1WTFA

Crystal structure of bacillus thermoproteolyticus ferredoxin variants containing unexpected [3fe-4s] cluster that is linked to coenzyme a at 1.6 a resolution
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
81
structure length
81
Chain Sequence
PKYTIVDKETCIACGACGAAAPDIYDYDEDGIAYVTLDDNQGIVEVPDILIDDMMDAFEGCPTDSIKVADEPFDGDPNKFE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Identification of variant molecules of Bacillus thermoproteolyticus ferredoxin: crystal structure reveals bound coenzyme A and an unexpected [3Fe-4S] cluster associated with a canonical [4Fe-4S] ligand motif
pubmed doi rcsb
source organism Bacillus thermoproteolyticus
molecule tags Electron transport
molecule keywords Ferredoxin
total genus 18
structure length 81
sequence length 81
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2004-11-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13370 Fer4_13 4Fe-4S single cluster domain of Ferredoxin I
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.20 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1wtfA00
2FJBB 4XK8C 1K0TA 1IR0A 4Y28C 1H0HB 1DURA 1JNZB 2C42A 3MMAA 1ROFA 2XSJB 3MMBA 1XERA 1FERA 2GMJA 3EUNA 1F5BA 1CLFA 3LW5C 1SIZA 1C4AA 1FXDA 1G3OA 1FRLA 2V2KA 1BD6A 2IVFB 2C3OA 3MM7B 1WTFA 2UZAA 3IR6B 5L8RC 2FGOA 1Y5NB 1FDBA 3PNIA 3MMAB 2GMHA 2WSFC 2XSJA 3EGWB 3MMBB 1A6LA 2C3YA 1KEKA 1Y5IB 2ZVSA 1DFDA 1FDNA 6FDRA 1Q16B 3MM7A 1GAOA 1SJ1A 2FDNA 3MMCB 1FXRA 5BYSA 2PDAA 4OV1A 4XDCA 1KQFB 1JB0C 2PMZD 1FRMA 2VKRA 2O01C 1FDAA 1BLUA 1Y5LB 2VPZB 4KT0C 1FRJA 3MM5A 5FD1A 3MM9B 1FRXA 1H7WA 2WAQD 1B0VA 1JNRB 4RKUC 4DHVA 1GT8A 4ID8A 1FRKA 4CI0B 1D3WA 1FRIA 1KQGB 1PC4A 3MMCA 1FD2A 3OR2B 1FRHA 1FEHA 2FJDB 5BYRA 1B0TA 2C3MA 3MM6B 1IQZA 2WSCC 3EXYA 2Y0SD 3MM8A 2WSEC 4OMFG 3IR7B 5E7OB 1H98A 2FD2A 3MM5B 3C8YA 3MM9A 1VJWA 1FDDA 1R27B 1Y4ZB 1C4CA 1FF2A 2VPWB 4XDDA 3IR5B 2V4JA 4AYBD 1RGVA 1G6BA 7FDRA 3HKZD 3OR2A 1FCAA 2VPXB 7FD1A 1FTCA 3OR1A 1F5CA 1PC5A 3MM6A 1BWEA 1GTHA 3MM8B 2PA8D 1HFEL 2FJEB 2VPYB 3GYXB 1GTEA 2WB1D 1AXQA 1SIWB 5CHCB 2V4JB 6FD1A 1BC6A 2FJAB 4YDDB 5CH7B 2C3UA 1BQXA 2Z8QA 1H7XA 2C3PA 3OR1B 1DAXA 5BYQA 4L6V3 1B0PA 1F2GA
chains in the Genus database with same CATH superfamily
1IBLF 1HBUB 3IGVA 2R7XA 1Q82T 1J5EF 4LF7J 3EDRB 5LJ3Y 3TQEA 1YG0A 2W1BA 3CCUS 2IM3A 3HPOA 2BMBA 4IH7A 3PFOA 2G9OA 2PE8A 2XSJB 1IJEB 2UXDJ 5IWAJ 5D8HB 4ECRA 5IC4B 2MZQA 2MKCA 2IJNA 1J27A 4X4SA 3UD3P 3DLGA 1IWAA 4YY3J 4DR7J 3TOQA 4WIQA 2R2UA 3C14A 4FYYB 2XGQA 1VQ6S 5IV3A 4KV8B 4PKDB 3ULHA 4ZN3A 2NYHA 2HFSA 4DR2F 2UUCJ 1RU2A 2UVWA 2MSTA 1JLFB 1NSAA 2QFJA 3SMZA 1X4CA 1REGX 5DDQC 5HL7Q 4JI2F 2XM3A 1AUDA 1EX8A 1WC5A 4DR5J 4DV5J 2NLWA 1IUJA 2HIQA 3AOCA 4U96A 3MMBB 2F4VF 3G87A 4DG1A 4D3GA 1KVJA 1RE1B 1V3SA 4AL6A 5DZ6A 1DTQB 5IM0B 4HI2A 4YHHJ 3M9OB 2UUCF 1MSWD 1XEZA 2E5IA 1KD1T 4UT4A 3C6TB 3ENQA 2FLPA 4F26A 1TV6B 4K4VA 4G1IA 3RR7A 3IBCB 3W7BA 3M32B 1F1BB 1Z2LA 1UW4A 1BE4A 2CNOB 4DFJA 1FD8A 2F3JA 2PEBA 4DUYF 4Y34A 5GAGI 3N6MA 1U1RA 2H3EB 2H5EA 3BKUA 1RDRA 3K8WA 2AW0A 1YJTA 2PMZD 1Y3KA 4B3MJ 1YRTA 2O01C 1HWIA 1BLUA 2AV5A 4DG1B 4X65F 3IMQJ 2XLKA 2MPUA 2CPJA 3PTWA 4R0JA 4Y6IA 4NCAA 1GNKA 4RR5A 3PXGa 2SXLA 3DDKA 1NH8A 3JAMY 5C25B 5IM0A 3SDEA 4MKYA 4NLGA 3GU0A 1D3WA 2ILYA 2Z58B 3PV8A 2GC8A 2VONA 4EMDA 1RJJA 3RYLA 3U1MA 2RT3A 3M32A 2DGOA 2EFNA 4U9RA 5DG8A 1WNEA 1EHWA 3BSCA 4QBUA 3TAMB 5D15A 4USTA 3M2RA 2BJ8A 3MTKA 3SSRA 2RRAA 3C66A 1R43A 2DHGA 3EGNA 2KG1A 4DPXA 2P5VA 1YBUA 2ZH4A 1YI2S 1T7PA 3DLBA 3R2DJ 1N5SA 2ZJPQ 3H2LA 1AW0A 3IA0A 3ZC4A 1R8BA 4HLBA 4ES2A 3DLHA 5HBMB 1B7YB 1M1HA 1FA0A 3HD2A 1SB6A 3SDEB 4RNOA 5IQQA 4ZVFA 2W8LA 5SZTA 4ERDA 1JKHA 1IBKF 1RAOA 2B6AA 3KFWX 3PM9A 3THTA 1GMVA 1RTHB 4ZLNA 3NP5A 3C16B 3MAHA 3MR3A 1JXEA 4FDFA 2MSSA 5GMEA 1KC8T 2JC1A 5GAHU 1FNXH 2J9DE 3EE3A 3M2RB 1VQKS 1GTHA 2Z57B 2HMIB 9RUBA 3JSRA 4OZ3A 5B0DA 1S57A 4FZVA 4QR0A 3RBXA 3PVXA 4OHXA 4DR1F 3GJTB 4HT5A 3Q0AA 3P49B 2IRYA 2BE9B 3KJNB 3TA0A 5DGBA 3I56S 4TKTA 5DGAA 3H5SA 2DNHA 2AD9A 4B9MA 1AXQA 4BHQA 3IM9A 2CQCA 2JVOA 1UJ6A 2RD5C 2XI2A 1M5HA 1SKUB 5A2QU 2E44A 4M5DB 1RTHA 2LDIA 5LSOA 3C16A 3Q2TC 2YNIB 2E5GA 3QATA 1R3NA 1H7XA 3BS9A 2IAJB 2OP5A 5ETKA 1EP4B 3NNAA 4ED7A 4ZA1A 1G2EA 4L3KA 2HHQA 3O5TB 1TELA 2YWEA 5GAEI 1VMBA 4M5NA 4PPDA 1RACB 3IG1A 3TVZA 2RU3A 3EX7B 2HQGA 2LA4A 3FRYA 5KG1A 1PJ6A 2PT0A 1X4HA 1HNVA 2EFGA 4CO0A 5HMZA 4JV2A 1KVIA 3GIJA 2FC9A 3B54A 3D2WA 1ZS6A 1JLBB 4OI2A 3LW5C 3WIUA 2GVZB 4OYAA 1HI8A 2YNIA 1MWYA 1GK8A 3CULA 3GG0A 3L3CA 1SH3A 1MN9A 2QYGA 3EDQB 2J0QD 2RQ4A 1SC1B 1FJGJ 4RW4B 2BVZA 1RTJA 2FVCA 3CXCR 1IM4A 4PYDA 1EJ7L 2EXUA 1SQEA 2JVRA 2Y8WA 4ECZA 4R5PB 2BKOA 2O3DA 3QLHA 1ZTWA 4LQ3A 4MTPA 3L95X 1CJUB 1TKZB 4P6QA 1JLBA 4K2XA 1NLKL 2O66A 3NWRA 3SIPB 4X4TA 2J9CA 4DV0J 5HVFA 1JLGA 4JI8J 4IG3A 4DSJA 3IM8A 4RW4A 4CNZA 3L09A 2MQLA 4URSA 4USIA 2CPYA 3QQCD 4Z2XA 1N33F 4K5SA 1SJ4P 4PCQA 1FESA 5AE2A 3FEYB 3RGIA 2R42A 3LQVA 5J2QA 3QLHB 2RDDA 1REVB 1LWEB 2F8EX 3I55S 4X62J 3RB3A 1PILA 3H4BA 1VC6A 2F4FA 1WF0A 3RZAA 1TKZA 5C2CA 4JI0F 2BZ2A 1EETB 1JQGA 3T1HF 2ADBA 4DV2J 3TZZA 1D0EA 4Q2MA 3O8WA 3QFWA 5KFZA 3OL6A 1JNRB 3FZBA 2AT1B 3A3PB 1NPRA 3DRPA 1RT3B 1XK8A 4RJVA 4YS2A 5B0BA 1TAQA 1V5IB 4IQXA 2AU0A 4ECYA 3N0VA 2DIUA 4YB5A 3KJVA 2ZJQQ 5LMUF 2C2EA 3K8VA 1T94A 3CGIA 4CLKA 5J2QB 5ETPA 1I5OB 2VG5A 4USMA 3VQSA 3MPVA 5C2GA 3NGDA 2VL1A 4OI3A 3NGTA 2M0GB 2WSEC 4OX8A 8RUCA 3DRRA 3NEKA 2FHMA 4N5SA 1M0SA 1QSYA 1Q95G 5E0OA 1R27B 4LFAJ 2XY6A 1C4CA 1UJ4A 3GFYA 2C2OB 2CWXA 3W62A 2YKMA 1ICEB 2EWHA 3ICLA 2HRUA 5F0WA 1TL3B 4NLXA 5HLFB 3OTDA 1RTIB 1U2RA 5AE3A 3QRPA 3OR1A 4IH5A 2MKKA 4NA3A 1ZH5A 1LFWA 3IWNC 3D6HB 4K50A 4AT1B 2AZ3A 3CIZA 3K59A 5LMNF 3MWBA 1Q8IA 4EUVA 3VAJA 1BUXA 4KO0A 3OVSA 2YWWA 5ETLA 2COLA 2GHVC 4WK3A 4B3SJ 3KLGB 2ZM6F 1URNA 4H4MB 4F4YA 1TL3A 1Y11A 2CA9A 4K5RA 3OJSA 2QA4G 2R7WA 2ZD1B 2BJ7A 3KKFA 5HLFA 3NNCA 5F8IA 3PW0A 5K20B 3UE2A 3OR1B 2MKSA 4YUDA 4ED4A 3U1LA 1N36F 1HKAA 2HS4A 1TL4A 1SC6A 1J5OA 1TK8A 1N32J 1BXNA 3WC0A 1K0TA 4PWUA 2FVQA 4J5OA 2J0SD 2ZZNA 2DD8S 2PO4A 1LXJA 1WSRA 5B09A 3PZPA 2HHXA 4RUCA 5HJYA 3FGVA 5M2PA 4AFFA 3SZ2A 3HXMA 2QMWA 2VBXA 3OVAA 4RWXA 2JJ4D 1AUSL 2KXFA 1KTVA 4A8SA 1N54B 1NH7A 2Y1IA 4IR1A 4HKQA 5IT9Y 2NXEA 2HQFA 2XY5A 2DB1A 3KLFA 2CJXB 2V68A 2ZD1A 4PXBA 4DQIA 5M2UA 3MM7B 3KOAA 5KG5A 2PI5A 4YR2A 2MHNA 4LR8A 1XNRJ 1J5OB 4PXDA 4J9LA 2XLJA 4KB7A 4HHHA 3HHNB 3QO9A 3IWLA 3EJMA 3MR6A 1IKXB 3BYRA 5LM7E 3MURP 4UUWA 1RCOB 3QT6A 4X4UA 4DPYA 3CSKA 3QGGA 4N8OA 2E9TA 3D6MB 4OLOA 2NUHA 1UKUA 3EVWA 2G0IA 3FDSA 1UMJA 2M5YA 2YXLA 3GSIA 3SFGA 2UVUA 3RR8A 3KLIA 2DH9A 1WC4A 2W2PP 4P2SA 4WWSA 2XYHB 1HBNA 3KLFB 3KK2B 1H38A 1IBLJ 2CJBA 4LJMA 1XNRF 2VODA 2GGPA 2RUSA 4NLYA 3MMCB 5DDRC 3R1HA 1OYEA 2CAJA 4PUOA 3OD2A 3KHRA 3K0JA 2YNFA 3SV4A 4GRSA 5JJBA 1IKXA 2PMWA 3HHLD 1N34J 3QJPA 2RQKA 3TJ9A 2W2QP 3HVRA 2OPQA 1QVFR 2CPDA 2KT3A 4W4MA 3SCKE 1YRXA 1IKYB 2VFSA 2BOAA 1U26A 4PG8A 2CPEA 3OQ2A 3T9ZA 2D3ZA 3FBBA 3Q8RB 4I69A 3KLIB 3Q22A 4G3IA 2Q66A 3KK2A 1HWKA 3DC2A 2XMKA 3OLBA 1X0PA 2HEKA 4C11A 4QW9A 4LREA 2IDLA 3MECB 4DL2A 5KG2A 3Q8PB 1M90T 2NXNA 4FF3A 3LPEA 3KDOA 3QT7A 3CCWA 4CT8A 4LFCF 5A2QY 3EXYA 3BR9A 4USWA 1UETA 1S9EA 1Q78A 1B3TA 2Y0SD 1CEZA 1LOUA 1OPZA 1IKYA 1LWFA 2MQ8A 3OT9A 2B5JA 2DR7A 4IQMA 3MPWA 3C8YA 4UQGA 1WOPA 2HZCA 3T3FA 4DDFA 1IKWA 1UP1A 1UWBA 2MJUA 3FZ2A 3CCLS 3QT8A 4C11B 1PIEA 1S72S 1EQMA 2JHEA 1LW2B 2FIUA 2Q6BA 2ZE2A 3LPYA 2BW7A 3NAIA 4XPEA 4IO9Q 1D8ZA 1S0NA 2E1CA 2WBRA 3PO4A 5HO4A 2LEPA 3MR5A 3QIDA 4DUTA 2BE2B 5LSLA 2HGLA 1Q0NA 3GFZA 3ZTSA 3JYTB 2IJFA 2LDYA 2VA3A 1LKZA 4L3NA 4DSLA 4HDHA 3PKMA 3PW5A 3GIIA 4JV0A 4OHYA 4QR1A 4W90B 4NXMJ 2XWYA 4C3LA 1TAUA 3BN4A 2G2OA 3EZ5A 1F2HA 4NXNF 3ET6A 1T95A 3R7NB 2GAHC 1FVQA 5HMYA 2FHJD 1R6YA 2RF2A 1IKWB 3UQSA 1UAWA 1NXIA 4LF4F 3QFHA 2CG4A 1RBAA 2ZE2B 3R5BA 1S1TB 2QO3A 4QIGA 4V19X 2KYZA 3OPKA 1UZHA 3RJMB 3F44A 1MMNA 1O6XA 1X8DA 4DV0F 2CDQA 2BE2A 2DNZA 4B08A 1CQNA 2HHUA 3MPUB 4M5IA 8ATCB 2XBPA 2XCAA 3N79A 1YJWS 4F4WA 4BC9A 2MKHA 2IA0A 1R8CA 4ZLPA 2ZH6A 4QYRA 4QIEA 3ET6B 4JI6J 2OSRA 3DLEA 2E7VA 2ERRA 1XMQJ 1JJHA 1CLFA 3EUNA 1CJKA 1LWXA 1PG5B 2V94A 4RW7B 3UVJA 8AT1B 1N32F 1RT1B 4ZPWR 3RU0A 1ZA2B 1J2VA 3CJ4A 3CO9A 5KFVA 1FWLA 1S1TA 3CW2C 4RNNA 2IFXA 3BPDA 2QLWA 5A8WB 4KQZA 1BD6A 4Y2MA 2IVFB 3OL7A 4OZ0A 3CMES 4B3TF 1HBOB 2QT7A 3NY0A 4ZVOB 3IXQA 4QJVA 4QYZJ 2DEJA 3IR6B 4C0BA 2Q6CA 2VD3A 2HBRB 4TYBA 4WP8A 3OHAA 4NLOA 5F3TA 1XNQJ 2HFUA 3MCSA 3J81Y 1S76D 2PA3A 5J2NA 2BE7D 3A12A 2GO9A 1ACMB 3DLEB 2A6MA 3PHEA 1UTAA 4RL1A 4ZPTR 1RWPB 4RBTA 2JLEA 5HVHA 5KAKA 1RKIA 2V0NA 4LF2A 3BGFA 3I0RA 3PIPQ 3HVTA 1RT1A 2H54B 2MDAA 1RTDA 4LF8J 3W8GA 1TZ0A 3HM9A 2ZVSA 3BGUA 3PX6A 4C8MA 3UDLA 1WC0A 4DF8A 2BR0A 5FJ4A 1HWUA 1TU0B 1HBOA 3NXZA 4ZITA 5KFYA 5KT2A 4PG5A 4GC6A 1SJ3P 4ANDA 1JJ4A 2DRBA 5E3AA 4ELVA 4JI7J 1Z4UA 1M1KT 2V69A 4A8XA 2EEYA 4EFAC 4RLEA 3ENVA 1S48A 1GX6A 2VQEF 1RXOB 2F8HA 1M1GA 4WYWA 3VAFA 1SL0A 2OJ3A 4DL6A 2Y1LB 3E01B 5B7WA 3HK2A 3I6PA 4HACA 2G2ZA 4TU7A 1RTDB 2XZDB 4O0NA 3V81B 3ZZUA 1NJWA 4PQUB 1HIYA 4X4RA 5HQLA 3PW2A 1S6UA 2IA6A 2J76E 3K58A 3EVOA 1YIJS 1OY6A 4X4OA 4QU6A 1V6HA 3FCVA 1W2IA 4DQRA 1HNXF 4F36A 1AB8A 2B9XA 3P8BB 4EZ9A 2VFRA 3Q23A 4E8UA 1QVGR 2CFXA 2WONA 4DL7A 2AWZA 5KFPA 4OYPA 4UUXA 2GQ2A 3VAGA 2L41A 1VCTA 3KHGA 2YX1A 3T6BA 1UEUA 4CLSA 4HACB 2I1RA 2EFVA 3CC2S 3V81A 4P2FA 1AA1B 4PQUA 3LGNA 3R5JB 2QC3A 2ZOGA 4CLLA 4FS1A 2AJ2A 2EKNA 1Q4RA 1HNXJ 2XWXA 7FDRA 3BR8A 5KT7A 1EKRA 3LANA 1K73T 1RAGB 4RWWA 2BJ9A 1UCNA 3K57A 5JMNA 3JSMA 1QD1A 1RLDA 2DGWA 2V8GA 2MZSA 2VZ9A 5JVGQ 2R8JA 2H51B 2KHDA 3K89A 3WX4A 1KOOA 2HZAA 4HVZA 2CJYB 2HYIB 4X4NA 4TXSA 5BJRA 1TL1A 1RAJA 4AE5A 5DLGA 5KG0A 1U45A 4FYVB 4WU2A 2RRBA 2HQCA 3G8TA 1QUPA 1NKEA 3NCQA 1FFGB 2QLFB 2LA6A 3Q89A 1OQ3A 2RAQA 4M63A 4NMLA 3KG1A 1H6KX 5CH7B 5U47A 1JXVA 3CDEA 3G6XA 2ZH2A 2AYMA 3DLGB 3HHLB 4DZ6A 2ZUAA 2Z8QA 2OD6A 2VFVA 3JSMB 1X5OA 2MXYA 1R0AA 1LFPA 4NX9A 4MKAA 1U1OA 2D3O1 3IBWA 1UZDA 3OSNA 2FJBB 2D41A 4UY85 4LSLA 1JLFA 4DV1F 2OTLS 2AX1A 4L76A 2VG7A 1JNZB 1ZBTA 1SH2A 5ETMA 3R8YA 3THVA 1S49A 2AZ1A 1P6TA 3D54A 3NKYA 2BQ3A 4RU2A 3U1NA 2LQJA 1HARA 2EK1A 3MMBA 3BKTA 3R27A 3BM7A 2EG2A 4G1PA 2ZHAA 2IJRA 1CS4B 1S99A 2HAIA 2DY9A 3PRBA 1SJQA 3D0HE 3V6DB 3UCUP 1T9UA 4CO2A 3HHLA 1PJ7A 2QJ3A 2D1CA 3JS9A 2DXEA 2U2FA 1YJNS 2V8HA 2H5JB 2VJUA 1Q8LA 3QWUA 1F9FA 3QZ8A 1S10A 1VQPS 3SCLE 3HMJG 2R2TA 1U0SA 5D4OA 3LP1A 1NK5A 1GX5A 3NMRA 4DEZA 4LSLB 4DFMA 1UPPA 2CQBA 1HNIB 3ZZZA 4O44B 2VQEJ 1W7WA 1WEXA 4ZP7A 4DR3F 3I5AA 1NNDA 3ENAA 4ECTA 2XO6A 3EGWB 3KLVA 1DJ0A 2DNOA 4ZVTB 1RA6A 1CS4A 2I5JB 3V6DA 4FYDA 4A4JA 1Y5IB 5T7LB 3CT9A 3ZTRA 3ZZ0A 2DGXA 4C3MA 3TW0A 3M6WA 4WE1A 2A1BA 4CO5A 5C25A 2UVRA 2IY5B 2FJWA 4GKKJ 2M9KA 1WI8A 2J7KA 3HHDA 4MKBA 2ZJRQ 1Q81T 1IQTA 1FKPB 1Q8KA 1VISA 2ROGA 3HLUA 1HWJA 3LP1B 4OV1A 1PBUA 1KSPA 4USKA 1VGYA 2B3TB 2JWNA 2RE1A 4Q2LA 2IYGA 1HNIA 1YJVA 3GJRB 1JB0C 4ICLA 2UU9F 2AMCB 3G82B 3BDEA 4G65A 3TA2A 4YQWA 3GIMA 4J9KA 5ETQA 2CZ4A 2KJWA 1FK9B 2Z0GA 4LF6F 1KVKA 2P8IA 4LRBA 4ZPCA 5GMDA 5KT4A 2AEMA 2E5LF 1VLOA 3MMJA 4GKKF 2YX7A 1FRXA 1H7WA 4WE1B 4RKUC 1QAYA 3R6GB 2VQFF 4CI0B 1JKHB 3O1LA 4O3RA 3CO0P 2Q43A 2YKAA 1WKJA 3M8RA 3DGVA 1FKPA 2QMUB 3CF5Q 3VWSA 2X51A 2FVPA 3AD9C 3CD7A 2F63A 3MD3A 4TY9A 1ZPWX 1RTZA 4ICLB 3GONA 1PYOB 3G82A 3EVMA 1VQMS 4LR9A 3M6VA 1HPZB 1IKVA 1FK9A 1YBAA 1X4FA 3KWMA 3GILA 2LU2A 1VQ7S 5E3PA 3KDNA 1SL2A 2AYGA 2RS2A 4X84A 3DN9A 3IR5B 3FBEA 4RUBA 2MQQA 3P3DA 1O8BA 3CDAA 4C0OC 1ZYQA 4M5DA 1P27B 3AT1B 3PKYA 2R7RA 2J8AA 2R8HA 2FLLA 3E51A 3C46A 3QGPA 1A7GE 2IAJA 1HWLA 2ZBPA 1EP4A 3TEHB 5KFLA 2ALZA 4LF5J 2I8EA 3T1AA 4U67Q 2FHOB 2XTJP 1TTHB 2DITA 1VQ9S 2R3VA 3CWJA 3IG1B 1T9VA 4OV6A 1HPZA 4QWEA 3JTOA 1SCJB 2FJEB 3KYLA 3CCSS 2C2DA 2J6SA 1KWMA 1Z2ZA 2B4PA 4NCGB 4P7VA 3BH6B 3RUBL 3TZYA 4C98A 1Q1KA 1T05A 1HNVB 1SVDA 1HBMB 4B9SA 2ATCB 3WDOA 4X62F 4Q8FA 4K4TA 3C3LA 1KKHA 1D9AA 3J81U 2GVZA 2VDHA 5AXLA 4WF9Q 4LF5F 4Y2IA 5ITHA 2CJQA 1X5TA 3BV8A 3K5OA 3M7VA 3NG8A 3P96A 4A8FA 3GIRA 4PZVA 4DU7A 2DRAA 2FZCB 2LKZA 4ECSA 2JNJA 1NMEB 2CADA 2AYBA 2PFFB 1HMVB 4DCPB 2E7WA 3P4UB 1NSQA 4R5PA 3DOMB 3NGKA 1ROFA 3DKDA 3V6HA 5B0GA 3N9UC 1RWKB 4CP5A 1XERA 2GMJA 4DBQA 5LXRA 4LF7F 3PYDA 1F5AA 2ZDPA 3AOAA 1DQAA 1SIZA 1X9MA 4C8OA 2I6WA 4U7CA 4F8RA 3MXHP 2V2KA 1QSSA 3W2WB 1VRTA 3QWPA 4OYMA 3QAEA 1X5SA 2C3OA 2OLWA 3GFXA 3UW1A 4QWDA 2XB2D 1R8PA 5EX3A 4KGXB 5KG3A 4F3QA 4EI2A 5CYMB 2QYCA 3HCXA 1PJ5A 4LRFA 4OYXA 2W7OA 2GMHA 3QPIA 2R7OA 2DNMA 3CJRA 3I4PA 4CZCA 3OTCA 4I0WA 3IN5A 1VRQC 3HSGA 2DHAA 1EETA 4OQJA 3GYGA 3OTOF 1FEEA 4J37A 2UXCJ 3W2WA 1VRTB 1XIQA 4NLUA 5IV4A 4NL5A 3KK3B 1S1WB 3DRPB 2VG6A 4J9MA 1RT3A 4ZMMA 3AQOA 5DDOC 3H0PA 3OSPA 3A8IA 2G1DA 2VBWA 3W61A 1WI6A 1RT6B 3KJQB 3VTIA 1HI0P 2LP4A 4ZP9A 1VK3A 4ZKAA 4IOAQ 5L9XA 3DXSX 3VCDA 2IMWP 1YLXA 1W26A 2V67A 3KNAA 2EC2A 2VG5B 4J91A 3M2UB 3V4MA 2FHJA 2GJIA 2Q1LA 4V19J 5AJ3J 4KT0C 3DRRB 4IFYA 5A8KB 5J2MA 5J2PA 3NL0A 1DY3A 4DHVA 3KK3A 1TVRA 2EG1A 2FPHX 1GT8A 2JLGA 3W63A 2YKMB 1FRIA 3NS7B 3Q8YA 2BX6A 4WZMA 3M9MB 1RT6A 3O3LA 1OSDA 4KH1B 2HNYB 4R8UA 4DV6J 2RQMA 2FHKA 3EZOA 4JI0J 1I1GA 1HNWF 5K8NA 2P2CB 5A76A 4WFYA 5DG9A 2VBYA 1S7IA 5THWA 1MMLA 1OS5A 3N5FA 1RI7A 2HGMA 3IAS9 2MZJA 2YVSA 5EHHA 1YSJA 2XNQA 2FD2A 4XIUA 1XWLA 3KK1A 1YJUA 4K4WA 2RS8A 2WRMA 1F3VA 1Y4ZB 2BQUA 2DK2A 3M8WA 1NUEA 4IDKA 1RGVA 4H4MA 1VDHA 4PXEA 3HKZD 4ILMA 3UR0A 2R2RA 5JUMA 3HJFA 2CQPA 2DJWA 3EMTA 1AYEA 3T5HA 2AGQA 4MK8A 4B9UA 4URQU 1YJ7A 2KRBA 3LP2A 2F7VA 3KG4A 2J6TA 1LWCB 1VIOA 3MM6A 2YQ0A 1KLMA 4DV7J 1BMQB 2OPSA 3AOBA 3IRXA 5E41A 2XMMA 3HO1A 2YWHA 4RW8B 4IR9A 4N7TA 4K7QA 4F0MA 1BQMA 2PGCA 3U7JA 3TQ1A 2CQ0A 4ELUA 4L75A 2GV1A 1JMTA 4X64J 4B9NA 4NYPA 4IDKB 3CPWR 2HBQB 2R7QA 2ZKUA 3BJYA 4AL5A 4O3SA 1EAYC 4WBFA 4Q43A 1WDTA 4TU8A 3W66A 4PAAA 2VB6A 3ZNUA 2HFVA 1GXUA 2QSWA 3G2XA 3IAM9 2RIJA 1KLNA 2XS7A 3U27A 4BS2A 2KVIA 1RSCA 3BB5A 2VF3A 1N0UA 2EFQA 3JSYA 5D0HA 4EO8A 5HSPA 4CLFA 3OTOJ 3MM8A 3QO9B 1DLOA 2QG9B 3POTA 3H25A 4B3SF 3IRXB 4OYWA 2HNZB 4RW8A 2CQ3A 2MQMA 3V6JA 4M95A 4MMOA 1Y10A 3Q8SB 5H9FK 2QL9B 5ETSA 2GIFA 1U6BA 3PEHA 3ZZOA 1YHQS 1C1BA 1H2UX 1TUVA 5DM7Q 2DT9A 3A4TA 1HNZJ 4NLWA 2RUGA 4DJBA 4ED1A 1WHWA 1G3OA 2B56A 3M05A 3I31A 2HK3A 3SCJE 2ATLA 2DY1A 1GH8A 3PRDA 1S0VA 4ILLA 2CVEA 4B3RF 2FZGB 3QGIA 1S59A 2CPZA 3AFGA 2WW8A 2CZVC 3ZTOA 1VC5A 2DNGA 3DDNA 1KFSA 4PUOB 4K4ZA 1WTBA 2EW9A 1M5KC 2U1AA 1Y5NB 3GR0A 2LCWA 2HNZA 5F8HA 1RKJA 3R1LA 3CJ8A 2OEMA 2BKPA 4DUZJ 1YQHA 5ETOA 4AXJA 4ZP8A 2VHGA 1WJ9A 2UXDF 4WXOA 1C1BB 2QSFA 3GZ7A 4XPCA 1Q86T 2CQIA 4NWBA 4OFZA 4C8KA 2E1MC 2NYIA 3TNVA 2O67A 3W8PA 1U47A 4ANEA 2OMLA 2ADCA 1NB7A 4F0KA 1KDNA 1KS2A 1N5VA 2OSQA 3IO1A 1FDNA 3J80U 3BQ0A 1IBKJ 1RWMB 2YX4A 4P72A 3RTVA 2CPXA 1SJ1A 3PYFA 2HW3A 2NS1B 4C3KA 1QE1A 2EFOA 5FLXY 3DLKA 5ETVA 1LK7A 4NZ6A 4MH8A 3MECA 3FQKA 1QAXA 1TKXB 3J7YI 4F02A 1VQSA 2W25A 2F4VJ 3NRBA 1IXKA 1KP6A 4YR3A 3VZIA 5AT1B 1NBEB 3OFFA 3ZNJ1 1S9EB 2KFYA 2KG0A 1U02A 2W9AA 2H4WB 2IBKA 2W4CA 1LWFB 2A0FB 3BYPA 4ZVPB 2RJZA 2B5JB 2DR6A 4KYZA 1CQMA 4O3OA 5B0EA 1SKWA 1N34F 4LRDA 1HYSA 4WPAA 1GEHA 1YJRA 1UWBB 2ZFHA 1WHVA 1H3DA 3A13A 4A8YA 3DOLA 1MN7A 1LW2A 1QE1B 2BJDA 3W2VB 2C1EB 2JEFA 1FEHA 4OYZA 4CLYA 2ZITA 1R8AA 3NS6A 4P75A 4FXVA 5BYRA 4CLUA 4X64F 2V2VA 2EI5A 1S4EA 4F7VA 3JYTA 3HP6A 2VIHA 4EBCA 3D5MA 2ZH1A 3CE8A 5KFQA 1RT2B 1QDUB 5DM6Q 3IR7B 1IJFB 2LQ8A 3MEGA 3VAMA 5IT0A 1FDDA 1HYSB 1P1TA 1FKOB 3H98A 1PO6A 3DOLB 2UV8G 2DIVA 3W2VA 3OR2A 3QIPB 1UJ5A 4BWMA 2VPXB 3DHWC 4LVNP 1FKAF 4ZVHA 1FTCA 2PMHA 1T9YA 4QPTA 4FYWB 3T1HJ 1UEVA 4JOUA 2E5LJ 4FPRA 4DV5F 1U1QA 4EO6A 4DQPA 1NZAA 4B02A 3KMQA 2IRXA 2VH7A 4EBDA 4DU8A 4DCJB 2RMLA 2HKEA 2X3GA 3RRGA 3VAIA 3MEGB 2X1GA 3HI9A 2Y0BB 2C2NA 3MR7A 3UVJB 1CJKB 1DQ9A 5KFIA 4FP9A 1GXTA 1CPZA 4HT7A 3QIPA 2PFDA 5L1JA 1LEOA 4K2JA 1HNWJ 5KFFA 1PKUA 4F04B 5A8WA 2DISA 1UA0A 1VLYA 3J7YU 4B3RJ 4CH1A 1ZA1B 2W2OP 2XHCA 1T9XA 2XZTB 2K1RB 3FUYA 2ZHBA 2VA2A 1IVZA 3IGNA 3D6FB 3T1YF 4KSEB 3HSJA 4USUA 3TUJC 2XS5A 1IR0A 1KR4A 3I0SB 4PQAA 4Y28C 1NPPA 1H0HB 4H4OB 2W4DA 4ETXA 1WC6A 2NREA 4NXMF 4LFBJ 4QR2A 1ZM3A 3FSYA 4N56A 1ELOA 2CNLB 2XYPB 1X9SA 4PPZA 5DO2A 2YQ3A 1FERA 1MNEA 2DGTA 2ZEJA 4DXLA 1RHJB 1X7VA 3HVTB 4TLQA 4BBYA 3GJQB 4ZIWA 2C2RA 4N76A 5KFHA 1CJVB 2J0XA 4JI4F 1PCAA 4NRTA 1O5JA 2V4RA 3ETMA 2YPYA 2I9SA 2KI2A 5L8RC 5IWAF 2FGCA 1RYSA 3D66A 3TAPA 3I0SA 3OHBA 4QWAA 3R5GA 2QLJB 3K7RA 2E5HA 1I51B 1IM6A 1F6TA 4ZVEA 1G4CA 4JI1F 2Z2ZA 3HSDA 3E01A 4WCEQ 3SI8A 2H5IB 2HFZA 1S79A 1EIYB 1P9YA 3RAQA 4JI2J 5D3GA 4BWJA 2CZ9A 3ILOA 3W1YC 4F3MA 4PG6A 1I3OB 3UD4P 1Q53A 3PG9A 4GKJJ 4OI6A 2YTCA 1HQ2A 1WC3A 5E3CA 2MKIA 2DHSA 2X1AA 3CCRS 3BBBA 1WC1A 4P74A 1NHUA 1MW7A 4RPFA 4Y3CA 3WHIA 5I4MA 4J9SA 1YVFA 1D9DA 3JB9k 2W24A 1D8YA 4JI1J 2VOPA 3US5A 2WONB 4YDXA 4KRWA 3OFEA 1FX2A 1K9MT 2LEAA 4FNIA 1TUWA 1FDAA 3UNGC 3P5BP 1WG4A 2ALYB 2XYGB 3DRSA 4KH0B 3R97A 2B9YA 3MM5A 2RNEA 2DXFA 3RW7A 3CIMA 3CJ5A 2NUUG 2D9OA 4P9SA 4CTAB 3GTYX 2ZDOA 1U09A 5HMWA 2DGVA 3CCTA 4YY3F 1JWWA 1WORA 2IHR1 3PY8A 3AY0A 4OJ3A 4M5LA 3VVUA 3NGRA 3FCWA 4NPOA 2KHCA 5AXNA 1T0TV 2V9KA 4YEAA 2M8DB 2MLYA 1ZETA 2WB4A 2FVSA 4DV7F 1SC4B 1F9EB 3EXCX 1IBMJ 3R2CJ 7AT1B 3QJLA 1JLCA 1TL1B 3B82A 2FYXA 4OMFG 5GADU 3QSYB 3MM5B 2ILZA 3A8JA 3PR4A 2AGPA 3X3UA 4O4RA 1APSA 1M5PC 3IP0A 3CB4A 1KFDA 2V8PA 3MI7X 2HBZB 4UOFA 1FT8A 2IM2A 3A1YG 3LO3A 3PJXA 1WKKA 4MK7A 2VC1A 4OX9F 3FCHA 5KFGA 3L7UA 5KOWA 4K8RA 2KRRA 2NSCA 1WKLA 4I1TA 1R0AB 1PGZA 3DLJA 2ZM6J 1JXLA 1RYRA 2DH7A 4I6WA 1L5UA 5ADZA 1H74A 3BQ1A 3FMWA 1VYAA 3BSNA 3ZZRA 2VG7B 2KZZA 3JQKA 2CUYA 4XTTA 5A6PA 5D6GA 2ACMA 4X4PA 3ZTQA 2LQ5A 4ZVUB 3IBFB 2W9BB 1U24A 1UFWA 3K2YA 1U1PA 1N8RT 3T5JA 1CULB 3PR5B 2DR5A 2EFPA 3ZFVA 2QE5A 2M52A 4YMEA 2J8SA 1B99A 2L9DA 1S5ZA 1BQXA 1D9FA 2POKA 3S01A 5IFMA 4CH0S 4J9QA 4YB6A 5HP1B 4DL0C 4MIWA 2QN6B 4JI6F 1F2GA 2L3MA 1N56A 1T03B 4CT9A 4DX7A 4CCHA 2H48B 4O44A 4KHRA 4BC7A 4NEYA 1UVKA 2HAFA 1OSCA 4MT1A 1C0TB 3RAXA 2OELA 2Q79A 3FEZA 4DR6J 1F5BA 3LGHA 4H4KC 4P7TA 1AROP 2E5JA 3V5RA 2I5JA 2AP6A 4OX6A 4Y2AA 5ETNA 1U1NA 1X9WA 5T7LA 3HT3A 3CC7S 2KH9A 2HVZA 4YN3B 1M5VC 3H5XA 2I38A 2P6TA 3OL8A 5IT4A 1VIXA 5I3PA 3G4SS 2ROEA 3DRYA 3DXBA 5CD4H 1YTYA 3E2EA 5K8PA 3M6XA 2E1RA 4UY8T 5KT5A 4H54A 3W65A 2RDJA 2OPPA 2LECA 2MEWA 1ZZNA 4ELTA 1MWQA 4DR1J 2YKNB 4FYXB 3WBZA 1FE4A 2Z56B 2VFTA 3IWXA 3LOUA 4WFXA 2XO7A 4CLPA 5C5JA 1N48A 4DSIA 2C3YA 4LBIA 3AB2B 5LL6d 4WTOB 3JTPA 3LA0A 1Y3JA 4WU3A 3BGRA 4CM2A 3N5BA 4UOGA 1UVNA 4KC5A 4E0DA 3TZWA 6FDRA 2VQFJ 3PYGA 4W98A 3UPFA 4QQBA 4QPXA 4C9DA 5KFTA 4OZLA 3Q86A 2B8QA 4DV4J 4FVMA 4K4UA 3AHPA 3UD5A 2J7WA 1TK5A 5IZHA 1KBRA 3N01A 4RNHA 4ZHRA 2N7CA 2OPPB 3Q2SC 3J81j 2XY7A 2ZOMA 1TKDA 2F9DA 4H4KA 4IO1A 1UL3A 4LBHA 3VVTA 4IRKA 2YKNA 2KFZA 4DUYJ 1RUSA 1IKVB 2JL9A 2L9NA 2ZVIA 3H8YA 4PABA 4Z37A 1FRJA 5T14A 4CM0A 3ILLA 2ROPA 5KFNA 1U1KA 1KTQA 2BM1A 1UA1A 1JX4A 3GCWP 4KGMA 4UW2A 3VGVA 4ID8A 4RW9B 2W8KA 2RILA 3OXLA 1KQGB 3QZ7A 1FRHA 3CTRA 3TJAA 2NXUA 1RZMA 2GCFA 5EUHA 1BGXT 4DX5A 4DV2F 3BBFA 4LF8F 3GLJA 4ID5B 1QM9A 4Q44A 3GV7B 2LQ9A 2APOA 5HAOA 2HS3A 3TZXA 2DHXA 2DVIA 2KU7A 2W9CA 5KFAA 1R31A 3TRGA 1YKWA 2JH3A 4NA1A 1Y0HA 2K3KA 3A3OB 4NCGA 4RW6B 2N82B 4ZJOA 1T3NA 1U2CA 2ZH3A 1HBMA 1T05B 1R8HA 1FX4A 4N8NA 4I4BA 3F0NA 2E9RX 1WHXA 1ZAWA 4AYBD 3EGZA 4MK9A 2WK4A 3DDIA 3FJ2A 5CYJA 3KMSA 5G0RA 1S4FA 1X4GA 3KUHA 3VGTA 4TY8A 3EPIA 4W92B 3RW6A 4OL8A 1KONA 2QA1A 3QAUA 4NMXA 4WP3A 5GVQA 7FD1A 2CNNB 2G0JA 2YNHA 3HDSA 1KOHA 3F41A 1HHSA 2HK2A 2YKQA 3ILJA 3TAQA 4IFVA 2GW8A 4U8VA 1HHTP 1HMVA 2PA8D 1VRUB 4HEA9 4DUZF 3TARA 4PWDB 4QCLA 2B0GA 4TLRA 4RU9A 1H2VZ 3BKFA 3OBIA 4N77A 3W60A 3TUIC 5D0GA 1IR2A 3GCXP 1GTEA 2K2PA 2VFUA 2DYAA 3DOMA 2W7AA 1V3RA 2DNKA 1FWKA 2QFIA 3R9LA 2RSQA 4DQQA 1R6VA 4TY8B 5DLFA 3VZHA 3MOZA 3DRXA 2C2ZB 3MPYA 1MROA 3JQMA 1YWXA 1YJ9S 1S6OA 4U7UD 2Y1JA 4IFVB 4UOHA 4CLZA 2QLBB 3BZQA 4XK8C 2NCKL 4FXWA 2MZRA 4C97A 3BPSP 1SKRA 1S7HA 2ZBRA 5CYMA 1HL6A 2DBBA 2GJFA 5KG7A 3BO3A 3RB6A 2RKIB 5H9EK 1N6QA 2D3OR 4USJC 4OJ1A 3MAQA 5A0YA 2VV5A 5JXSA 4RBUA 4DV1J 4K4SA 2JFKA 4NEZA 3RRHA 3J7Z5 3CD5A 4NRUA 1VHFA 5F41A 3MFHA 4OX9J 1FXDA 3BF4A 3MAAB 2CRLA 1FRLA 5EN1A 4DV6F 1N5TA 3BEGB 3T6JA 5GAHI 2BDPA 2G4BA 2NZ4A 2GJ2A 4DPTA 2R7VA 1S1WA 1MROB 4GVBA 5SUHA 4ZJQA 2VG6B 2YKOA 5DS7A 3UO0A 4KJIA 3H5YA 3CD6S 1RBOB 4LRCA 5KG6A 1QJHA 2QX0A 2CVIA 2J6UA 1QSLA 4F0HA 4GC7A 2R8KA 1NKCA 1WG1A 3S1TA 2RKIA 2BJEA 5KFDA 2R8GA 2A2DA 3MMAB 1QTNB 2B7BB 2HGNA 1LNQA 3EGVA 2WCXA 2WSFC 3M2UA 4KR0B 4ES1A 5E5NA 1KEKA 4IFYB 4I64A 5A8KA 5J2MB 5J2PB 3ETOA 3UDCA 2FY8A 4ZN1A 3K5PA 1QAJA 2HURA 5HATA 4AUKA 1TVRB 3CMQA 1Q16B 5HMXA 2M88A 2QL5B 2R7UA 2XMJA 2XS2A 2BJ3A 1NDKA 2HRTA 3FEXB 4ED6A 3W9HA 4GO5X 2HNYA 3A3NB 3CJQA 1T9WA 3D68A 1KQKA 4R8UB 2ZH7A 3SSQA 4FS2A 1OPIA 2A18A 4HR2A 1SJFA 1WUUA 4KAIA 4J9PA 2PI4A 2ZNZA 3CCES 1FRMA 5MLCV 2RB7A 4QU7A 5DJBA 3MPDA 4CQ1A 2G13A 1U6ZA 4KIAA 4NLVA 3T5KA 4ZCMA 2ZNYA 2Q3PA 2CPIA 5FD1A 4X4QA 1NAQA 2KM8C 4P73A 3KK1B 3BQ2A 4B9TA 1R89A 4LVOP 4JI7F 4O3QA 2E7XA 4CO1A 4FKXA 3BN7A 2KYXA 2LMIA 2GVDA 3TO8A 4CDIA 2A3JA 1BHNA 5K8OA 2GFFA 5AXKA 3RBZA 4ECVA 2HZVA 2AJ0A 1WHYA 3CJ3A 5AJ3F 3MHYA 4DR7F 3LP2B 4S0MA 3GWCA 3PJWA 4I2QA 1LWCA 3MM6B 4UZBA 3NS5A 1KLMB 2XC9A 2Z2LA 1H72C 2OPSB 4GO7X 3SCIE 3CDUA 2Z30B 1BQMB 2KM8B 2QA2A 1H98A 2IC3B 4C8NA 2HHWA 2XSFA 2CQDA 4P71A 1AZSA 4B3TJ 5C42B 1G6BA 1W2BR 2GVDB 2NPIA 2OHDA 4HDGA 1RWXB 3NGUA 4OZ1A 4JI4J 1ZAXA 3G9CA 3FMBA 1TP7A 1IWGA 4RBVA 3OJUA 3E8OA 2VC0A 4V1Ak 1GQEA 1HNZF 1PC5A 2V2ZA 1VHIA 4I2QB 2BOPA 3MM8B 1U7LA 1DLOB 3POTB 4YFUA 3SYZA 1NKBA 2B7CB 1S9GA 1SUQA 3G86A 5CZXA 3L7PA 5CABA 1QTMA 2AIRB 4X66J 1U1MA 1YK9A 2WHOA 1MLAA 2IC3A 2QZ8A 1NO8A 5M2RA 3EYZA 2UUWA 1Q7LB 2CQ1A 1B70B 1AZSB 2BUNA 2KB2A 2BRKA 1YZ7A 2MZTA 3LGMA 2V4JB 5CHCB 1NDLA 4JP8A 1ZZFA 3B8HA 4NOHA 2CG8A 3OUYB 3LH2S 2ZHOA 4JI8F 4EYIB 2QLXA 3IS9B 4MJKA 2UXCF 4KPYA 2VDIA 4LMZA 4BCAA 3DHXA 4OJHA 4BLGA 1O0PA 4L6V3 3T9NA 5KG4A 2DNPA 1KRPA 4NCBA 3VGUA 2Y9HA 5HQMA 2Y3YA 1DBDA 2CWKA 3KLHA 3AH6A 4LRAA 1S1UB 5LXYA 4RNMA 5H1SV 4N47A 2RVJA 1X0FA 1RA7A 2M3DA 4AD6A 3VALA 1ITPA 1TR0A 1L3TA 3NBPB 2GA7A 4DS4A 3CDWA 3I87A 5ETRA 1GMWD 3OUYA 2K7JA 1O51A 1MWZA 4KGZB 2CJ9A 5J1PA 2NPFA 2QA4S 1ULRA 3G6ES 2AHOB 4ITSA 1HW8A 1K1SA 5DETA 3HZGA 1WTFA 2QV6A 4JYAJ 2KXHA 3DI6A 3DLKB 5FDLB 3VHQA 4F25A 2V2QA 3GFHA 3G6VA 1PAUB 1TKXA 2XHWA 5K8MA 1FDBA 5EDWA 2K8GA 3ITHB 4DWIA 3HVWA 1NB2A 1YX2A 4WTYA 3N6NA 3KLHB 5J1NA 1S1UA 4QIVA 2UXBJ 1VI7A 2JRSA 1R0BG 3J7AN 2IDEA 4M8LA 1I94F 2KJVA 2HWTA 2ZUGA 1EZZB 3CJKA 1WDDA 2XGPA 5KFEA 3KHHA 4PG7A 3MF5A 1TL7B 4C4WA 3NWGA 1TQLA 3FSIA 3ZZPA 2H9ZA 4RUAA 4HTJA 3DU5A 2HG4A 1FFSB 4WFBQ 1IR1A 1S6QB 4KY3A 4ZCKA 1FXRA 3JQJA 5AE1A 3GQCA 3D1HA 2VOOA 1M5SA 3PRVA 5EGYA 3DOKB 3R7SB 3THPA 2YKPA 4WFAQ 1PAEX 3ITHA 1FHTA 3U02A 1U1LA 4J9NA 3LWMA 5L9NA 3KUEA 3PDNA 3G8SA 2N4DA 2V5HG 4WZQA 3CVKA 1HR0J 1Y5LB 2MY7A 1RT2A 2UV8A 2AJFE 4Z7YA 2JFDA 5DDPC 4C0HA 1FFWB 1X5PA 1OYDA 1TL7A 3UN2A 3UDEA 5BR8J 3R5AA 1RCXB 5AXMA 5E2QA 3I32A 4I6AA 2C22A 1NK7A 2UVVA 1FKOA 3AXKA 3PCOB 4ENOA 4DR4F 4OYOA 2GO8A 1FI4A 1S6QA 3KLEA 5I3UB 3OR2B 2GHWA 2H4YB 2BYCA 1R7IA 2WBMA 1RU1A 4PR6A 3WIVA 4I68A 4ZS6A 5C24A 1B0TA 3ZZYA 3TUPA 3QYYA 3EICA 2X1BA 2EPIA 4I7FA 4OHWA 1M5OC 3TVYA 2M2BA 4OHZA 4A8QA 5K5MA 1LV5A 2RHQB 5B08A 4ZK7M 2JEJA 1Q79A 1SPBP 1UW9A 4DPOA 3W5ZA 3M1VB 2BA9A 2E9ZA 4ED5A 3AQPA 1FF2A 2IBOA 4DF4A 1SV5B 2VPWB 4XDDA 2LXIA 1SQFA 2QRRA 3V2UC 5I3UA 4P52A 3AA9A 1FCAA 3DLLQ 4YOEA 2D69A 2F65A 5C24B 1N88A 3D67A 1VOMA 2K1RA 2ZH9A 2BKNA 1NJYA 1F5CA 1U6FA 2IIHA 1VQYA 3AJ2A 3MEKA 3PYEA 1SBRA 1TL5A 1ZM9A 2HVDA 2V8VA 4RUHA 2PC6A 4H4OA 4O3NA 1QAIA 1FNOA 3CCJS 1N5YA 3D9BA 2DPIA 2X1FA 5E33A 2ZZMA 2DRDA 2NSBA 3M1VA 4MIBA 4F4ZA 1RWUA 4MYUA 2DHHA 5T41A 4B3OA 1SIWB 6FD1A 4DFKA 4ZVGA 3RG6A 3EPGA 1V5VA 5IS2A 3H7HB 2C3UA 3C19A 1CJVA 3M8ZA 2ASYA 5IC6B 2YH1A 2IVYA 1XR6A 4ALZA 1TFYA 2HPUA 3EZUA 2GIRA 2N7YA 1JJCB 2KT5A 2WVEA 3G8QA 4L73A 3M2VA 3TWZA 4Q0BB 5L1KA 4KTQA 4CO4A 5CZVA 2CQHA 5HANA 2AYEA 2LYVA 2MY8A 1NDCA 1S1VA 2HVIA 4DR5F 5J1EB 1E6VA 3W9IA 1KQSR 3C6UA 2B51A 4RX6A 1HW9A 3SXLA 4TNOA 3I5BA 4NZ0A 4KGVB 1NPKA 2BEFA 2BXJA 2DXDA 2LXFA 3GR1A 5D3GB 4NLQA 4HHJA 2YNGA 4Q45A 3NNHA 3H90A 2LXUA 2W01A 3N4WA 4C7QA 3D0GE 3ILIA 4CIOA 2DNLA 1TFWA 2MTLA 3CDBA 4HH1A 2R9LA 1VBKA 1AFJA 2YH0A 5I42A 4WXWA 1AFIA 2FGOA 3HFKA 2M70A 3VQTA 1N4LA 4DPWA 3HULA 4EWTA 1I6JA 2NQPA 2C28A 5J1EA 4B3MF 3C6UB 3I4HX 1NK6A 3SEOA 1I94J 2X7IA 3TYTA 1HQEB 3FKBA 3M8QB 4IG0A 3PHTA 3DRSB 4KBIA 4Q7AA 2DGSA 2F40A 1N0VC 1PSDA 4F4AA 2CJAA 4LR7A 4OI1A 1CBKA 2KN4A 3KNGA 3MCNA 1KHVA 4CTAA 1T8EA 2DO0A 1GAOA 4Q5VA 1Y9OA 3CJSA 5HROB 5BYSA 4Y00A 2XMUA 5I42B 1R0CB 4LIRA 2M4MA 3HSZA 4C6AA 3CJTA 4Y0FA 2D9PA 2BANB 4M5HA 2ABYA 4YB1P 2HFNA 4FBTA 1VR6A 3D1OA 1JLEB 1X4EA 3GP9A 2OIHA 1HQUB 5CAAA 1JLCB 1RWOB 2V8DA 4IG0B 4E2FB 4NXNJ 2OFGX 1P9QC 1RHKB 2RH3A 5GADI 3RBDA 4DZDA 1S1XA 2G0CA 1H73A 4BDPA 2KZMA 5CA5A 1LW0A 2P6SA 1UFKA 2WAQD 1B0VA 3AXMA 2OO4A 4M1KA 5F8LA 3VAKA 1JK9B 4DL5A 1FJ7A 2D3UA 1U49A 1F3FA 3ZTPA 3AJ1A 1HD0A 3SSSA 3DGPB 3QRQA 4OI4A 2E66A 5JVHQ 3D3BJ 2DCUB 3FRZA 5EWGA 5DG7A 4RO0A 1NK8A 1JLEA 2WSCC 2XI3A 5IQ6A 1XTZA 2MQPA 1HQUA 3V4IB 1BQNA 2P9CA 2V50A 3IFEA 4RNFA 4ED0A 1VQ5S 4KHPJ 3K5MA 2Y8YA 2HWIA 1SQGA 1KNZA 1S1XB 3MUVP 4LFBF 2WVFA 1EKSA 1JJ2R 3R5DA 4NE9C 3W64A 4FF2A 3MEEB 1TKTA 3Q24A 2W9BA 4DMZA 4A47A 4ZJLA 1CULA 1L3UA 4ZPVR 1TMJA 4ZVQB 5KFOA 2MQOA 2AJ1A 2W2NP 4FBUA 2GIQA 2MQNA 2VASA 3SQGA 3UNYA 3CC4S 2YWKA 4LF9J 2OKQA 3I9ZA 4EGLA 1NK4A 4DV3F 5HP1A 2P9EA 1DARA 1T03A 3NOCA 2CXEA 4X65J 3V4IA 3H4DA 1BQNB 1EB0A 4P2MA 5H9FJ 3L7OA 5F8JA 2DEIA 1GMWA 3UWTA 4PWWA 2MB0B 4IOBA 1UEKA 1PBAA 2A10A 2CJKA 1C0TA 4TN2A 2JEIA 3MEEA 1RT5B 2PD1A 3D0IE 4NI2B 5HI7A 4YR0A 2LQBA 2FJAB 3DYAA 4YDDB 4G6VB 3G6YA 1RT4A 1Q8BA 2DGQA 4I56A 4Q8EA 3DM2B 4FF1A 4F2SA 4I6YA 4JBCA 3SQGB 3UFCX 1BWVA 4MIAA 3P6YC 4TQRA 1ZAVA 4A48A 4ZIVA 4L74A 1X4AA 2UUTA 5CYQB 5F9LA 4DX8H 1HLWA 5KT3A 3D1QA 1YITS 3M9NB 4MAKA 3OTEA 1XR7A 5CCLA 5KTQA 3OV7A 3MR2A 1DURA 3G71S 3T1YJ 4KPCA 2C42A 2HWHA 3T41A 4LFCJ 2CPFA 1MU2B 3SFUA 3T5LA 5H9EJ 2HNDB 2UU9J 1RT5A 4NI2A 2UUBJ 1RAIB 3T19A 3NCRA 4JI5J 1X4DA 2AX0A 2C2KB 2GQCA 2IYIA 1C4AA 3B6BA 2J9EA 4LSNB 4AL7A 3BGRB 3J7ZT 3O44A 4FN5A 2VUGA 4KHMA 3KHLA 5B0FA 3TR5A 2CYYA 4DFPA 2RRNA 5CYQA 4JI3F 3OXFA 4R25A 2A6OA 3TA1A 2FY1A 2ZH8A 5LOQA 1HBUA 2HMIA 2J9DA 1X31C 4CH7A 1FO1A 4ZHRB 4OI0A 1NJZA 2Z4PA 3K5NA 1A9NB 3PJ9A 3PNIA 3M30A 4UTGA 1NRKA 2XSJA 3O2IA 3OFHA 4NLTA 1RAFB 2L08A 3VV2B 5K14B 2K3IA 1RAEB 3H42A 2OMOA 1X60A 3P45B 4LSNA 1FJCA 4WKYA 1S97A 2FTRA 3QJJA 4X4VA 2QMXA 4RW9A 2DNQA 3C14B 1ZTTA 2FDNA 2CQGA 3OW2R 1AT1B 4O23A 1Q7YT 4B9VA 5EWFA 1HHQA 1NJIT 1QY7A 2F1FA 1JIHA 2OEKA 3R7BB 3SV3A 1H2TZ 3HJVA 4XDCA 4E98A 1XN9A 4GMKA 1ZOTA 5KFJA 1FJEB 4ID5A 1KQFB 1OWXA 1U25A 5F8MA 3W3SA 1WACA 2HBYB 4C48A 3M30B 2ASJA 2UXBF 3FQLA 4M5JA 3CCMS 1V9OA 2W9CB 5F3ZA 4X66F 2VPZB 1J5EJ 4B17A 5K14A 4C2MA 4DV3J 1JLAA 4RW6A 5D78A 1YRUA 1DQ8A 3TI0A 2M7SA 1YZ6A 1DTQA 3I9V9 3OXGA 1IBCB 3BGLA 3H2VE 1GMUA 4CWBA 5L46A 4YHHF 4K0KF 3C6TA 2RHSB 2MLZA 4KGKA 3HF5A 5G0RB 1TV6A 1HI1A 5IXUA 5LSRA 4ED3A 3CCQS 3OFGA 3HHKA 2YNHB 3GJSB 3LUYA 1L3SA 1XBWA 3B4MA 1V3ZA 3PW4A 1FTRA 2HS0A 3H5UA 1T11A 1VRUA 4PWDA 4QW8A 5GMKa 1WELA 3LWLA 2XLIA 2PEHA 2WVBA 4F50A 2F8MA 5KOXA 1JLAB 2FQQB 3S7RA 3TEGA 5HJXA 1K8AT 4CNYA 3C2PA 3UN5A 2HHVA 4R0EA 4ZLLA 2B4UA 1U2FA 3BBCA 1BY9A 4AQYF 3D6TB 1CVJA 1T02A 2FB0A 2J7UA 4DCOB 3HHLC 2UUBF 3TAMA 4JI5F 2V34A 3MOJB 1FNMA 4ZLJA 5BR8F 3RB4A 2AGOA 1ZPVA 4JV1A 1C1CB 2GX8A 2LEBA 1N52B 2ZC4A 1S6PB 4KE5A 5EWEA 4C8YA 3QNWB 2M8HA 4USVA 5KFCA 1N6QB 2HQIA 4ZDNA 1UVMA 5HBMA 5CQGA 5A0YB 3BO4A 3ENWA 3AD8C 3CCZA 5K9FA 1S0OA 3J7A1 1K47A 1YDLA 1NHKL 2B6AB 1NEEA 4NLSA 4NLPA 2IMOA 3MAAA 3HVAA 4K0KJ 5L1IA 4M94A 4JV5F 2C3PA 4GVBB 2OD4A 3GIKA 4DLGA 3F73A 5BYQA 1C1CA 1NCLA 1B0PA 1FVSA 1RT7A 3FBCA 4OZ5A 2HIYA 2HLTA 5F0UA 4DLEA 2B4VA 3FVYA 1LXNA 2HSEB 4HYKA 2OTJS 1S6PA 1WG5A 2D7SA 2VU5A 4ZCLA 1UVLA 3NMAA 3MMAA 2QIFA 4J9RA 2AKWB 3LF0A 2MYFA 3PW7A 4N41A 3FFIA 1KN6A 4FVCA 3GG1A 4QYZK 1MG7A 3KUGA 4LT6A 3RB0A 3N28A 2R2SA 5C7PA 2VICA 1L3VA 3CMAS 5D77A 2Y1RI 3B78A 2HRYA 2YQ1A 4WFZA 4AXIA 4X2BA 1K44A 3ELHA 3IC1A 2LFVA 3X1LB 2EC0A 4WP9A 3QT5A 3VR1A 3D7SB 1XQIA 2E1AA 1RT7B 1SC3B 1SH0A 2E1PA 2KFNA 3PEJA 4J90A 4ECXA 3M4XA 1B4SA 4OX7A 2AEJA 1RWNB 1VS3A 4NA2A 4B9LA 1RHRB 1IBMF 2KDOA 5KFMA 2C2MB 2OPRB 4EK2A 3FFIB 3NAHA 1YBTA 2ZKTA 1W25A 3H2UB 3BSAA 2JX2A 1N33J 1WEZA 1SXLA 1LK5A 4EEYA 1DFDA 2XG8A 2O5DA 3BO2A 1DZ5A 2FJVA 3ZZTA 4DN0A 2DGUA 1RTJB 2BV3A 2HQ3A 3ISZA 3Q83A 2PDAA 2RU9A 2XMVA 3N6LA 5KFRA 2FLNA 2GS8A 1RWWB 2RDIA 2BBEA 3CD0A 3LAKA 4OYBA 2B9EA 3MD1A 4PG4A 4U7UK 1TK0A 2CNKB 2PIIA 3K17A 2B9WA 4CLTA 1XC9A 1NK0A 2OPRA 2UUAF 3QMQA 1CJUA 3TUZC 3PO5A 1EARA 5LJ5Y 3MCOA 4L72B 3UDVA 2DO4A 1VQ8S 3QRRA 3NOGA 1XMBA 2I0XA 1JLGB 4Y2CA 5C42A 4JI3J 4IG3B 1DHMA 4AQYJ 4A8MP 2NXCA 1NSPA 2ASDA 4UQTA 4P2XA 1F0XA 2LLZA 3MGJA 1S9FA 2DH8A 4IUFA 1NZ8A 3S6EA 4CLWA 1OO0B 4ZCIA 5F9NA 3HKWA 1REVA 1LWEA 5L38A 2DKOB 4ED2A 4TU9A 1C0UB 1JLQB 1WOOA 1CSJA 1S9GB 1SUQB 3AB4B 2CQ2A 2B43A 3AA8A 5D0EA 9ATCB 5FLXU 2YWFA 1NDPA 1RB0A 5E7OB 2K06A 1F60B 2AJ4A 5DZ7A 4RZRA 5RUBA 2V4JA 4F4KA 4TQSA 4NASA 4JYAF 2H65B 2OI2A 3FK4A 4FXDA 1URRA 3MEDB 2A2CA 4F2RA 4JV5J 1CJTB 2ZBQA 3KJVB 3IS9A 1CG2A 1HA1A 2IM1A 5L1LA 4LIWA 2HLUA 2N3OA 3DNCA 2BJ1A 1GFWB 1TUGB 3EWGA 2J5AA 4JUZA 1C0UA 1JLQA 2EBEA 4NYZA 3TANA 2OGUA 3CJ0A 2VPYB 1K0VA 3GYXB 1OIAA 4K4XA 5HN0A 2OUGA 5ETTA 1T3OA 2JOQA 3GPAA 4FNHA 3B4DA 3NBPA 4M5KA 4PXCA 1VFJA 4UF4A 4CRJA 1OJ4A 3BSOA 1SJRA 4WIIA 3GYNA 4K4YA 3RBEA 5D4PA 4C8LA 3MEDA 5EX0A 2XMAA 1CJTA 1RTIA 4A8OA 1Y00A 5KFSA 2WTFA 1G7CB 3DI6B 5FDLA 4Y65A 1U8WA 2JSXA 3AODA 3FNNA 3QBCA 3DCAA 1E6YB 2ZBIA 4DSKA 4I67A 4KO0B 3LALA 4ZVSB 3MFIA 1UVJA 2HHPA 3KG0A 2AEFA 2LU1A 3CJKB 2HHTA 3ONQA 1Q5YA 4DR3J 1VQLS 3KLGA 2WZ1A 1RAAB 3NLCA 3QSIA 3HZEA 5GAEU 4DI6A 4ER8A 3QGHA 3GV5B 3I96A 4O3PA 3GB0A 3WQPA 5KT6A 1U4BA 2B8PA 2ZWOA 1WF2A 1D1UA 1RABB 2R7SA 3AJDA 5IT9U 2L48A 3LTOA 4ECWA 4LSZB 3Q8QB 2QTWA 2WVDA 2OH2A 4URGA 3KTQA 2NR0A 1RISA 3DOKA 2BABA 2EKYA 3IRWP 4IRDA 1VQNS 4HH0A 1E6YA 1OY8A 4ZPBA 4D3HA 1RHQB 2HHHJ 2KVQE 2V63A 2QL7B 2ACYA 2WW4A 1S77D 1RBLA 1S0MA 4ECUA 3R5CA 1A6LA 5CXTA 1G1XA 5BXIA 5KFWA 3MUMP 4DV4F 3M8PA 1WWHA 4QIWD 4QWBA 2WVCA 1Y7PA 4DSFA 1HD1A 2JEGA 3MM7A 4DR4J 1UWAA 5DQGA 2FVRA 2HVHA 1S12A 2YBVA 3D3CJ 3KLEB 3PX0A 3KXDA 2BW2A 4DL4A 4OZNA 1WEYA 3SBMA 2PN6A 1XR5A 2F9JA 3EM1A 5L39A 2B4OA 4F67A 3J80Y 1VBZA 3OL9A 3HFZB 1CC7A 3VF0B 4OJGA 3S8SA 4I7FB 2KO1A 2XMTA 2R8IA 1VBYA 3UCGA 1RLCL 2ZH5A 1A0OB 2V4QA 2W7PA 1NM2A 1K1QA 1GXLA 2Z2YB 1U0HB 3WZ0A 2XNRA 4WYLA 4IH6A 3L4BC 4FF4A 3DMJA 3M8PB 1NSKL 4KFBB 1DTTA 1HBNB 4DSEA 2KXNB 3W9JA 3NCPA 1SV5A 4DR2J 2GGPB 3BH7B 1P8GA 1RHMB 4DL3A 3MMCA 1PC4A 3D28A 4ED8A 2EVZA 1VBXA 2HQDA 2XULA 2YNFB 2QEXS 3H20A 3JAMU 2C3MA 4DN9A 3D4JA 2VKZG 2W2MP 2KL8A 3R3TA 2QGFB 4JB8B 3G96A 3CUNA 2DNNA 2ZBCA 1IQZA 3A8EA 1SL1A 2OPQB 5D0RA 2HHHF 3LAMA 2IRUA 3AD7C 2VBZA 1B64A 1U0HA 3UI3A 3Q8VA 4PRFA 4A46A 4EZ6A 2HFOA 1N5YB 2G1HA 4QZVB 1UVIA 3DMJB 3R6LB 4HTIA 4CYUA 4KFBA 1DTTB 4ANCA 4DX6A 5DQHA 4OLPA 5F8GA 5LMNJ 1XMOF 4B3OB 1RK8A 2HVEA 4LBPA 3K5LA 1VJQA 1T9TA 2W4PA 4MKVA 2CQ4A 1IN0A 3PFEA 3TX0A 2NZCA 2H1YA 3MDFA 3WX8A 2R7TA 1EQ0A 4KKOA 4EU0A 2I2YA 3GV8B 1FE0A 4Q0BA 2GQQA 3M2VB 4LF4J 4OIXA 3PIOQ 2MGZA 4WKRA 6AT1B 1HFEL 2RQCA 1QLNA 5I3QA 1UPMB 1S1VB 2FC8A 4ZP6A 5E3QA 3UR3C 1E6VB 5KFBA 4UZCA 1VC0A 2XEXA 3L9ZA 4CYUB 4Y2KA 4OZJA 3MZIA 2WB1D 4QIFA 4ZOSA 2DR8A 1BC6A 2DNYA 5KFUA 3Q8UA 4U6PA 1L3KA 4QOTA 4XO0A 1YGYA 2Z2MA 3W5XA 2FUG9 2YNGB 2EK6A 4IOCQ 3JTNA 3LP0A 4KKOB 4NZ7A 3CCVS 4I2PA 1OMSA 2X3DA 4P10A 4ZPAA 1X4BA 1MMDA 2MGZB 5FIIA 5CCMA 2ASLA 5LT5A 4LFAF 2YY3A 4USHA 4ILRA 1VQOS 2FJXA 2N4CA 2G2YA 1C2PA 2EBGA 3CJ2A 4NLDA 4O4GA 4OZ2A 4DQSA 4DS5A 2RF2B 3I82A 1HQEA 3M8QA 2UP1A 4EYHB 4OHVA 2GNKA 4J9VA 4QWCA 3GSDA 4NLRA 1XNQF 2ZWPA 1CC8A 3H59A 3TP2A 3UN3A 4ECQA 2N3LA 1N36J 1RAHB 2NXJA 2XCPA 1B7FA 3LP0B 2MHEA 3UCZP 1NJXA 2KKHA 2ZOFA 4I2PB 4LUBA 2UZAA 3ZO7A 4DPUA 1ZM4A 4J9OA 4LF6J 5HROA 2AJQA 2DCLA 3PACA 2D74B 1ZM2A 3P5TL 4EBEA 3M8YA 4YB7A 2WOMA 3FC9A 5KFKA 2MKYA 2BANA 1RWVB 2XZWA 4MYTA 3DU6A 4G1QA 4O4GB 3RRKA 2XMWA 3BDPA 1FJGF 3HX9A 1XMQF 2ZC3A 1TMMA 3FBFA 5DRKA 2AF6A 3DFEA 4HI1A 4RW7A 5B0AA 5IOLA 5LMUJ 4A8WA 2HHSA 2BACA 1OY9A 3PX4A 3JXOA 2P9GA 4ATNA 2XQCA 1LW0B 5DQIA 4F3OA 5HQ8A 2J0WA 4DR6F 1KHWA 1RP5A 2KT2A 4IRCA 4U8YA 2GMLA 4FKYA 5D4LA 2JZ5A 4LF1A 3M8SA 2ZZTA 4M5MA 5D4NA 1Z1ZA 1XMOJ 3DGPA 2WOMB 5HVGA 2FLOA 1WF1A 2OFHX 2VJVA 2IM0A 5J2NB 4G1QB 4KHPF 3ISND 3VAHA 1NK9A 1NU4A 2VKRA 4O0IA 4ES3A 2BQRA 1SKSA 3ADAC 3MTJA 3MUTP 3I0RB 4TVAB 1PYTA 2LVWA 3W5YA 1UFLA 3SQOP 1PYSB 3MM9B 2CIMA 4WK1A 1TKTB 4NYOA 1FRKA 1FXLA 1FD2A 2MMYA 1WD6A 4UOCA 2DPJA 4U95A 2FJDB 2IPOB 4A8KA 2MJNA 3HD1A 5HK4A 4MFBA 3MCMA 4WFNQ 3V6KA 2CKWA 3TJ8A 3CEDA 2JDJA 2OAUA 3C15B 2BRLA 3F56A 4TYAA 4J7CA 3FSXA 3TX8A 4CO3A 1U48A 1U8SA 2GHPA 3AAWB 3OLAA 3HHEA 2DNRA 2AQ4A 1HR0F 4OYIA 2UUAJ 5A8RA 3VGSA 1SI9A 1VK8A 2CPHA 2DTJA 1Q5VA 3CNQP 1OQ6A 4WJBA 4ZVRB 4Z7CA 2OEJA 3MM9A 4K59A 4PYAA 1VJWA 2YPZA 4ZPDA 5A6WA 2MLXA 3BGOP 1D09B 3NGSA 3O6QA 4J9UE 2GAGC 1LQ9A 2E29A 3E3XA 4HL9A 4IKAA 3BREA 2K7KA 5CD4A 3DYAB 1F9HA 1RT4B 2FZKB 1NHVA 3I5CA 3HFVA 3DM2A 2JC0A 3RAMA 3ZXWA 1RHUB 5G4DA 4MFBB 4PEOA 3A8KA 3WC2A 1BWEA 3C15A 4F4XA 2YWGA 1N5QA 2KTQA 4IYQA 2PSZA 2V6AA 4FPIA 3TVKA 2CDRB 1WOSA 2IVMA 5GAGU 5A8RB 1RADB 1DRZA 2V9WA 2R4FA 4XAKA 3GMGA 4LF9F 1MU2A 5F8NA 2HNDA 1FWPA 1XJWB 2GZOA 5B0CA 3HT0A 5MAOA 1VQ4S 2F5GA 2L9WA 2O1PA 2MKJA 5E3RA 3H40A 4GVLA 4LQ9A 3OVBA 2MZ1A 4DOZA 4GKJF 4ETZA 1RQ0A 2BM0A 3M6UA 1QUVA 1P1LA 2JLFA 1WSVA 3KJFB 3OTBA 4YP3A 2DR9A 1DAXA 4M5GA 4KV8A 5KFXA 3GE9A 4C8ZA 3JSBA 3ISNC 4HHUA
chains in the Genus database with same CATH topology
1IBLF 1HBUB 3IGVA 2R7XA 1Q82T 1J5EF 5LJ3Y 1YG0A 3CCUS 2IM3A 3HPOA 4IH7A 3PFOA 2G9OA 2PE8A 2XSJB 1IJEB 5D8HB 4ECRA 2MZQA 2MKCA 2IJNA 4X4SA 3UD3P 3DLGA 3TOQA 2R2UA 2XGQA 1VQ6S 4DR2F 4KV8B 4PKDB 3ULHA 2UVWA 2MSTA 1JLFB 2QFJA 3SMZA 1X4CA 5DDQC 5HL7Q 4JI2F 1AUDA 2NLWA 1IUJA 2HIQA 2F4VF 3MMBB 4DG1A 4D3GA 1KVJA 1V3SA 4AL6A 1DTQB 5IM0B 4HI2A 3M9OB 2UUCF 1MSWD 1XEZA 2E5IA 1KD1T 3C6TB 3ENQA 2FLPA 4F26A 1TV6B 4K4VA 4G1IA 3RR7A 3W7BA 3M32B 1Z2LA 1UW4A 4DFJA 1FD8A 2F3JA 4DUYF 1U1RA 4Y34A 5GAGI 3N6MA 2H5EA 1RDRA 3K8WA 2AW0A 1YJTA 2PMZD 1Y3KA 1YRTA 2O01C 1HWIA 1BLUA 2AV5A 4DG1B 4X65F 2XLKA 2MPUA 2CPJA 4R0JA 4Y6IA 4NCAA 1GNKA 3PXGa 2SXLA 3DDKA 1NH8A 3JAMY 5C25B 5IM0A 3SDEA 4MKYA 4NLGA 1D3WA 2ILYA 3PV8A 2GC8A 2VONA 1RJJA 3RYLA 3U1MA 2RT3A 3M32A 2DGOA 2EFNA 4U9RA 5DG8A 1WNEA 4QBUA 3BSCA 3TAMB 3M2RA 3MTKA 3SSRA 2RRAA 3C66A 1R43A 2DHGA 3EGNA 2KG1A 2ZH4A 2P5VA 1YI2S 1T7PA 3DLBA 1N5SA 2ZJPQ 3H2LA 1AW0A 3IA0A 3ZC4A 1R8BA 4HLBA 4ES2A 3DLHA 5HBMB 1FA0A 1SB6A 3SDEB 4RNOA 5IQQA 4ZVFA 2W8LA 5SZTA 4ERDA 1JKHA 1IBKF 2B6AA 3KFWX 3PM9A 3THTA 1RTHB 3MR3A 3NP5A 3MAHA 1JXEA 2MSSA 1KC8T 2JC1A 5GAHU 1FNXH 2J9DE 3M2RB 1VQKS 1GTHA 3JSRA 5B0DA 4FZVA 4QR0A 3PVXA 4OHXA 4DR1F 4HT5A 3P49B 3Q0AA 2IRYA 3TA0A 5DGBA 3I56S 4TKTA 5DGAA 3H5SA 2DNHA 2AD9A 4B9MA 1AXQA 4BHQA 2CQCA 2JVOA 1UJ6A 2RD5C 2XI2A 1M5HA 3RAXA 2E44A 4M5DB 1RTHA 2LDIA 5LSOA 3Q2TC 2YNIB 2E5GA 1R3NA 1H7XA 3BS9A 2IAJB 2OP5A 1EP4B 3NNAA 4ED7A 4ZA1A 1G2EA 2HHQA 3O5TB 4LFAF 2YWEA 5GAEI 1VMBA 3EX7B 4PPDA 2RU3A 3IG1A 3TVZA 2LA4A 5KG1A 3FRYA 2PT0A 1X4HA 1HNVA 2EFGA 4CO0A 5HMZA 4JV2A 1KVIA 3GIJA 2FC9A 3D2WA 1JLBB 4OI2A 3LW5C 1HI8A 2YNIA 1MWYA 3CULA 3GG0A 3L3CA 1SH3A 2J0QD 2RQ4A 4RW4B 2BVZA 1RTJA 2FVCA 3CXCR 1IM4A 1SQEA 2JVRA 4ECZA 4R5PB 2O3DA 3QLHA 1ZTWA 4LQ3A 4MTPA 3L95X 1TKZB 4P6QA 1JLBA 4K2XA 2O66A 4X4TA 2J9CA 1JLGA 4IG3A 4DSJA 4RW4A 4CNZA 3L09A 2MQLA 4URSA 4USIA 2CPYA 4Z2XA 1N33F 4K5SA 1SJ4P 4PCQA 1FESA 5AE2A 3FEYB 3LQVA 5J2QA 3QLHB 1REVB 1LWEB 2F8EX 3I55S 3RB3A 1PILA 3H4BA 1VC6A 1WF0A 3RZAA 1TKZA 4JI0F 2BZ2A 1EETB 3T1HF 2ADBA 1D0EA 4Q2MA 3O8WA 5KFZA 3OL6A 1JNRB 3FZBA 3DRPA 1RT3B 1XK8A 4IQXA 5B0BA 1TAQA 2AU0A 4ECYA 3N0VA 2DIUA 4YB5A 3KJVA 2ZJQQ 5LMUF 2C2EA 3K8VA 1T94A 3CGIA 5J2QB 2VG5A 3NGDA 3VQSA 3MPVA 2VL1A 4OI3A 2M0GB 2WSEC 4OX8A 4N5SA 3DRRA 1QSYA 2FHMA 1M0SA 5E0OA 1R27B 2XY6A 1C4CA 1UJ4A 3GFYA 2YKMA 3ICLA 2EWHA 2HRUA 5F0WA 1TL3B 4NLXA 5HLFB 3OTDA 1RTIB 1U2RA 5AE3A 3OR1A 4IH5A 2MKKA 4NA3A 1ZH5A 1LFWA 3IWNC 4K50A 3K59A 3CIZA 5LMNF 3MWBA 1Q8IA 4EUVA 3VAJA 4KO0A 3OVSA 2COLA 2GHVC 4WK3A 3KLGB 2ZM6F 1URNA 4H4MB 4F4YA 1TL3A 2QA4G 4K5RA 1APSA 3OJSA 5HLFA 2R7WA 2ZD1B 3KKFA 3NNCA 5F8IA 3PW0A 3UE2A 3OR1B 2MKSA 4YUDA 1N36F 3U1LA 2HS4A 1J5OA 1TL4A 1SC6A 1TK8A 3WC0A 1K0TA 4PWUA 2FVQA 4J5OA 2J0SD 2ZZNA 2DD8S 2PO4A 1LXJA 3PZPA 5B09A 2HHXA 4RUCA 3FGVA 5M2PA 4AFFA 3SZ2A 3HXMA 2QMWA 2VBXA 3OVAA 4RWXA 2JJ4D 2KXFA 4A8SA 1KTVA 2Y1IA 1N54B 1NH7A 4KHPF 4IR1A 4HKQA 2XY5A 2DB1A 3KLFA 2ZD1A 4PXBA 4DQIA 5M2UA 3MM7B 3KOAA 5KG5A 2PI5A 4YR2A 2MHNA 1J5OB 4PXDA 4J9LA 2XLJA 4KB7A 3HHNB 3QO9A 3IWLA 3MR6A 1IKXB 3MURP 4UUWA 4X4UA 3CSKA 3QGGA 4N8OA 2E9TA 4OLOA 2NUHA 1UKUA 3FDSA 1UMJA 2M5YA 3RR8A 3SFGA 2UVUA 3KLIA 2DH9A 4P2SA 3KLFB 3KK2B 1HBNA 1H38A 1XNRF 2CJBA 4LJMA 2VODA 2GGPA 4NLYA 3MMCB 5DDRC 3R1HA 4PUOA 3KHRA 3K0JA 2YNFA 3SV4A 5JJBA 1IKXA 3HHLD 3QJPA 2RQKA 3HVRA 2OPQA 1QVFR 2CPDA 2KT3A 3SCKE 1YRXA 1IKYB 2VFSA 1U26A 4PG8A 2CPEA 3OQ2A 3T9ZA 2D3ZA 3Q8RB 3Q22A 4I69A 3KLIB 4G3IA 2Q66A 3KK2A 1HWKA 3DC2A 2XMKA 3OLBA 1X0PA 4C11A 4QW9A 3MECB 4DL2A 5KG2A 3Q8PB 1M90T 4FF3A 3CCWA 4CT8A 4LFCF 5A2QY 3EXYA 3BR9A 1UETA 1S9EA 1Q78A 2Y0SD 1CEZA 1LOUA 1OPZA 1IKYA 1LWFA 2B5JA 2DR7A 4IQMA 3MPWA 3C8YA 4UQGA 2HZCA 3T3FA 4DDFA 1IKWA 1UP1A 1UWBA 2MJUA 3FZ2A 3CCLS 4C11B 1S72S 2JHEA 1LW2B 2FIUA 2Q6BA 2ZE2A 3LPYA 3NAIA 4IO9Q 4XPEA 4AQYF 1D8ZA 1S0NA 2E1CA 2WBRA 3PO4A 5HO4A 2LEPA 3MR5A 3QIDA 2BE2B 5LSLA 2HGLA 3GFZA 3JYTB 2IJFA 2LDYA 2VA3A 1LKZA 4L3NA 4DSLA 4HDHA 3PKMA 3PW5A 3GIIA 4JV0A 4OHYA 4QR1A 4W90B 2XWYA 4C3LA 1TAUA 3BN4A 3EZ5A 4NXNF 1T95A 1FVQA 5HMYA 2FHJD 1R6YA 2RF2A 1IKWB 3UQSA 1UAWA 4LF4F 2CG4A 2ZE2B 3R5BA 1S1TB 2QO3A 4QIGA 4V19X 2KYZA 3OPKA 3F44A 1MMNA 1X8DA 4DV0F 2CDQA 2BE2A 2DNZA 4B08A 1CQNA 2HHUA 2XBPA 2XCAA 3N79A 1YJWS 4F4WA 4BC9A 2MKHA 2IA0A 1R8CA 4ZLPA 2ZH6A 4QYRA 4QIEA 2OSRA 3DLEA 2ERRA 1JJHA 1CLFA 3EUNA 2V94A 4RW7B 1N32F 1RT1B 4ZPWR 3RU0A 5KFVA 1J2VA 3CJ4A 3CO9A 4RNNA 1S1TA 2IFXA 5A8WB 2QLWA 3OL7A 4KQZA 1BD6A 4Y2MA 2IVFB 4OZ0A 3CMES 4B3TF 1HBOB 2QT7A 4QYZJ 3IXQA 4QJVA 3IR6B 4C0BA 2Q6CA 2VD3A 4TYBA 3OHAA 4NLOA 5F3TA 1S76D 3MCSA 3J81Y 2PA3A 5J2NA 3DLEB 1JXLA 2GO9A 3PHEA 2RQCA 4J9MA 4ZPTR 5KAKA 4RBTA 2JLEA 1RKIA 2V0NA 3PIPQ 3BGFA 3I0RA 3HVTA 1RT1A 2MDAA 1RTDA 3HM9A 1TZ0A 2ZVSA 3BGUA 3PX6A 4C8MA 3UDLA 4DF8A 2BR0A 5FJ4A 1HWUA 5KT2A 1HBOA 1SJ3P 4GC6A 5KFYA 1JJ4A 4PG5A 2DRBA 4ELVA 5E3AA 1Z4UA 1M1KT 4A8XA 4EFAC 4RLEA 3ENVA 1S48A 1GX6A 2VQEF 2F8HA 4WYWA 3VAFA 1SL0A 2OJ3A 4DL6A 3E01B 5B7WA 3HK2A 3I6PA 4TU7A 1RTDB 1NJWA 3V81B 3ZZUA 4PQUB 4X4RA 3PW2A 2IA6A 1S6UA 2J76E 3K58A 1YIJS 4X4OA 4QU6A 1V6HA 1W2IA 4DQRA 1HNXF 4EZ9A 2B9XA 2VFRA 3Q23A 4E8UA 1QVGR 2CFXA 2WONA 4DL7A 2AWZA 5KFPA 4UUXA 2GQ2A 3VAGA 2L41A 3KHGA 2YX1A 3T6BA 1UEUA 2I1RA 2EFVA 3CC2S 3V81A 4PQUA 3LGNA 2ZOGA 4FS1A 1Q4RA 2XWXA 7FDRA 3BR8A 5KT7A 3LANA 1K73T 4RWWA 3K57A 3JSMA 2DGWA 2V8GA 2MZSA 2VZ9A 5JVGQ 2R8JA 2KHDA 3WX4A 1KOOA 4HVZA 2HYIB 4X4NA 4TXSA 5BJRA 1TL1A 1RAJA 4AE5A 5DLGA 5KG0A 1U45A 4WU2A 2RRBA 3G8TA 1QUPA 1NKEA 3NCQA 2LA6A 1OQ3A 4M63A 4NMLA 3KG1A 1H6KX 5CH7B 5U47A 3CDEA 3G6XA 2ZH2A 3DLGB 2AYMA 3HHLB 2Z8QA 2OD6A 2VFVA 3JSMB 1X5OA 2MXYA 1R0AA 1LFPA 4NX9A 4MKAA 1U1OA 3IBWA 3OSNA 2FJBB 2D41A 4UY85 4LSLA 1JLFA 4DV1F 2OTLS 2AX1A 2VG7A 1JNZB 1ZBTA 1SH2A 3THVA 1S49A 3D54A 1P6TA 3NKYA 4RU2A 2BQ3A 3U1NA 2LQJA 1HARA 2EK1A 3MMBA 3R27A 3BM7A 2EG2A 4G1PA 2ZHAA 1S99A 2HAIA 3PRBA 3V6DB 1SJQA 3D0HE 3UCUP 4CO2A 3HHLA 2D1CA 2U2FA 1YJNS 2V8HA 1Q8LA 3QWUA 1F9FA 3QZ8A 1S10A 1VQPS 3SCLE 3HMJG 2R2TA 5D4OA 3LP1A 1NK5A 1GX5A 3NMRA 4DEZA 4LSLB 4DFMA 2CQBA 1HNIB 3ZZZA 4O44B 1WEXA 4ZP7A 4DR3F 3I5AA 1NNDA 4ECTA 3EGWB 3KLVA 1DJ0A 2DNOA 1RA6A 3V6DA 2I5JB 4FYDA 4A4JA 1Y5IB 5T7LB 3CT9A 3ZZ0A 2DGXA 4C3MA 3TW0A 3M6WA 4WE1A 2A1BA 4CO5A 5C25A 2UVRA 2M9KA 1WI8A 2J7KA 3HHDA 4MKBA 2ZJRQ 1Q81T 1IQTA 1FKPB 2ROGA 3HLUA 3LP1B 1HWJA 4OV1A 1KSPA 1VGYA 2B3TB 2RE1A 2JWNA 4Q2LA 2IYGA 1HNIA 1YJVA 1JB0C 4ICLA 2UU9F 3TA2A 4J9KA 3BDEA 4YQWA 3GIMA 2CZ4A 2KJWA 1FK9B 2Z0GA 4LF6F 4ZPCA 5KT4A 2E5LF 3MMJA 4GKKF 2YX7A 1FRXA 1H7WA 4WE1B 4RKUC 1QAYA 2VQFF 4CI0B 1JKHB 3O1LA 4O3RA 2Q43A 2YKAA 3M8RA 1FKPA 3CF5Q 3VWSA 2X51A 2FVPA 3CD7A 3MD3A 4TY9A 1ZPWX 4ICLB 1VQMS 3M6VA 1HPZB 1IKVA 1FK9A 1YBAA 1X4FA 3KWMA 3GILA 2LU2A 1VQ7S 5E3PA 1SL2A 2AYGA 2RS2A 4X84A 3DN9A 3IR5B 2MQQA 3P3DA 1O8BA 3CDAA 4C0OC 1ZYQA 4M5DA 1P27B 3PKYA 2R7RA 2J8AA 2R8HA 3E51A 3C46A 3QGPA 1A7GE 2IAJA 1HWLA 1EP4A 2ALZA 5KFLA 2I8EA 3T1AA 4U67Q 2FHOB 2DITA 1VQ9S 3CWJA 3IG1B 4QWEA 3KYLA 1HPZA 2J6SA 3JTOA 2FJEB 2XS2A 3CCSS 2C2DA 2B4PA 1Z2ZA 4P7VA 4NCGB 1T05A 4C98A 1Q1KA 1HNVB 4B9SA 1HBMB 4Q8FA 3WDOA 4X62F 4K4TA 3C3LA 1D9AA 4WF9Q 5AXLA 4LF5F 4Y2IA 5ITHA 2CJQA 1X5TA 3NG8A 3K5OA 3P96A 4A8FA 2DRAA 4ECSA 2LKZA 2AYBA 2PFFB 1HMVB 2E7WA 4R5PA 3NGKA 1ROFA 3V6HA 5B0GA 3N9UC 4DBQA 5LXRA 1XERA 2GMJA 4LF7F 1F5AA 2ZDPA 1X9MA 1DQAA 1SIZA 4C8OA 4F8RA 4U7CA 3MXHP 2V2KA 1QSSA 3W2WB 1VRTA 3QWPA 3QAEA 1X5SA 2C3OA 2OLWA 3GFXA 3UW1A 4QWDA 2XB2D 1R8PA 5EX3A 5KG3A 4F3QA 5CYMB 2QYCA 2W7OA 2GMHA 3QPIA 2R7OA 2DNMA 3I4PA 4CZCA 3OTCA 4I0WA 3IN5A 2DHAA 1EETA 4OQJA 3OTOF 1FEEA 4J37A