1WTFA

Crystal structure of bacillus thermoproteolyticus ferredoxin variants containing unexpected [3fe-4s] cluster that is linked to coenzyme a at 1.6 a resolution
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
81
structure length
81
Chain Sequence
PKYTIVDKETCIACGACGAAAPDIYDYDEDGIAYVTLDDNQGIVEVPDILIDDMMDAFEGCPTDSIKVADEPFDGDPNKFE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Identification of variant molecules of Bacillus thermoproteolyticus ferredoxin: crystal structure reveals bound coenzyme A and an unexpected [3Fe-4S] cluster associated with a canonical [4Fe-4S] ligand motif
pubmed doi rcsb
source organism Bacillus thermoproteolyticus
molecule tags Electron transport
molecule keywords Ferredoxin
total genus 18
structure length 81
sequence length 81
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2004-11-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13370 Fer4_13 4Fe-4S single cluster domain of Ferredoxin I
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.20 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1wtfA00
1PC5A 1FXRA 1H0HB 6FDRA 1GTHA 2VPWB 3MM6B 3MMBA 1Y5NB 5CHCB 1RGVA 1BC6A 2VPXB 4OMFG 5BYQA 1CLFA 1DURA 2V2KA 3MMBB 2O01C 3IR7B 1G3OA 4L6V3 2C3OA 1F2GA 1FXDA 3MMCA 2ZVSA 6FD1A 1HFEL 2Y0SD 5BYSA 2IVFB 1R27B 5BYRA 2XSJB 2C3MA 1FDAA 1XERA 2FDNA 3MMCB 3MMAA 1FD2A 2VKRA 4XDDA 1GAOA 1D3WA 1GTEA 2WAQD 2WSCC 4ID8A 3HKZD 1SIWB 1BD6A 1F5BA 2WSEC 3EGWB 3MM6A 1FDNA 1FERA 1FRMA 1KQGB 1K0TA 2C3PA 3GYXB 3OR1A 2GMJA 1B0VA 2FJEB 5L8RC 1FRHA 1C4CA 4OV1A 1Y5IB 1BLUA 1VJWA 1FDDA 1H7XA 7FDRA 1JNRB 1FRLA 1AXQA 1FF2A 2C3YA 1IQZA 2Z8QA 3LW5C 3MM7B 2C3UA 2V4JA 5FD1A 1WTFA 1BWEA 1F5CA 2FGOA 2XSJA 3MM8A 3EUNA 7FD1A 1DFDA 4DHVA 1B0TA 5E7OB 3MM7A 2C42A 4Y28C 4YDDB 3EXYA 1JNZB 1IR0A 3IR5B 1SJ1A 3MM8B 1Q16B 4AYBD 4XDCA 4XK8C 4CI0B 1PC4A 2FJAB 2FJDB 2PA8D 2UZAA 1GT8A 2PMZD 2VPZB 1FDBA 3IR6B 1Y4ZB 3OR1B 3MM9B 1ROFA 2WB1D 1DAXA 3OR2A 2WSFC 3MM9A 1B0PA 2V4JB 1FEHA 1BQXA 1FTCA 3OR2B 1C4AA 1FRIA 1Y5LB 5CH7B 1KQFB 2PDAA 3PNIA 4RKUC 1FRJA 1H7WA 3MM5A 2FD2A 1KEKA 1A6LA 2VPYB 1G6BA 1FRXA 1JB0C 2GMHA 1H98A 4KT0C 3MMAB 3C8YA 2FJBB 3MM5B 1FRKA 1SIZA 1FCAA
chains in the Genus database with same CATH superfamily
2KVQE 1KS2A 5A76A 3QRQA 5B0FA 5K8NA 4Z7CA 4WYWA 1JJ2R 1EHWA 4K0KF 3NY0A 1IM6A 4DZDA 3VAJA 4B3SJ 1BC6A 3GTYX 3C66A 3UCZP 1Q8KA 2NYHA 1B4SA 4A8FA 1JLGA 4FXDA 2BJ1A 1REVA 2YVSA 4HHHA 3TOQA 3OTOJ 1BQMB 2DT9A 2IRYA 3IFEA 3JQKA 4L6V3 2HG4A 3HHLC 5H9FJ 4DR6F 4URGA 3KLGB 4FVCA 1CJUB 1CBKA 1S6PA 4P52A 2ZHAA 1OPZA 1F9FA 4PEOA 1VQ6S 1A9NB 2P6SA 1FKOB 1S1TA 3CWJA 3O6QA 4K2XA 1T8EA 3QBCA 5K5MA 2MQOA 3M8PB 4CIOA 2J0QD 4QZVB 4RX6A 3GB0A 2NUUG 3H20A 2MKJA 1RACB 1YX2A 2IDLA 5CYQB 3PTWA 5H9EK 4DXLA 4XDDA 3CB4A 1R0AB 4AUKA 4YQWA 3NEKA 2NXCA 4FDFA 2IVMA 1WG1A 4OHVA 5AT1B 4FYYB 3H98A 3TP2A 3HKZD 2YKMB 4F2RA 3UN2A 3ENVA 4BHQA 1FRMA 4Q44A 2VIHA 4GC7A 4KR0B 1NH8A 1HW8A 4ED7A 2E9TA 1HWIA 4H4KA 2XYHB 4CYUB 1WHXA 2DR5A 3ISNC 2LFVA 1S12A 2JOQA 4X65J 5L8RC 2WVEA 1FJGF 4MYUA 4YB7A 1Y5IB 3RBXA 4OI2A 3LPYA 3GJTB 3GQCA 3N28A 2XY7A 4KQZA 1RWMB 2M9KA 2RE1A 2DVIA 4EEYA 2E5LJ 1TUVA 3MWBA 5ADZA 5CA5A 1WTFA 5KFEA 3VAMA 2XS2A 3MM8A 3MEEB 4NA2A 1DLOB 1DFDA 1HBMA 2OMLA 5DQHA 3V6KA 4YN3B 2M0GB 2LA6A 1A7GE 2QJ3A 2DYAA 4X4VA 2Z56B 3I9ZA 3T9ZA 4B9SA 1HPZB 1C0TB 4N8NA 2HHSA 1IR0A 3ILIA 4RPFA 3DRYA 3U1NA 3DGPA 3V6JA 4AYBD 4UOFA 2DR7A 4X4NA 3QLHA 2BM0A 2RILA 2EFPA 3W1YC 4X65F 1S1WB 2NXNA 4WIIA 2XMAA 4J9KA 2NZ4A 4DDFA 3WZ0A 1MROA 2F8HA 2RJZA 5K8MA 1U0SA 5IZHA 4Y65A 1OPIA 3IR6B 3M6UA 1HNZF 2OTLS 3ZTRA 2NREA 2Z57B 4DV4J 2J0SD 3NCPA 3DM2A 2HYIB 2D9PA 4C11A 1Q7LB 1FKAF 3OJSA 4KAIA 1L3UA 3HHEA 3V6HA 3PFOA 1K44A 2RDIA 2L9NA 2AD9A 4OZ5A 3DYAB 3GFYA 1JKHB 4RNOA 4RW9A 2LQ9A 5HROB 4OI6A 2WVBA 3BB5A 3H5UA 2BOPA 2E7XA 2CPEA 1ZTTA 5D4LA 2E29A 2BJ8A 4M5IA 5IM0B 3AB2B 4A8QA 1QDUB 3MDFA 4OYMA 5KTQA 3A8EA 2FQQB 5HP1A 4C8YA 3BYRA 1WF2A 1UP1A 2YWKA 4K59A 4DUZJ 4DUZF 1FFGB 1RLCL 3VGUA 2ZH5A 4AFFA 2ZWPA 3TUIC 2ZH2A 2CPXA 1NK6A 3DRPB 4AQYJ 4M94A 1UW9A 3KKFA 3EGZA 2DIVA 2GQ2A 3NGRA 2VBWA 1CS4B 2MJNA 1R8PA 3PDNA 2ROEA 4IFVA 1HARA 3EYZA 3IBCB 1N8RT 3IAS9 4ZOSA 5J1NA 1CC8A 2JVRA 3BKTA 2BKPA 2JLGA 1RTJA 5L46A 1HHSA 4PR6A 4DV5J 1YHQS 4CRJA 1T03A 3KG1A 4WFXA 1PC5A 1RHJB 3FQKA 1H0HB 5A8RA 3CD6S 1GTHA 2WVFA 4WFNQ 3I5AA 2C2DA 1BQMA 5LMUJ 4K50A 2L3MA 4DQPA 2W01A 2PA3A 1D9FA 1ZETA 1H2TZ 3NL0A 1N5YA 3B4MA 2CJKA 2OTJS 2GCFA 1D8YA 1OYDA 2VDIA 3DOLA 2L9DA 1XWLA 3CJ5A 3LA0A 5F0UA 1XBWA 3SXLA 2UUBF 2ZBQA 1R89A 5AXMA 4EMDA 4ETZA 3MTJA 4WCEQ 2ZVSA 5DS7A 1U4BA 2PFDA 1O5JA 1XMOF 3DRSA 1IKWB 4TU9A 4DPTA 3UN3A 2AEFA 1NB2A 4K4WA 1UJ4A 4QR1A 2ZHBA 2BZ2A 1XERA 3DXBA 4OFZA 3HMJG 1TKTA 4H4KC 1RAHB 1U49A 3W7BA 1X0FA 3A8KA 4NCBA 4L3NA 3MAAA 2BV3A 1Q7YT 1VQLS 2C2NA 3CMAS 4LQ3A 1QD1A 2ACMA 3DC2A 2EFOA 1GK8A 2LQJA 3TA0A 2ASJA 1N32F 1U1NA 3CDWA 4NXMF 1TL7B 2DY1A 1SIWB 4ILLA 1EJ7L 1WF1A 2MHNA 2QL5B 4HACB 1HHTP 1X4BA 5GVQA 3S1TA 3JSMA 2W7OA 1SL1A 4O0IA 4J37A 4OL8A 1E6YB 3NOCA 1JLQA 4PABA 2RU3A 2KI2A 1KNZA 3LP0A 2ZD1A 4Y2IA 2HBQB 2EFGA 2DCLA 4GO7X 5E0OA 1QY7A 2B7CB 2HWIA 2KT3A 3JXOA 2DGVA 2HHTA 2RRBA 4V19J 2OSRA 2YNHB 2O1PA 2MY8A 4JUZA 5F3TA 2KJWA 4PXCA 5KFDA 1BXNA 3SCJE 3E01B 3NS5A 3JYTB 4AQYF 4UUWA 2L48A 4ZVFA 3FSIA 4C3KA 4IH6A 2I2YA 1HNWJ 2I0XA 3NLCA 1WC6A 2RQKA 1MU2B 3QGGA 3PEHA 4RBVA 4ANDA 3GIIA 4O3QA 1VLOA 3NNHA 2B5JB 1DJ0A 2FC9A 1CULA 3EXYA 3OJUA 4WF9Q 1H72C 1HWKA 2GHPA 3IR5B 4O0NA 5KG6A 4F0KA 1PYSB 4IFYB 1SH3A 3FK4A 5KG3A 5KG4A 3GP9A 4IH7A 4Q5VA 3DM2B 1YJNS 2VQEF 5DLFA 4UZCA 4YDXA 4FNIA 4M5DA 4NEZA 5FLXU 3OTDA 2HFUA 1N5SA 5E33A 2C2RA 1Z2LA 1RBLA 3I82A 3RU0A 4XO0A 1C1CA 2HS0A 2OPQB 2Y0BB 1TZ0A 2B43A 2WSFC 1R8AA 1X0PA 1I3OB 3BR9A 3ENAA 3M2UB 1HBUB 2FGCA 3FEXB 2A2CA 5E2QA 3ZTSA 2YQ1A 3PV8A 1UPPA 1UL3A 5EN1A 2HHVA 3IA0A 2P2CB 1HNIA 2OP5A 1NEEA 1CS4A 4IFVB 3D28A 1H7WA 1Q86T 4ZA1A 3DLLQ 2MKCA 2ACYA 1KTVA 3EZUA 3I5CA 4KFBA 5LL6d 1ZH5A 1EQ0A 2DHXA 1T03B 1X8DA 1EARA 5ETOA 1XQIA 1A0OB 1YJWS 2DGOA 2XQCA 3G6VA 4FBUA 4FF1A 1YJ7A 4WKYA 2JNJA 3BM7A 5E3RA 1T0TV 1BE4A 2WVDA 3TUPA 4ZPCA 2VUGA 3BPSP 3SBMA 3PJWA 3QIPA 4NRUA 1Y3KA 5HMXA 1N5YB 2J6SA 2D3OR 1UFWA 3ET6B 1W7WA 4IKAA 2AKWB 3D3BJ 4F7VA 2HURA 3N79A 1ZAXA 5A6WA 3MMBA 4DPWA 2UUBJ 3WIUA 4Q43A 4GC6A 4YOEA 3BS9A 3WBZA 1LW2B 4OYAA 2VJUA 2N7CA 2I6WA 4KIAA 2QX0A 3EDRB 5BYQA 3J7YU 2H65B 3H2VE 3ZZOA 4EYIB 2B9WA 2FPHX 2LXFA 4DQIA 2OHDA 4P71A 4C0OC 1NJWA 2BR0A 2AJ0A 2JEFA 3PHTA 1Q78A 1JLAB 2F65A 2GV1A 3GFHA 2OPRB 3I0SB 3W64A 3W8PA 1JK9B 3D68A 2CQ1A 1XMBA 2Y0SD 1OIAA 5I3PA 4X62J 2AIRB 3EVMA 1KSPA 2OPPA 1SC6A 3MPWA 2F5GA 5BYRA 3JSRA 1L5UA 5IXUA 3P8BB 4LIWA 4B3TJ 2BEFA 1FI4A 5L9NA 2FJXA 3M32B 4GMKA 3W5XA 4IO9Q 4QYZJ 1WDTA 1UW4A 3LUYA 4RL1A 3BSCA 3NOGA 2Z4PA 4WU3A 3T1HF 3T1HJ 1D3WA 5T7LA 3MUVP 4R8UB 3CCRS 1CC7A 4DR1J 4DL4A 3FEYB 3W60A 3MR2A 1HQUB 4J9VA 1JJHA 4U7UK 1I6JA 4LF4J 2YWHA 2OELA 3AA8A 3R8YA 3PYGA 1VQOS 5KFRA 2MXYA 4JI2F 2YNHA 1UTAA 1UWBA 1HLWA 4WFBQ 2CPHA 3CDAA 5EX0A 5HBMA 3TAPA 3DOMA 3MCOA 5G0RA 1VISA 3KG4A 3O5TB 4R5PB 2UV8A 2MQ8A 1P27B 1LEOA 3MEGB 4RW4B 3TAQA 1M5PC 1DTQA 3WQPA 1NSQA 4ECTA 4NRTA 1NMEB 2W8KA 3IS9A 2WZ1A 2GJIA 2CJAA 2DRBA 4F25A 1N0UA 4HTIA 2BM1A 3P5BP 3QATA 5JVHQ 1TQLA 3UDEA 3MPUB 2UVVA 3RAXA 2D7SA 1E6VA 2F40A 1SH0A 3G4SS 5I42B 5HJXA 2G2ZA 1RU2A 5K8OA 1O51A 2OD4A 5LT5A 3OSNA 5F8JA 2QRRA 3IP0A 4NZ0A 2EBGA 4ED0A 4LF5J 3T5JA 4C4WA 3BV8A 1ZYQA 2R42A 4FXVA 2R8IA 1WC4A 5C2GA 2W7PA 2HSEB 1BY9A 2IRXA 3KTQA 2XWYA 5CCMA 4F36A 2GHWA 1JLFA 1S1XA 2BJ3A 2DH7A 3EDQB 2F4FA 4PG5A 2KZMA 3G87A 2I1RA 1U47A 2E66A 2ALZA 4LUBA 4DG1B 3HLUA 3GYNA 3U1LA 1X4AA 1HNIB 3QGHA 4NYOA 1NKEA 2HZCA 1WORA 1Q53A 1YJUA 2KH9A 2NQPA 4WP9A 4KFBB 4NI2A 4JOUA 1SBRA 1PGZA 4B9MA 5L9XA 3L9ZA 5LJ3Y 4DR5J 2ALYB 3KHHA 5G4DA 1NLKL 4PG6A 1U0HB 1UFKA 2FHJA 3UE2A 3G8SA 4BS2A 1M0SA 4USTA 4C0BA 4LFAJ 3K58A 2B4VA 4QWAA 5C24B 3QIPB 1RISA 4FP9A 3R2CJ 4HI2A 3C3LA 1V9OA 3GG0A 4PXDA 4OYZA 4EK2A 5KFQA 2G0JA 3LWMA 2XZDB 3G6YA 4DSFA 1P6TA 4TN2A 1MWZA 4USJC 3RAQA 4FVMA 2NUHA 3VF0B 4Z37A 2IBOA 1LW0B 1ACMB 2YY3A 1SJQA 4C0HA 6FDRA 4LFBJ 1JXEA 2HNYA 1OO0B 3C16A 2C2EA 2V67A 4IR9A 2LA4A 2CG8A 1S59A 3M6WA 1I51B 4FKYA 2DNNA 4NA3A 5DJBA 1X5TA 1I5OB 3CIMA 4RWWA 4A8SA 4NLGA 5KT3A 1LXNA 1FFWB 1Q5YA 1TKXA 3D54A 2K1RB 3MUMP 1WJ9A 3KLIB 2J8AA 2CPIA 3IR7B 4DV3F 2QC3A 1OWXA 1FXDA 1V6HA 2PN6A 1TVRB 3AT1B 3C46A 2DY9A 5L1IA 3W2VB 3TZYA 2CZVC 2OO4A 5J2MA 1V5IB 1LK7A 1YIJS 2W2QP 3DDIA 1NK8A 4FPIA 3KHRA 3G6ES 4GVLA 4RUAA 3GILA 1J5OA 4HKQA 2OUGA 3SCKE 2DD8S 3BF4A 1X9MA 3KLGA 1HQEA 3LGMA 4JI1F 3DGVA 3ICLA 1HWJA 1Y3JA 2D3UA 4USKA 2XC9A 3HSZA 2RAQA 3ZZUA 4ECVA 1FHTA 2WK4A 4LVOP 2R7RA 4CH1A 4JI0J 1NK5A 3DU6A 2IHR1 3N6LA 4I7FB 4JV5F 1RT3B 3N6NA 4BWJA 1TP7A 3KLEB 3IRWP 3K89A 1HA1A 3BGLA 3UD5A 3PX0A 4DWIA 1R0AA 4O4GA 5K8PA 2JX2A 1EAYC 3FFIB 1DTQB 5U47A 4WBFA 5AXLA 2DTJA 4JI6J 2YKMA 5D0HA 4B9TA 2KDOA 3R7BB 1YJRA 2QSFA 1JLCB 1F60B 1PJ7A 1TV6A 2P5VA 4H4MA 1RA7A 1VLYA 3M30A 1RT5B 3K8VA 4HL9A 1BWVA 1S57A 4CYUA 5KOXA 2VASA 5DGBA 1SKUB 2JSXA 4ZVRB 2A18A 4NCAA 2J7KA 2XZTB 3AA9A 3H2UB 2HHHF 4RR5A 4LRBA 3BO2A 3QGIA 5HMWA 3RZAA 2BDPA 2P9CA 2V94A 2HNDB 1KQKA 3R5CA 3HK2A 5KT4A 2QO3A 4C7QA 4U67Q 5KFOA 4V19X 4O44B 1HI1A 1U02A 4KGMA 4MK7A 4JI6F 4P2MA 1CSJA 1LWEA 3KK3B 2PMZD 3KHLA 4DG1A 2R7WA 1HMVA 3DCAA 3OR1B 5JJBA 3DGPB 2DNHA 2YPYA 5K14A 5B08A 2QA4S 1U1PA 2XHCA 2IM2A 2JFKA 1VGYA 5BXIA 3BKUA 2HFNA 1VBKA 3B4DA 4MFBB 1RA6A 5MAOA 2QIFA 5E3CA 3L7OA 2MEWA 1K1QA 4DLEA 1UVKA 2M7SA 2QLWA 3OXGA 3JAMU 5M2UA 4X64J 2I5JB 4N77A 4Y2MA 2ASDA 1X9WA 1VQ7S 4ANEA 2LEAA 4ZPBA 5ETPA 1LOUA 3D0IE 4YB1P 3KNGA 3HM9A 1RHMB 1SV5A 1SQGA 2Q1LA 2XHWA 3D7SB 3DLGB 3KG0A 5HI7A 5DM6Q 3IAM9 3IC1A 3VHQA 2ERRA 3R5GA 4CLYA 4U8VA 8ATCB 3J7AN 4GKJJ 1VHFA 2P9EA 1NKBA 1L3VA 5I3QA 1N54B 4CO5A 2ZH7A 4J9OA 3QYYA 2I8EA 1SB6A 3PXGa 2EWHA 4JV0A 1N4LA 2FLPA 1MMLA 1R8BA 2HQFA 1XIQA 5GMEA 4LRAA 5D15A 4LT6A 4ECUA 1WTBA 3OTBA 3RBEA 4NLOA 1H2VZ 3BSNA 1OS5A 4J9NA 1U48A 2XNQA 1SC4B 3SCLE 1EZZB 2IY5B 1QE1B 3OTCA 3TA2A 2BOAA 1RTJB 2BE2A 2PMWA 1SQEA 3THVA 4DU8A 4NXMJ 2XYPB 3BGRA 5A8RB 5J2MB 2AGPA 1U2RA 4C3LA 2XB2D 1TL4A 1S6QB 5DRKA 2KFZA 2DGTA 2F1FA 2ZH3A 4PWDA 2LQBA 2CPFA 4FZVA 1WG4A 1J5OB 3PZPA 2K3KA 3KUHA 4FS1A 2HLUA 4YEAA 5CZVA 4B9LA 1YBUA 1R6YA 2M8DB 3TVKA 4NXNF 4OX9J 4ZLLA 2PGCA 1VQMS 4JYAJ 1ZZFA 2KL8A 3UNYA 1KVKA 3EWGA 1B64A 2V9WA 1KP6A 2C2KB 1P1TA 3M2VB 4TY8B 4B17A 5IV3A 1ZTWA 3RRGA 3BDEA 4B9NA 4YHHJ 2FVSA 2GIQA 3MPVA 4ZPDA 4JI4F 3FFIA 4LR8A 2LEBA 1W2BR 4ID8A 2MZRA 4LFBF 2IM3A 5IFMA 2KFNA 1QSSA 4QU6A 1RT4B 3I9V9 4C2MA 1EIYB 2Q66A 1JLCA 3MOZA 3T1AA 4F2SA 1SI9A 2DITA 2GW8A 3M30B 5JUMA 3PIOQ 4K0KJ 2HEKA 3SV4A 4OJGA 4DR2F 1AROP 1UETA 3IWLA 3N5BA 3TI0A 5K9FA 2FLNA 5FJ4A 1CQNA 5ETMA 4KE5A 1H6KX 2RMLA 4C11B 3J81Y 1VOMA 3TQ1A 4LFAF 2HVHA 2V69A 4HACA 4OZJA 4YR2A 4RJVA 1IJFB 2NPFA 3M8QB 4ZVHA 4FYXB 2DGWA 2ZOFA 1FF2A 2AJ4A 4S0MA 4YB6A 2PI4A 2ROGA 2PD1A 2RUGA 1BWEA 4K4VA 4UT4A 4JP8A 3D2WA 2LQ5A 3O2IA 7AT1B 5M2RA 1K0VA 1JMTA 3KMSA 2BRKA 5AE3A 4WU2A 3J7Z5 3CCES 2YNFA 1UEUA 2QLXA 3N4WA 2C2MB 1NJIT 1R0CB 1YVFA 5F9LA 1VQYA 2UP1A 1RE1B 3OL6A 5K14B 3VALA 2CG4A 3R9LA 3T6BA 1KVJA 1MU2A 4XAKA 2UXDF 4DV3J 4K5RA 1S49A 1EETA 2O5DA 2DXDA 4KGKA 3X1LB 3W9JA 3Q23A 2VG7A 3OPKA 5IT4A 2VFVA 3K5LA 4ES1A 4IFYA 1FNXH 1SPBP 3FCHA 1ZS6A 3ILLA 2KXFA 4F4AA 1MWYA 3G86A 3KJQB 4USUA 3UD4P 2X7IA 4H54A 2F9DA 3CD0A 3PYEA 3Q0AA 1TK5A 3VTIA 2H4YB 3NAIA 2HW3A 2WW8A 2PEHA 1L3KA 2EC0A 2NCKL 1FTCA 2RVJA 5L1JA 4O4RA 1Z1ZA 1D9DA 2HBYB 1KBRA 1Y7PA 1S4FA 4DV1F 1RAAB 4WJBA 2KHCA 4ED3A 3RB0A 4BC9A 1XNQF 2AEJA 1QUVA 3MM5A 3M4XA 4CDIA 4J90A 2ZBIA 2DPIA 2AF6A 2I38A 5E3PA 4B9UA 2XLKA 1Z2ZA 3TUJC 1JLBA 1HIYA 2YQ0A 2HHXA 2EKNA 2X3DA 3V2UC 4PXEA 3MAAB 2CQ0A 1F1BB 4LF1A 2RSQA 1K1SA 1D09B 3A3PB 1FRKA 1R7IA 1RADB 2NXJA 4NLDA 1PO6A 5KFKA 2KG0A 1FXRA 1TL7A 3MD3A 4RNMA 1RSCA 1HHQA 3V81A 2EFNA 3ENQA 1ZAVA 2EI5A 3OFFA 3AXMA 5CHCB 4PWDB 2G9OA 4ECXA 3H2LA 2DR8A 2VPXB 4KO0A 3GIJA 4KHPF 4OYIA 1MSWD 2HRTA 5GAEI 1CLFA 3MMBB 5GMKa 4DN9A 1OSCA 3K59A 2M88A 3QRPA 2FZCB 2ZE2A 3FNNA 4LR7A 1X5SA 4B02A 2QA1A 4AD6A 4JBCA 4LF2A 5KT2A 1QLNA 3KLVA 3NMRA 2V6AA 1FT8A 2UUTA 4K2JA 5BYSA 2G2YA 1AT1B 2VV5A 2AWZA 2E1CA 3BJYA 1OY9A 3QWPA 3TUZC 2ZEJA 4EZ6A 4DX8H 2X1FA 1B70B 2ZZTA 3CNQP 3UCUP 5EWFA 2OFHX 1RHKB 2RDJA 3C6TB 2IA0A 2LXIA 1NHKL 2VBYA 2NSBA 3DN9A 2VL1A 4LSLB 4C8NA 3T41A 3CCJS 3Q83A 2YKQA 3PHEA 2OPPB 4FKXA 3RBZA 5B0BA 2FZGB 2AJ1A 3HHDA 4NMXA 3W2WA 5SZTA 3G82A 2VQFF 1VS3A 1GXUA 2EXUA 3HULA 3P96A 4ATNA 2HGMA 3Q8SB 1SH2A 2IBKA 1U24A 4URQU 2WOMA 1BD6A 1U1LA 4JI5F 4RNFA 3H25A 1TTHB 3Q2TC 5IWAF 1J2VA 2C1EB 3PRDA 3KLHB 3MF5A 3M8QA 2QV6A 3HD1A 4M5GA 1YLXA 2APOA 2FLLA 2RF2A 2CPZA 1HQUA 4ZCIA 2MSSA 1TUWA 3L7PA 4JV5J 2MQPA 3JTOA 2NS1B 2Y8WA 2W9BA 3WIVA 2AX1A 4WXOA 4YUDA 1C1CB 4DR6J 3LO3A 1BLUA 1MNEA 1FDDA 1HWLA 3I31A 3NGUA 4ZLJA 1FRLA 4HDGA 4CH0S 2XO6A 4QWDA 2QFIA 2C3YA 1RTDA 3M2UA 1S9GA 3FVYA 3TJAA 3HXMA 2YNFB 3LTOA 2RH3A 3UDLA 2IC3A 3OW2R 3D4JA 3QFWA 3I5BA 4DHVA 3UR0A 4RW4A 2FHMA 1S97A 1PJ5A 2J0WA 3AOBA 3Q8YA 4B3MF 1G1XA 4UUXA 4QCLA 1N36J 2HKEA 1TFWA 2E7WA 2B9XA 4F50A 4K4UA 2R8HA 3GJSB 3TX8A 3IM9A 5MLCV 4XPCA 4TU7A 3BQ0A 1Q16B 3CJ4A 3OVBA 1S0OA 3TEGA 4DX6A 2YKAA 4QWEA 2W8LA 2VICA 1RTHA 1WNEA 1UVIA 2V8HA 1GT8A 1FE0A 2OI2A 2OH2A 2PFFB 2KJVA 2ZDOA 3CJKB 2X51A 4DPUA 2M8HA 3GZ7A 1VFJA 5BJRA 3D1HA 3M8SA 2YQ3A 3CJSA 5D4OA 5ETVA 1QSYA 2NXEA 3CDEA 2JC1A 4Y3CA 4ZPAA 2D41A 1TL3A 1ZBTA 1D0EA 5A0YA 5KFGA 2H51B 3RB4A 1MLAA 2AP6A 3G2XA 5HLFA 1HNVA 3EJMA 4BWMA 1YK9A 1YBAA 3MMJA 4URSA 3K7RA 4BLGA 4E2FB 2V4QA 4D3HA 2DGXA 2HS3A 3OR2B 5F8GA 1KQFB 1SKWA 2JVOA 1IKYA 1XMOJ 2R7UA 2OPRA 4JB8B 2UUCJ 1X4DA 2VQFJ 4WP3A 2H5JB 3H7HB 4ZCLA 3NNAA 1G6BA 3TJ8A 3I87A 2XY6A 2ZJRQ 2R7SA 3JTPA 3ISND 4OX6A 2P9GA 4ZVSB 5KT6A 1EKRA 1HBNA 4L74A 4ECQA 2R8JA 2ZVIA 3BBCA 1WG5A 1TAQA 3OD2A 4J5OA 4GRSA 3IN5A 2JLFA 3GFXA 3DFEA 4RW6A 2GIRA 1DQ8A 2L08A 4HHJA 2VG6A 1FCAA 1SQFA 3MEDA 3ZZTA 3TANA 1S76D 3THPA 1UVJA 4CLPA 3NGSA 5KFLA 2BRLA 1S1UA 5T14A 1T9WA 4LR9A 2DEJA 4RU9A 1SVDA 4OHZA 2R7VA 4B3RF 3JSYA 1XR6A 3DOKB 4PZVA 4ZN3A 1F5AA 2EPIA 2U2FA 4U7CA 1NPPA 4CO3A 3PR4A 3GIMA 4K4SA 3VGTA 2W4CA 2R9LA 3T1YF 1U45A 3IXQA 1IR2A 1F2GA 3N0VA 2IPOB 2KKHA 2X1GA 3UDCA 4EO8A 1AFIA 3RG6A 3C6TA 4LSLA 3IS9B 4TQSA 1RT7B 4U96A 2ZHOA 2K1RA 3PO4A 1YQHA 2GVZB 1ZA2B 2ZNYA 2ATLA 5KG0A 1KQSR 3CMES 4DR7J 2HWTA 1O0PA 2H5EA 2RU9A 2YWFA 3HSGA 1S6UA 2NPIA 1KRPA 4H4OB 1MN9A 1H2UX 1P8GA 2BE7D 2CAJA 4ZPWR 1H74A 1WKKA 1OJ4A 3DMJA 4MKVA 4NLVA 1HKAA 5D0EA 4ED4A 4K4YA 1GTEA 2WAQD 1G2EA 4O3PA 2ZBCA 1DTTA 2LDIA 4A8WA 1U6BA 2OMOA 2R7XA 4EO6A 2RQCA 1S0MA 2W9BB 1G4CA 3KOAA 2DHSA 4OHYA 2QLJB 1ZPVA 4M5KA 4V1Ak 1RT3A 2CQHA 4DJBA 4M5NA 4RZRA 1T3NA 4OZ3A 2ADBA 2B0GA 3BR8A 4ZVOB 2F9JA 4OV1A 3MCMA 1KC8T 2IC3B 3CJQA 1QVFR 3K2YA 1VYAA 2AJ2A 2A3JA 3LANA 4USWA 3W5ZA 7FDRA 2J6TA 4DV0J 1O6XA 2ZM6F 3HZGA 3LW5C 4OX8A 2MMYA 4A4JA 2J9CA 5LM7E 4PUOA 1LQ9A 1TAUA 4DV6J 5D78A 2HQIA 1WWHA 3AXKA 4KKOA 1VC6A 3QGPA 4J9UE 5RUBA 1V5VA 1YJVA 3QSIA 3MR6A 3FKBA 2HHWA 2DNPA 4C98A 2C42A 4YDDB 4NLUA 1WHWA 2Q6CA 5KFFA 1LWFA 5GADU 2OEMA 1KDNA 3CF5Q 3MOJB 2ROPA 4K4XA 4X64F 3QT6A 4PYAA 4A8XA 1H73A 2GHVC 5CYJA 4IRDA 4NLXA 1FD8A 2CWXA 1TL3B 3GE9A 4K4TA 5HMZA 2AZ1A 4X84A 5A0YB 4WZMA 3NP5A 4PG7A 4LSNB 3HHLB 2FIUA 2C2OB 3D6MB 4CT8A 5A8KA 2BACA 4J91A 3OSPA 3A3NB 3FZBA 2F8MA 4DV0F 5HLFB 1UMJA 1VRQC 2KB2A 3D0GE 4B9VA 3PRVA 2DNQA 3SMZA 3M8ZA 4C48A 5A2QU 1M5VC 4OI3A 1LWCA 4ZHRA 1FJ7A 3OR2A 1BQNB 5GADI 3H4BA 1KVIA 2V8VA 3PIPQ 1IKYB 5LSOA 3HPOA 2XMTA 4UQTA 3ZO7A 4XTTA 2XMVA 4U8YA 1K47A 1NO8A 3KLIA 1IVZA 4CCHA 1C4AA 4W92B 4UOGA 5DDOC 1U2FA 2J9DE 3BDPA 2PDAA 3GCXP 3SSRA 4TXSA 1NM2A 3EM1A 2VPYB 3HFVA 5KFZA 2XGPA 2IVYA 2HHPA 2ZKTA 3GJRB 4CO4A 5J2QB 4DF8A 5C7PA 5I4MA 2L41A 4WP8A 1RKJA 2MZ1A 1SV5B 1YG0A 3DLGA 1CJKA 3RUBL 2E5GA 2ZUGA 3GLJA 3VQTA 3KJVB 1EQMA 4LVNP 2AYMA 3NWRA 3P4UB 4C3MA 1JX4A 1IBLJ 2G4BA 1X5PA 1GMUA 4MH8A 2CNOB 1UA1A 4L3KA 5F8IA 3DOKA 3LAMA 4DV2F 5IT0A 2BMBA 1U2CA 4ECSA 3KDNA 2LKZA 1R0BG 4OYBA 4AT1B 4ZJLA 2H5IB 1M5SA 5CQGA 5KG1A 1DQAA 1JLEB 3KMQA 2EKYA 2KVIA 3AOCA 4IG3B 4IQMA 2DNLA 2AV5A 2B3TB 1D9AA 3M9NB 2CPDA 3D9BA 2E5HA 1SKSA 4P6QA 3WDOA 3CVKA 1Q8IA 3NGDA 4ELVA 4K4ZA 4JI3F 4JI3J 3HSDA 6FD1A 1T9XA 4ZJOA 3AD9C 1T05B 1HFEL 4RBUA 4TLQA 1S6QA 1XNRF 1NXIA 1NRKA 4Q0BB 4GKKJ 4PYDA 2AW0A 2FDNA 3W9HA 3VWSA 3MMAA 4RWXA 3RB6A 2LEPA 2HNDA 4I4BA 5D3GB 3QT5A 4NZ7A 4Q8FA 3NCRA 4F0MA 3UVJB 5LXRA 2ADCA 2WBRA 2POKA 2RS8A 4JI7F 2WSCC 4J9QA 2YWGA 1URRA 2BANB 3KJNB 4G1IA 2GFFA 4KH1B 3UDVA 1T3OA 3J80U 1FE4A 3KNAA 2ASYA 2F8EX 4TY8A 3W62A 1QVGR 1WKLA 1FKPA 3W65A 2VOOA 3CMQA 4ES2A 3Q8RB 1NK0A 2EC2A 3F73A 2GMJA 1XEZA 1VR6A 5HAOA 3GSDA 2ZH4A 2CJ9A 3TYTA 4WZQA 4C9DA 1VJQA 1TL1B 2HRYA 1P9YA 5KFUA 2FVQA 4MFBA 4PXBA 2LLZA 4F0HA 4M95A 1N34J 3M8YA 2HFVA 5CAAA 3R7SB 1F0XA 3MM7B 3SQGA 2G0CA 1NU4A 2I5JA 5FD1A 1KFSA 5AE1A 2HIYA 4CNYA 1UVMA 2YH1A 3POTA 3CJ3A 3SI8A 2W4PA 2LU2A 3O8WA 4CLTA 3M9OB 3G8TA 1L3TA 3GV8B 1ITPA 1PAEX 4P7TA 5IC6B 5E7OB 4FXWA 5LXYA 1ZPWX 2CJQA 1WKJA 3E3XA 3I6PA 4WFZA 4DSLA 2ATCB 2W24A 3AHPA 4L72B 3R7NB 4DQRA 2HMIA 1DY3A 1AUDA 1RAIB 2LVWA 4CI0B 2QLFB 4X4SA 2DNRA 4ER8A 1X4GA 2HK2A 2YXLA 3DDNA 3C2PA 4DQQA 2WONB 3TWZA 3U1MA 1BGXT 2CVEA 1IR1A 2LQ8A 1FDBA 1BQNA 3OHAA 4GKJF 3SFGA 1QUPA 1RI7A 3MHYA 2L9WA 3S8SA 3LF0A 1M5HA 4ZVTB 3OUYA 2BQUA 2B8QA 1S0VA 2WB1D 2CJYB 1B7YB 2CIMA 2HGNA 2PE8A 3BBBA 1IBKJ 4ANCA 2VBXA 1RT6B 4MMOA 3G8QA 1RQ0A 3ENWA 5EDWA 2Y9HA 3SV3A 1JXLA 2BE2B 5HL7Q 1IBMF 1WC5A 3TQEA 4C8LA 2FY1A 1WOPA 3BGRB 2Z30B 4A47A 4NMLA 2V4JB 4DV5F 3D1OA 1OY8A 1BQXA 2IJNA 5AXNA 4Y0FA 1S9FA 2ZH1A 4TVAB 5J2QA 1KLNA 2R2RA 4IUFA 2GAGC 1NH7A 4Q7AA 3FMBA 2FVCA 3EGVA 2QA4G 1N6QA 1CJUA 2M4MA 4WKRA 1RT2B 2N82B 2W2MP 3AJDA 3MAHA 2B7BB 1NNDA 5B0DA 1YRXA 2N4CA 1S9EB 3DLKA 4MIBA 4RW7B 5GAGU 2F7VA 1JB0C 4CLLA 1I94F 4QW9A 3TVZA 3VAFA 2HWHA 1AZSB 3MM5B 1KD1T 4TKTA 2Z2MA 4F4WA 1RWNB 3KK2A 3J7A1 2XYGB 3WC0A 4Q8EA 3RW6A 3ZNUA 4J9PA 2QT7A 2BJDA 1JLEA 1GX5A 3FC9A 4ZJQA 5KG5A 1R8HA 1HNXJ 1VQ9S 2JDJA 4ELUA 2MZTA 3I32A 3TVYA 1FX2A 4IDKB 2IMWP 4WXWA 2QTWA 2NZCA 1FFSB 3R2DJ 1UEVA 4PQAA 1OYEA 4ID5A 4J9RA 4DCPB 4CH7A 1T9TA 3R5BA 1NPRA 2HVEA 3I96A 4CWBA 1QJHA 4F26A 5GAHI 1VQ5S 4LF5F 2DRAA 4OZLA 2OJ3A 4Z2XA 3KUEA 2M70A 1X7VA 4WYLA 3QSYB 3BYPA 1DBDA 2UUCF 4WFAQ 4Y2AA 2FVRA 4M5LA 1U26A 4QIEA 2MSTA 2C3MA 3LP2A 1DLOA 2UV8G 1S1VB 1HBMB 6AT1B 3QJLA 3H5XA 2BKOA 2OAUA 1X4HA 2QGFB 3WX4A 2AJFE 5CABA 4KV8B 1HPZA 4IG0B 3N5FA 1MW7A 4J7CA 5EHHA 1NJZA 1XJWB 4CLFA 2OFGX 4ZDNA 4N47A 4Y2CA 3MFHA 1F3VA 3G96A 3SIPB 3S01A 1B3TA 2R7QA 3NGKA 3EPIA 4LF8J 3PCOB 2Z0GA 1RJJA 4LBIA 3DLEB 4M63A 1TFYA 3GONA 3OT9A 4RW8B 1LKZA 3SQGB 3KK1A 1SJFA 4GVBA 5F8HA 2E1RA 2WOMB 4NYZA 3W8GA 5KFBA 3F41A 1FA0A 2W1BA 3KLHA 1APSA 2BW2A 5SUHA 3ZTPA 1JIHA 1RWXB 2QFJA 4ZCKA 3J81j 3GV5B 1TU0B 3R1HA 5HROA 2YKNB 2MZJA 2G1HA 3KHGA 1FO1A 2HMIB 1PBUA 1VK3A 2RDDA 2R7TA 1FWKA 1VIXA 2OIHA 2PO4A 1RWWB 1VDHA 3M8PA 3NRBA 5DGAA 1RCOB 4QR2A 4HHUA 4LF9J 1VCTA 2V2QA 3K5NA 3JSBA 4NLQA 3SYZA 2O66A 2M5YA 2MGZB 4WK1A 3PX4A 2YNGB 3DRPA 4RO0A 5M2PA 2EW9A 4XDCA 4ZVPB 5C25B 1NKCA 4FPRA 3RR7A 5E3AA 4DR3J 2ZH9A 2UZAA 4YP3A 1VK8A 2HQGA 4DMZA 2E1PA 3E51A 3DXSX 3BKFA 2XNRA 3N6MA 1X4CA 2MPUA 2OEKA 4D3GA 3HJFA 4ED2A 3EVWA 2J7WA 3MECA 1XMQJ 3T19A 1KOOA 4N7TA 5HQLA 3HHLD 1RAFB 3HDSA 3CJKA 3GR1A 3IGNA 1RKIA 4QPTA 1EKSA 5GMDA 1N6QB 2ZBPA 2V68A 1RT2A 3HP6A 4HTJA 3GCWP 2GO9A 4U7UD 4LJMA 1FEHA 3HCXA 1AA1B 3N01A 1GEHA 2ZE2B 4J9MA 4F04B 1VC0A 1M90T 2IDEA 1N5VA 4X4UA 3R5DA 4R0JA 1OQ6A 3GFZA 1RAOA 2OLWA 3KK2B 2EBEA 2WHOA 3D67A 3K17A 2R8GA 2BKNA 4FYDA 3BH6B 1MG7A 2XBPA 4I0WA 1UWAA 4I6AA 4LF6F 2UXDJ 4IDKA 2CVIA 2RD5C 2V2ZA 3IRXB 2DK2A 3I0RB 2DISA 2BE9B 2QA2A 1W26A 3AJ1A 4OIXA 2YH0A 2MQQA 3G82B 3R6LB 2HHQA 2J6UA 1B7FA 1HBNB 2YWWA 1V3RA 4L73A 3UFCX 5LOQA 1NPKA 1Q81T 1HYSA 2VKZG 2VBZA 3OQ2A 4HEA9 4TY9A 4P73A 4RW6B 5J1PA 3K8WA 1FESA 1SKRA 1E6YA 1RHRB 2VG6B 3GJQB 4DS5A 3PYFA 2QZ8A 4DL2A 3BN7A 3P3DA 2X1AA 1NSPA 4MIWA 4OX9F 4JI0F 3OTEA 4NXNJ 1O8BA 2RRNA 5IOLA 1S7IA 2PMHA 2ZJPQ 2C3OA 3CD5A 1S1VA 3CCUS 4WIQA 1S7HA 4NX9A 2A6MA 2DJWA 1RTDB 3MXHP 4G1PA 2UXBF 1FWLA 1Y10A 3GMGA 2XTJP 3SQOP 2DXFA 3UCGA 3VAIA 2RIJA 5ETKA 5HANA 3BBFA 4KPCA 4NYPA 3WHIA 4ZCMA 5CD4H 3G71S 1IBKF 3DLJA 4R25A 1FD2A 1IBMJ 2DGUA 1RT7A 2BJEA 2CQBA 2GS8A 4LBPA 4ED6A 1GAOA 3A3OB 1XTZA 4X66J 1HR0F 2N3OA 2E9ZA 5FDLB 1CVJA 1RUSA 5EX3A 2PC6A 4RW8A 3S6EA 1RTHB 3KK1B 3U02A 2DR9A 1GQEA 4H4OA 4NASA 1DZ5A 1FERA 2HPUA 1LWXA 5LMUF 1GXLA 3RB3A 3MI7X 4BCAA 4Z7YA 1YITS 1XR5A 3K57A 3AFGA 4LRDA 1VRUA 4IOAQ 5KFMA 4ZVGA 4OV6A 3A1YG 4K7QA 4QWCA 3JQJA 1K9MT 1JNRB 4C8MA 2F4VJ 1KLMB 4CLZA 3PKMA 4MKBA 5D6GA 4KTQA 1IKWA 1HWUA 4UY85 4DL3A 1XC9A 1F5CA 1CPZA 5GAEU 5C25A 4FBTA 3HZEA 3CCTA 4A48A 4DR3F 1FXLA 2KT2A 1EX8A 1XN9A 2HAFA 1XK8A 5CD4A 1U1OA 2JHEA 2QLBB 4QJVA 1QM9A 1UJ5A 4DSEA 2A10A 3FRZA 4ZITA 3E2EA 1NDLA 2B6AB 4ZVUB 1PBAA 1R31A 1YJ9S 4DCOB 4MJKA 3VQSA 4O3RA 3NAHA 2KZZA 3PJ9A 1WOOA 1X4FA 2UU9F 5C42A 4I68A 4LRCA 1C1BA 4AL6A 4OZ0A 3MEDB 3LP0B 4PG4A 3R6GB 1U09A 5T41A 1U7LA 2B51A 2MQLA 1M1KT 3ETMA 1J5EJ 2AX0A 4E8UA 3C14A 1S1UB 2HZAA 2XMUA 1RABB 2LMIA 3HHLA 3Q8UA 3RGIA 5A8KB 1LW2A 2QL7B 1LFWA 2UVRA 1S0NA 3GYGA 1AUSL 1CJTA 5KFAA 3J7ZT 2VOPA 2F63A 3X3UA 5J2NA 1NZ8A 3OVSA 3W63A 1N52B 2IAJA 4QR0A 3OLBA 2JZ5A 4E0DA 5IT9U 2D69A 4LF8F 4F4ZA 2QSWA 3FZ2A 4KPYA 2R2UA 3TR5A 2XS5A 3Q8QB 1IBCB 2VFSA 3NXZA 1NDPA 2WTFA 1RHUB 2B9EA 3PW7A 2HZVA 3CO0P 3NG8A 4ERDA 3IMQJ 1WSVA 1URNA 3BZQA 5DG8A 3NGTA 4KHMA 4OYOA 4P2FA 1VBYA 3C15A 1FEEA 5HVFA 3WC2A 3KLFB 4ZP6A 3FCVA 2VF3A 4WK3A 3NNCA 1RAGB 1VC5A 3DMJB 1IBLF 4EFAC 4G65A 1IXKA 1LK5A 5ETNA 1ZOTA 3PYDA 2B8PA 1NDKA 1QTMA 1FJGJ 4DSJA 2N3LA 4LF4F 1DTTB 1NSAA 2E7VA 1BHNA 5D0RA 3DDKA 4DV2J 2KO1A 5J1EA 1NK7A 4HVZA 1H3DA 4I2PB 2MB0B 4Y2KA 1S10A 4DPOA 4DX5A 2A2DA 1RGVA 1RYRA 3HJVA 2I9SA 4F4XA 3QZ7A 1NUEA 4RNHA 4CO1A 1RCXB 3FJ2A 2HS4A 2WRMA 3DOMB 2XZWA 3OHBA 3JB9k 1Y00A 2O01C 4A8YA 1G3OA 4RUCA 4ZP8A 4KC5A 2KU7A 2JL9A 3LP1A 2FTRA 1T9UA 4IOBA 4KGVB 4CLSA 2CQ4A 2OD6A 3P45B 4HR2A 1KFDA 3VZHA 3CC2S 3MPDA 1WDDA 2QE5A 2G0IA 5ETRA 2MQMA 3QAEA 1MN7A 3SEOA 3H4DA 1XMQF 5AJ3F 1MWQA 3PW5A 1YTYA 2AU0A 2CA9A 1T05A 2GQQA 2GIFA 4PWUA 3TAMB 3CSKA 3VZIA 1K73T 4Q2MA 1ZM3A 2FY8A 4ZKAA 1LWFB 3T3FA 2Q6BA 1WC3A 1WEXA 2V9KA 2W2OP 2W25A 4MIAA 4MKAA 2XMMA 1N32J 3PY8A 1VQPS 3HO1A 1LNQA 4O3NA 2XI3A 3NS6A 1VRUB 1UVLA 2UXCJ 1F5BA 2WSEC 3PM9A 2GMLA 3ELHA 4KGXB 4DPYA 4KJIA 2R2TA 4W98A 1FTRA 1KLMA 3FUYA 1FVQA 2FJEB 1JLFB 1NZAA 2GNKA 1S1XB 2W7AA 2IYIA 2GJFA 1LWCB 3FBEA 5EWEA 3I56S 1H7XA 3TX0A 5HK4A 3R97A 1JLAA 1TKZB 4RUHA 3CUNA 1U1QA 5B0GA 2ZM6J 1N36F 3U27A 1IQZA 2K3IA 1TK8A 1H38A 4JI4J 3ZZ0A 1GMWA 3DHXA 5KFVA 4HYKA 2AYGA 2MLXA 4DR7F 4NI2B 2R3VA 2FGOA 2RQMA 2XSJA 2KM8C 4DL5A 1UPMB 3EVOA 1RWUA 3H90A 5JVGQ 4CLUA 1B0TA 2A1BA 2IFXA 3BREA 3HD2A 2E44A 3M32A 3MM7A 1YBTA 4UTGA 3RJMB 2VG5B 3BSAA 4EWTA 1YKWA 1JNZB 5C42B 2XMKA 1XNRJ 4GKKF 2VC0A 3POTB 4ZPVR 4ED1A 2FHOB 3DU5A 3VGVA 4JI5J 3CCWA 2ZOGA 2IJRA 3D6HB 5H9FK 2DHHA 2VFRA 1NHUA 3KJVA 2J8SA 4NL5A 4UF4A 1RBAA 1R6VA 3C14B 5DDRC 2VPZB 3QAUA 4DFJA 2AEMA 2IIHA 4NCGA 3T5LA 2E5LF 1Y4ZB 3MM9B 3TA1A 1CJTB 3NBPA 2IJFA 4M8LA 4MTPA 5HBMB 4I67A 1AW0A 5J2NB 1RAJA 2HNYB 3C16B 5G0RB 1NDCA 3SFUA 3VAGA 1IKVA 3F44A 5A6PA 2MKIA 3ISZA 3ZFVA 4LREA 5A8WA 4O3SA 4B3OA 3MEGA 4G3IA 1JQGA 1PAUB 2MHEA 2ZITA 3GU0A 1BUXA 5KFJA 5LJ5Y 4N5SA 1GXTA 1RT6A 4NLRA 5ETTA 1KONA 5KFXA 3OTOF 2H9ZA 3CJ2A 3IG1B 2MTLA 4EI2A 1TVRA 3PKYA 1LV5A 2FB0A 3PNIA 2JEJA 2CQCA 5B09A 5D4NA 3O3LA 5I42A 2BQ3A 4Q0BA 3Q86A 2JH3A 2XLIA 4EGLA 4DV4F 2HRUA 1KEKA 5D8HB 1A6LA 1KHWA 4QOTA 2CADA 1N88A 2HK3A 3AAWB 4OZ1A 4IO1A 3MMAB 1JWWA 2P8IA 1HQEB 3P49B 2XI2A 2F4VF 3IWNC 2XSFA 2B4PA 4EU0A 1S9EA 3DLKB 3GPAA 2UVUA 1SIZA 2J9EA 2IM0A 4MAKA 3HVTA 1HBOA 3L4BC 5L39A 4LF7J 4LF7F 1VBZA 1AZSA 2CUYA 2HVZA 4P75A 1Q0NA 1FWPA 4RLEA 3MCSA 2HNZA 4X4TA 4YHHF 3E8OA 3CPWR 4DFMA 4I6YA 1VQKS 3IM8A 3FCWA 3LP1B 3TO8A 2ZFHA 4ZPTR 4LF9F 5DDQC 1RP5A 5DZ7A 2MZSA 2YWEA 1VRTB 2JFDA 2D3ZA 1LXJA 8AT1B 1TL1A 1TKDA 2R8KA 5KAKA 3M8WA 2W2PP 1W25A 4TQRA 2HQCA 2J5AA 4OI0A 2ABYA 3UI3A 3CT9A 1IM4A 2CQGA 2H4WB 2EG2A 3FBBA 5AXKA 3TJ9A 5L1KA 3PX6A 3PFEA 1IJEB 1T9VA 2DB1A 3AB4B 2GC8A 2GVDB 2RUSA 4WE1B 3SZ2A 2AHOB 1X4EA 2JLEA 3MMCB 5LSLA 2C28A 1AYEA 4DSKA 3QT7A 2UXCF 4MKYA 2HHHJ 3D5MA 4MK8A 2VONA 1FK9B 3Q8PB 3W5YA 3G9CA 3TNVA 2ZDPA 3OVAA 1SC3B 1RWKB 1V3SA 4WTOB 1OQ3A 1LW0A 1RWVB 2XULA 3QFHA 3DI6A 3KK3A 4F4YA 3ULHA 2WVCA 2OKQA 3MM6A 4OLOA 9RUBA 5HVHA 3CGIA 4KV8A 3FGVA 1HMVB 2EK6A 4JI8F 4KYZA 2Z2YB 3OR1A 4TNOA 4YS2A 5F9NA 1HI0P 1MMDA 3QZ8A 1RTIB 1TKXB 4P7VA 2DKOB 3AOAA 1U8WA 1VJWA 1FVSA 3EXCX 2UVWA 3HT0A 3VAKA 3DLEA 1UCNA 2K7KA 3LH2S 1AXQA 3BGFA 3W2VA 1JXVA 1YRUA 2YKPA 2Z8QA 1C0UA 1TL5A 3EGNA 2OPSA 2MKSA 2V4JA 2EG1A 2VZ9A 4ZVQB 2A0FB 4ENOA 1M5KC 1S72S 4ECZA 2RT3A 2FZKB 4RNNA 5L1LA 7FD1A 3EZ5A 2V5HG 4JI1J 1F9HA 2V8GA 1YDLA 4LRFA 4HT5A 3QO9A 3DLBA 3UN5A 4EUVA 3EPGA 2YKNA 3OL9A 4QPXA 3J80Y 1SJ1A 4QYRA 3C19A 4DFPA 2NR0A 3NBPB 2AYEA 2AQ4A 4I7FA 3W3SA 2ZNZA 4A46A 5GAGI 3KLEA 4FYWB 4PKDB 3GR0A 2BQRA 2PA8D 2UUAF 4DOZA 1SJRA 5B0EA 3UPFA 3J81U 2W9AA 3RRHA 3PVXA 2UU9J 1REGX 4YB5A 2V8DA 2YNGA 3CCZA 3Q8VA 1S4EA 5HQMA 4UOCA 2DIUA 3NS7B 5DM7Q 4PQUA 2OEJA 1UA0A 1ROFA 2HVIA 2V8PA 1QE1A 1TV6B 2CZ4A 4H4MB 4HH0A 2MYFA 2WB4A 4MK9A 4OYPA 4U9RA 1MMNA 3AH6A 4ID5B 4QIVA 4WTYA 1CJVB 4ITSA 2Y3YA 2J9DA 3RYLA 3TW0A 1T95A 2ZWOA 5H9EJ 1I1GA 4YY3J 1CEZA 1HD1A 3U7JA 3TZWA 3GG1A 3JTNA 2D9OA 1YZ7A 3DRRB 2SXLA 1F9EB 3OXFA 1NBEB 3TZXA 3HVRA 3PO5A 1T9YA 2FLOA 3OXLA 5KFYA 5HQ8A 2VJVA 2DGQA 4RKUC 3IBFB 4G6VB 4KHPJ 2DH9A 4ICLA 4AE5A 2QMXA 4RBTA 2BYCA 4PCQA 2LYVA 4QIFA 3LPEA 4O44A 3MPYA 5B0CA 1KTQA 5DZ6A 9ATCB 4LMZA 2M2BA 4P2SA 4DX7A 3KUGA 5DQGA 3OV7A 1LWEB 3Q89A 4JI8J 3FQLA 1GNKA 3ITHB 4JI2J 2O67A 4ZN1A 2HNZB 5DETA 4GO5X 2UXBJ 2XO7A 2HFOA 2D1CA 3K5MA 1EP4A 2G13A 2MJUA 2O3DA 4EYHB 1RHQB 1VRTA 2H3EB 2VPWB 3PRBA 3IRXA 3I0RA 2Q3PA 3HT3A 2FJWA 5KT5A 3CC4S 5I3UA 3ZC4A 2HFZA 4PPDA 1QAJA 2GJ2A 4GVBB 2AGQA 5FLXY 2AYBA 2XY5A 2V2KA 3HFKA 3EMTA 1XR7A 4C8OA 1TMJA 4QIWD 2Y1JA 4IOCQ 3MMCA 5HVGA 3FRYA 3GIKA 1VBXA 4DSIA 4JV1A 1UEKA 2M52A 2GAHC 5IT9Y 1DQ9A 3OL7A 3I4PA 2IVFB 4IR1A 4LBHA 1N33J 3ZZZA 3RW7A 5JMNA 4C97A 2GA7A 4DFKA 2FHJD 3DI6B 2VKRA 2YKOA 4W4MA 2Q43A 4NLSA 5HMYA 3EX7B 2VA2A 2ILZA 1RT1A 4B3SF 4UY8T 1ZM4A 3SDEB 2PEBA 3US5A 2KM8B 2VDHA 3MTKA 2QMWA 2ZC4A 1RTIA 2D3O1 3N9UC 4J9LA 2VA3A 1Q1KA 2LCWA 3DLHA 3K0JA 2FJVA 5KFNA 4ED8A 1KQGB 4DU7A 3KWMA 4ELTA 3GYXB 2WW4A 4U6PA 2VG7B 5FDLA 3R3TA 1JLGB 1C0UB 4Q45A 3BO4A 3MECB 4TLRA 2HBZB 1U6FA 5B0AA 5EWGA 1IKXA 2VH7A 4ALZA 2XCPA 3HHNB 4DUYJ 2LDYA 4NEYA 2QMUB 2COLA 2GQCA 4X4RA 4DR1F 2XMWA 5CXTA 3W9IA 3AJ2A 4ZMMA 1Q8LA 2B4OA 2VC1A 2WCXA 3H0PA 3ZTOA 4DBQA 3M2RA 1WELA 2OSQA 4X2BA 4I69A 4OZ2A 3ZNJ1 4CTAA 1SJ4P 4Y28C 2BJ9A 5KFWA 4KY3A 3M2VA 5THWA 3KXDA 3AD8C 4W90B 2MKKA 3NKYA 2RKIA 4DUTA 1U6ZA 2K2PA 3GSIA 2FYXA 4PWWA 4DV7F 2KTQA 1AFJA 3KYLA 4PQUB 1PC4A 2FJDB 2U1AA 2DPJA 1QAIA 4X4OA 1RT4A 4ZLPA 5HO4A 4YR0A 2LU1A 2ZZMA 2CKWA 4CLKA 4OJ1A 2B6AA 3QQCD 4I1TA 1CJVA 4KBIA 2KXHA 4NWBA 3V4MA 3TZZA 1YGYA 4RUBA 1NSKL 1RBOB 5GAHU 1VQNS 1WEYA 2RS2A 3RRKA 1FJEB 1HYSB 2LXUA 3L95X 3IBWA 4FNHA 4FN5A 4XIUA 2DNGA 2R7OA 2YPZA 3MCNA 3V6DB 5D4PA 4HH1A 3M9MB 3VVTA 4OI4A 1J27A 3THTA 1UJ6A 1Q95G 2FHKA 3OBIA 5LMNJ 4OYXA 4DCJB 5DQIA 1U1KA 4NE9C 2NLWA 4ZS6A 4F8RA 1U8SA 2DXEA 2VD3A 1FRJA 2JEGA 3QMQA 1DRZA 4B3RJ 4AXJA 2GX8A 3M7VA 3ITHA 2FD2A 3M6VA 3BQ1A 2DHAA 3EE3A 5HATA 2IAJB 2AZ3A 3H8YA 2ZKUA 2DEIA 4YR3A 4LSZB 1S6OA 3QLHB 4R0EA 1YSJA 2DNZA 2YTCA 3ADAC 4KH0B 2GZOA 3JS9A 1SL2A 1HW9A 1EETB 2CPJA 4OZNA 3RBDA 4PAAA 2QG9B 2DO0A 1RAEB 1GFWB 2QYCA 2VB6A 2CRLA 3O44A 1F2HA 3C15B 4MYTA 5D77A 3KLFA 1REVB 2BX6A 2Y1RI 1DHMA 3DNCA 4DQSA 2HIQA 1QAXA 2G1DA 4WPAA 3V5RA 1U25A 1FNMA 3CDUA 3VAHA 2BA9A 1PCAA 3BO3A 2RF2B 1S6PB 2QYGA 2ZC3A 4OMFG 4RW9B 3TEHB 3WX8A 5J1EB 2XG8A 1Q82T 4I2PA 4OHXA 2PI5A 3ZZYA 1TK0A 2HVDA 5IM0A 3C6UB 2XWXA 4DL7A 3HX9A 3QT8A 5F41A 2EK1A 1S9GB 1PYTA 1KHVA 1KN6A 1R27B 2CQ3A 2R4FA 3NCQA 2N4DA 1S99A 5ETLA 5C2CA 3PW0A 4ILMA 4EBCA 5EUHA 1JLBB 1TMMA 1Y0HA 4DEZA 4E98A 4TU8A 2KFYA 3FBFA 3H42A 4CZCA 4QYZK 5F8LA 3D0HE 2QL9B 5DLGA 2D74B 2MZQA 2YBVA 2XCAA 1N5TA 4N41A 1HNWF 4ILRA 2B9YA 3S7RA 4X66F 3M8RA 1HR0J 3BGUA 1Y11A 2BVZA 3LGNA 2DGSA 4P2XA 2KRRA 3RAMA 3V81B 3LWLA 4LFCJ 1ELOA 2V50A 4DR5F 1BMQB 1FDNA 2YX1A 3DHWC 3MEKA 2MLZA 1WSRA 3CE8A 3P5TL 3QWUA 4HDHA 2Z2LA 1NAQA 1C1BB 3AODA 2V34A 5KOWA 2CQIA 4KO0B 4DR2J 4EBEA 2CQPA 3B6BA 5KFSA 2HLTA 5BR8F 1I94J 1V3ZA 1P1LA 1ZA1B 1M1HA 3PR5B 4OJ3A 2VODA 1HQ2A 1RB0A 3M2RB 3M6XA 4KRWA 3B54A 3MEEA 4CM0A 3T1YJ 3VCDA 2ZBRA 1RYSA 3B8HA 2CFXA 2J0XA 3K5PA 3R5AA 3W61A 5F8MA 2BBEA 4DL6A 1NB7A 1UFLA 2C3UA 2NYIA 4DS4A 5FIIA 5KG7A 2FUG9 5ITHA 4J9SA 1ZM9A 2E5JA 2Y1LB 1TKZA 1SJ3P 2IA6A 1XNQJ 2QEXS 1HD0A 3UR3C 4C8ZA 4USHA 3ILJA 1MROB 2Q79A 3NWGA 4I2QA 4AL5A 1RU1A 1Q8BA 4M1KA 3W2WB 4B08A 1K8AT 3BSOA 5F8NA 1DARA 5CYMB 2HQDA 4FYVB 4OX7A 3MR3A 3JSMB 1HNZJ 4C6AA 1RK8A 2ZUAA 3OFEA 3CCMS 1K0TA 4IRCA 2HGLA 8RUCA 1T11A 3W66A 1VQ8S 2NXUA 4N76A 4NCGB 1Z4UA 2CNKB 3QRRA 1GX6A 3MM9A 3A4TA 3LGHA 3UD3P 3SSSA 2MLYA 5HP1B 4UZBA 2CNNB 1CQMA 4N56A 2A6OA 4BDPA 1ULRA 3MZIA 1IKVB 3PACA 4DV6F 2RB7A 3CXCR 2V63A 1FRIA 3CIZA 4G1QA 2IM1A 2CZ9A 4B3MJ 3H40A 1FX4A 1N34F 3CC7S 3B78A 5KFPA 2JEIA 2B5JA 1R8CA 4DL0C 3MFIA 1CULB 4RU2A 4FF2A 1C2PA 5J2PA 3QNWB 3EZOA 3CCQS 1FRXA 1QSLA 2E9RX 2GMHA 1VMBA 4KT0C 2CJBA 2VHGA 3C8YA 1N48A 3D1QA 3UNGC 1KKHA 3PEJA 4DI6A 4NLWA 1R3NA 3TAMA 2W9CB 4DUYF 4B3TF 4F02A 4XPEA 2EVZA 2VFTA 4I64A 1VQSA 4ECWA 2BJ7A 2GGPB 3H5SA 3LQVA 2CQ2A 4NPOA 1IWAA 5BR8J 1M5OC 3A12A 4OYWA 2FVPA 1NK4A 2VQEJ 1TR0A 5DG9A 3DOLB 2YX4A 1IUJA 1Y5NB 4KGZB 4OI1A 5IWAJ 3ILOA 2K7JA 1J5EF 2OPQA 1VQ4S 4IRKA 3CCLS 2H54B 3C6UA 1QAYA 3LAKA 2EFQA 1ICEB 3FEZA 1HNVB 3B82A 1HBOB 1TUGB 1EB0A 2MY7A 3DRSB 4KSEB 1HBUA 2IYGA 2DBBA 4L75A 3QIDA 1Q5VA 1KWMA 3JQMA 4Y6IA 4QWBA 4DV7J 5E5NA 3UO0A 2VFUA 2N7YA 3OFHA 2UUAJ 2DH8A 1TKTB 1UKUA 2RRAA 1X9SA 2H1YA 1L3SA 4U95A 4QQBA 2ZH6A 2KN4A 1PIEA 3PW4A 1NCLA 3HF5A 4PUOB 1YWXA 1OMSA 1LFPA 3VV2B 2E1AA 2B4UA 2XSJB 3VR1A 2KRBA 2JRSA 2ASLA 4DR4J 1WI6A 4M5MA 4P72A 1P9QC 3ETOA 1WOSA 4USMA 3HVAA 2ZJQQ 3HKWA 2CNLB 2ILYA 1UAWA 1Y9OA 2VG5A 2BXJA 3GIRA 3MD1A 4OQJA 5ETQA 3OUYB 4ED5A 4UQGA 4WE1A 4JI7J 2J7UA 1JLQB 1GMVA 1RDRA 4M5JA 2G2OA 1X60A 2ZD1B 3AQPA 3ET6A 3IWXA 3T9NA 5EGYA 3H5YA 1WUUA 5KFIA 4F4KA 1FNOA 3EGWB 1SC1B 1FK9A 4CP5A 4LSNA 1PG5B 4HLBA 2C3PA 2CPYA 4HI1A 3D6TB 4FF4A 1GH8A 4CT9A 1PSDA 3F0NA 1VIOA 2C2ZB 2K06A 2F3JA 3MURP 1ZZNA 2X3GA 3E01A 2RHSB 2MKHA 3CW2C 1FRHA 3FDSA 4Y00A 3JYTA 1C4CA 1RXOB 1SL0A 3DRXA 4JV2A 5A8WB 3J7YI 1UVNA 4B3OB 3HVWA 1X31C 2KG1A 1W2IA 2WBMA 3RTVA 3CJRA 3I0SA 4DF4A 4BC7A 2OGUA 2HBRB 2YNIA 4I2QB 3LOUA 4ZIVA 5DDPC 2DHGA 2GVZA 2JJ4D 2R2SA 4ECYA 3EUNA 1RTZA 1RZMA 2KYXA 2MKYA 3FMWA 3IG1A 3L09A 1UZHA 3MR7A 4F3MA 5CYMA 4X4PA 1QTNB 3ZTQA 5E41A 5AJ3J 1N56A 3HSJA 3CCVS 4USIA 2HAIA 1X5OA 2OPSB 4M5DB 3A13A 4LIRA 5B7WA 3AD7C 2CYYA 5T7LB 1HI8A 3ZXWA 1OY6A 3IGVA 4CO0A 4CQ1A 4XK8C 2Z2ZA 5KFTA 4UOHA 5H1SV 2DNYA 5KFHA 1T7PA 3CJTA 2DNMA 5CZXA 2CWKA 4I56A 1YI2S 3ZZRA 4BBYA 3MAQA 3AQOA 2KT5A 3MUTP 1Q79A 3KJFB 1U1MA 2E1MC 2XLJA 3BQ2A 2Z58B 1UWBB 2YX7A 2E5IA 3HVTB 4MT1A 2W2NP 3UQSA 4ZLNA 2W4DA 4OHWA 3CEDA 1U1RA 4C8KA 2DNKA 2C22A 4ECRA 4R5PA 2V4RA 2XM3A 1KR4A 4G1QB 1SUQB 1G7CB 4O3OA 4X62F 1B0PA 1HNXF 2DCUB 3D66A 4QW8A 1D1UA 2DR6A 4IQXA 4ZK7M 3TARA 1WC1A 5J2PB 4KKOB 4CO2A 3BPDA 2AMCB 5ETSA 3ZZPA 1D8ZA 1VHIA 3MR5A 1IN0A 2VU5A 2FC8A 3KFWX 3V4IB 4FF3A 3K5OA 3LALA 2X1BA 3Q2SC 2W9CA 1WEZA 3VVUA 2GVDA 2GGPA 4DPXA 4ZP9A 2V2VA 4L76A 1T94A 4IYQA 2EFVA 4ETXA 3RR8A 3PJXA 4HT7A 2FJBB 3QJJA 4JYAF 5DG7A 1OSDA 1S48A 1N5QA 2BW7A 2HFSA 3H59A 4KHRA 4ZVEA 4CM2A 5AE2A 3R5JB 2AGOA 3T6JA 3MM6B 3CO9A 2AT1B 4ZHRB 4CLWA 2CJXB 3BH7B 2ZOMA 5KFCA 4DZ6A 5LSRA 3M1VA 4DLGA 1S79A 3L7UA 3GV7B 2PSZA 4ZP7A 1DURA 4WFYA 3A8JA 2KXNB 1TELA 1M1GA 5IQQA 1F3FA 1YRTA 4EBDA 1T02A 1WHYA 5I3UB 3R27A 3IO1A 1F6TA 1NJYA 4N8OA 1WI8A 5D3GA 4M5HA 2ZH8A 2XMJA 4K5SA 1ZAWA 3CTRA 1JJ4A 1N33F 2B56A 4USVA 2MDAA 4DN0A 2H48B 4R8UA 1FDAA 3Q22A 5C24A 1NK9A 3QO9B 2MQNA 3D3CJ 5KG2A 1CJKB 2JWNA 4AXIA 1WACA 2DNOA 3BGOP 3FSXA 3SSQA 4A8OA 1NJXA 3NMAA 1FKOA 1S1TB 2AJQA 4K8RA 5E3QA 5IQ6A 2KHDA 3I4HX 2IRUA 4NOHA 4UW2A 5DO2A 3OFGA 5CYQA 1HL6A 1S5ZA 2GO8A 4F3QA 1NHVA 1WD6A 2EEYA 1RT1B 2KYZA 2PT0A 1PYOB 1VI7A 2XEXA 4NA1A 1SXLA 4O23A 3GWCA 3SCIE 1UZDA 3CJ0A 3SDEA 3T5HA 3T5KA 4ZIWA 1B0VA 4F3OA 1PJ6A 4IG3A 1WHVA 2YNIB 3HFZB 3O1LA 1N0VC 3EICA 3CCSS 4F67A 5IV4A 1B99A 5HSPA 5K20B 3PW2A 2MGZA 2RQ4A 4YFUA 1CG2A 5IS2A 3A8IA 2CQDA 5JXSA 4ES3A 1ZM2A 1E6VB 5KT7A 4A8MP 5A2QY 2K8GA 5IC4B 3L3CA 3D6FB 3DRRA 3ONQA 3MGJA 1IKXB 2HQ3A 2JC0A 2CDQA 2J76E 2M3DA 2RNEA 4Q2LA 4P9SA 5F0WA 1JJCB 3JAMY 2XGQA 4AL7A 3QJPA 3CDBA 2ZZNA 4ICLB 5L38A 4DV1J 4I6WA 3CULA 4IH5A 4PRFA 3AY0A 4NLPA 3UVJA 2BUNA 3TRGA 4RW7A 3MM8B 3FSYA 1SCJB 1RWOB 4LQ9A 3OL8A 4EZ9A 2BABA 2BANA 3FBCA 2CXEA 2FJAB 4NLYA 4CTAB 3OLAA 2CDRB 2UUWA 3BEGB 4X4QA 4QIGA 1R43A 4O4GB 3QPIA 1C0TA 4QBUA 1FKPB 3I55S 4A8KA 2Y8YA 1SUQA 2RKIB 1YZ6A 1YJTA 4P10A 4WWSA 1S1WA 1EP4B 1FJCA 2LECA 1DAXA 1GMWD 4QU7A 2DO4A 1RLDA 1WF0A 1RT5A 1RWPB 4FS2A 1PKUA 4LF6J 3V4IA 5HN0A 4P74A 3BN4A 3G6XA 4YY3F 4YMEA 3KDOA 1AB8A 1U0HA 2IMOA 2NSCA 2Y1IA 2XS7A 4NZ6A 5CCLA 3VGSA 5LMNF 3HHKA 4LFCF 2HHUA 1Y5LB 4OJHA 5CH7B 5D0GA 3Q24A 3UW1A 3V6DA 5F3ZA 3DYAA 3PG9A 3CD7A 3M05A 1JKHA 3F56A 3UWTA 4PPZA 1WC0A 3DKDA 4NLTA 3LP2B 4TYBA 3CJ8A 5C5JA 1PILA 4CNZA 4TYAA 1H98A 5HJYA 4Y34A 1Q4RA 4OLPA 1IWGA 4DR4F 2WONA 2LP4A 1KOHA 2PIIA 3HI9A 4IG0A 1IQTA 4PG8A 1S77D 2P6TA 2RHQB 2DRDA 3R1LA 2V0NA 4KB7A 3P6YC 3M1VB 2QN6B
chains in the Genus database with same CATH topology
1KS2A 5B0FA 5K8NA 1JJ2R 4WYWA 4K0KF 3VAJA 1BC6A 3C66A 3UCZP 4A8FA 1JLGA 1REVA 2YVSA 3TOQA 1BQMB 2DT9A 2IRYA 3IFEA 4L6V3 2HG4A 3HHLC 5H9FJ 4DR6F 4URGA 3KLGB 4FVCA 1S6PA 2ZHAA 1OPZA 1F9FA 1A9NB 1VQ6S 2P6SA 1FKOB 1S1TA 3CWJA 3O6QA 4K2XA 1T8EA 5K5MA 2MQOA 3M8PB 4CIOA 2J0QD 4QZVB 4RX6A 3GB0A 2NUUG 3H20A 2MKJA 5EUHA 5CYQB 4XDDA 3CB4A 1R0AB 4AUKA 4YQWA 4OHVA 2IVMA 1WG1A 3H98A 3TP2A 3HKZD 2YKMB 4F2RA 3ENVA 4BHQA 1FRMA 4Q44A 4GC7A 4KR0B 1NH8A 1HW8A 4ED7A 2E9TA 1HWIA 4H4KA 1WHXA 2DR5A 3ISNC 2JOQA 5L8RC 1FJGF 4MYUA 4YB7A 1Y5IB 4OI2A 3LPYA 3GQCA 3N28A 2XY7A 4KQZA 2M9KA 2RE1A 2DVIA 4EEYA 1TUVA 3MWBA 5ADZA 5CA5A 1WTFA 5KFEA 3VAMA 2XS2A 3MM8A 3MEEB 4NA2A 1DLOB 1DFDA 1HBMA 2OMLA 5DQHA 3V6KA 2M0GB 2LA6A 1A7GE 4X4VA 3I9ZA 3T9ZA 1HPZB 1C0TB 4N8NA 2HHSA 1IR0A 3DRYA 3U1NA 3DGPA 3V6JA 4AYBD 2DR7A 3QLHA 2BM0A 2RILA 2EFPA 4X65F 2AGQA 1S1WB 4J9KA 4WIIA 2NZ4A 4DDFA 3WZ0A 1MROA 2F8HA 2RJZA 5K8MA 5IZHA 1HNZF 4Y65A 1OPIA 3IR6B 3M6UA 2OTLS 4B9MA 2NREA 3NCPA 3DM2A 2HYIB 2D9PA 4C11A 1Q7LB 1FKAF 3OJSA 4KAIA 1L3UA 3HHEA 3V6HA 3PFOA 2RDIA 2L9NA 2AD9A 4OZ5A 3DYAB 3GFYA 1JKHB 4RNOA 4RW9A 2LQ9A 5HROB 4OI6A 2BOPA 3BB5A 3H5UA 2E7XA 2CPEA 1ZTTA 5D4LA 2E29A 5IM0B 4A8QA 3AB2B 3MDFA 5KTQA 3A8EA 5HP1A 4C8YA 1WF2A 1UP1A 2YWKA 4K59A 4DUZF 2ZH2A 2ZH5A 4AFFA 3TUIC 2CPXA 3DRPB 4M94A 3KKFA 3EGZA 2DIVA 2GQ2A 2VBWA 4IFVA 2MJNA 1R8PA 3PDNA 2ROEA 1N8RT 1HARA 3EYZA 3IAS9 4ZOSA 5J1NA 1CC8A 2JVRA 2JLGA 1RTJA 1YHQS 1HHSA 4PR6A 1T03A 3KG1A 4WFXA 1PC5A 3FQKA 1H0HB 5A8RA 3CD6S 1GTHA 4WFNQ 3I5AA 2C2DA 1BQMA 4K50A 2L3MA 4DQPA 2PA3A 1D9FA 1ZETA 1H2TZ 3NL0A 1N5YA 3B4MA 2CJKA 2OTJS 2GCFA 1D8YA 3DOLA 2L9DA 1XWLA 3CJ5A 2UUBF 5F0UA 1XBWA 3SXLA 1R89A 5AXMA 4ETZA 3MTJA 4WCEQ 2ZVSA 5DS7A 1U4BA 1O5JA 1XMOF 3DRSA 1IKWB 4TU9A 4K4WA 1UJ4A 4QR1A 2ZHBA 2BZ2A 1XERA 3DXBA 4OFZA 3HMJG 1TKTA 4H4KC 1U49A 3W7BA 1X0FA 4NCBA 4L3NA 2BV3A 1Q7YT 1VQLS 3CMAS 4LQ3A 3DC2A 2EFOA 2LQJA 3TA0A 2ASJA 1N32F 1U1NA 3CDWA 4NXMF 1SIWB 4ILLA 1WF1A 2MHNA 1HHTP 1X4BA 5GVQA 3S1TA 3JSMA 2W7OA 1SL1A 4OL8A 4J37A 1E6YB 2RU3A 1JLQA 1KNZA 2KI2A 3LP0A 2ZD1A 4Y2IA 4GO7X 2EFGA 2DCLA 5E0OA 4C3KA 1QY7A 2B7CB 2HWIA 2KT3A 2DGVA 2HHTA 2RRBA 4V19J 2OSRA 2YNHB 2O1PA 2MY8A 4JUZA 5F3TA 2KJWA 4PXCA 5KFDA 3SCJE 3E01B 3NS5A 3JYTB 4AQYF 4UUWA 2L48A 4ZVFA 3FSIA 2I2YA 4IH6A 2I0XA 3NLCA 2RQKA 1MU2B 3QGGA 3PEHA 4RBVA 3GIIA 4O3QA 3NNHA 2B5JB 1DJ0A 2FC9A 3EXYA 3OJUA 4WF9Q 1HWKA 2GHPA 3IR5B 5KG6A 4Q5VA 4IFYB 1SH3A 5KG3A 5KG4A 4IH7A 1YJNS 3DM2B 5DLFA 4YDXA 4FNIA 4M5DA 3OTDA 5E33A 1N5SA 2C2RA 1Z2LA 3I82A 3RU0A 4XO0A 1C1CA 2HS0A 2OPQB 1TZ0A 2B43A 2WSFC 1R8AA 1X0PA 3BR9A 3M2UB 1HBUB 2FGCA 3FEXB 2A2CA 5E2QA 3PV8A 1UL3A 5EN1A 2HHVA 3IA0A 1HNIA 2OP5A 1NEEA 4IFVB 3D28A 1H7WA 1Q86T 4ZA1A 3DLLQ 2MKCA 2ACYA 1KTVA 3EZUA 3I5CA 4KFBA 5LL6d 1ZH5A 2DHXA 1T03B 1X8DA 2DGOA 3G6VA 4FBUA 4FF1A 4WKYA 3BM7A 5E3RA 4ZPCA 2VUGA 5HMXA 3PJWA 3QIPA 4NRUA 1Y3KA 1N5YB 2J6SA 2D3OR 1UFWA 4IKAA 2VQEF 2W9AA 1NJYA 1AFIA 4ILMA 3N79A 1ZAXA 5A6WA 3MMBA 4Q43A 4GC6A 4YOEA 3BS9A 3WBZA 1LW2B 2N7CA 4KIAA 5BYQA 3J7YU 4EYIB 3H2VE 3ZZOA 4DQIA 2B9WA 2FPHX 2LXFA 4C0OC 1NJWA 2BR0A 2AJ0A 2JEFA 1Q78A 1JLAB 2GV1A 3GFHA 3I0SB 2OPRB 1JK9B 5I3PA 2CQ1A 1XMBA 2Y0SD 1OIAA 1KSPA 2OPPA 1SC6A 3MPWA 5BYRA 3JSRA 1L5UA 5IXUA 4LIWA 5L9NA 2FJXA 3M32B 4GMKA 4IO9Q 4QYZJ 1UW4A 3LUYA 3BSCA 4WU3A 2Z4PA 3T1HF 1D3WA 5T7LA 3MUVP 4R8UB 3CCRS 1CC7A 4DL4A 3FEYB 3MR2A 1HQUB 1I6JA 1JJHA 4U7UK 2YWHA 3AA8A 1VQOS 5KFRA 2MXYA 4JI2F 2YNHA 1UWBA 4WFBQ 2CPHA 3CDAA 5EX0A 5HBMA 3TAPA 3DOMA 5G0RA 3KG4A 3O5TB 4R5PB 2UV8A 1P27B 3MEGB 4RW4B 3TAQA 1M5PC 1DTQA 4ECTA 4NRTA 2W8KA 3IS9A 2GJIA 2CJAA 2DRBA 4F25A 1N0UA 4HTIA 2BM1A 5JVHQ 1TQLA 2UVVA 2D7SA 1E6VA 2F40A 1SH0A 3G4SS 5I42B 5K8OA 5F8JA 1O51A 2OD4A 5LT5A 3OSNA 2QRRA 4NZ0A 4ED0A 2EBGA 3T5JA 4C4WA 1ZYQA 4FXVA 2R8IA 2W7PA 1BY9A 2IRXA 3KTQA 2XWYA 5CCMA 2GHWA 1JLFA 1S1XA 2DH7A 4PG5A 2KZMA 2I1RA 1U47A 2E66A 2ALZA 4LUBA 4DG1B 3HLUA 3GYNA 3U1LA 1X4AA 1HNIB 3QGHA 4NYOA 1NKEA 2HZCA 2KH9A 1Q53A 1YJUA 2NQPA 4KFBB 4JOUA 1SBRA 1PGZA 5L9XA 5LJ3Y 3KHHA 5G4DA 4PG6A 2FHJA 3UE2A 3G8SA 4BS2A 1M0SA 4C0BA 3K58A 2B4VA 4QWAA 5C24B 3QIPB 1RISA 4FP9A 4HI2A 3C3LA 1V9OA 3GG0A 4PXDA 5KFQA 3LWMA 3G6YA 4DSFA 1P6TA 4TN2A 1MWZA 4USJC 3RAQA 4FVMA 2NUHA 3VF0B 4Z37A 2IBOA 1LW0B 2YY3A 1SJQA 4C0HA 6FDRA 1JXEA 2HNYA 1OO0B 2C2EA 4IR9A 2LA4A 4NA3A 5DJBA 3M6WA 2DNNA 4A8SA 1X5TA 3CIMA 4RWWA 4NLGA 5KT3A 1LXNA 1TKXA 3D54A 2K1RB 3MUMP 3KLIB 2J8AA 2CPIA 3IR7B 4DV3F 1OWXA 1FXDA 1V6HA 2PN6A 1TVRB 3C46A 5L1IA 3W2VB 2CZVC 2OO4A 5J2MA 1YIJS 1LK7A 1NK8A 3KHRA 3G6ES 4RUAA 3GILA 1J5OA 4HKQA 3SCKE 2DD8S 3BF4A 1X9MA 3KLGA 1HQEA 3LGMA 4JI1F 3ICLA 1HWJA 1Y3JA 2D3UA 2XC9A 4ECVA 3ZZUA 1FHTA 2WK4A 4LVOP 2R7RA 1NK5A 3DU6A 2IHR1 3N6LA 4I7FB 4JV5F 1RT3B 3N6NA 4BWJA 1TP7A 3KLEB 3IRWP 3PX0A 1HA1A 3BGLA 4DWIA 1R0AA 4O4GA 5K8PA 2JX2A 3FFIB 1DTQB 5U47A 5AXLA 2DTJA 2YKMA 4B9TA 2KDOA 1YJRA 2QSFA 1JLCB 1F60B 1TV6A 2P5VA 4H4MA 4Q8FA 1RA7A 1VLYA 3M30A 1RT5B 3K8VA 4HL9A 5KOXA 2VASA 5DGBA 2JSXA 4NCAA 2A18A 2J7KA 3AA9A 3H2UB 2HHHF 3BO2A 2BDPA 3QGIA 5HMWA 3RZAA 2P9CA 2V94A 2HNDB 1KQKA 3R5CA 3HK2A 5KT4A 2QO3A 4C7QA 4U67Q 5KFOA 4V19X 4O44B 1HI1A 4KGMA 4MK7A 4JI6F 1CSJA 1LWEA 3KK3B 2PMZD 3KHLA 4DG1A 2R7WA 1HMVA 3DCAA 3OR1B 5JJBA 2DNHA 5B08A 5K14A 2QA4S 1U1PA 1VGYA 2IM2A 2JFKA 2HFNA 3B4DA 4MFBB 1RA6A 5MAOA 2QIFA 5E3CA 3L7OA 1K1QA 4DLEA 1UVKA 2M7SA 2QLWA 3OXGA 5M2UA 2I5JB 4N77A 4Y2MA 2ASDA 1X9WA 1VQ7S 2LEAA 4ZPBA 1LOUA 3D0IE 4YB1P 3KNGA 3HM9A 2Q1LA 1SV5A 3KG0A 5HI7A 2XHWA 3DLGB 2ERRA 4RU2A 5DM6Q 3IAM9 3IC1A 1VHFA 2P9EA 1NKBA 1L3VA 5I3QA 1N54B 4CO5A 2ZH7A 4J9OA 3QYYA 2I8EA 1SB6A 3PXGa 2EWHA 4JV0A 1N4LA 2FLPA 1MMLA 1R8BA 4LT6A 4ECUA 1WTBA 3OTBA 3RBEA 4NLOA 1H2VZ 3BSNA 1OS5A 4J9NA 1U48A 2XNQA 3SCLE 1QE1B 3OTCA 3TA2A 1RTJB 2BE2A 1SQEA 3THVA 3BGRA 5J2MB 5A8RB 2XB2D 2AGPA 1U2RA 4C3LA 1TL4A 1S6QB 5DRKA 2DGTA 2F1FA 2ZH3A 4PWDA 2LQBA 2CPFA 4FZVA 1WG4A 1J5OB 3PZPA 2K3KA 4FS1A 2HLUA 4YEAA 5CZVA 4B9LA 1R6YA 2M8DB 3TVKA 4NXNF 2PGCA 1VQMS 1ZZFA 1B64A 2V9WA 3M2VB 1P1TA 4TY8B 1ZTWA 4B17A 3RRGA 4B9NA 3BDEA 2FVSA 2GIQA 3MPVA 4ZPDA 4JI4F 3FFIA 2LEBA 1W2BR 4LFBF 4ID8A 2MZRA 2IM3A 5IFMA 2KFNA 1QSSA 4QU6A 1RT4B 3I9V9 4C2MA 2Q66A 1JLCA 3MOZA 3T1AA 4F2SA 1SI9A 2DITA 2GW8A 3M30B 5JUMA 3PIOQ 3SV4A 4OJGA 4DR2F 1AROP 1UETA 3IWLA 3N5BA 3TI0A 5K9FA 2FLNA 5FJ4A 1CQNA 4KE5A 1H6KX 2RMLA 4C11B 3J81Y 1VOMA 3TQ1A 4LFAF 2HVHA 4YR2A 4OZJA 1IJFB 2NPFA 3M8QB 4ZVHA 2DGWA 2ZOFA 1FF2A 2AJ4A 4YB6A 2PI4A 2ROGA 2PD1A 2RUGA 1BWEA 4K4VA 3D2WA 1K0VA 2LQ5A 3O2IA 5M2RA 1JMTA 3KMSA 2BRKA 5AE3A 4WU2A 3J7Z5 3CCES 2YNFA 1UEUA 2QLXA 3N4WA 1NJIT 1YVFA 5F9LA 1VQYA 3OL6A 5K14B 3VALA 2CG4A 3T6BA 1KVJA 1MU2A 4XAKA 2UXDF 4K5RA 1S49A 1EETA 2O5DA 4KGKA 3X1LB 3Q23A 2VG7A 3OPKA 5IT4A 2VFVA 3K5LA 4ES1A 4IFYA 1FNXH 3FCHA 2KXFA 1MWYA 3G86A 3UD4P 4H54A 2F9DA 3CD0A 3Q0AA 1TK5A 3VTIA 3NAIA 2HW3A 2WW8A 2PEHA 1L3KA 2EC0A 1FTCA 2RVJA 5L1JA 4O4RA 1Z1ZA 1D9DA 1Y7PA 1S4FA 4DV1F 4WJBA 4ED3A 2KHCA 3RB0A 4BC9A 1XNQF 1QUVA 3MM5A 3M4XA 4B9UA 2ZBIA 2AF6A 2I38A 5E3PA 2XLKA 1Z2ZA 3TUJC 1JLBA 2HHXA 3V2UC 4PXEA 2CQ0A 2RSQA 1K1SA 1FRKA 1R7IA 4NLDA 5KFKA 2KG0A 1FXRA 3MD3A 4RNMA 3V81A 2EFNA 3ENQA 1ZAVA 2EI5A 3OFFA 4PWDB 5CHCB 2G9OA 4ECXA 3H2LA 2DR8A 2VPXB 4KO0A 3GIJA 4KHPF 1MSWD 5GAEI 1CLFA 3MMBB 5GMKa 4DN9A 1OSCA 3K59A 2M88A 2ZE2A 3FNNA 1X5SA 4B02A 2QA1A 4JBCA 5KT2A 1QLNA 3KLVA 3NMRA 1FT8A 2UUTA 5BYSA 2VV5A 2AWZA 2E1CA 3BJYA 3QWPA 3TUZC 4EZ6A 4DX8H 2X1FA 3UCUP 5EWFA 2OFHX 2RDJA 3C6TB 2IA0A 2LXIA 3DN9A 2VBYA 2NSBA 4LSLB 2VL1A 4C8NA 3CCJS 2YKQA 3PHEA 2OPPB 5B0BA 2VQFF 3HHDA 2AJ1A 3W2WA 5SZTA 4FXDA 2XNRA 1VS3A 1GXUA 4ATNA