1WTFA

Crystal structure of bacillus thermoproteolyticus ferredoxin variants containing unexpected [3fe-4s] cluster that is linked to coenzyme a at 1.6 a resolution
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
81
structure length
81
Chain Sequence
b'PKYTIVDKETCIACGACGAAAPDIYDYDEDGIAYVTLDDNQGIVEVPDILIDDMMDAFEGCPTDSIKVADEPFDGDPNKFE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ferredoxin
publication title Identification of variant molecules of Bacillus thermoproteolyticus ferredoxin: crystal structure reveals bound coenzyme A and an unexpected [3Fe-4S] cluster associated with a canonical [4Fe-4S] ligand motif
pubmed doi rcsb
source organism Bacillus thermoproteolyticus
molecule tags Electron transport
total genus 18
structure length 81
sequence length 81
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2004-11-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13370 Fer4_13 4Fe-4S single cluster domain of Ferredoxin I
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.20 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1wtfA00
1FXDA 2FDNA 1C4CA 5BYQA 3MM6A 1FRKA 4KT0C 4XDCA 3EGWB 1SIWB 1GT8A 3C8YA 1BQXA 1B0VA 1IQZA 1C4AA 1JB0C 1HFEL 3PNIA 2C3OA 3MM5B 2O01C 2WAQD 1H0HB 1H7XA 5L8RC 2GMHA 1FRXA 1FDNA 1BWEA 2Y0SD 2V4JA 2VPXB 3IR6B 2VKRA 4XDDA 2WSCC 2XSJA 2WB1D 3OR1A 2C3UA 1B0TA 1FRJA 1SJ1A 1DURA 5E7OB 1ROFA 3IR5B 1RGVA 5BYRA 1WTFA 1PC5A 1FXRA 7FDRA 4RKUC 2GMJA 1Y5NB 2ZVSA 2Z8QA 4YDDB 2VPYB 1Y5LB 1F5BA 1DAXA 2FD2A 1H7WA 3MMBA 1KEKA 3MM6B 1FRIA 1FTCA 5BYSA 2C42A 3MM8A 1FERA 1BD6A 1FRHA 7FD1A 3MMAA 3LW5C 4XK8C 1FDAA 1GTHA 3MM9A 1AXQA 2PDAA 1CLFA 3MM8B 1H98A 2V4JB 1D3WA 1A6LA 1G6BA 2C3MA 2C3YA 2VPWB 2VPZB 3GYXB 2XSJB 3IR7B 1FRMA 3MM7A 3OR2A 3OR1B 1K0TA 4ID8A 1BC6A 4OMFG 2C3PA 1XERA 1B0PA 1Y4ZB 1JNZB 3MM7B 1FD2A 2FJAB 2FJEB 3MMCA 5FD1A 1R27B 4DHVA 2IVFB 1IR0A 3MMBB 1FDDA 4OV1A 1F5CA 2UZAA 1FDBA 1JNRB 1Y5IB 3MM5A 4Y28C 2FGOA 3HKZD 5CH7B 4CI0B 1GTEA 3MMCB 6FDRA 2WSEC 2PMZD 1PC4A 4AYBD 3MMAB 1G3OA 1FEHA 1FF2A 1KQFB 1Q16B 3MM9B 6FD1A 2V2KA 1DFDA 3EUNA 4L6V3 1GAOA 1F2GA 2PA8D 1SIZA 1FRLA 3OR2B 1KQGB 1VJWA 2WSFC 3EXYA 5CHCB 1FCAA 2FJDB 1BLUA 2FJBB
chains in the Genus database with same CATH superfamily
3KUGA 1S7HA 3TUPA 1CJTA 2QA1A 3Q8YA 1JB0C 2CDRB 2I0XA 1I51B 1L3KA 4DR7F 3R7NB 4LSLB 2XCAA 2G2ZA 3CDWA 1M90T 4F4XA 2HVEA 4B17A 2LVWA 1QTMA 3RU0A 1FRJA 4KIAA 1DBDA 3HP6A 1KDNA 2MLYA 3M6UA 2MKKA 3QWUA 4OJ1A 4W90B 5MLCV 3V6DA 2F9JA 4WFBQ 5ETPA 3AA8A 3T19A 2PGCA 3RG6A 4PXBA 3AD8C 4DV3J 4ECUA 3CD0A 4XIUA 2V94A 4P7TA 1Y0HA 2YVSA 1WUUA 1E6YB 3FZBA 2IVYA 4OLOA 2K3IA 2FY8A 2HWTA 2GGPB 1RTDB 3VGVA 2WHOA 1FDBA 3N4WA 4DXLA 4RUHA 1OY6A 1WD6A 3H2UB 2YNFB 2L08A 3FNNA 4W92B 5LSLA 4HLBA 1Z1ZA 2JFDA 3CCRS 5KFWA 5I3UB 3CCQS 1S9EB 3N5FA 3DI6A 2E7VA 4KO0A 5IQQA 4X65J 2ASLA 4V19J 2MGZB 2YTCA 2WCXA 3CDAA 1IQZA 2BQ3A 4PXDA 2O01C 3FEZA 5BXIA 4USMA 4I7FB 3EZOA 2P9CA 4P2FA 2DGSA 1IM4A 1VQYA 1R43A 5CABA 5I3QA 1NPKA 2YWFA 4NLPA 4M5KA 2CPDA 2QL5B 2Z2MA 4NCGA 3DGPA 2J6TA 3KHLA 3GV7B 4K4TA 2K1RA 1U4BA 1EX8A 3I55S 4RW6B 3FBCA 2LLZA 4HTIA 4ERDA 1O51A 5B0GA 1L5UA 1N6QB 4Y28C 1SUQA 1NNDA 2Y1LB 1MN7A 2PE8A 3MPWA 3TW0A 3DRRA 3MD3A 4DL0C 1XN9A 3CW2C 2M8DB 2RU3A 1I94J 2FLPA 2CJAA 4CH1A 2MQ8A 2QYCA 5KFRA 4X4OA 4HI2A 3SV4A 3RR8A 3UN3A 2EC2A 1U1MA 1IVZA 2H5EA 2NXCA 2OFHX 2FQQB 4YS2A 1JXLA 4PG4A 4DR6F 5E2QA 2W9AA 1YSJA 2X3DA 4PXCA 4P72A 3GR0A 4RW7A 2FVSA 3OV7A 5KT3A 3AODA 3K59A 2CPEA 1WC6A 2H48B 2C3YA 3K89A 3M1VA 2AW0A 2R7XA 1R0AB 3R5AA 3KK1B 1RT7A 1FTRA 1LNQA 1JLEA 3MZIA 3MDFA 2E1AA 1TKZB 3G82A 1TFYA 3F44A 2YX7A 3K5OA 3TX8A 2PMZD 3TQ1A 4M5GA 3DXSX 1R0CB 2GIQA 3NMRA 2Q79A 1RHJB 3PW0A 3GFHA 1VBXA 1FKOB 1XNQJ 2ZOFA 1RT5A 4DN0A 5HP1A 1X9WA 4OYXA 1WC1A 2WOMB 1PJ6A 4PXEA 2BX6A 4JBCA 1P6TA 1D9AA 1FDNA 4CLZA 3AOBA 3THTA 2V5HG 3CJKB 1OPIA 2E5HA 4JI0F 2XZDB 3BPSP 4N41A 2FGCA 2MPUA 2LKZA 2RIJA 4I69A 1C0UB 4DV2F 1NJWA 4JI2F 2BJ8A 3UVJB 3I31A 2Z56B 3UNGC 3GJRB 1U0SA 2EK6A 3BEGB 4Y2AA 1LQ9A 1L3TA 1AT1B 4NA3A 4LR7A 3H25A 1MNEA 1ZPWX 4ECVA 3OW2R 3PX4A 2YQ3A 4O44A 3R8YA 4MFBA 3R2CJ 2QZ8A 3UD4P 2IVFB 1X4EA 1O5JA 2UXBF 2Y3YA 1SC1B 4B3SJ 6FDRA 3LGNA 1DTTA 2B4PA 1S6OA 4TLQA 4ZVTB 3GCXP 2NPFA 2AMCB 4YEAA 2K3KA 5FJ4A 2GHVC 1L3UA 1YZ6A 1RWKB 3V81B 5DO2A 3OL9A 2CWXA 2G9OA 4DV3F 1RLCL 3FK4A 1YDLA 3H5UA 4LVOP 3H2LA 4QIGA 3SCLE 4YOEA 1WKKA 2R7RA 4JI5J 2AYBA 5DG8A 4U95A 4WE1B 4DQIA 4ES2A 2KXNB 3HK2A 1UJ4A 3QRRA 3KLEB 1WF2A 1SKRA 3D1QA 2KYZA 3IP0A 3A3OB 5F0WA 2W9BA 4ZPCA 2MEWA 2ZBPA 3PRVA 1EETA 2EBEA 1HD0A 3ZZZA 3GFYA 4FKYA 4X65F 1HPZB 5DG9A 2DCLA 4LSZB 1XMQJ 2BVZA 4LSNA 5KT6A 3FFIB 2BJ9A 2LQ9A 4YB1P 3CJ3A 3D6TB 5DDRC 4OZ5A 3CJ5A 2XI2A 1CC8A 5CCLA 1HNVA 4H4KA 1BY9A 1NAQA 4R8UA 4EBCA 1HFEL 1S1UA 1H72C 2KXFA 3IWLA 3RRHA 1RTJA 1ITPA 3PY8A 3N28A 4Y2KA 2MKYA 4I6YA 4TU7A 3GIJA 4GO5X 2XO6A 4Z2XA 4ES3A 1REGX 1SL0A 1F3VA 4ZLJA 3OXFA 3M32A 3NXZA 4ZVHA 2DY1A 1KLMA 2VBXA 3I5BA 3PEJA 2B5JA 3DYAA 4P2XA 2KVQE 4TU9A 1RAOA 5GAGI 1JX4A 3L09A 1J5EJ 4RW8B 1X7VA 5ETMA 3EWGA 1NB2A 4JOUA 2CPIA 1S0MA 1G7CB 4PG5A 1FE0A 4NCBA 1W2BR 1KSPA 3DLBA 1JLFA 2DPIA 3H4DA 2DGXA 2H51B 1R0BG 4J7CA 2M5YA 2HVHA 4OZ2A 1OPZA 2DGVA 1GXLA 3OVAA 4ID5B 1SIWB 2Z2YB 1IQTA 4HACB 3CJTA 2GHPA 2ZKUA 3O3LA 5KT5A 2J7UA 4J9PA 2WK4A 4MK7A 2C3UA 3OUYA 4NX9A 4UQGA 1RT2A 4OYOA 3NAHA 2M0GB 7FDRA 4OHXA 1UVLA 1S9GA 5K14A 3AHPA 5HK4A 4DZ6A 1HIYA 2HAFA 2R7UA 2P5VA 2ZHAA 1V3ZA 3M8ZA 1BD6A 3CCTA 9ATCB 4LRAA 4X4NA 2POKA 1UVMA 3S1TA 2XS2A 2JX2A 1IJFB 2D3OR 3KDOA 3WC2A 1XNQF 2CG4A 1VQ5S 4X4RA 4PKDB 1FNXH 4WJBA 1U6ZA 4DF8A 2XLIA 2OD4A 1RHRB 2ZBIA 3EZ5A 4O4GB 1PYOB 3O8WA 3OTBA 4WZMA 2IJFA 3QRPA 4DX6A 4FP9A 3UW1A 5LMNJ 3RBZA 1VQSA 3BGFA 3OQ2A 1JK9B 3H5XA 1RYSA 2GO9A 3JTNA 3BGOP 5CXTA 4J91A 2V34A 1RP5A 1VHFA 3LUYA 3KTQA 4FYDA 4WXWA 3O44A 4Y65A 2BV3A 3J81j 4CQ1A 3JQMA 1U0HA 1R8CA 1RBOB 3DLKA 5HQ8A 4KKOA 3OTOJ 4B9VA 3PX6A 4TN2A 3HSDA 3RBEA 1J5OA 3OR1B 1HHQA 3KK3B 2LXUA 1B0PA 5KFVA 2HHHJ 4GO7X 2YKNA 1NUEA 3LPYA 1TKXB 4DV7J 2HFUA 4DOZA 4NEYA 2Y8YA 3QT5A 4K50A 2H3EB 3OPKA 1MSWD 3UDEA 2ZZTA 5KFKA 3QQCD 1HBMB 5CYQA 1HKAA 2R7VA 4JI5F 1B0VA 4I4BA 1SJQA 2A18A 2XMVA 4RUBA 1I5OB 2G1DA 1MLAA 4U8YA 4RW4A 5KOXA 2EK1A 2FZKB 4FPRA 1X4CA 3VGTA 5HL7Q 1QVGR 5KFGA 3P4UB 4V19X 4KR0B 3IGNA 1JLBA 2B9XA 3A8EA 4Q8EA 2MSTA 4ZCKA 3H90A 3C6TA 4V1Ak 1ZM4A 4LBIA 1XMQF 1PILA 3EICA 1QAXA 1NK9A 1IKWB 3GB0A 5E3AA 4OQJA 3NY0A 4CO0A 1MROB 5H1SV 1KWMA 3Q0AA 3SSQA 1DHMA 2XTJP 5EGYA 1RACB 3QT6A 4I6AA 3IMQJ 2Y1RI 4CI0B 1S6PB 5HVFA 4OHVA 4OFZA 4J9KA 5KFLA 4W4MA 2AGOA 3U1NA 4MIAA 1GAOA 2OSRA 1NCLA 2KRBA 2EFQA 1CJUB 5K8OA 4NXNJ 3EVWA 4I2PB 1R8HA 5JXSA 3NBPB 1WSVA 1H0HB 1FJCA 3C19A 3M8YA 2OPQB 1X4DA 4I0WA 1BWEA 2CZ9A 4ECZA 1IXKA 3ZZYA 2E7WA 1PBAA 2QA2A 1J5EF 3TA0A 4GRSA 1RKJA 2OPPA 1KNZA 1S1XB 3JSRA 3DDIA 3IN5A 3V4IA 2AX0A 3NLCA 3NWRA 4WKYA 3M6VA 4Q45A 4LF4J 3MAAA 4ZHRB 1U09A 3KLHB 2XSJB 3DRPB 3KG4A 2AV5A 4DL2A 1XR6A 3I32A 4DPWA 4I56A 3H5SA 1YTYA 2E9ZA 4OHWA 2I5JA 1X8DA 5A8WB 1Q16B 1HLWA 2LCWA 4UF4A 3NS6A 1Q0NA 1NPRA 2W7AA 4FPIA 3I0RA 3AD9C 1SKSA 2QSFA 5C42B 1UZHA 1VK8A 3TARA 2AJ0A 3BO4A 3H5YA 2AJ4A 1VJQA 4HDHA 3MCNA 1DRZA 4JV5J 1M1KT 4RBTA 3OL6A 3MPDA 1VYAA 2QT7A 3BBBA 4DL5A 2VG5B 3G86A 4WP9A 2V4QA 2OFGX 2NXNA 1H7WA 3RAMA 4QBUA 1O0PA 1HWLA 4PUOA 2CWKA 4J9LA 2BJDA 2YWWA 4NOHA 3ET6A 1DLOB 3QGPA 2FJAB 4HVZA 4ED2A 3LP0A 4L76A 4DSJA 3WX4A 2CJBA 1HI8A 3GG0A 1TMJA 5A0YB 2XS7A 2MY7A 1M5SA 4P10A 5LMNF 4B3TJ 1CS4A 5CD4A 1YX2A 4M5JA 4QYZK 1QAIA 2N7CA 3LOUA 2VHGA 3M7VA 4NZ6A 3W2WA 2JRSA 2J5AA 2ZITA 3CCSS 1FRKA 2DD8S 4ZIWA 2ASDA 3DLLQ 2KG1A 4R0EA 4IOBA 5AXLA 5LM7E 4IQXA 5GVQA 5KFPA 2WVBA 4A8WA 2BJ1A 3MEKA 1WEZA 1NDPA 1RT4A 1ACMB 2FPHX 1NK8A 2HHHF 4OZ3A 2FLNA 2CG8A 5J2NA 2E1RA 3IG1B 1JKHB 4DV7F 1AXQA 2MXYA 2V4JB 5JUMA 3WDOA 5D4OA 3IBCB 4KJIA 3MM7B 3MR5A 2FJEB 1QAYA 1ZPVA 1RT3B 4Y3CA 2RHSB 2OUGA 4I2QA 2V68A 2FVPA 4TYAA 3LWMA 3LP2A 1G3OA 4HDGA 1N5YB 1O6XA 4B08A 3BKTA 3J7Z5 3KJQB 2ATLA 1CVJA 1NJIT 5I42A 5E0OA 4LFBJ 4G3IA 4FVMA 3ZXWA 1T11A 1HQUA 1A7GE 4XDCA 5H9EK 3Q86A 1C1CA 2WAQD 4AL5A 2MLXA 2MZQA 1QE1B 1IJEB 5BYRA 1S49A 2C2DA 4NI2B 4NLVA 3VAJA 1UFKA 1Y5NB 4YR3A 4OYZA 4RUCA 3RB3A 2ZOGA 1M5PC 3OTEA 1F1BB 2AGQA 1WOPA 3AXKA 4PQUB 5AXKA 4ZPTR 2OSQA 3PV8A 4DLEA 3HSZA 1FXLA 3JQJA 3WHIA 2VASA 1MMLA 1S1TA 4OYAA 4NXNF 3T5KA 2WB4A 1VOMA 2LU2A 4C8OA 2CQBA 3C15B 4ITSA 2ZH3A 2Q43A 2VC0A 3VV2B 2MZSA 2QE5A 3KLIB 1TL3A 4KBIA 3CNQP 1A0OB 3RAQA 1K1SA 2H1YA 1S4FA 3QT7A 4YY3J 2FJDB 3V4MA 5G0RA 4C8MA 4H4OA 3M2VB 1RZMA 4HL9A 1GH8A 1N0UA 1RAJA 2PD1A 1IBMJ 1VQKS 1GMWA 2HWIA 4LF4F 2AGPA 2Y1JA 2WB1D 3GFZA 1RTHA 2KFNA 3P6YC 3ZZPA 2L41A 5D4PA 2NLWA 2GMJA 4RU9A 4DDFA 3CO9A 2GVDB 3PACA 2DHHA 2MQOA 2V67A 3UR3C 3MOJB 2IVMA 5ETKA 1ZAXA 4ZDNA 2WVCA 4DFPA 2ZZNA 4DR5J 2Q1LA 2ALYB 2IJNA 1BMQB 3QJJA 2KG0A 1HNXJ 1TMMA 3C6UA 3EGNA 3HVWA 5GAEU 2DH7A 4YHHJ 2QA4S 3MMBB 3QIPB 4F3OA 1VC0A 2XQCA 5AXMA 4ED8A 2IRXA 5M2RA 2I1RA 3T41A 5J2QA 4AT1B 2DXEA 1KQGB 3K17A 1X0PA 3VAGA 1VJWA 3VAKA 2D9OA 5B0CA 3MURP 1WEXA 4DPYA 5BYQA 5D4LA 1Y9OA 3CC2S 4EBDA 2L9WA 1H7XA 2MZ1A 4USVA 2RDDA 1GEHA 4ZIVA 4ED4A 1REVB 3K8VA 4DX5A 3M30B 4IFVB 2ABYA 4N56A 3O5TB 3QATA 2YQ1A 4P2MA 4LUBA 4KGXB 2ZHBA 1FERA 3CJSA 3W9JA 3AA9A 4B3TF 1TV6B 4FNHA 5A8RA 4DZDA 1BC6A 2QL7B 4Q43A 2IRYA 4DWIA 4RNFA 1N48A 1Q7YT 4TVAB 3Q22A 2XI3A 3DFEA 3CJRA 4C8YA 3ZZOA 2MKIA 1DTQA 4HT7A 5ITHA 1MWYA 1RA7A 2HQCA 3HX9A 4O23A 2KHCA 2DR5A 3HDSA 3GWCA 4CM0A 4F4YA 4FXWA 3KYLA 5KFBA 4KGMA 4UT4A 2ZVIA 1HBUB 5KFHA 3HHNB 3F0NA 5ETQA 4F25A 2OPSA 4F3MA 5J1EA 1C1BB 1X5TA 2P2CB 1P9QC 2CPZA 4R5PB 3DLGA 1XNRJ 3FRZA 5DZ6A 4JI3J 4IDKB 1Y3KA 2CYYA 4HHJA 3SZ2A 1SPBP 5C5JA 5K9FA 1UP1A 1K8AT 2KT2A 3B78A 3DCAA 4YB7A 1G1XA 3CD5A 4LFBF 4DG1B 3HVTB 3HZGA 3MMCA 3MPVA 4NMLA 3KDNA 3E01A 2DK2A 5JVGQ 3JYTA 4G1QB 1TL7B 2RSQA 4LREA 4Y0FA 4EZ9A 2DO0A 3LP1A 1U1RA 2OO4A 3KFWX 3TRGA 2YBVA 4OI2A 4HTJA 3J7A1 3JSYA 1CULA 1HNWF 2M8HA 1N33J 2FVQA 1NHVA 4U96A 2KFZA 1T95A 4XPEA 2DGWA 3MM6A 1BQNB 3W63A 3OLAA 4OL8A 3R9LA 1M1GA 3D0HE 3K2YA 3FZ2A 1YK9A 3S7RA 1FJ7A 5HMYA 3MGJA 4FYYB 3PHTA 2JZ5A 3JSMA 1SL1A 1LWXA 4C8ZA 2OPRB 2MZRA 1FTCA 5KFOA 5EUHA 4HYKA 1QLNA 2EKYA 4LF2A 3MECA 3ZTRA 1M0SA 4DL6A 2PN6A 1H98A 2PI4A 1NH7A 3Q2SC 4ZITA 2NSBA 2OELA 4CZCA 4YY3F 2XMKA 3LGMA 3KMQA 2Q66A 4O3OA 2MJUA 1JNZB 4ED7A 3V2UC 2GIRA 2R2SA 3F41A 2DNHA 4X84A 6AT1B 3FVYA 1WEYA 3RTVA 2J0SD 4GVBB 4H4KC 3FUYA 2H4WB 3IAM9 1ZZFA 3HCXA 1IBMF 2HQFA 4GKJJ 3J80Y 2E9TA 1Z2LA 4AL6A 3FCWA 1DQAA 3KHHA 3VAFA 3TZZA 2DO4A 2IAJB 5K8MA 1JWWA 5KG1A 3KMSA 1WHWA 4KV8A 4FKXA 2W9CA 5ETRA 4C3KA 2GFFA 3WIUA 3VCDA 2GZOA 4DR5F 3W8GA 1UWBB 4U7UD 1FWKA 5ETLA 1WDDA 4JI4J 3POTA 1HNXF 3SXLA 4RWWA 2QX0A 4K5SA 5IQ6A 5E5NA 1CJTB 1NO8A 4YHHF 4USTA 5E33A 5CQGA 4HH1A 3MM9A 1S48A 4NLWA 2YH0A 2FVCA 2OEJA 2RUSA 1H73A 2DGOA 4WZQA 1YGYA 1S59A 3SFUA 3V6DB 4A8OA 2A6OA 1Y10A 1HWUA 4Q2LA 2KYXA 1FVSA 1W2IA 1GX5A 4ES1A 5EX3A 3C14B 4RU2A 3OFGA 4DFKA 2WW8A 3KG0A 1EHWA 1XJWB 2RNEA 3ZTQA 5FLXY 4H4MA 4X4PA 5C7PA 3VVUA 2OP5A 1RTZA 1GMVA 1T0TV 4X4VA 2EG1A 2GMLA 1HWJA 2VKRA 3EMTA 1U02A 3W2VA 4N8NA 4EI2A 3G8SA 3HZEA 1U45A 1RXOB 1ZETA 3KKFA 4KO0B 4Y2IA 2AX1A 3UD5A 3UI3A 3H20A 1WKJA 4ZVRB 2BANA 3BQ0A 2V4RA 1SC6A 2CQIA 4ZPBA 4ANDA 3VWSA 1UCNA 1SC3B 3TJAA 3DNCA 5CA5A 4DCJB 4U9RA 1HARA 3IO1A 3LAKA 3FQLA 4Z7YA 4ZLPA 2AT1B 3MM5A 1J2VA 4LF5J 2LDIA 2FHKA 4NCGB 4JUZA 3M2RA 2K1RB 3TEHB 2XC9A 3VAIA 1UJ5A 2GVZA 1D8YA 1FJEB 1X4FA 5L46A 1X60A 3AB4B 2DNYA 1CQMA 4KGKA 4Q5VA 4WP8A 4RR5A 5F8JA 2FLLA 2V8HA 1XNRF 3AQOA 5KFNA 4JI3F 1T03A 1SUQB 1F9FA 3PKMA 3RAXA 4YN3B 3NGKA 4ECWA 2AYMA 4ECSA 3M8SA 4UOGA 2ZEJA 2VFTA 4CLPA 3R3TA 1ZA2B 2HQIA 4PYAA 3ZTSA 2FC8A 2ZDOA 5GAEI 4C97A 3HHLA 3SQOP 4X2BA 2M52A 2DY9A 2RHQB 3MPYA 4ILLA 1FKPA 1V6HA 2H54B 4K7QA 5ADZA 1N33F 1TFWA 2YWEA 3ILLA 2YNHB 1UEKA 4WK1A 2D74B 1MU2A 4RW7B 4USJC 2RDJA 2OTLS 4NLGA 3Q8PB 4UY85 1FFWB 1S57A 3CXCR 4QWAA 5D0GA 4K5RA 5B0DA 4YUDA 3VVTA 2NXJA 2YNIA 2XHCA 4LSLA 3HM9A 3OXGA 3G82B 3MR3A 3ONQA 1RHUB 2BQUA 1ICEB 3P5TL 3OFEA 2F9DA 3I87A 2MZTA 1RAAB 2RRNA 2AEFA 4QR0A 1YJTA 1Y5LB 1RT5B 4UZCA 5D0RA 4CLTA 3HXMA 4C48A 7FD1A 4RLEA 1LOUA 4RW9A 1D3WA 2C22A 4ATNA 3E3XA 4ECQA 3CC4S 2GGPA 2IMOA 4ZMMA 4ECTA 2C2KB 4BLGA 3GSDA 3GYNA 4BHQA 3SCKE 2ZZMA 4CIOA 1U1KA 1OQ6A 4USHA 3UDVA 1S9EA 1N5QA 4XPCA 1N5VA 1RA6A 2DIVA 1RAFB 2DPJA 2FJVA 3MEDA 4MMOA 3QT8A 2VFRA 4KE5A 3HJFA 1MN9A 2F4VJ 4JI4F 4MFBB 5A6PA 2R9LA 4F04B 4I7FA 2BM0A 4TY9A 3JTOA 2GAHC 3CE8A 3W9IA 2DHSA 2AJ1A 1S4EA 2DKOB 1SH3A 3A3PB 2HFNA 1BGXT 2C28A 3BM7A 4NLQA 3D66A 1SJ1A 4GVLA 2HWHA 5LJ3Y 1T94A 4FN5A 1A9NB 2YKPA 4J37A 4ZN3A 1P8GA 2KXHA 4F26A 4FF4A 4RW6A 3ZTOA 4BS2A 4B3RJ 2CA9A 3LALA 2NQPA 4OYIA 3N0VA 2Z57B 1IBLF 3QAEA 4IFYA 5CCMA 4LQ3A 4LRBA 1QVFR 5AE2A 3VGSA 1N6QA 4IKAA 2HSEB 1JLAA 1D0EA 3GR1A 4ZK7M 5AE3A 3JAMY 2FGOA 1WOOA 2CNOB 4F02A 4RL1A 3AB2B 4LRFA 4CNYA 1CBKA 2PA8D 1WACA 3V6HA 2B6AA 2E44A 1R8PA 1EETB 3PCOB 2ZKTA 5E3CA 3SDEB 3CD6S 3D1HA 4MKYA 1FWPA 3KLGB 1WKLA 2LA6A 2X1AA 4DEZA 4LSNB 3GJSB 2GMHA 1U8SA 4USKA 5E7OB 3S6EA 1QAJA 2HRUA 5J1PA 3IM8A 2JLFA 3FEYB 1FFGB 1NPPA 1HNVB 1BE4A 4R8UB 3RB6A 4LF5F 3GJQB 3VAMA 4OJHA 1NSQA 2V2ZA 1RTJB 4DUTA 2BOPA 1S77D 3M8PA 5B09A 1NSAA 3KK1A 2BJ3A 4N76A 1HI1A 1W7WA 4IOCQ 1XR5A 2ZH4A 2H5IB 2XNQA 2CQHA 1FDDA 2NYIA 3M32B 2OEKA 2VA3A 5CH7B 2C2ZB 2XMMA 2DRBA 3LPEA 4EBEA 2MQLA 1SXLA 3DYAB 2XCPA 4EUVA 2NUHA 1SIZA 2C2MB 1XBWA 2RS8A 2W01A 4X4QA 3ICLA 4Z7CA 2CJ9A 3CF5Q 3DRSA 5C24A 1JLFB 4A8QA 2PC6A 2ZC4A 4KFBA 5DM6Q 2HRYA 5MAOA 4QCLA 1RADB 2RDIA 2ZD1A 3A1YG 2DNQA 1VRTB 4OLPA 3MAQA 1AFJA 2GQCA 1RABB 4OYBA 1RAGB 3NCPA 1HYSA 3E2EA 2VFUA 2ZH5A 5E3RA 2CQGA 4ECYA 1R7IA 4ZCMA 2DJWA 1RCOB 3OUYB 2CADA 1RT2B 3WX8A 1UEUA 1ZOTA 1VQOS 3VR1A 2B9YA 4G1PA 1IR0A 3T5HA 3FGVA 2Q6BA 4ZVSB 1WELA 4P6QA 2CJKA 1LWFA 1SV5A 2QMXA 2ZDPA 3CJ4A 2MLZA 1ZYQA 2F3JA 2AHOB 4EU0A 4PPZA 3K5MA 1HBOA 2ZJPQ 3S8SA 3QGHA 1L3VA 1QDUB 3H0PA 3J80U 1HWIA 3JTPA 1WC3A 1YRUA 2KZMA 2HNDA 2LQ5A 3VGUA 2BE7D 2V63A 4LFAJ 2GJ2A 1VC5A 3THPA 3EDQB 5EDWA 5KFUA 3HFZB 2CUYA 4J9SA 5KFAA 2DT9A 1PIEA 3AFGA 2B9EA 4MT1A 3Q23A 3UN2A 1AB8A 1HBNA 3FC9A 1KOHA 2I8EA 2KVIA 1K0TA 4NLOA 3BJYA 1HWKA 1ZAVA 2FLOA 3K58A 3FFIA 2OKQA 2DRAA 2F4VF 3MD1A 3PJ9A 2EC0A 1U0HB 4DFMA 2NZ4A 2CQCA 3PVXA 2IHR1 4KKOB 4EEYA 1NSKL 2V2KA 1VQ4S 4PG8A 4KGZB 1Q8BA 2GC8A 1J5OB 1FCAA 2MY8A 3IFEA 3V5RA 1JLCB 1U7LA 2YKNB 2H5JB 4FBUA 3NOGA 5FDLB 3PRBA 3DC2A 4B3RF 2D3UA 2YXLA 3DKDA 1RDRA 2BR0A 2M70A 4ZN1A 5F8LA 5CYQB 1SC4B 1VDHA 2B51A 1SKUB 1RWXB 2P9EA 3ZFVA 2K7JA 4E2FB 3G9CA 3PRDA 1UEVA 4RW4B 2MHEA 3TQEA 5KT2A 4KB7A 1LXNA 1IKVB 1VC6A 2JHEA 3NWGA 3ZNJ1 5LOQA 3CUNA 4K4SA 4F2RA 2W2NP 1XIQA 2B43A 2XSFA 1PAEX 1CEZA 3C6TB 3BQ2A 1VQ6S 3FBFA 3R5BA 1U6BA 1RWWB 1WI8A 4DU7A 4ID5A 1V5VA 8RUCA 3T1AA 1R8BA 3PKYA 4Y6IA 3KUEA 3QMQA 4K2JA 2VBZA 3EDRB 2M2BA 1R3NA 1YZ7A 1U1QA 2UP1A 4J9RA 4CO3A 4GKKJ 2PI5A 3TZWA 3FSXA 2JDJA 1CJKB 4M5IA 4UUWA 2VPYB 1TELA 2EVZA 2DHGA 2IM0A 3HFVA 2CQDA 3LF0A 2DNMA 2R7WA 4DQRA 3ENWA 4KHPJ 2DXDA 3H59A 3MM8B 4DJBA 5D78A 5LJ5Y 2A0FB 2PEBA 4MK9A 1OO0B 1EKSA 3CDEA 2BMBA 2OPPB 2R7TA 1S99A 4A46A 2KL8A 3GJTB 1BUXA 2UXBJ 3G96A 3V4IB 3J7ZT 5DGAA 2RJZA 2YWKA 3QWPA 4JYAJ 5A8KA 1T7PA 3N6NA 1LW2A 3W5YA 1RHKB 5HBMA 1G4CA 4TY8A 4NLDA 2COLA 3AQPA 4IR9A 4OZLA 4OZ0A 4LF9J 5IWAJ 2I5JB 4M8LA 2RQKA 1X4GA 3IR6B 1H74A 3GV8B 4FXDA 1UKUA 2PFFB 4F36A 9RUBA 1LK7A 4RKUC 4ED0A 2ZVSA 2GV1A 2DNNA 5FIIA 2HBYB 2OIHA 4DSLA 1I3OB 4P73A 3OL8A 5EX0A 4IO9Q 1NU4A 2JOQA 4KPCA 1FK9A 4RBVA 3OTDA 3KNGA 4UOCA 5FD1A 2ACYA 4LVNP 1IN0A 4ELVA 4HEA9 2VDIA 3GFXA 3SI8A 1U49A 3AAWB 2QGFB 1KLNA 3VZHA 2L9NA 2M4MA 3K8WA 1GMWD 4NYOA 3QIDA 5EWEA 2MSSA 4LFAF 4IO1A 3ET6B 2J0WA 2FDNA 2QG9B 5D4NA 1ZH5A 2WZ1A 2KT5A 1S6UA 5L1LA 3LP0B 1D9FA 1DZ5A 1S79A 2BE9B 3IBWA 3CCZA 2HGLA 1FJGJ 1CS4B 5CYJA 3UQSA 2F1FA 3BN7A 4OYWA 3HULA 2UUTA 2GQQA 4JP8A 2I6WA 2XWYA 3ZTPA 4HHHA 5IV4A 4F0MA 3W2WB 3GP9A 3OVBA 4M95A 1IKWA 1Q8KA 1RYRA 1RAEB 1T9VA 4RX6A 4DUZJ 1TVRA 2V6AA 3IBFB 1FDAA 3JSBA 3W9HA 5IC6B 2IA6A 2VOOA 5IS2A 1PO6A 1X0FA 2R42A 3OXLA 2RU9A 2C2NA 4QPXA 4A47A 3BR8A 3R27A 4ZVOB 1LWCB 1WJ9A 2FIUA 4I67A 1F6TA 2RH3A 2YKOA 1CJUA 4RNOA 4MYUA 1NSPA 2CIMA 3CIMA 2KHDA 5D8HB 3WQPA 3JAMU 1S9FA 2VONA 2DISA 3MEEB 1RSCA 4ZCLA 2D69A 5KT7A 1FE4A 3NG8A 5AXNA 4DPXA 3LP2B 2JLEA 3TJ8A 1R8AA 2JSXA 4YP3A 1WF1A 3EJMA 4K4WA 3TX0A 3HT0A 2Z8QA 1QY7A 3MTKA 5DJBA 4DCOB 1HQUB 1QTNB 1CPZA 4U67Q 1CC7A 5L1JA 3AOCA 1UAWA 3BB5A 1C1CB 3V6JA 4M5HA 2GIFA 3MMAA 3IM9A 1XTZA 2XMTA 2H4YB 4AXIA 4ICLB 2KN4A 3PFOA 3BGRA 3CSKA 3MF5A 4DX8H 2E5LJ 4JI7J 3PZPA 4MTPA 5KFEA 1SH0A 3W3SA 2UZAA 1SL2A 2XEXA 2HVDA 4WFAQ 3ULHA 1E6VB 2BE2B 2XMJA 2BKNA 3MUTP 3LWLA 2UXCJ 4GKKF 3HPOA 2A3JA 2FJBB 1S1WA 3Q8RB 1FESA 1S1TB 3G8QA 2FB0A 3MAHA 2XB2D 1LW0B 2GHWA 5JVHQ 4WTYA 4MJKA 4CO2A 1U2FA 3SSSA 4ALZA 4KHPF 2HHQA 1NK7A 1FWLA 3CTRA 2ZBRA 3UFCX 3D6HB 1MMNA 5G0RB 3OVSA 1U1OA 4OX7A 3M8WA 3WZ0A 2M9KA 1CLFA 3CGIA 4JYAF 2H9ZA 3CMAS 2HQDA 3M9MB 2CQPA 2K8GA 4ID8A 2RF2A 2BEFA 4KY3A 2AJQA 1HNZJ 2QA4G 5A0YA 1JLGA 3R2DJ 1V3SA 2J7WA 4LF9F 5HROA 1VBZA 5IWAF 3E8OA 2N82B 3G6ES 1S1VA 1RU1A 2VH7A 1HQ2A 1KRPA 4NASA 2BW7A 4CLUA 1EIYB 1LXJA 1RWNB 1C4AA 4ETZA 2OMOA 3D1OA 1P1LA 5J2QB 3HHLC 3PEHA 1TKTB 3MCMA 4Z37A 2QLFB 2B3TB 3IR5B 3SEOA 2ZH9A 2U1AA 2F8HA 3HI9A 4YR2A 2JVRA 2B9WA 1KONA 3RUBL 4TNOA 1IKYB 4ZVEA 2YY3A 2KI2A 3GMGA 4FVCA 1RWPB 4ZP8A 4USIA 5H9FJ 3KNAA 3G8TA 4MKBA 3MM7A 4O4RA 4S0MA 2EEYA 4ANCA 2NSCA 4ZVGA 3FBEA 3NGDA 4TYBA 1NHKL 3CB4A 2LXFA 3QAUA 3CCES 5HSPA 3TEGA 1FJGF 4OJ3A 3KLFA 4M5DA 2XMUA 2D41A 4LBPA 2ZJRQ 3ENQA 1NDKA 1MWZA 3F56A 3GPAA 2V8DA 3TANA 2OH2A 2JVOA 4WTOB 3QZ7A 4OV6A 1IBKJ 2QRRA 4NLUA 1F5AA 1QE1A 3CCWA 4DUZF 2HG4A 1HR0J 5L38A 1DTQB 4LF6J 1M1HA 3NNAA 2KDOA 3DOMA 2NREA 2R7SA 3TAQA 1WI6A 1RE1B 5HLFA 2ROPA 2LQ8A 1CJVA 4NE9C 2WW4A 3GCWP 2XBPA 2F63A 5IV3A 2IMWP 4X66J 4BC9A 2OPSB 1RHMB 2KT3A 5J1EB 3R97A 4DUYJ 1JJ4A 2O1PA 3Q8UA 1BWVA 1NDCA 1T9YA 2ROEA 3R6LB 4ZVFA 3HO1A 2HW3A 1N34J 3ADAC 3DLGB 3KLIA 1Y5IB 5D15A 3KHRA 4FF1A 1TZ0A 3CMQA 4WKRA 1FKAF 2QJ3A 4NLTA 4AUKA 1M5KC 3MEGB 4R25A 4ZJOA 4K4YA 1YJUA 3OD2A 1ZTWA 2WSFC 2JEFA 4CO4A 1SJ4P 1K73T 3SIPB 2XULA 5T7LB 3E01B 4ECXA 1Q78A 4ZVUB 4X4SA 2P6SA 3BBCA 1ZS6A 5KT4A 2RS2A 1C0TA 3LP1B 1KD1T 3WIVA 1CULB 1WG4A 2RMLA 1TTHB 3MM6B 2E5LF 2B56A 5J2PB 4C9DA 4JI7F 5DDQC 3QZ8A 4NA1A 5U47A 2V50A 4Q44A 3ZO7A 2L48A 4EMDA 2IC3B 2ZOMA 2QO3A 1I6JA 5HJYA 4N8OA 2OTJS 4J9OA 2UXCF 3QIPA 1D8ZA 2BOAA 3JSMB 3C16A 2BKPA 2W24A 5L9NA 3BF4A 1CQNA 4FYXB 2QC3A 2CQ2A 3DGVA 3U02A 2CNNB 2B7BB 3EZUA 2J76E 1R6YA 4B9SA 3MECB 3MR6A 2QLBB 3RBXA 2BACA 2IDEA 4IYQA 1RI7A 4L6V3 1X9SA 2CKWA 4G65A 3TJ9A 4QIFA 1HQEA 3ILOA 3LGHA 1FXDA 3PO4A 2DIUA 3SCJE 3L7PA 2ZH6A 4AQYJ 4ZJLA 1VRUB 2HS0A 5LSOA 4DV1J 3L95X 1S76D 4KRWA 2HBQB 1REVA 4ZJQA 3T6JA 3M30A 3HHLD 2KTQA 1SQGA 3HSGA 1XC9A 4DMZA 2VG7B 2BDPA 2Y1IA 3D54A 5HANA 4DQSA 2MB0B 1HNZF 3MCSA 4O3SA 5EHHA 1YIJS 3H40A 4IR1A 2MMYA 4KV8B 5F3TA 1TV6A 1ELOA 4F7VA 1SQFA 2QYGA 2DTJA 4USWA 1Q1KA 3RZAA 1Q79A 2F65A 1A6LA 4LMZA 1QM9A 4LIWA 3I6PA 4CLWA 2UUAJ 1X5PA 4NL5A 2DR9A 3NGRA 4UY8T 2NYHA 1PYTA 1X4HA 4DL7A 1KR4A 3AJDA 3HHKA 4DQQA 2JWNA 3MM9B 1KQSR 1PSDA 2GX8A 5BR8J 3MTJA 1VBYA 2PEHA 1LKZA 4DSFA 4B3OA 4ED6A 5GADU 3L4BC 3PYDA 3UE2A 3QJLA 4N5SA 3Q83A 2LQBA 1VFJA 4ZLNA 4ZP6A 2UVUA 4NLSA 1C1BA 1RTIA 3BYRA 4CTAA 3A12A 4ZS6A 2YKMA 5L1IA 3N01A 1YVFA 4OYPA 3R1HA 1FFSB 4IDKA 1YJWS 1JMTA 1YITS 5LXYA 3NCRA 3QLHB 3O2IA 1F9EB 3EXCX 3NS5A 3P3DA 2OI2A 3BSNA 3VAHA 3HVTA 1AZSA 2VODA 1X31C 1SVDA 1S12A 1NZAA 1Z2ZA 2QSWA 3TZXA 1EJ7L 1TL7A 3SBMA 3GIKA 2MQPA 3AXMA 3NGSA 2QN6B 1NM2A 1IBKF 4DI6A 1UTAA 3I0SB 5KFTA 2BW2A 5AJ3J 4M5MA 3A4TA 1HR0F 5ETNA 2O5DA 1RWVB 4LF6F 3AJ1A 4DF4A 2ALZA 3BREA 5IT9Y 4QPTA 4TLRA 3MFIA 4EO6A 2OAUA 3MM5B 3US5A 4PR6A 4F50A 1AFIA 1PGZA 3R1LA 2AJFE 3M2RB 4J9VA 4LBHA 4X66F 3W60A 2KH9A 4OI3A 4DUYF 1XMBA 2E5IA 1VLYA 1Q7LB 1N34F 1AROP 3FSIA 2DBBA 5I3PA 3S01A 2AEMA 3IC1A 1RBLA 2LEBA 3M8QA 5KFJA 3DM2A 2FHJA 4GVBA 2E29A 2E5JA 3HHLB 4NLRA 1DQ9A 1VISA 4DR3J 2V8PA 3I9V9 4NZ7A 1Y00A 3CDBA 2NPIA 4DBQA 1FKPB 4F4KA 5KG3A 2KO1A 2WRMA 3OLBA 1KFSA 2PMWA 2CPXA 2W4CA 3DOKA 2CJYB 2YKQA 1NZ8A 1KP6A 3OBIA 2IPOB 4KPYA 1SKWA 1M5OC 2G0IA 1RT1B 5KG2A 1UPPA 2J6SA 4WPAA 3CD7A 1NJZA 2AQ4A 1MU2B 2CAJA 3D0IE 2MKCA 1HL6A 3JS9A 4LF8J 1DURA 2UUWA 1T3OA 4KYZA 1RT6A 3NNCA 2KRRA 1DAXA 2VU5A 2BJ7A 2YNIB 3BKFA 2K2PA 2VBWA 2GAGC 2Z0GA 2D3O1 1NDLA 2A2CA 3BSAA 3G2XA 2CQ4A 4PWWA 4C11A 4DCPB 1G6BA 2OJ3A 2F8MA 5K5MA 4K4XA 3PFEA 1ZM3A 3G87A 1N36J 1K44A 3UD3P 4OZ1A 4AQYF 3C66A 3QO9A 2OD6A 3IXQA 2W7OA 3B4DA 4DV1F 3RRKA 2QEXS 1Q82T 2R8GA 3C14A 4J90A 4C0OC 4RW9B 3MUMP 2XGQA 1Q5YA 4U7CA 1IBCB 1TK8A 4J5OA 3RW7A 4Q0BB 3R7BB 3BSOA 1RAIB 1JJHA 3DHXA 5DQIA 5A6WA 4EYIB 2HNZB 3ZNUA 4OHYA 3D6MB 1YQHA 2JNJA 3UR0A 1S6QA 1OY8A 2UUCJ 5D0EA 1B0TA 1V3RA 3MEDB 3ENAA 1PC5A 1RLDA 3PIOQ 4G6VB 3FMBA 2UUAF 1UZDA 3N79A 3I9ZA 1VQ9S 1GXTA 2AIRB 4XK8C 3TAMA 3PW4A 5HVHA 2VB6A 3OR2A 2MQMA 5GAHU 5BR8F 4PAAA 2WONB 2VQFJ 2R8IA 2DVIA 5DETA 1Q8IA 4OV1A 2YNGA 4DLGA 1TUVA 4A48A 3HKZD 3G6YA 3MR7A 3AOAA 4N7TA 2W2OP 3D3BJ 4OX8A 1FF2A 2HHUA 2MKHA 1VI7A 1KFDA 2DHXA 4IFYB 2HHSA 3T1HJ 4KC5A 4X62J 4C2MA 4ILRA 1HNWJ 1JLAB 5C25A 3M2UA 1FEEA 1Q4RA 1FO1A 1LWEA 1FRXA 4CYUA 5BJRA 1T8EA 3SQGA 5D3GA 1F0XA 2RD5C 2OHDA 1U1LA 1RGVA 2IRUA 2B6AB 3PJXA 2DNGA 4URQU 2F5GA 3H98A 4CH7A 2JH3A 3EYZA 4DR4J 3TVYA 1OY9A 1PYSB 4PCQA 1ZAWA 2LMIA 2QL9B 2LQJA 2DNRA 2PDAA 5AJ3F 4YMEA 3IWNC 4KHMA 1AUDA 2YNHA 4DPUA 2LFVA 2N7YA 2F4FA 2RUGA 1Y4ZB 2EKNA 2V2VA 4PWUA 1TUWA 5IM0B 2DGTA 3PW2A 5IOLA 4ELTA 3IRXB 1GTEA 3W65A 1YBAA 4CLLA 1RKIA 3MUVP 3GIRA 3M8PB 1F2GA 4QJVA 1WF0A 5AE1A 1AUSL 2RKIA 1NHUA 1PBUA 4ZOSA 4K0KJ 2J9DA 1WC4A 2WVDA 1GT8A 3PNIA 1XR7A 4C7QA 1VLOA 2W1BA 3QYYA 4ENOA 2EBGA 3NP5A 3LH2S 2V2QA 3W64A 2ZFHA 1R31A 4LFCJ 3PM9A 3TUJC 3DRSB 3EX7B 2CNKB 4RWXA 2ZE2B 5C24B 2PSZA 4KFBB 4O3PA 3ZZUA 2C3MA 1ZM2A 4DR3F 1YRXA 5EWGA 2XYGB 3OL7A 3KJVA 2ZD1B 2HIYA 1NRKA 1FA0A 1C2PA 1BQMA 2OGUA 1JIHA 1VQNS 5GADI 4FZVA 1Q5VA 4ED1A 1HYSB 3GONA 5HO4A 2GNKA 1I1GA 2ASYA 3SV3A 2B8PA 3TAPA 2HFOA 1IWGA 3MOZA 2BKOA 4KSEB 4LF8F 4RPFA 2AZ3A 2QLWA 2XHWA 3Q8VA 1C4CA 1N4LA 4C3LA 1FT8A 2HMIA 4IG3B 4FYVB 3CCUS 5DS7A 1EP4B 1UETA 2V0NA 2JFKA 1LWFB 1UPMB 1SV5B 5KG7A 2JEIA 2ERRA 2Z4PA 1RAHB 5J2MA 2HHPA 5CAAA 3I56S 4Y34A 1TU0B 4K2XA 3M9NB 1N36F 1HD1A 2HLUA 1HBOB 4WYLA 1VR6A 5BYSA 3BBFA 1V9OA 2MHNA 3W7BA 1IUJA 4A8MP 4EK2A 1CG2A 2HNDB 1FNMA 1HNIA 5M2PA 1H3DA 2HKEA 5K8PA 3ELHA 3PXGa 1F5CA 2YH1A 1YLXA 2J8SA 3GYGA 3HJVA 1OWXA 1NK6A 1HBNB 3SDEA 3UNYA 1URRA 1WC5A 4ZLLA 2UUCF 2MKJA 1GK8A 5DDOC 3KLGA 2A10A 1T05B 4IG0A 4W98A 2J7KA 2YPZA 4FDFA 2J9CA 1TL1A 1N54B 3TVZA 4J9NA 2IY5B 3BDPA 3SCIE 3QFHA 2JLGA 4A8KA 4NMXA 3OSPA 4JI8J 4USUA 5HMXA 3HMJG 2VQFF 2OLWA 4CO5A 4F4WA 1TL4A 2GCFA 1WDTA 2KJVA 4OI6A 1JXEA 1GTHA 1QSYA 2IA0A 1YBUA 2OMLA 2ZBQA 4OI1A 3RBDA 4I68A 4EZ6A 2JC0A 5F9NA 5KFSA 4CRJA 3DOLA 3T1HF 4IQMA 4X62F 5DM7Q 2UU9J 2HNYA 3BYPA 3H8YA 3PJWA 2W4PA 3DLEA 4NCAA 1U8WA 1VGYA 2MQNA 1SBRA 1FRLA 3R5JB 3IS9A 1I94F 3UDCA 2Y0BB 4KGVB 1UFLA 5D0HA 2X51A 4N77A 2CFXA 1M5HA 1U47A 4IH5A 4RNHA 1FI4A 4OIXA 3Q2TC 4DR4F 4AD6A 3E51A 2J6UA 1P9YA 2E66A 2PA3A 1VRTA 4D3GA 4Q2MA 1K9MT 2CPHA 3QBCA 5IT9U 1JLQA 2D7SA 2IBOA 3TZYA 3QGIA 3ITHA 3T3FA 2GA7A 2G4BA 4PQAA 4ELUA 4CWBA 2VD3A 1ZTTA 4NWBA 2VG6A 1UFWA 4WK3A 2PIIA 2B4UA 2R2TA 4WU3A 1YRTA 3HVRA 4WF9Q 4K0KF 4JB8B 4DV4J 4OI4A 3QJPA 4PRFA 2FZGB 4CT8A 5KFFA 3KK2A 4C4WA 2NR0A 2FZCB 2HHVA 3W1YC 1NXIA 5KOWA 1WHYA 3GTYX 3A13A 2DXFA 3T5LA 3P96A 2FTRA 3OHAA 5A2QY 2NXUA 2G1HA 1UA1A 3PX0A 4EO8A 3JXOA 5ETTA 5L9XA 4LFCF 2EFPA 2C3OA 1MG7A 2ASJA 2HZVA 3I4HX 2ADBA 2VPXB 1WG1A 5A8KB 3HD2A 4XDDA 4URGA 1LW2B 2XZWA 5HBMB 4B9MA 2DR6A 3EGZA 3DN9A 4TY8B 2QMUB 5D77A 5GAHI 3TYTA 3TO8A 2E1MC 2Z30B 3LANA 3B54A 3VTIA 2R8JA 4O3QA 4OZNA 2HFZA 3CC7S 5CYMA 1RQ0A 5ETVA 2RRAA 4HHUA 4TXSA 1TAQA 1WHXA 2HVZA 5DLGA 1Q81T 3MMJA 4B3MJ 5L1KA 3M6WA 2LYVA 1IBLJ 1NEEA 3ZZRA 2Z2LA 4DS5A 1Q8LA 1VMBA 1N0VC 4B3SF 3NAIA 3T9ZA 3MHYA 4PZVA 3DMJA 1IKXA 4OZJA 3RW6A 4Y2CA 5B0AA 1HMVA 1JLCA 1RWMB 2LA4A 2LEAA 3CEDA 5C2GA 5FDLA 1LV5A 3DI6B 1FK9B 2OEMA 2WTFA 4L75A 3OJUA 3TWZA 2AEJA 4BWJA 4J9MA 2DITA 2XY7A 1K1QA 4CDIA 3M9OB 4L73A 2R8HA 5KG0A 3NRBA 3QPIA 2E5GA 2E9RX 2W8LA 4P7VA 2M3DA 4QR2A 2NZCA 4J9UE 1IKVA 4PABA 1VQPS 3DGPB 2HAIA 1B99A 3PR4A 1N5SA 3TOQA 5SZTA 3Q24A 4DSKA 3EGVA 1N52B 5KFIA 3DHWC 5E3PA 1U25A 3W5ZA 4ZVQB 3H2VE 1TVRB 1AW0A 1OSCA 1N32J 1NKCA 3W66A 4OYMA 5ETSA 4WCEQ 1G2EA 2HHTA 3IGVA 3LA0A 3U1MA 3DRRB 3PYEA 4NXMJ 3A8KA 1BLUA 4JI8F 3NGTA 4NLXA 1KVKA 2IJRA 3BN4A 4QYRA 3RB4A 3CJ2A 2ZH8A 2ZH1A 2VC1A 3D9BA 1CJKA 3L7UA 2HFSA 2Y9HA 2EFOA 2XMAA 2C2OB 2DEJA 2BM1A 2WBMA 2F8EX 2QIFA 5IXUA 3K5PA 1FRIA 2UU9F 4A8SA 3MM8A 3NOCA 1YJ7A 3C2PA 1JQGA 2CQ1A 3M6XA 3G4SS 3ZZTA 4AFFA 2JL9A 1NK0A 4PWDA 4M1KA 4BWMA 3GYXB 2HLTA 1MMDA 4NPOA 3M1VB 3MCOA 3CCMS 4UOHA 1T9WA 1RT7B 1JLEB 2WSEC 3J81Y 1TK0A 4DL3A 3MMAB 3CCVS 1FEHA 3C46A 2FC9A 4K8RA 3DDNA 3GZ7A 2HK2A 1FD8A 3D28A 4O3NA 2V69A 2WBRA 4PEOA 2E1CA 3BGRB 1IWAA 5F8GA 2MKSA 1N88A 2R7OA 4QWCA 3ISNC 2J9DE 3B4MA 3EGWB 3ILIA 2R8KA 3FCVA 3HF5A 2DNPA 3D2WA 5F3ZA 3CMES 2W2QP 2Z58B 1T9TA 4DX7A 4ER8A 5HP1B 5HMWA 3PW5A 2G13A 3P5BP 2FHMA 2XM3A 1E6YA 1XWLA 4ECRA 2FUG9 2O3DA 4QR1A 1NKBA 2CZ4A 2NXEA 5F8NA 5HQLA 1S1WB 3D4JA 3ENVA 1RTDA 4U6PA 5KG4A 1OYEA 1SQEA 4DV4F 2YNFA 1PCAA 3AT1B 3B8HA 4QIVA 1VCTA 3L7OA 3N6MA 4KHRA 3KWMA 5I3UA 2M7SA 2ZNYA 4M5NA 1HW8A 2DH8A 2Q6CA 1P1TA 2HGNA 2MGZA 1CSJA 3VZIA 3TVKA 3MI7X 4Y00A 2YPYA 1Q86T 2RT3A 4O44B 2YX4A 2XYPB 1QSLA 1S0OA 4B9NA 4NA2A 2EFVA 2G2YA 2ZC3A 4RO0A 2XLKA 3JB9k 1DTTB 2PFDA 2RF2B 3R6GB 5F9LA 1Y3JA 4QWDA 2MQQA 3NNHA 2R3VA 1JLGB 4A8YA 3BQ1A 3DRYA 3QGGA 2BA9A 2X7IA 3UCZP 5HROB 3NS7B 1S1VB 4B3MF 2VJVA 2EXUA 2VIHA 1DARA 1D1UA 2JC1A 2HHXA 5B0BA 4K59A 2H65B 1OYDA 2FD2A 2QFIA 4M5LA 3EVOA 2ZH2A 4CLYA 3OTOF 2ZWPA 1GXUA 4A8FA 4I1TA 4IH7A 5GMKa 3BO2A 1U2CA 3J7YU 4CM2A 4WP3A 4JI6J 1LWCA 5T41A 2JEGA 2W9BB 1YJNS 4DR1J 2B0GA 4ZA1A 4BDPA 1TQLA 1URNA 4WFNQ 2PMHA 2NCKL 1N56A 3SMZA 2G0CA 1YJRA 1VRQC 4PYDA 4ANEA 4DV6J 1TK5A 3MEEA 3O1LA 1S10A 3NMAA 1S1UB 3KLFB 4M5DB 1R0AA 2DB1A 2VV5A 2W7PA 2BRLA 5M2UA 2A1BA 2LXIA 1TKZA 3GSIA 2VFVA 4O3RA 3TP2A 3D7SB 5ETOA 4FS2A 3THVA 2IIHA 4ICLA 5LL6d 2KFYA 5DGBA 1MW7A 3GV5B 1KHVA 4ZP7A 1YHQS 1N32F 4HT5A 4DV0J 2UVWA 2DNLA 1GMUA 1KLMB 1S5ZA 5KFZA 5G4DA 4YB6A 4TKTA 2J9EA 1EARA 2B5JB 2QMWA 4L74A 1FKOA 3DOMB 4IRDA 4NXMF 2HHWA 3ETMA 1FD2A 2QLJB 1SJFA 5HLFB 2QTWA 2VF3A 1AA1B 1NK4A 2WOMA 1CJVB 1JNRB 1E6VA 2BE2A 3PDNA 4C0HA 3KJFB 2CVIA 3CJKA 1TUGB 5DLFA 3LAMA 4A8XA 2CRLA 4RBUA 1LW0A 1RJJA 4LF7J 5CHCB 4DPTA 3I96A 2B8QA 1C0UA 3ISND 2A6MA 3UVJA 3P8BB 2I38A 4CP5A 1WG5A 2BYCA 2HQ3A 1NJYA 5EWFA 2RILA 1D9DA 4A4JA 3VQSA 3GIIA 3PG9A 4JV0A 2BQRA 4OHZA 3G6VA 2XYHB 1RWUA 1RISA 2DNZA 2CZVC 2CQ0A 2UVRA 3D68A 1S9GB 5K14B 1TAUA 2XZTB 3IWXA 5RUBA 1PJ7A 1Q53A 3FEXB 1C0TB 1X5SA 5T14A 3IAS9 4K4ZA 2XO7A 2XG8A 3R5DA 1X5OA 3OTCA 1T9UA 3V81A 1S0NA 5LMUJ 1RCXB 2DGQA 4OI0A 1VK3A 3FBBA 5SUHA 2VJUA 2W25A 3ILJA 3D6FB 2NS1B 2G0JA 3C16B 2KJWA 4YB5A 4MH8A 4IRKA 4WE1A 1MWQA 4QYZJ 2YWGA 4JV5F 4QW9A 3BR9A 4B02A 5L8RC 4G1IA 2SXLA 3KLEA 4DSEA 1TKTA 4C0BA 1B70B 3B82A 4XO0A 5KAKA 3IRWP 1OQ3A 5KG5A 5A2QU 4FBTA 3OHBA 4WU2A 3CJ8A 2IM1A 2X1BA 2RE1A 1WNEA 1HQEB 4YDXA 1HPZA 1XMOJ 1IKYA 2ATCB 1KS2A 2XLJA 2B4VA 2FHJD 2LECA 1WHVA 4CLSA 4B9UA 3DLKB 3QSYB 2AU0A 3EPIA 5B08A 2ZM6J 2VPZB 5DG7A 1T3NA 4BCAA 1ULRA 4NLYA 3EPGA 1Q95G 4B9TA 1EQMA 5B0FA 3N6LA 5DDPC 1QUVA 5CZVA 2HS3A 4RZRA 2MYFA 3GG1A 1UW4A 2LEPA 3EUNA 4LRDA 2B4OA 4ED3A 1IR2A 4QIEA 3W5XA 1WOSA 3DRXA 3HKWA 2MJNA 2P8IA 5FLXU 5JJBA 5CD4H 2CJXB 1F2HA 2HRTA 1OJ4A 2HBZB 2P9GA 3X1LB 3Q8SB 4UOFA 1XQIA 4RW8A 2ZJQQ 2C2EA 1ROFA 3M05A 5KG6A 3CPWR 2FHOB 4JI6F 5H9EJ 3CCJS 1FX2A 1PAUB 4B3OB 1SH2A 4QWEA 2MDAA 1FX4A 4DR1F 1JLBB 3FSYA 1NB7A 1S0VA 3HLUA 2UV8A 2RRBA 2MTLA 2HS4A 2ZWOA 2APOA 4DV6F 1DJ0A 1QJHA 1RTIB 3P45B 4HI1A 2XY5A 4CTAB 2CPJA 1YKWA 2DH9A 2YKMB 4GC7A 5F8HA 2DEIA 2ZUAA 5IT4A 4HACA 4AL7A 2L9DA 3OT9A 3FRYA 4O0NA 2AJ2A 3MEGA 2BBEA 2LDYA 4AXJA 3BSCA 3TR5A 4F3QA 4QIWD 2IBKA 1ZBTA 3NCQA 5K20B 1RWOB 2XGPA 1XK8A 2EPIA 1AZSB 3B6BA 5T7LA 4HKQA 4UZBA 3C8YA 4OX6A 3BZQA 2HIQA 5DRKA 1Z4UA 2VICA 1UVIA 2AP6A 3W61A 2F40A 5KFXA 3JQKA 1B64A 2WSCC 4DV0F 3T1YJ 2KKHA 3CCLS 1S7IA 5J2PA 1KOOA 2CVEA 3PO5A 4QZVB 2V9WA 3P49B 2EG2A 2PO4A 2IC3A 1RU2A 1O8BA 3LW5C 4H54A 2HPUA 3ZC4A 4ZCIA 3H4BA 4YR0A 3I82A 2BZ2A 4O4GA 2ILZA 3PR5B 3HHEA 1H2VZ 3MAAB 4DN9A 4LF7F 4F4ZA 3WC0A 5KTQA 3DU6A 1L3SA 1H38A 2HBRB 5KFQA 1PKUA 1Y7PA 1TL5A 3BPDA 4P9SA 4KAIA 3CVKA 1YBTA 4F0KA 1HHSA 2GJIA 3GILA 3HHDA 3M8QB 3GU0A 1VRUA 1F9HA 3Q8QB 4MKAA 1TR0A 1QUPA 1VQLS 3DM2B 2AKWB 1ZZNA 4EYHB 3J81U 3I0RB 2R4FA 5A76A 5B7WA 2HFVA 1K0VA 2IYGA 4WFXA 2VG7A 1UW9A 2HGMA 2X1FA 3OR1A 3KK3A 1RBAA 1W26A 2FJXA 1V5IB 5CZXA 3BGUA 4M63A 3J7YI 3DU5A 5I4MA 1KEKA 3DOKB 4UTGA 1NBEB 4RJVA 2DR8A 2C42A 1TKXA 3AD7C 8ATCB 1LEOA 5LMUF 1PJ5A 4PUOB 4LJMA 4ED5A 2C2RA 5F0UA 1FVQA 3LO3A 1HBMA 3U1LA 2EFGA 1KVIA 1LFWA 1RT6B 3DLHA 4MK8A 4ZKAA 3NL0A 1NKEA 2WVFA 1KHWA 3QNWB 3BH6B 4C11B 1GNKA 2R2RA 4P71A 1BXNA 2R7QA 5DZ7A 4L72B 5D6GA 5IFMA 3QSIA 1FHTA 3UPFA 4KT0C 4ZPVR 1XMOF 2AD9A 4B9LA 3PW7A 1U2RA 2W2MP 3QO9B 3FQKA 2KM8C 3KXDA 4LT6A 1VS3A 1MROA 5F8MA 5LXRA 4K4VA 3M8RA 5LT5A 1VIOA 2XWXA 3WBZA 2ZM6F 5H9FK 3AH6A 1VQ8S 4TQRA 3K5LA 4OJGA 3QLHA 2GO8A 3V6KA 1RT4B 3BKUA 1KBRA 3NGUA 1B7YB 2RB7A 1S6PA 1NK5A 3KUHA 2N4CA 1S6QB 2VOPA 5J2NB 4CLFA 4HR2A 3DDKA 4C8LA 2U2FA 2ZBCA 3BV8A 3TUIC 4URSA 4PPDA 4I2PA 2L3MA 3NBPA 3I0SA 4MAKA 1IR1A 3U7JA 4WWSA 4R0JA 3BO3A 2OPQA 1Y11A 4P52A 4DR2J 2HVIA 4NZ0A 4LIRA 2WVEA 4I2QB 3TAMB 4X64J 3ETOA 1DY3A 1WWHA 2LU1A 1OIAA 3CDUA 3OR2B 4X4UA 5HMZA 3CULA 3EXYA 3AY0A 2ADCA 3U27A 3EM1A 5I42B 3TNVA 1S1XA 2YNGB 2FYXA 4CCHA 4QU7A 4ZPWR 2Y0SD 4K4UA 4ZHRA 5KFYA 3KLHA 2CXEA 2XSJA 3DRPA 4CLKA 4M94A 3OJSA 1EAYC 3KOAA 1TKDA 3GE9A 3MWBA 1SJ3P 2RQCA 3KG1A 5C25B 3F73A 3M2UB 3MPUB 2CDQA 2GJFA 4YQWA 1VQMS 5A8WA 2YWHA 1KTQA 1LWEB 1H2TZ 2XY6A 3FMWA 4CYUB 4UQTA 2HK3A 4WYWA 3SQGB 7AT1B 4P74A 5D3GB 3VALA 4JI1J 3BS9A 4MIBA 2AYEA 5KFDA 5KFMA 2DRDA 4FF2A 3VHQA 4E0DA 5C42A 4NYPA 2W2PP 3T6BA 2QV6A 4CH0S 3UN5A 2ZH7A 5IT0A 2RVJA 2YKAA 2EFNA 4WIQA 4PG7A 1X4AA 2W4DA 4FXVA 1JJCB 1EKRA 1KN6A 1TL3B 3T1YF 4N47A 2GQ2A 2VG5A 4JV1A 3FKBA 4IOAQ 3I5AA 4CO1A 1RT1A 3RJMB 3D0GE 4BC7A 3N5BA 4FS1A 3UCGA 2ZNZA 2VL1A 4C6AA 1UVKA 2E1PA 4H4OB 3HFKA 4C8NA 1YI2S 1DLOA 5C2CA 3VF0B 2ILYA 4AE5A 5HATA 2AWZA 2RKIB 2AF6A 1RTHB 2IM3A 1W25A 2J0XA 2FVRA 4EGLA 2FY1A 2M88A 1OSDA 2RAQA 1U1PA 4DSIA 2EWHA 2DNKA 2DCUB 2I2YA 1D09B 4KH1B 4OMFG 1PG5B 2VQEJ 2DNOA 2EI5A 3IA0A 2XNRA 4KTQA 3C6UB 1M5VC 4MKVA 4DV5J 1N5TA 2J0QD 4GKJF 1UL3A 1YG0A 4Q0BA 3SYZA 2KZZA 4PG6A 4MIWA 4DL4A 2HNZA 5B0EA 3KJVB 3HD1A 4IH6A 3FJ2A 2O67A 4FNIA 1BQMB 4TU8A 1RB0A 2K7KA 2Z2ZA 4OX9J 3W62A 3GIMA 3HVAA 3IG1A 1JKHA 2GS8A 1T9XA 2V4JA 4DPOA 3K7RA 1UJ6A 2F7VA 4HH0A 3DLJA 4QOTA 3OFFA 2IYIA 3HSJA 1OMSA 4YDDB 4KQZA 1RT3A 2NUUG 3J7AN 2HMIB 2YQ0A 2R2UA 1UWAA 1N5YA 1AYEA 1B3TA 3R5CA 2ZHOA 4LRCA 1HA1A 2WONA 5KFCA 1KTVA 2VZ9A 5J2MB 3RB0A 1B4SA 4C98A 5A8RB 4L3NA 1GFWB 4F0HA 1N8RT 4DHVA 5LSRA 1JJ2R 2O66A 3MXHP 2UXDJ 5EN1A 1SJRA 3TA1A 4NYZA 4UUXA 1KC8T 5K8NA 4QU6A 4CNZA 3PYFA 4NI2A 2V8GA 3TUZC 3BDEA 1HNIB 3BGLA 2PT0A 3OFHA 2DYAA 4GC6A 2ROGA 2YX1A 5DQGA 1BQXA 5F8IA 3G6XA 1TP7A 1BHNA 2B7CB 4PQUA 1R89A 2GW8A 1GX6A 2N4DA 1ZA1B 3A8IA 5HJXA 1FXRA 4IG0B 2Y8WA 4I64A 2IDLA 1NH8A 3C15A 1U6FA 2IM2A 2ZUGA 1HW9A 2HZAA 1TL1B 4YFUA 5F41A 8AT1B 1U1NA 4P75A 1J27A 4U8VA 4DR2F 3CJQA 1WC0A 4X64F 5IM0A 4WXOA 2D1CA 2BUNA 1XERA 3L3CA 3IRXA 4QWBA 3M2VA 2HEKA 4DQPA 1S72S 3H42A 4UW2A 2X3GA 3MMCB 4C3MA 1ZM9A 1PC4A 1KQFB 4WIIA 3JYTB 3RR7A 1DFDA 3PIPQ 1F3FA 4DS4A 3ZZ0A 1X9MA 2DR7A 3DOLB 2GVDA 5HVGA 2XS5A 2VBYA 3FDSA 2UUBJ 2HNYB 3T5JA 1UA0A 4DU8A 1JXVA 1H2UX 3DLEB 2BRKA 1HHTP 1EZZB 3T9NA 2HQGA 3SFGA 3DXBA 3IS9B 4JI1F 3UO0A 3A8JA 1F5BA 3MMBA 4DR7J 2ZE2A 3H7HB 1VBKA 3CJ0A 4C8KA 4D3HA 4ZPDA 2UVVA 1HI0P 3IR7B 4DFJA 1KQKA 2KU7A 1NJXA 4JV2A 1JLQB 3X3UA 4NRTA 1R27B 1H6KX 3ITHB 2G2OA 4Q7AA 2KM8B 1XEZA 1SB6A 4ZVPB 4AYBD 2VG6B 1K47A 2EW9A 6FD1A 3I5CA 3C3LA 3NKYA 4E8UA 2A2DA 4IFVA 3L9ZA 2QLXA 4IG3A 1S97A 4RNMA 4FYWB 1YJVA 4ZP9A 1EP4A 1UVJA 3CWJA 3K5NA 3LQVA 4RNNA 2JJ4D 3KHGA 3BH7B 2UV8G 2X1GA 5HN0A 3KK2B 5GMEA 2LP4A 2W9CB 3RYLA 1U24A 3ISZA 4MYTA 4EWTA 5E3QA 3RGIA 2IFXA 1P27B 3MFHA 5AT1B 2AYGA 1IM6A 2VQEF 4ILMA 2J8AA 2V9KA 3POTB 3OSNA 2CPYA 1FRHA 4DV5F 3A3NB 2Q3PA 5HAOA 2P6TA 4Y2MA 4F4AA 3K0JA 3KLVA 2XMWA 3LTOA 4CT9A 4QQBA 2VA2A 2HYIB 3UDLA 3CIZA 3R5GA 1VQ7S 3KJNB 4Q8FA 3FCHA 3AJ2A 3UWTA 1RHQB 1HBUA 3CO0P 2BJEA 3RRGA 5IC4B 1X4BA 4OX9F 5CYMB 1EQ0A 3SSRA 3K57A 4EFAC 3PYGA 4F2SA 1T05A 2CNLB 2DHAA 1KKHA 2VDHA 2CJQA 4R5PA 5E41A 3QRQA 1F60B 4LF1A 3VQTA 4U7UK 4KH0B 2W8KA 3G71S 1WTBA 1VHIA 4NEZA 4H4MB 4WBFA 2FJWA 4IRCA 3QFWA 2C1EB 2HZCA 4P2SA 3DMJB 1IKXB 3R7SB 4LQ9A 1HMVB 4ETXA 1WTFA 3W2VB 4DG1A 3N9UC 3TA2A 2N3OA 1LFPA 1RUSA 1UVNA 4TQSA 3PTWA 4I6WA 5HI7A 1SI9A 4XAKA 4XTTA 4G1QA 1RK8A 4LR9A 2UXDF 2BXJA 2BANB 2RQ4A 3MR2A 3W8PA 1U48A 2VPWB 1FRMA 1R6VA 3CT9A 2CQ3A 5GMDA 1U26A 2RQMA 3GQCA 1BQNA 4DR6J 4O0IA 1SCJB 4NRUA 3O6QA 1FNOA 4L3KA 5DQHA 2VKZG 1YWXA 1GQEA 2CPFA 4X4TA 2JEJA 4ZPAA 5JMNA 4WFYA 4J9QA 3UCUP 4RUAA 3I4PA 2D3ZA 3EVMA 2E7XA 2ACMA 2OPRA 4F67A 1OS5A 2GVZB 2VUGA 4LR8A 3D67A 1WORA 4BBYA 2V8VA 5THWA 1APSA 2N3LA 3Q89A 1NLKL 1T02A 3GLJA 4E98A 1T03B 1DQ8A 2BABA 5HQMA 3PHEA 1B7FA 4QW8A 1VIXA 3M4XA 4FF3A 4JI0J 5IZHA 1QSSA 1QD1A 2KB2A 3D5MA 2QFJA 2IAJA 4F8RA 2C3PA 4DV2J 4JI2J 2MZJA 4WFZA 2DGUA 2VFSA 1EB0A 1NMEB 1UMJA 1WSRA 4IUFA 5L39A 3NEKA 2UUBF 3D3CJ 5J1NA 5GAGU 3EE3A 1LK5A 2AZ1A 4PWDB 2HURA 1UWBA 4GMKA 3HT3A 2D9PA 3TI0A 2K06A 2I9SA 1KVJA 1YJ9S
chains in the Genus database with same CATH topology
3F56A 1S7HA 2V8DA 3TANA 2OH2A 4XPEA 4QWDA 2JVOA 2DGWA 3MM6A 2MQQA 3NNHA 1BQNB 3OLAA 3QZ7A 2QA1A 1JLGB 1JB0C 4A8YA 2I0XA 2QRRA 1L3KA 3BQ1A 4DR7F 4NLUA 3DRYA 4OL8A 1F5AA 1QE1A 3D0HE 4LSLB 2XCAA 3QGGA 2BA9A 3CCWA 3K2YA 3FZ2A 2HG4A 4DUZF 3CDWA 5L38A 3UCZP 5HROB 1M90T 1DTQB 1S1VB 3S7RA 4F4XA 1FJ7A 4B17A 5HMYA 3MGJA 4B3MF 2LVWA 1QTMA 3RU0A 1FRJA 3NNAA 4KIAA 1DBDA 3HP6A 2KDOA 3DOMA 2NREA 1DARA 3M6UA 1D1UA 2R7SA 2JZ5A 2JC1A 2MKKA 3QWUA 3JSMA 1SL1A 3TAQA 1WI6A 4C8ZA 2OPRB 4OJ1A 5HLFA 2HHXA 2ROPA 4K59A 5B0BA 4W90B 2FD2A 2MZRA 5MLCV 3V6DA 2F9JA 1FTCA 5KFOA 4WFBQ 3AA8A 3T19A 2PGCA 2XBPA 5EUHA 2ZH2A 4HYKA 4PXBA 1QLNA 3OTOF 2EKYA 4ECUA 3CD0A 3MECA 4XIUA 1GXUA 1M0SA 4A8FA 2V94A 4P7TA 2PN6A 4DL6A 1H98A 2PI4A 1Y0HA 2YVSA 4I1TA 4IH7A 2IMWP 1NH7A 3Q2SC 1E6YB 4BC9A 2OPSB 3FZBA 5GMKa 2KT3A 5J1EB 3BO2A 1JJ4A 2NSBA 2IVYA 3J7YU 2O1PA 4OLOA 1LWCA 4CZCA 4YY3F 2XMKA 2ROEA 3LGMA 5T41A 3KMQA 2K3IA 2JEGA 2W9BB 2Q66A 4O3OA 1YJNS 2MJUA 1JNZB 4ED7A 4ZVFA 2HWTA 2B0GA 3HO1A 4ZA1A 2GGPB 1TQLA 3V2UC 1RTDB 4BDPA 4WFNQ 1URNA 2HW3A 2GIRA 2R2SA 3F41A 2DNHA 3DLGB 3KLIA 4X84A 2PMHA 2WHOA 1FDBA 3FVYA 1Y5IB 3N4WA 4RUHA 1WEYA 3RTVA 1N56A 2J0SD 3KHRA 1WD6A 4FF1A 1TZ0A 3H2UB 4WKRA 1FKAF 2YNFB 3SMZA 4H4KC 4NLTA 2G0CA 2L08A 3FNNA 4W92B 1YJRA 5LSLA 3IAM9 1ZZFA 4AUKA 1IBMF 1M5KC 3MEGB 4HLBA 3J80Y 4R25A 2E9TA 1Z1ZA 2JFDA 4K4YA 1YJUA 3CCRS 5KFWA 5I3UB 1Z2LA 3CCQS 4AL6A 1S9EB 3N5FA 1DQAA 3DI6A 3KHHA 3VAFA 1ZTWA 2WSFC 4KO0A 2DO4A 5IQQA 2JEFA 4CO4A 1TK5A 3MEEA 2IAJB 5K8MA 1SJ4P 1K73T 2ASLA 4V19J 2MGZB 2YTCA 1JWWA 5KG1A 2WCXA 3CDAA 3KMSA 1WHWA 2XULA 5T7LB 1IQZA 4KV8A 3E01B 4ECXA 1Q78A 2BQ3A 3O1LA 2W9CA 4PXDA 2O01C 1S10A 3FEZA 3NMAA 4X4SA 2P6SA 4I7FB 2P9CA 4C3KA 1S1UB 2GFFA 5KT4A 2DGSA 3VCDA 2RS2A 1C0TA 3LP1B 4DR5F 1IM4A 1VQYA 1KD1T 3KLFB 4M5DB 1R0AA 2DB1A 1UWBB 1R43A 2VV5A 1WG4A 2W7PA 2BRLA 2RMLA 3POTA 5M2UA 2A1BA 1HNXF 3SXLA 5I3QA 4RWWA 2LXIA 1TKZA 2YWFA 4NLPA 2VFVA 4O3RA 3MM6B 4K5SA 2B56A 5IQ6A 5J2PB 2CPDA 2E5LF 5E5NA 3TP2A 5DDQC 4JI7F 1NO8A 4YHHF 3QZ8A 4NA1A 4FS2A 2Z2MA 5U47A 3THVA 4Q44A 4NCGA 3DGPA 2L48A 4ICLA 2J6TA 3KHLA 5LL6d 5E33A 2K1RA 3GV7B 4K4TA 2KFYA 1U4BA 2IC3B 4HH1A 5CQGA 2ZOMA 5DGBA 1MW7A 3I55S 3MM9A 3GV5B 1KHVA 4ZP7A 1YHQS 1N32F 1S48A 4HT5A 4RW6B 2UVWA 2DNLA 2QO3A 1KLMB 5KFZA 1I6JA 4N8OA 5G4DA 4YB6A 4TKTA 2J9EA 4NLWA 2YH0A 2B5JB 2FVCA 2QMWA 2OTJS 2LLZA 4J9OA 2UXCF 1FKOA 3QIPA 1D8ZA 4IRDA 4HTIA 3JSMB 4ERDA 4NXMF 1O51A 3DLLQ 2HHWA 1FD2A 1SJFA 2DGOA 5B0GA 4WZQA 5HLFB 1L5UA 2W24A 5L9NA 1YGYA 3BF4A 1CQNA 3SFUA 1NK4A 2CQ2A 2WOMA 3V6DB 1JNRB 3U02A 1N6QB 1E6VA 4Y28C 2BE2A 2B7BB 3EZUA 2J76E 4A8OA 1SUQA 1R6YA 3PDNA 4C0HA 1HWUA 4B9SA 1NNDA 3MECB 4Q2LA 2CVIA 2KYXA 1FVSA 1W2IA 2PE8A 3CJKA 3MR6A 3MPWA 3TW0A 3DRRA 2BACA 1GX5A 3MD3A 4ES1A 4IYQA 1RI7A 4L6V3 4DL0C 5DLFA 1X9SA 1XN9A 2CKWA 3LAMA 4A8XA 2CRLA 5EX3A 2M8DB 4RU2A 3OFGA 4RBUA 4QIFA 1LW0A 1RJJA 4DFKA 5CHCB 1HQEA 3I96A 2WW8A 1C0UA 2RU3A 3ISND 2FLPA 3KG0A 1FXDA 2RNEA 3PO4A 2DIUA 3SCJE 3L7PA 5FLXY 2ZH6A 2CJAA 4H4MA 4X4PA 1VRUB 2I38A 4CH1A 1WG5A 2OP5A 2QYCA 2HS0A 5LSOA 3L95X 5KFRA 1S76D 2BYCA 4X4VA 2HQ3A 4KRWA 2EG1A 4X4OA 1NJYA 2GMLA 1HWJA 1REVA 3T6JA 4HI2A 3SV4A 3RR8A 3M30A 3HHLD 2KTQA 1U1MA 2VKRA 5EWFA 3W2VA 2RILA 4N8NA 1D9DA 4A4JA 3VQSA 3GIIA 3G8SA 1XC9A 4DMZA 2H5EA 3HZEA 1U45A 2VG7B 4JV0A 2BDPA 2Y1IA 2BQRA 4OHZA 3G6VA 2OFHX 1ZETA 3D54A 4DQSA 1RWUA 1RISA 2MB0B 3KKFA 4KO0B 1HNZF 3MCSA 4O3SA 1JXLA 4PG4A 2DNZA 4Y2IA 2AX1A 5EHHA 2CZVC 2CQ0A 3UI3A 1YIJS 2UVRA 4DR6F 5E2QA 3H40A 2W9AA 1YSJA 4IR1A 2MMYA 3H20A 1S9GB 4PXCA 4KV8B 3GR0A 5F3TA 1TV6A 2BANA 4RW7A 1ELOA 3BQ0A 2FVSA 5K14B 2V4RA 1SC6A 2DTJA 2CQIA 1Q1KA 3RZAA 3OV7A 1TAUA 5KT3A 4ZPBA 3VWSA 3K59A 1Q79A 3IWXA 2CPEA 1A6LA 4LMZA 1Q53A 3FEXB 1C0TB 1X5SA 2C3YA 5T14A 3M1VA 3DNCA 1QM9A 4LIWA 2AW0A 3IAS9 1R0AB 4K4ZA 5CA5A 2R7XA 2XO7A 3R5AA 3KK1B 3I6PA 1RT7A 1FTRA 1JLEA 4U9RA 1HARA 3IO1A 3MZIA 3LAKA 2XG8A 3FQLA 1X5OA 3MDFA 3R5DA 2E1AA 1U47A 1X5PA 1TKZB 3OTCA 4ZLPA 4NL5A 1TFYA 3F44A 3MM5A 3V81A 1J2VA 2YX7A 1S0NA 3K5OA 2DR9A 2LDIA 2FHKA 4NCGB 4UY8T 3TX8A 1X4HA 2PMZD 4DL7A 1KR4A 2DGQA 3HHKA 3TQ1A 4DQQA 4JUZA 3DXSX 2K1RB 3M2RA 4OI0A 2JWNA 1VK3A 3MM9B 2GIQA 1KQSR 2XC9A 5SUHA 3VAIA 3NMRA 1UJ5A 1PSDA 2GX8A 2W25A 1D8YA 3MTJA 2Q79A 1VBYA 2PEHA 1FJEB 1LKZA 1X4FA 2NS1B 2DNYA 3AB4B 1CQMA 4DSFA 3PW0A 3GFHA 4ED6A 4B3OA 1VBXA 1FKOB 4KGKA 5GADU 2ZOFA 1RT5A 4Q5VA 4DN0A 5HP1A 2KJWA 5F8JA 3UE2A 2FLLA 4YB5A 4MH8A 1X9WA 3QJLA 4IRKA 2WOMB 4WE1A 4N5SA 2LQBA 2V8HA 1XNRF 4QYZJ 1VFJA 3AQOA 4PXEA 2YWGA 5KFNA 4QW9A 3BR9A 4JBCA 4ZP6A 4JI3F 4JV5F 1P6TA 5L8RC 4NLSA 4G1IA 1D9AA 4B02A 2UVUA 2SXLA 3KLEA 4DSEA 1FDNA 1SUQB 1TKTA 1T03A 1C1BA 1F9FA 4C0BA 3B82A 3PKMA 4XO0A 1RTIA 5KAKA 3RAXA 3THTA 2V5HG 1OQ3A 5KG5A 3CJKB 3IRWP 1OPIA 4CTAA 2E5HA 3NGKA 4JI0F 4FBTA 4ECWA 3OHBA 4ZS6A 4WU2A 2AYMA 4N41A 2FGCA 2YKMA 4ECSA 2MPUA 2LKZA 3M8SA 2IM1A 2X1BA 5L1IA 2RE1A 2RIJA 1HQEB 1YVFA 3N01A 1HPZA 4YDXA 4I69A 1WNEA 3R1HA 1C0UB 1IKYA 4DV2F 1NJWA 4JI2F 4IDKA 2VFTA 1YJWS 1JMTA 1YITS 5LXYA 3R3TA 2HQIA 3NCRA 3QLHB 3I31A 2FC8A 1KS2A 2ZDOA 2XLJA 2B4VA 3UNGC 3O2IA 4C97A 5GAEI 2FHJD 3HHLA 2LECA 1WHVA 4X2BA 2M52A 4B9UA 2EK6A 3EXCX 3BEGB 4Y2AA 3NS5A 1LQ9A 3DLKB 3P3DA 1L3TA 2AU0A 3EPIA 3BSNA 5B08A 4NA3A 3MPYA 3H25A 4ILLA 2VPZB 3VAHA 1MNEA 5DG7A 1ZPWX 1FKPA 3HVTA 4ECVA 4BCAA 1T3NA 1V6HA 3OW2R 3PX4A 1ULRA 2VODA 2YQ3A 4O44A 4NLYA 1NZAA 4MFBA 1Z2ZA 2QSWA 5ADZA 3EPGA 1N33F 1TFWA 2YWEA 2QZ8A 3UD4P 2YNHB 4B9TA 2IVFB 1O5JA 1X4EA 2UXBF 5B0FA 3N6LA 3GIKA 5DDPC 2MQPA 4WK1A 1QUVA 1IBKF 2D74B 6FDRA 3LGNA 5CZVA 1MU2A 1DTTA 4RW7B 2B4PA 2HS3A 3I0SB 4USJC 5KFTA 2RDJA 2BW2A 4RZRA 2OTLS 2MYFA 4NLGA 1S6OA 3Q8PB 3GG1A 4UY85 1UW4A 2LEPA 4TLQA 1HR0F 3EUNA 3CXCR 4QWAA 2O5DA 2B4OA 4LF6F 4ED3A 3AJ1A 4K5RA 4QIEA 5B0DA 4DF4A 4YUDA 2NPFA 4YEAA 3DRXA 2K3KA 5FJ4A 3HKWA 2MJNA 2ALZA 2GHVC 4C9DA 1L3UA 3BREA 2YNIA 5JJBA 4LSLA 5IT9Y 4QPTA 3HM9A 5CD4H 3OXGA 4TLRA 3MR3A 3MFIA 4EO6A 2OAUA 3MM5B 3V81B 3ONQA 5DO2A 3US5A 4PR6A 4F50A 1AFIA 3OL9A 2P9GA 3X1LB 2BQUA 1PGZA 3Q8SB 3P5TL 3OFEA 2G9OA 2F9DA 4DV3F 3I87A 3R1LA 2AJFE 3M2RB 2MZTA 4RW8A 2ZJQQ 2C2EA 4X66F 2RRNA 1ROFA 3H5UA 3M05A 4LVOP 5KG6A 2KH9A 4QR0A 3H2LA 4OI3A 4QIGA 4DUYF 3CPWR 2FHOB 4JI6F 3SCLE 5H9EJ 1YJTA 3CCJS 4YOEA 1XMBA 4B3OB 1SH2A 4QWEA 2MDAA 1Y5LB 1RT5B 2R7RA 4DR1F 2AYBA 2E5IA 5DG8A 1JLBB 3FSYA 1NB7A 1S0VA 1VLYA 1Q7LB 3HLUA 1N34F 3HXMA 2UV8A 2RRBA 4WE1B 1AROP 4DQIA 4ES2A 2KXNB 3HK2A 1UJ4A 7FD1A 3FSIA 2HS4A 3KLEB 4RLEA 1LOUA 1WF2A 1SKRA 2DBBA 3D1QA 5I3PA 2APOA 2KYZA 4DV6F 4RW9A 1D3WA 1DJ0A 1QJHA 1RTIB 4HI1A 2C22A 3S01A 5F0WA 4ATNA 2W9BA 3IC1A 2LEBA 2XY5A 3E3XA 4CTAB 4ZPCA 4ECQA 3M8QA 5KFJA 2CPJA 3CC4S 2GGPA 1EETA 2EBEA 2DH9A 2YKMB 4GC7A 1HD0A 2IMOA 3ZZZA 3GFYA 5F8HA 4X65F 1HPZB 3DM2A 4ZMMA 5DG9A 5IT4A 2FHJA 4ECTA 2E29A 3GSDA 3GYNA 2DCLA 4BHQA 4AL7A 2E5JA 2L9DA 3SCKE 2ZZMA 3FRYA 4CIOA 2BVZA 4LSNA 1U1KA 5KT6A 3MEGA 1OQ6A 3FFIB 2BBEA 2LDYA 4USHA 4AXJA 3BSCA 3HHLB 4NLRA 3TR5A 4F3QA 2LQ9A 4MKYA 1DQ9A 1S9EA 4QIWD 2IBKA 1N5QA 4XPCA 1ZBTA 4YB1P 3I9V9 1N5VA 3CJ3A 1RA6A 2DIVA 3NCQA 4NZ7A 5DDRC 1Y00A 3CDBA 2DPJA 2XGPA 4OZ5A 2FJVA 3CJ5A 1XK8A 2EPIA 1FKPB 2NPIA 3MEDA 5KG3A 4DBQA 2KO1A 4MMOA 4F4KA 2XI2A 1CC8A 2VFRA 2WRMA 4KE5A 3OLBA 1KFSA 5T7LA 4HKQA 5CCLA 2CPXA 1HNVA 3HJFA 2W4CA 4JI4F 4MFBB 4H4KA 3DOKA 5A6PA 2YKQA 1BY9A 1NAQA 2R9LA 3C8YA 4I7FA 4R8UA 3OBIA 4OX6A 4EBCA 2BM0A 3BZQA 2HIQA 4TY9A 1SKWA 5DRKA 4KPYA 1M5OC 1HFEL 1S1UA 1RT1B 3JTOA 5KG2A 2J6SA 2KXFA 3CE8A 3IWLA 3CD7A 2DHSA 2AJ1A 3RRHA 1RTJA 1NJZA 2AQ4A 1MU2B 1Z4UA 3PY8A 3D0IE 1SH3A 1UVIA 2AP6A 3N28A 2HFNA 1BGXT 2F40A 2MKCA 4Y2KA 5KFXA