1T9UA 4LSZB 3M2VB 3N5FA 3BPSP 3CD5A 2ZZNA 1JLQB 3SI8A 3GQCA 3DN9A 3F0NA 2LLZA 3A3OB 2J7KA 3O3LA 1HNZF 2QLJB 1SKUB 2QC3A 4WKYA 4OLOA 1X4HA 2E7VA 2E9ZA 3VAJA 5H9FJ 5D0GA 3DRRA 2ZHBA 3A1YG 4DL6A 3G8TA 2AJ4A 2A0FB 4DV5J 1RWPB 2E7WA 4KPCA 4ZIVA 3VHQA 3MD3A 2XBPA 4LJMA 2V4JA 1CJVA 2X1FA 1FF2A 4C0BA 3GFHA 3OL6A 2DR7A 1LFWA 1VJWA 3PRVA 1WG1A 1WC3A 3CO0P 3CCTA 1OIAA 3EZ5A 4PWWA 1D8ZA 1NSAA 1OO0B 4O0IA 4UT4A 4ZCMA 3VAGA 2HGNA 3CMAS 2CJ9A 3MOJB 2RDJA 2LEPA 2UV8G 2AV5A 3R5JB 3RAXA 1FJEB 4ES1A 4R5PB 3R5CA 4QR1A 1UVIA 2YWFA 4J9QA 3R7NB 4K4WA 5T41A 3K5LA 1FDDA 3CD7A 1FE0A 2N3LA 1RK8A 2GAHC 2XGPA 5KFOA 1NJYA 1KFDA 1EJ7L 1HBMB 4GKKF 4ZPWR 2QLWA 2ZJRQ 3NP5A 4ALZA 2QYCA 5EDWA 2Z2ZA 2CNLB 3BGUA 4LQ3A 1F9FA 2A2DA 5F8JA 1AZSA 3QJPA 1RT7B 3S8SA 2HPUA 4LSLA 4DV2F 4LF1A 1Q7YT 1RTDB 4WIIA 2CQPA 1LEOA 1G6BA 5D4LA 3TANA 4ERDA 3D6MB 1HHTP 1R0CB 3B6BA 3J81j 5KFDA 2RS8A 1ZH5A 1D1UA 2DNKA 5A0YA 3OSPA 2YKPA 2LVWA 5LL6d 5HANA 2HWHA 4OI4A 2FQQB 5L39A 5K14A 5DLFA 3QQCD 2WBRA 1W25A 3BKTA 5BYSA 3C2PA 3KDOA 3EPGA 4WKRA 1FRIA 3AOCA 4ZMMA 3OTEA 3SFUA 2C42A 4DQRA 1RDRA 5CABA 2HMIB 2WSFC 1WHVA 2EFVA 1UVJA 1GMVA 3C66A 3DGVA 1S1VB 4QIVA 4USKA 1GXTA 3CCES 4WXOA 2GAGC 3TYTA 3DRYA 1O6XA 2WHOA 2CG8A 1U09A 3GG1A 7FD1A 3IBWA 2Z4PA 2DY9A 1NK0A 2FHMA 4LFAJ 1V6HA 4ZPAA 4B3RJ 2M52A 2BABA 2KKHA 3BJYA 4A47A 2OPRA 5DGBA 2P6TA 2WVBA 2NCKL 3DOKA 3NNAA 3PVXA 1UZHA 5KT3A 4PYAA 4TYAA 1YG0A 3Q0AA 1J2VA 2C2NA 4ZVQB 1FJGJ 3BBBA 1RT2B 2VD3A 4FS2A 3KLGA 4YR3A 2WSCC 3PEHA 5U47A 4K7QA 4IG3B 2AP6A 4DPWA 2YKMA 4ZLJA 4FYWB 2AGOA 1LFPA 5L38A 3K8WA 5C2GA 4RU2A 4QYZK 2SXLA 3MMCA 2FDNA 3N6LA 3N6MA 5KFZA 3OPKA 4MKAA 2BX6A 3CJRA 5CYJA 3PRDA 2XEXA 3DYAA 2D9PA 3WBZA 2LECA 3GJQB 2UVRA 4IR1A 1N36J 1YRTA 2E1AA 3BS9A 4YB5A 2G0JA 2YX4A 3C16B 2J0XA 2CPIA 3MM8B 3RB4A 3QLHA 4F0KA 1T9TA 5EWEA 3ZTPA 2V69A 1KSPA 3SDEA 4KT0C 4LRCA 4O3OA 4MK9A 3FUYA 2C2DA 2UU9F 1ACMB 4GO7X 4OL8A 4TU8A 3TVZA 3NWGA 3VZIA 1KVJA 2DGVA 3NOGA 3QSYB 2K1RA 1HBNB 3CJ8A 5K8MA 1G7CB 3MM9A 4WFBQ 1FXRA 1JLFB 3K89A 3OXGA 2IRXA 5KT4A 1VK8A 2VKRA 1RISA 4Y28C 4JI6F 4X66F 1VLOA 3H59A 2DHGA 4ZPBA 5HP1B 4IO9Q 1OYEA 2HHQA 4ANCA 1KVIA 3OL8A 3VGVA 1Q86T 3CCZA 4OHXA 3NNCA 4OZ1A 1H2VZ 2HHVA 3UPFA 1E6YB 1TKZA 4C6AA 3V4MA 3TA0A 4OZNA 4ZVGA 2CQ4A 1N0VC 1R3NA 1REVA 5GADI 2EC2A 3R97A 3L7OA 2GVZB 2L9DA 4DUZJ 2LYVA 4DV3J 1IR1A 3LO3A 3CULA 2VG6B 4ED5A 3HZEA 2P9EA 3DU6A 4NXNJ 3D54A 4P9SA 1RGVA 2ATLA 1VC0A 3OQ2A 2HHSA 3UN3A 2R2UA 1G4CA 2QSFA 1WC6A 2Y0BB 1NK8A 3W9HA 1BLUA 5D3GB 1V5VA 2UUAF 3HXMA 3C8YA 4ZLNA 2I8EA 3GCXP 2VB6A 3U1LA 2O66A 1RAGB 2HZVA 2UUBF 4WFAQ 2GVDA 2W9BB 2MHEA 3ILIA 3EICA 1CJTA 1KDNA 2RQ4A 1FK9B 1VQPS 2OPSB 4L74A 2LEBA 1M1HA 4ECTA 2DY1A 3LGHA 4EBDA 3BH7B 2YKQA 4CLLA 3HX9A 1HKAA 3NCQA 4PG5A 4RW8A 3O2IA 5HVFA 5FDLB 2FUG9 1S10A 3OTDA 2HHXA 3D1HA 1RT4A 4DMZA 1NKBA 2M3DA 1SJ1A 3IRXA 2KFNA 4F4AA 2CWXA 4F50A 1XNRJ 5K8OA 3UDCA 3GZ7A 3GYNA 3C14B 4K0KF 4B9MA 4PEOA 3KG4A 5F8HA 4ED1A 1U1PA 2E5LJ 4QWAA 2V2ZA 2LDIA 2P8IA 3CVKA 4MK8A 5KG5A 4RNNA 2XB2D 2J8SA 2E1PA 1TMJA 4H4OB 5CXTA 1L3SA 1ZM2A 2R4FA 5L1JA 3W66A 1V9OA 2FJVA 1UEVA 3FRYA 1BHNA 4IOAQ 3GPAA 3ZTOA 2V63A 3TAMA 2Q3PA 2Z0GA 5CA5A 2OGUA 3FVYA 4F7VA 4TVAB 4OJHA 4I4BA 1VMBA 1QAIA 2IM2A 1LK7A 2VL1A 2M7SA 5K8PA 2YNIB 3SEOA 1AROP 1FHTA 2OSRA 3PKYA 5AXLA 4A46A 5LT5A 5HATA 1OQ3A 1RBAA 2OEMA 2DNLA 4PWUA 2HFNA 3I55S 1U6FA 4QU7A 5B08A 2DYAA 4UF4A 4DSEA 2WONA 4O23A 1VHFA 4PXEA 2AGPA 1JXLA 4ZP9A 1SV5B 2ZWOA 3OUYA 4C0OC 4LREA 3UVJA 1RAIB 1LQ9A 4O44A 1RTZA 1TKTA 3I31A 2HURA 1SJQA 2HVEA 4DCOB 5C7PA 3JQKA 1GQEA 1N6QA 2GW8A 2JVRA 1U24A 3MCSA 3NS5A 1UWBB 2ZDOA 2BZ2A 4WYWA 4Y2MA 4M1KA 3LANA 3JSYA 3IM8A 3V81B 2BANA 3FSIA 1U45A 1FXDA 4NOHA 3CIMA 1JK9B 1RTHB 2MDAA 4UY85 1T9XA 2YQ3A 4NMLA 2W9AA 4IFYB 4XO0A 4X84A 2AJ0A 4HH0A 5A2QY 4DQSA 1TL7B 2LXUA 1VIOA 2HGLA 3HHLA 2XY5A 3KOAA 4P2SA 4DUYJ 3KJFB 4ZN3A 1RT1B 4Q2LA 4IG0A 2DGUA 4QQBA 1FA0A 1T7PA 3CCWA 3EGVA 1MN7A 5IS2A 2WB1D 4ES2A 3Q8VA 4WK1A 4JV2A 2PGCA 2HAIA 2B9WA 1DTTB 1H2UX 1D09B 4DG1B 3V5RA 1KQSR 3IG1B 4K8RA 3A8JA 4DL4A 1R8AA 4LMZA 4DSFA 5DZ6A 3WZ0A 2RQKA 4F0MA 2XWXA 1S0OA 4U8VA 4ED3A 1RADB 2B4VA 1L3KA 4ZVRB 3W65A 4IQMA 4WXWA 2NXUA 2IFXA 2VJVA 1U1QA 1RHMB 4CZCA 3P6YC 1X4FA 4A8SA 4HL9A 1N5YA 5KFLA 1UVKA 3Q8UA 1P6TA 1U2FA 3NMAA 3QT5A 1FEEA 3Q23A 2EFGA 4J5OA 5IWAF 4B3OB 2HWTA 2RB7A 2BRKA 4KV8A 2GHWA 1EX8A 2MHNA 4LIWA 1B99A 1C0TA 2IVYA 4YOEA 4ES3A 2DH9A 2OTJS 1IXKA 1RP5A 2XY7A 4I7FA 3MEGA 3Q8YA 3NWRA 3W1YC 1YKWA 2DHAA 3QJJA 4ILMA 3P5TL 1GT8A 3MMAA 3EXCX 4KR0B 2ZOGA 4E98A 3NBPB 3OLAA 5IFMA 1T94A 2IHR1 2ZNYA 4ZCIA 3CD0A 3P49B 2H65B 4AQYJ 3FMBA 4P7VA 4YMEA 4XTTA 2XHWA 4HKQA 4YR2A 3QGPA 3LP0B 5B7WA 2BW7A 5C42B 1P27B 4OFZA 2HQDA 5CAAA 1HIYA 4CM2A 2R7XA 1RABB 1XN9A 4ANDA 3QWUA 1AFIA 4TLRA 5D0EA 4N56A 5HN0A 2E5HA 1Z2LA 1RWVB 1DTQB 1PYOB 2ZH9A 1HMVB 3TP2A 5BR8J 3MM6A 1OY8A 3TEHB 4BWMA 1TELA 3FZBA 4ZPCA 4EI2A 1WC4A 2QX0A 4ENOA 3W64A 1XMOJ 1H73A 3OR1B 4J9VA 3AFGA 2VG7A 2YBVA 5MLCV 4Y2KA 2AEMA 1NJZA 2ZBRA 2VOOA 1MG7A 4WTOB 2VQEF 1C2PA 1NZ8A 3PRBA 2I5JB 2IIHA 1XC9A 4C3LA 1F3VA 3MAAA 2VA2A 4O4GB 4LR9A 4UW2A 4X2BA 4WP3A 2CPZA 2OP5A 4ZA1A 2DGOA 2E44A 3KK1A 4LF2A 4DPOA 3PYFA 2LDYA 1TV6A 3N4WA 2FLNA 2RQMA 2ZDPA 1NXIA 1DRZA 3CCVS 1RYSA 3CGIA 2HNYB 3FBFA 2XCPA 4RU9A 1K1QA 2IM3A 3W3SA 3B78A 1IKXA 1VRUA 4B9SA 2D69A 4CH7A 1FFGB 5DZ7A 3MD1A 4NLPA 4C8YA 1UZDA 1F0XA 1TVRA 2KFYA 3I9ZA 1NBEB 1T02A 1VQKS 4Q5VA 5DG8A 2R7UA 5G0RA 1TKXA 1SPBP 3D4JA 3NY0A 4A8XA 4LF7F 2DCUB 2HS4A 2FVSA 4QR0A 3CCJS 5GMDA 3HP6A 2OELA 3PZPA 3OFEA 1CEZA 4NMXA 4WIQA 4Q45A 1FKOA 2G1DA 4DOZA 2Z2MA 2BE9B 1BC6A 3D1QA 2QIFA 1S6QA 5H9FK 3SQOP 1VQNS 2DNPA 1J5OB 4ECZA 4K2JA 3W61A 1WORA 3M1VA 2DNOA 4C0HA 2MKIA 2GJFA 4DFKA 1HQEA 1U26A 3B8HA 1BQMA 4OHYA 3QJLA 3D7SB 5IV4A 3PYDA 4CH0S 2V8HA 2NUUG 2CVEA 1X9SA 3KLIA 4DR5F 2RD5C 2A1BA 4C11B 4L3KA 2JX2A 2CIMA 3RYLA 1UJ6A 4TLQA 5H1SV 3C6TA 3T1HJ 2B8QA 3BPDA 2UUAJ 4AE5A 1HWJA 3MOZA 1YJRA 4DWIA 2XMUA 2Z30B 3GFYA 4CI0B 4Z7CA 1RTJA 4FYXB 1OPZA 4EK2A 4K4SA 1VK3A 3SMZA 4EEYA 2HBRB 1RA7A 8ATCB 5EWGA 3DGPB 1IQZA 2E9RX 5EGYA 1WUUA 2V0NA 2X3GA 2MSSA 2XLKA 2JHEA 4ZVOB 4NRTA 3UCGA 4EO8A 3J80Y 1MWYA 1WNEA 3GIKA 1UL3A 3TZZA 3TX0A 4GKJJ 1U1NA 2H4YB 1HI0P 3R1LA 2F3JA 2V9KA 4UOHA 4DFMA 2B4OA 1B70B 3BO4A 2NQPA 5A0YB 2HG4A 3O8WA 4JI8F 2V5HG 3VAKA 2FJAB 4P72A 4ICLA 3LQVA 3FCWA 1VRTB 2CPJA 2C3MA 3T6JA 3EGNA 4IH7A 1SJFA 4R8UB 3W60A 5JMNA 1IBMJ 4HTJA 2WVFA 3HT3A 3PIPQ 2FB0A 3NG8A 4PKDB 1YI2S 1F5CA 2YH1A 4CO3A 1RAAB 3FCVA 1TR0A 2EFPA 3U27A 5I42A 1Q8KA 1HNWF 1YRXA 2IDEA 2KG0A 1JJ2R 3W2VA 2HS0A 2J9DA 4JUZA 4KE5A 2JEFA 4L76A 4MT1A 3OTOF 3G2XA 2F9DA 3B4DA 5IOLA 4LF9F 1P9QC 4HT5A 1FEHA 3OBIA 4Q8FA 1TKDA 1VQOS 3QRRA 3TAQA 4NL5A 5C24A 4B9LA 3R27A 4X4QA 2YWWA 4ELTA 1GK8A 3Q8SB 1FKPB 3AHPA 1WEZA 4TKTA 5CCLA 2KVIA 3MCNA 4NLRA 2CPFA 2V94A 1JLGA 5D8HB 1VBXA 3FFIA 4OLPA 1BQNB 4CTAA 1YITS 3KWMA 4U6PA 1UVLA 1SQFA 3MEKA 4Y0FA 5KFSA 4D3HA 1RU2A 4M5NA 1NJWA 1RCXB 2BJ9A 2W25A 2H5EA 4PUOB 2O01C 4ED6A 3HFZB 3VCDA 2E9TA 3FCHA 2UUCF 4LFBF 2ZWPA 1CQNA 2QO3A 3T5LA 3MMCB 3DKDA 2V4QA 5DDOC 1ZPWX 3N6NA 3SQGA 4IDKA 1Q95G 4LF8J 3M6XA 1F3FA 5LMNF 1RKJA 4EYIB 4W90B 4MIWA 1JKHB 1Y3KA 5DLGA 4WK3A 4YP3A 1TUWA 2EBEA 3BEGB 3GYGA 3BGFA 1Z2ZA 2MZSA 4HI1A 2EPIA 4LF6F 2CQDA 1QUVA 2XZTB 1N4LA 4WE1A 4L73A 1VQ4S 3IN5A 2K8GA 2U2FA 3QLHB 3RJMB 4J9KA 3ZO7A 5AJ3F 4AFFA 4OI6A 4M8LA 3W5YA 4A4JA 1U6ZA 2C2KB 1OMSA 4HTIA 4NLOA 1XJWB 5DDPC 2DEIA 3TZWA 4FBTA 5HL7Q 2WVCA 2G0IA 2D3ZA 1M5PC 4QPXA 2EI5A 4QYRA 4Q8EA 4DSJA 1CJKB 1MMNA 4V19J 2DHSA 5CYMA 4IRDA 4ZP7A 2N4DA 4DCJB 3T5KA 5LMUJ 4WU3A 3JTNA 4R0EA 2R2RA 1K1SA 2FVCA 5T7LB 1UTAA 3CDEA 4CO2A 5DO2A 2KM8B 2CRLA 1NSPA 2Y0SD 2AX1A 5D4NA 4RUAA 2MGZA 3H5SA 4OYOA 2VFSA 4P2MA 5T14A 3HDSA 3IXQA 3B4MA 2J0QD 2YWEA 1YWXA 4F02A 1B0VA 4CO5A 3LF0A 4UOCA 3BSNA 2AD9A 2CZ9A 3BN4A 2RKIA 1UCNA 5L8RC 5SUHA 4DR1J 3MEDA 1DZ5A 1LW0A 4FPIA 2HQCA 1RUSA 2BR0A 4B3TJ 1IBLF 1C1BA 2EEYA 2O3DA 2R7QA 3BSCA 5GVQA 4OZJA 2WVDA 4HYKA 5J2MB 4EUVA 5I3UB 1FO1A 5IM0B 2YH0A 2KN4A 4YB6A 3DU5A 3BB5A 2E1RA 1W7WA 3E8OA 1HPZA 2ZE2A 4I2PA 3HHKA 4QPTA 2RU9A 3M8WA 1XTZA 1VC5A 4JI2J 1L3VA 4DSKA 4QIGA 1RWKB 1UA1A 3M4XA 3QBCA 3KLEA 1CSJA 2N82B 4IH6A 3AQOA 2DXDA 2HW3A 4RW6A 3R6LB 4NZ6A 3B82A 1R0AB 1M5VC 5KFNA 2DEJA 5KAKA 3V6DB 1CLFA 2WOMA 1FJCA 4ZVTB 1WC0A 3WHIA 2FHKA 2VU5A 1CS4B 1G3OA 3MR2A 2PIIA 3GFZA 3R5AA 1X0PA 3RTVA 1N33J 3MHYA 1SH2A 2Z2YB 1PBAA 1U1KA 2PN6A 4NLVA 4DS4A 4ECQA 3QSIA 2AQ4A 2FC8A 5HVGA 4RX6A 2XMKA 1FRHA 3HSJA 1SKWA 3MUTP 5F8MA 1GX5A 4X4RA 2ZOFA 2XY6A 3RRHA 3CEDA 1IQTA 1NK7A 1H98A 1T9WA 3K58A 4DJBA 5KFBA 3HVWA 1NB7A 3AOAA 4ECUA 3DRPA 5HLFB 3K2YA 3C15A 1U48A 3EVOA 1H2TZ 2B43A 3L7PA 3MECA 4RR5A 1Q82T 3TAPA 5H9EJ 2ROEA 3OFGA 4LUBA 1XR6A 3DC2A 1CC7A 4ELUA 3G87A 2H48B 2HFUA 2OPPB 2ZH3A 5KG6A 2ZC4A 4CO4A 2XG8A 2WVEA 3M2UB 4JI3J 3DHWC 1W2IA 1IKVA 4WPAA 3GSIA 3OFFA 3LPYA 3JYTB 1U1MA 3DOLA 1ZBTA 5KFAA 4NZ7A 3R1HA 4DZDA 1AUSL 3QATA 4DPTA 3J7Z5 3OW2R 2BYCA 1MWQA 4KC5A 1OY6A 4YY3F 2Q6BA 4F25A 2UVVA 2QMXA 2W7PA 3ZZ0A 4X62J 1AXQA 1UWAA 3P5BP 1KQGB 4CT9A 4KH1B 4N5SA 4AUKA 3NS6A 3A8IA 1ZYQA 4PCQA 1SJ3P 4BHQA 1F9EB 3UI3A 1S5ZA 5KOXA 2COLA 3H25A 2ZH1A 4LSNA 5A76A 3AXKA 2A6OA 4QJVA 1S99A 1TUGB 4U7UK 2W01A 1TL5A 3MF5A 2RT3A 4DR4F 5LSRA 2QZ8A 2YNHA 2ZOMA 2LQ5A 4DL5A 2KM8C 4CLSA 4XPCA 3CT9A 1FJ7A 3KHLA 3I56S 4LF5J 3AA9A 2DB1A 3MI7X 3HKWA 2YWGA 2MZ1A 3DLGA 3GONA 3QGHA 2WK4A 3OHAA 3PHTA 4DS5A 3U1MA 5C2CA 2AYEA 3E01A 1T05B 3DLEB 4UUXA 4IG0B 3CJTA 5I3QA 3KLHB 5LJ3Y 4NLUA 4J9RA 1NK5A 2NS1B 4NLXA 2Y9HA 4JI5J 1WHXA 2W9CB 3CJ5A 3UCZP 1X5OA 3CJQA 2GGPA 3GJSB 3BREA 2AIRB 4DPXA 3C19A 4RKUC 4KHPF 1ZAWA 3FC9A 1PSDA 2VG5A 1DQAA 3OR2B 3MAHA 5F41A 2K7JA 3RZAA 2DNZA 1QY7A 3CC7S 4J9PA 3H0PA 2NXJA 1TQLA 1S72S 5BYRA 1RB0A 3T41A 1S1XB 3V4IA 1K0VA 3GU0A 1K8AT 1X0FA 1UPMB 2HLTA 4KGZB 2GMLA 1S7HA 2PEBA 2N3OA 4DV5F 1LOUA 4HI2A 4Y2IA 5IV3A 4NLSA 4C9DA 3RU0A 4ANEA 1S57A 4M95A 4DCPB 1D8YA 1FERA 3ZZYA 2OPQA 4KAIA 1FD2A 2Y3YA 2RU3A 2IMOA 4LRAA 4B9NA 3EGWB 1H7WA 2K2PA 1VHIA 3DI6B 1S79A 1KKHA 3BF4A 1X4BA 4I7FB 4HT7A 3EX7B 4W92B 4P10A 3NGUA 5KFJA 2D1CA 1YDLA 1LWEB 3NCRA 1F2HA 3RRKA 1YJNS 4WZMA 3BQ2A 3MPDA 3PW7A 4ER8A 4F2RA 2KT2A 5CCMA 1RWOB 3DRSB 3ICLA 2DRBA 2O5DA 3TOQA 4Q44A 1KWMA 2EFOA 4I6AA 2XLIA 1FDAA 2PFFB 2MKJA 3POTB 2KTQA 2MKSA 3MPUB 2OI2A 1FX4A 4RW9B 3N28A 2VPYB 2AW0A 2EXUA 2DR5A 2XI2A 3AJ2A 5MAOA 1NJXA 4A8FA 1N32J 2OJ3A 3KJQB 2LXIA 2FJWA 3L4BC 3UD3P 1QSSA 3PYGA 4ZPVR 2AHOB 3MM6B 2XS2A 4G1PA 2HZCA 4LR7A 2HFSA 3MURP 5HSPA 3DMJB 4U96A 5HROA 3JQJA 4J9MA 1JLEA 2FYXA 4OJ3A 1JB0C 3GV8B 5F8GA 1KTVA 5ADZA 2VG7B 4MH8A 3Q8QB 1YBAA 3CPWR 4CYUA 4Q0BB 2FY8A 2NYIA 3QNWB 2BKOA 2BM1A 3GLJA 1XERA 1HL6A 1WTBA 3S01A 3K5MA 4FKYA 1IKWB 3JB9k 1VIXA 1JQGA 2CADA 2DNMA 4OI3A 4K4UA 2QA2A 3OV7A 2J9EA 2CFXA 2YNGB 3CCSS 4MTPA 2ZM6J 5L46A 1EETA 3MM5A 4BC9A 5BYQA 4KBIA 2UVWA 3BQ1A 2H54B 3UNGC 2UXCJ 4ZLLA 1NAQA 5I3PA 2MKHA 4W4MA 3D6HB 4FKXA 1HFEL 2ZH4A 2KHCA 1EZZB 3BN7A 1SJRA 1TVRB 2UUWA 4ED0A 2Q43A 2ACMA 4QW9A 4ED7A 1WJ9A 2CDRB 2KXFA 2IVFB 4LRBA 1SCJB 3MR6A 5G0RB 4NWBA 4ZHRB 4Y2AA 4LT6A 2XYPB 4LFAF 4ZDNA 4TY8B 1K44A 4B3RF 2R7SA 3IBCB 1UAWA 1J27A 1FDBA 1NDCA 3BSAA 1SBRA 1J5EJ 2IYGA 4TQSA 3CDWA 1MNEA 2ABYA 3T9ZA 3GV7B 4K4XA 2CPEA 3AB4B 4DV4J 2J5AA 3WX8A 2B6AA 2P5VA 2DNYA 4X65J 1S6OA 1JJHA 4J91A 5FLXU 1FJGF 4X4UA 4IFVB 3TEGA 3DCAA 1O0PA 1S1TA 2E1CA 1V3SA 3NL0A 2FZKB 5AXNA 4PR6A 5KFWA 4C3MA 4ZKAA 4CDIA 2BM0A 2PI5A 1LW2A 2YKNB 1REGX 4ZS6A 1Q5VA 3RR7A 2XMJA 1BQMB 3Q2SC 6FD1A 5J2QA 3HHEA 1TFWA 5C25B 3BYRA 2MEWA 2BJ8A 2JZ5A 4HACA 4F8RA 2E66A 2P9GA 4O4RA 3OVSA 3KUEA 4HH1A 1U0HA 4J90A 3H5UA 2IM0A 4NLQA 3DDNA 2MQQA 4USHA 3EMTA 1S9GA 1WI8A 2J7WA 3TJAA 4KY3A 1SC1B 1N36F 3NMRA 4I56A 3CSKA 1NK4A 3UN2A 1SC3B 3CDBA 2P2CB 3DLLQ 3DLHA 1IVZA 2B7CB 2BOPA 1W26A 1I1GA 1VRQC 3AOBA 4NASA 3ZNJ1 1C1CB 2ZH6A 3MEEA 4BWJA 4DV7J 3P8BB 2BE2A 2H4WB 3KJNB 5KFFA 5J1PA 4D3GA 3CF5Q 2W2MP 1JX4A 3T6BA 3CJKA 2CQ1A 1PJ6A 4F3QA 4YN3B 5AE1A 5KFPA 4FXDA 2FLLA 4KFBA 1D9FA 4LVNP 1CPZA 3PX4A 3H8YA 2OEKA 4Y65A 1G1XA 2DNGA 4XDCA 4UUWA 4K2XA 1X9WA 5A8KA 2QA4S 1SXLA 5K20B 3H5XA 2GCFA 2W1BA 2OAUA 4DL3A 3ETMA 3JTOA 3M30A 3QO9B 4DUZF 4M5GA 1YBTA 3CTRA 4DV3F 2DIVA 3MTJA 5M2RA 3PR4A 4Q2MA 3HHDA 2VDIA 1S97A 4J9LA 4NXNF 2ZH2A 3T5HA 3KJVA 3H40A 1SVDA 4ZOSA 4DN9A 2IY5B 2BJ1A 3I82A 1KHWA 2ACYA 1MU2B 3HVRA 2G13A 4DSLA 3MXHP 1LWFA 4QCLA 2CPXA 3WIUA 4IH5A 2V8PA 3EXYA 1QDUB 4XK8C 4KSEB 3ITHB 2FVQA 5ETSA 1EIYB 2MLZA 4ED4A 5E3QA 1KC8T 3CMES 2CNNB 3DFEA 2MTLA 2DCLA 1APSA 1ZM9A 5K8NA 1ZTTA 4OYZA 1YJ7A 5KFQA 3JAMU 3FQKA 1HBUA 2ZJPQ 2I6WA 4DSIA 1XMBA 3NGTA 2HK2A 4YDXA 3EDRB 2P6SA 5HI7A 2YNFA 4UTGA 2QYGA 2MB0B 4L72B 4ECVA 2CQ0A 2HIQA 3SQGB 4U7CA 2H9ZA 3HSZA 2QGFB 4NI2B 5DQIA 1KFSA 2ROPA 3JSMB 3GILA 4N7TA 4JI0J 1YVFA 3QMQA 3SSSA 1OSCA 2NZCA 3PTWA 2LA6A 3H4DA 2XWYA 3ILLA 5BXIA 3M2VA 4DEZA 3MDFA 3BYPA 4NYZA 1XNRF 3D9BA 2GZOA 4WE1B 5EHHA 4MYTA 2OHDA 3CMQA 4A48A 4WCEQ 2E5LF 2IJFA 3J7A1 4J9UE 3G86A 4MKYA 3EZUA 3FJ2A 1T9VA 3QIPB 3VAMA 4LR8A 2RHQB 4M5HA 3MR7A 1VS3A 3WQPA 1WDDA 1WC1A 2MQMA 5K9FA 2DVIA 1TZ0A 2DGTA 3TZXA 4QW8A 1SQEA 1TL3B 1ZZNA 4C8LA 1U2RA 3LP2B 3BO3A 3PCOB 2AZ3A 3G9CA 3M32B 4MMOA 2M9KA 7FDRA 3H20A 4QWCA 1R8HA 3D28A 2XS5A 3ONQA 1AA1B 3CCLS 3QAEA 1UW4A 5AXMA 4RNMA 3E2EA 5F9LA 3OJSA 1HYSB 4M5JA 1LWCB 1N34J 1VQSA 1JMTA 1ZM3A 4QIFA 1TK0A 9RUBA 3J80U 3VVUA 3LWMA 2RH3A 3QT7A 3MAQA 1Y0HA 4PG7A 5KT2A 3P4UB 4O3SA 1R6YA 3TQ1A 1EP4B 5EN1A 3TUZC 2G2ZA 2EFNA 2AWZA 1RT6B 3NEKA 3JQMA 1WKJA 1N48A 4P73A 4QIWD 2RKIB 1O8BA 4E2FB 4WBFA 3KK3B 3JXOA 2HHHJ 3M05A 4Z7YA 2L9WA 1Y5IB 5GAHI 1JLAB 5ETLA 2FGOA 3AH6A 3DM2A 1HBMA 1V3ZA 2JLEA 3S1TA 4GRSA 5HO4A 4A8WA 3D0GE 2MKKA 4C48A 3HHLD 3UDLA 1HNIA 2BV3A 2FPHX 1RT7A 5J1EA 1NKCA 4DXLA 2LMIA 1S12A 4F4WA 1RTDA 1TAUA 1VQ9S 2LQJA 1FT8A 4DUYF 4OYXA 3OXLA 2CPHA 1QE1B 2G0CA 4EZ6A 3ZZUA 1VBKA 3PO4A 1GX6A 1A7GE 1H6KX 1PC5A 4RW6B 3QWPA 4ECYA 3LW5C 2MKYA 1M5HA 3GIIA 3BGRB 5J1NA 1Y9OA 1S0NA 4NLGA 4USUA 4HR2A 3PG9A 3R5BA 6AT1B 3D0HE 3OT9A 4USJC 3LGNA 4JI4J 4QU6A 2RRBA 5D6GA 3G8SA 1X4CA 3HK2A 1FNXH 2HMIA 2BE7D 3NGKA 2QA1A 2JLGA 1XIQA 1S1VA 1U8WA 5DJBA 2QMUB 3EDQB 2YXLA 3IRWP 4MAKA 2HRYA 2C1EB 2FLPA 1HWUA 1R31A 4KRWA 3EJMA 3D5MA 2HYIB 2KFZA 1HNXJ 2RUGA 1NPPA 2BJ3A 4OYAA 4FNHA 2X51A 4NLTA 2W4DA 3HHNB 1DURA 2IDLA 2HQ3A 4IYQA 1RAFB 2D9OA 1WHWA 4FXWA 1OQ6A 3C15B 5DM6Q 1RTIA 4DF4A 1GAOA 1T8EA 1Q7LB 4QYZJ 3P96A 2XSFA 1EKRA 3ZTSA 1GTHA 1S1UB 1IKYB 1SUQB 3SIPB 2KB2A 3V6KA 4IG3A 2JNJA 2ZFHA 2ZUAA 3EVMA 2V8DA 1VQ5S 2QE5A 2M5YA 4AQYF 1AT1B 2FJEB 2HNDB 1KLMA 3HD2A 4ILLA 4M5DA 3M8SA 3PV8A 3OFHA 3PACA 4Z2XA 3DLKB 2DRDA 1URNA 4J7CA 2UVUA 5L9XA 5E33A 2IJNA 2BJDA 1OS5A 4OX8A 3CW2C 4DR2J 1X4DA 5KFGA 4A8KA 1I3OB 4AL7A 3JSRA 3UNYA 2L48A 1L3TA 1JLCB 2A3JA 3ZZZA 5B0EA 1FWLA 5BR8F 1VBZA 5D15A 4JV1A 3C16A 1NHUA 2VPWB 2FC9A 3VZHA 1RI7A 3MM8A 5HBMB 1WOOA 3ET6A 2KDOA 2ZUGA 1XMOF 2GFFA 3AJDA 2GX8A 1C0UB 1S1WB 5CH7B 4YFUA 1QAXA 3KNAA 4FYDA 2LQ8A 3EVWA 4X4TA 3DLGB 1HBNA 2IRYA 1K0TA 2XSJA 1JLFA 1GEHA 4E0DA 1RAJA 4CIOA 3DXBA 1P8GA 3W5XA 1HR0J 4AXJA 5LSOA 4H4MB 3G82B 3TA1A 3LAMA 2CQ2A 5GMKa 3TUIC 1HI1A 4CO0A 5HP1A 4NZ0A 3R5GA 3MCOA 1VQ7S 2MZJA 3K8VA 2M8DB 2HGMA
chains in the Genus database with same CATH topology
4TXSA 3MTKA 4GMKA 4NA1A 2AJFE 2GGPB 3I4HX 5LMNF 4EYIB 1RKJA 4W90B 2DR9A 3KJVB 1X5PA 3S6EA 4F4ZA 4PG6A 3RB6A 2DR8A 1LWEA 2IA0A 4MIWA 1IN0A 1JKHB 4MFBB 1Y3KA 4O3NA 2PMHA 2XC9A 5DLGA 4WK3A 2ZH5A 4YP3A 2D41A 3E51A 1GH8A 2EBEA 3MM7A 2DK2A 3H2VE 3G6YA 3BEGB 2VG5B 2DBBA 2ZD1A 3BGFA 1Z2ZA 2MZSA 4HI1A 2B3TB 4TQRA 1KLNA 1YJUA 4NCGA 1N5YB 2RRAA 3FGVA 1S0MA 2EPIA 4LF6F 2APOA 2XNRA 3WDOA 2CQDA 1QUVA 1N4LA 3DRSA 4WE1A 1VQ4S 5CD4H 3H5YA 3LGMA 1DTQA 2M0GB 2MQPA 1YGYA 3IN5A 4XDDA 5JJBA 4G1IA 3POTA 3L09A 2K8GA 3RW6A 4DL0C 2U2FA 3QLHB 5CQGA 4KV8B 2UP1A 2O67A 3V4IB 1Q4RA 2IMWP 1QVGR 1JLBA 4Y6IA 5CYQB 1C0TB 1VI7A 3FSYA 2V2KA 2WB4A 3JTPA 4OJGA 4J9KA 3BR8A 3G96A 5AJ3F 3THPA 4RW9A 5FIIA 5AE2A 3PW5A 1WHYA 4AFFA 5CHCB 2JH3A 2HHUA 3MPYA 1R27B 4OI6A 5HMYA 3NCPA 4M8LA 2HHHF 1LXNA 3I96A 4IRCA 4K50A 2KRRA 1FRXA 2CJAA 1U6ZA 4A4JA 4ILRA 3MEGB 2YKOA 2RMLA 4HTIA 2DGWA 4NLOA 4DV6F 1R8BA 4N77A 2FJXA 5DDPC 3PM9A 4PWDB 1SJ4P 2ZH7A 1FRLA 3LP1A 2WRMA 1H3DA 2V8VA 4ZK7M 1ULRA 4FBTA 5HL7Q 3ISZA 1VBYA 2D3ZA 1M5PC 2EC0A 1FRMA 3MMAB 2R7TA 2VPXB 2HWIA 2CZVC 4QPXA 1HBUB 2EI5A 4K5SA 4QYRA 4B3SF 4C2MA 2JEJA 4Q8EA 1N88A 4DSJA 2C28A 1MMNA 5BJRA 4ID8A 3F73A 4V19J 2DHSA 3G4SS 3DMJA 4O4GA 2BQ3A 4RBTA 2BW2A 2B4PA 5CYMA 4IRDA 2J7UA 3GE9A 2ZHAA 4ZP7A 2N4DA 3O44A 5D3GA 3T5KA 2YNFB 4WU3A 1N8RT 4A8OA 1Z4UA 2ZITA 3JTNA 4R0EA 1RT5A 3W7BA 2R2RA 1Q16B 1K1SA 1IJFB 3DLJA 2EG2A 4X4VA 2FVCA 5T7LB 1R89A 2E5IA 3CDEA 2DJWA 3IGNA 2YKAA 3I0RA 4Q0BA 4YUDA 2R8KA 1X8DA 4CO2A 5DO2A 2IBKA 4ZVHA 2I1RA 2L08A 2CRLA 5F9NA 2KM8B 1XMQF 3NLCA 1WEYA 2Y0SD 5JVGQ 2W9BA 2AX1A 1S6PB 2DH8A 5D4NA 4RUAA 2W4CA 2MGZA 4OI1A 2PMZD 4U67Q 2BQUA 2E1MC 2EW9A 2FGCA 2ASLA 2CG4A 4MIAA 1FK9A 3G6VA 3M2VB 3H5SA 2VFSA 3N5FA 5T14A 3CD5A 3HDSA 3IXQA 5A8RB 1IKWA 2EVZA 2EBGA 3B4MA 2J0QD 2YVSA 4LFCF 2YWEA 1YWXA 1DQ8A 2PE8A 4F02A 2ZZNA 1JLQB 1PGZA 1B0VA 4CO5A 2RS2A 4WFXA 3SI8A 3GQCA 3DN9A 3LF0A 4UOCA 3BSNA 2LLZA 2R8JA 2J7KA 2YNGA 3O3LA 2AD9A 4I6WA 5FDLA 3BN4A 1HNZF 4RWWA 2RKIA 5L8RC 5SUHA 1TL1A 3CDAA 3T1HF 3MMBB 4OLOA 4WKYA 1TK5A 1X4HA 3TUJC 1N56A 2E9ZA 3VAJA 4JI4F 3MEDA 3KHGA 1NO8A 2CKWA 1LW0A 2OD4A 5H9FJ 1DZ5A 4OI0A 3IWNC 3DRRA 2ZHBA 2BR0A 3A1YG 1IBLF 4DL6A 1C1BA 3G8TA 2AJ4A 2E7WA 1P1LA 2O3DA 2GMHA 4K59A 2R7QA 3BSCA 5GVQA 3L95X 4OZJA 4F3MA 5KT6A 3M8PB 3CE8A 2B51A 3OVBA 3MD3A 3TARA 2XBPA 2DNNA 4HYKA 5J2MB 4LJMA 4EUVA 5I3UB 1FO1A 5IM0B 2C2EA 3TR5A 2YH0A 1Q53A 1ELOA 2K3IA 2KN4A 3K59A 2MZQA 2LKZA 4YB6A 4QWBA 2AYGA 2CPDA 2W24A 3BB5A 2E1RA 3DU5A 3O5TB 4RW7A 2V4JA 4DFPA 2OO4A 3GV5B 2C3OA 2X1FA 3E8OA 4X4SA 2IAJB 1HPZA 1FF2A 2ZE2A 3X3UA 3QGGA 1R43A 5HROB 2CZ4A 2HQIA 3HHKA 4I2PA 4C0BA 4MIBA 3GFHA 4RBUA 2NUHA 4QPTA 2RU9A 3OL6A 2DR7A 4ZHRA 4ATNA 1HNXF 1YIJS 3GIMA 4TY8A 1XTZA 1YQHA 4YB1P 5ITHA 2D3OR 1U49A 4PPDA 1VC5A 4C8ZA 1NK6A 1LFWA 3KK1B 4OMFG 1L3VA 4DSKA 1VJWA 1WG1A 1TV6B 4QIGA 4GKJF 4PQAA 3CCTA 2OMLA 1OIAA 3EZ5A 2R2SA 1UA1A 3M4XA 4I2QA 1D8ZA 1FCAA 3KLEA 2KXHA 1OO0B 2E5JA 1SI9A 3BQ0A 1CSJA 1QJHA 4IH6A 2N82B 4O0IA 2Q6CA 3GR1A 2BJEA 3AQOA 4ZCMA 3VAGA 2VODA 2B5JB 2IRUA 1YSJA 5J2NA 1R8CA 4ED8A 4EZ9A 1IKXB 1QTMA 3OVAA 1VRUB 2RJZA 2HGNA 3CMAS 1RJJA 2RF2B 3WC2A 2HW3A 1UEUA 2CJ9A 1HHSA 2RDJA 3MOJB 4IFVA 4ZPDA 2LEPA 2UV8G 1HD1A 4RW6A 2AV5A 1M5OC 4KB7A 3RAXA 3KK2A 4N76A 3V6HA 4NZ6A 1FESA 1FJEB 1KN6A 3C46A 2DISA 3B82A 4ES1A 3FEXB 4R5PB 3ENVA 4OX6A 1IBMF 3R5CA 2PA3A 4QR1A 1R0AB 1UVIA 1M5VC 3EGZA 2YWFA 3V6JA 2DNRA 3HHLC 5KFNA 4J9QA 1H0HB 2UZAA 2OD6A 2VH7A 3IAM9 5KAKA 1HARA 3V6DB 4K4WA 1KQFB 2YNIA 3Q2TC 1CLFA 1TKXB 3ZZPA 5T41A 3K5LA 4ECXA 2WOMA 2YKNA 1U1LA 1FJCA 1NH8A 2CQ3A 1FDDA 2VKZG 4YDDB 4Q43A 2FHKA 3CD7A 4L3NA 1N0UA 3U7JA 1G3OA 1CC8A 1FE0A 2N3LA 1KQKA 5JUMA 2ZKTA 1RK8A 3MR2A 2PIIA 3GFZA 4FP9A 3R5AA 2XGPA 4N41A 1X0PA 5KFOA 5C25A 3NAIA 5KFTA 3RTVA 1NJYA 3MHYA 1RT3A 1D9AA 1KFDA 1SH2A 3ETOA 3DLBA 1HBMB 1XBWA 4GKKF 1HNVB 1U1KA 4IRKA 3PX0A 2PN6A 4NLVA 4ZPWR 2QLWA 2ZJRQ 4ECQA 4DS4A 2UV8A 3NP5A 4ALZA 2VV5A 2FC8A 2AQ4A 1I6JA 2QYCA 2BRLA 5EDWA 4RX6A 2XMKA 4DR2F 1Q79A 1FKOB 1FRHA 2VFRA 3BGUA 1SV5A 2D74B 5HMZA 1SKWA 2KO1A 4LQ3A 1F9FA 2DD8S 3MUTP 1MROA 5F8MA 2A2DA 3UQSA 2PEHA 1NJIT 5F8JA 1S6QB 2ZNZA 1RT7B 5KFCA 1GX5A 4X4RA 3QJPA 3S8SA 3ISNC 2ZOFA 2HPUA 4LSLA 4DV2F 2XY6A 2Q1LA 4NLYA 1RA6A 4IKAA 3RRHA 2IYIA 2BACA 4BDPA 1A9NB 4ZLPA 3KLFB 1Q7YT 1RTDB 3CEDA 4WIIA 3I0SA 3C6UB 2CQPA 2MJNA 1G6BA 1IQTA 2Q79A 5D4LA 3TANA 1NK7A 4ERDA 1H98A 5L1KA 4GC6A 3M1VB 1UJ5A 2QT7A 4DJBA 3K58A 5KFBA 1HHTP 3HVWA 4RNHA 1NB7A 4ECUA 3DRPA 2IC3A 3MPVA 5HLFB 1PC4A 5KFDA 2RS8A 3K2YA 4CO1A 3V81A 1HQEB 1U48A 1ZH5A 2G9OA 1H2TZ 1C1CA 2B43A 3L7PA 3MECA 1D1UA 4G3IA 2QV6A 5KG4A 1Q82T 2DNKA 2MQLA 3M2RB 3TAPA 4RW4B 5H9EJ 3PHEA 1RTHA 5A0YA 2ROEA 3OFGA 4I0WA 4LUBA 2RSQA 5L9NA 2GA7A 2O1PA 1L5UA 3OSPA 2YKPA 1XR6A 2LVWA 3DC2A 1CC7A