1WTFA

Crystal structure of bacillus thermoproteolyticus ferredoxin variants containing unexpected [3fe-4s] cluster that is linked to coenzyme a at 1.6 a resolution
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
81
structure length
81
Chain Sequence
PKYTIVDKETCIACGACGAAAPDIYDYDEDGIAYVTLDDNQGIVEVPDILIDDMMDAFEGCPTDSIKVADEPFDGDPNKFE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ferredoxin
publication title Identification of variant molecules of Bacillus thermoproteolyticus ferredoxin: crystal structure reveals bound coenzyme A and an unexpected [3Fe-4S] cluster associated with a canonical [4Fe-4S] ligand motif
pubmed doi rcsb
source organism Bacillus thermoproteolyticus
molecule tags Electron transport
total genus 18
structure length 81
sequence length 81
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2004-11-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13370 Fer4_13 4Fe-4S single cluster domain of Ferredoxin I
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.20 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1wtfA00
1JNRB 3LW5C 3C8YA 1B0VA 1Y5IB 1VJWA 6FD1A 1ROFA 1XERA 3MM8A 2IVFB 2UZAA 1DFDA 1FEHA 1Y5NB 1A6LA 1Y4ZB 1FDAA 2VPYB 3MM7B 1BQXA 1GT8A 5E7OB 1WTFA 1H7XA 2VPXB 3IR6B 2Z8QA 3MM5A 1SIZA 4XDCA 1K0TA 1IQZA 3OR1B 2PA8D 3MMAB 2FJDB 1KQFB 1FERA 3EGWB 3MMCB 2C3PA 1RGVA 5BYSA 1BD6A 1FXRA 1FDDA 1FRJA 1KQGB 2PDAA 2XSJB 4AYBD 1G3OA 1PC5A 1GAOA 3OR2A 2FD2A 4CI0B 7FD1A 3MM6B 1FDBA 3MM7A 2V2KA 3MMBB 1JNZB 3MM9B 2GMJA 2VKRA 1C4AA 1FTCA 2WSEC 1FXDA 2WAQD 2VPZB 1GTEA 2V4JB 4DHVA 1KEKA 2WSCC 2Y0SD 2FDNA 1FD2A 3MM8B 1GTHA 2FJBB 1FCAA 1FRXA 5BYQA 1SIWB 1DAXA 4XDDA 2PMZD 5FD1A 1BLUA 1F5BA 4ID8A 2ZVSA 3GYXB 1FDNA 1Y5LB 3MM5B 2FJEB 4XK8C 5CH7B 1FRMA 5BYRA 1CLFA 4OV1A 2O01C 2C3UA 3MM9A 4OMFG 1PC4A 1Q16B 1F2GA 1FRKA 1FRIA 5L8RC 1FRHA 3OR1A 2C3OA 3PNIA 3MMAA 2VPWB 1R27B 1SJ1A 1AXQA 2FJAB 3EUNA 3MMCA 4YDDB 1JB0C 3IR7B 6FDRA 1F5CA 3OR2B 1DURA 5CHCB 1B0TA 1H98A 1HFEL 7FDRA 2GMHA 2XSJA 1H0HB 1G6BA 1B0PA 2WSFC 3EXYA 1C4CA 2FGOA 1FRLA 4Y28C 1FF2A 1BWEA 2C3YA 1IR0A 2C3MA 3MM6A 3IR5B 4KT0C 4RKUC 1H7WA 2C42A 3MMBA 3HKZD 4L6V3 1D3WA 2V4JA 2WB1D 1BC6A
chains in the Genus database with same CATH superfamily
2ZH3A 3S7RA 4PG6A 4B17A 6FD1A 1VQLS 2VASA 3N0VA 2UZAA 1T03B 3MPVA 5LMUJ 1E6YA 2AZ1A 3W2WA 1HWJA 2ZH7A 2OGUA 4KY3A 3IBWA 2WBRA 1PIEA 3OL8A 1U1NA 1SCJB 3ENQA 3O2IA 1FFGB 1NJWA 3GIIA 1PAEX 2IPOB 4U96A 1XJWB 4CP5A 3VAIA 3SYZA 2QIFA 4K8RA 4I64A 2IYGA 2CWKA 3GG0A 1HW9A 5GAEI 1TAQA 2QFJA 1G7CB 3ILIA 3DYAA 5KFIA 2H5IB 3R5AA 4M8LA 2O01C 1BUXA 2L9DA 2RRBA 2MKIA 3EDQB 5L1LA 3PNIA 3W9IA 4ZMMA 4DFKA 1CJUA 2NXEA 4XPEA 2OP5A 4USKA 5L39A 2PD1A 1YJUA 2GHWA 5D3GB 3AOCA 2MGZA 1NH8A 1NPPA 5CXTA 1TUWA 2CXEA 4RX6A 3POTA 3JSBA 3G6ES 4RWXA 4TY8A 4CLUA 2OD4A 3RYLA 3IBFB 3MEGB 4RLEA 2HS3A 2IHR1 2ILYA 4QWAA 3PY8A 2FHMA 5J2QA 5L1IA 1HNXF 3DLGA 3DRPB 2A3JA 2KT3A 2H4YB 3OJUA 2OO4A 2JLFA 2RF2B 3Q8QB 5AXLA 4USJC 1YDLA 4DZDA 4JI6J 4H4MB 1KDNA 3C6UB 2ZBQA 3M2UB 4EZ6A 2V67A 2I5JB 1CS4A 3NCPA 1Q79A 3FEYB 4KQZA 4ZKAA 2GIQA 4QW9A 5KFRA 2FYXA 4X4TA 4X65F 1T9VA 1HARA 4FVMA 3JQMA 1UJ6A 3PJWA 2NXUA 5F8IA 4WFNQ 1H74A 3RB0A 4K2JA 3L95X 2X1GA 4URQU 4GC6A 1X60A 4XDCA 1PILA 4LQ9A 2JDJA 4KTQA 4N47A 5C24A 1WC5A 4ZP7A 3DLHA 3RUBL 3THPA 1S1VB 3BF4A 4CYUA 5G0RB 2K7JA 3IO1A 3MM6B 4AD6A 3HHEA 2DGWA 4UQTA 4JV0A 4B9LA 4DHVA 2DK2A 2Y8YA 5MAOA 3BPSP 1HI0P 3NGKA 3BDPA 3BYRA 4TN2A 3JQKA 3PHTA 1N5SA 4Q0BA 2VG7A 3G8TA 4Y3CA 2C3UA 2B5JA 1F9FA 4HEA9 3HHLA 1T11A 4RWWA 4LBIA 4OZJA 3TVZA 2I1RA 4OFZA 3L3CA 4DV5J 1MLAA 3KHGA 3LANA 3AH6A 1OYEA 4P9SA 1JLGA 4QWCA 1NB2A 4LRBA 2E5LJ 3TAPA 2HHVA 2VFUA 1B99A 3GZ7A 3IXQA 1HBMB 1M1GA 2ZBRA 3QPIA 3GFZA 3D6FB 2QYGA 3GIMA 2V9KA 4KB7A 3Q8SB 3A13A 1U2FA 1YJTA 1RU2A 4KGMA 1CQNA 3E51A 4FKYA 1A0OB 2JOQA 1SI9A 2R8IA 1P1TA 1KNZA 1GFWB 2NS1B 5HVFA 4NA1A 1VRTA 4FNIA 3BR8A 2H9ZA 1RWWB 3TUPA 2RHSB 2F63A 2KG1A 3KHHA 1TL7A 2DPIA 3PX6A 2A6MA 2V4JB 3D6TB 3M1VB 4R5PB 1R8CA 2Z2LA 2DNRA 3NXZA 3GFXA 3T6BA 1DLOB 3D6MB 3N5BA 3MDFA 3OJSA 4WKYA 3K17A 2FVSA 5HROA 4WXWA 1N0UA 3KJQB 2IIHA 4DSFA 5L8RC 2EG2A 3QSIA 1R27B 1JLCA 2NSCA 5LL6d 1B0PA 3I6PA 5KT3A 2DPJA 3M8YA 3UFCX 4RKUC 1WDTA 2DYAA 4OHZA 3PACA 2JEIA 2V4QA 1U45A 3QRPA 4FXVA 1TFWA 1S6QA 4OYIA 2OSQA 4ZS6A 1RAOA 2VA3A 2ABYA 3Q0AA 1TL1A 1BQNB 4A46A 3EE3A 5HLFA 1HQEB 3OTOJ 2P9CA 4TLRA 3PW2A 2W7OA 5CZVA 2R7OA 3RBZA 2CUYA 3HLUA 2C2OB 2M52A 2ZE2B 4MKYA 5HL7Q 5ETOA 3CVKA 1MWYA 4LF8J 3SMZA 3R2CJ 5HATA 1SQGA 2A10A 1H2TZ 3A3PB 1A7GE 5C5JA 4OHYA 2KZMA 5K8MA 2XHWA 5KFUA 3D68A 3QSYB 1RAIB 2FJVA 2F65A 3EVWA 2OLWA 4O4GA 4XTTA 3N4WA 3KK1A 4Q45A 2D74B 5IWAJ 2UU9F 1U49A 5DS7A 2DGXA 1JJ4A 2PFDA 1IUJA 1FWKA 2QC3A 2F8HA 3DU5A 3LP1B 2CPDA 3W9HA 4WYLA 2MQPA 2W7PA 1ZPWX 1U6BA 1LWEA 2PN6A 3NGRA 2AD9A 2K1RB 2EBGA 3HJFA 1T3NA 3CIMA 1YLXA 3LTOA 3EGZA 2DR5A 5DRKA 1ZBTA 4NLSA 4P6QA 2GIFA 4U8YA 2W4CA 2GMJA 3JAMY 1PYSB 2IMWP 1RTJB 3F41A 3AA8A 3EJMA 1QVGR 4ZCMA 1XIQA 2P9GA 1RISA 1LW2A 2EFVA 1YK9A 2ZBIA 3OLAA 2ZJPQ 3OR1A 2Q3PA 2HQFA 1LW0A 2HVDA 2DH7A 1RYSA 2J6SA 5CD4H 1H98A 1IWGA 4RNFA 2HNDA 5J1NA 2GVZA 4RNMA 2G13A 7AT1B 4JYAJ 3EWGA 4B3TF 2BQ3A 3JSRA 3BR9A 5RUBA 3KHLA 3MAAA 4WBFA 4F25A 3LGMA 4NXMF 1YBTA 2KHCA 4JI2F 1BWVA 2UUTA 1NJIT 4ZLLA 2FLLA 1RT2A 2JJ4D 3TYTA 4DV6J 1MU2B 2XZDB 3UN5A 4C0HA 2CADA 3N6LA 4OYXA 2GJIA 3SSQA 1WKJA 2DNPA 3KG1A 4DF4A 1V3RA 2WSCC 4UF4A 4O0NA 4OI0A 5EGYA 2GZOA 1GMWA 1N88A 4CO0A 3N28A 1WNEA 1RQ0A 2Y1RI 2HHSA 1MG7A 2HRTA 1KN6A 4K5RA 2DB1A 2CPFA 2HVZA 5I3UA 2RB7A 4LF2A 4KGXB 3IRXA 2POKA 2MSTA 2FHJD 1N48A 2QLJB 5HMYA 4LF1A 1VRUB 3TUJC 3NMAA 1Q0NA 4FZVA 5D15A 3MOJB 3T41A 3EM1A 1QM9A 1RACB 4G1IA 1Q8IA 2EPIA 5CYJA 1HNVB 4YHHJ 4AQYF 1VCTA 5LM7E 1IBKF 1XN9A 1QSSA 4Y34A 3RRKA 3W60A 2XNQA 1RGVA 2YNIA 4C0BA 4I2QB 1RTIB 2CJQA 1RT4B 4CDIA 7FD1A 4DR7J 2Z2ZA 2KH9A 4DWIA 5F8JA 4J37A 4FYDA 2OKQA 1ZM9A 2HVIA 2PMHA 3PYFA 2DHHA 1I3OB 4Z7CA 3IAS9 5IXUA 4M5MA 4G3IA 4WWSA 4KIAA 4DXLA 2UV8A 5DGAA 3QRQA 5T14A 3OTBA 2ZVSA 1C1BA 2HHHJ 2XCAA 2MDAA 4ZPWR 1CPZA 4NWBA 4FNHA 4X62F 4ZP6A 3DCAA 1CJKA 2EK1A 1S72S 3D6HB 2WBMA 3CEDA 3QWPA 4MKVA 2F4VJ 1PYTA 1U8WA 2DXDA 1HR0F 3CMAS 4PG4A 3U02A 1NHVA 2A2DA 5ETRA 3K57A 1WWHA 2UUWA 1V9OA 1F9EB 2HGLA 2DIUA 1TELA 2X1FA 1N32F 2IM1A 3M6UA 4ILRA 4DR6F 3PR5B 5GAGU 4KPYA 1SIZA 3ZZUA 1TP7A 3ENVA 2ZH8A 3VGVA 2FQQB 3TAMB 3P5TL 3NCRA 1HNIB 1VK8A 4YB6A 3GG1A 3T1AA 2OAUA 1HNWJ 2YY3A 3K5LA 2HAIA 1C4AA 1FTCA 4MFBA 5FDLA 1LEOA 1XK8A 1RBAA 5CZXA 2HNZB 3U1LA 2ROEA 4X4OA 1FD2A 3MM8B 1UAWA 1OSCA 3MM5B 4FF2A 4JI3J 1XR5A 3MMAA 1N5YA 4U7UD 2WONB 3VALA 2BKPA 5BJRA 2B8PA 1B7FA 3NY0A 2ALZA 1E6YB 4DPWA 2FGCA 5LJ5Y 4M5NA 3DI6B 4ED3A 3KDNA 5BR8J 4O44A 3M05A 4F4ZA 1AYEA 2M2BA 3AOAA 4J9KA 4DFJA 5L1KA 3I5BA 4OYOA 1VDHA 3BN4A 1KFDA 3HP6A 2XG8A 4W92B 4I2PA 1FNOA 2E9RX 2K3IA 1UL3A 4IG0A 4NZ6A 3KJFB 3E2EA 4TQRA 4CTAA 3EVMA 1SJ4P 5DJBA 2KXNB 2J8SA 2QMUB 3J81U 1YJWS 4NYZA 3W5XA 2N3LA 4O3SA 4HACB 3H2UB 2QJ3A 5A0YA 2LQ5A 4DV4F 1B70B 1FK9A 2XC9A 2Z57B 4GVBA 4C8LA 1SJ1A 1RCXB 2HNYB 2MKCA 4DCOB 1GMVA 4HHUA 3GCWP 4ZVEA 2V69A 2D69A 4R8UA 1QVFR 1DJ0A 1SXLA 2UVRA 4TQSA 3NBPB 4J9SA 5F9NA 3DLGB 3M8SA 3AJ1A 1TQLA 1CEZA 4IH5A 1P8GA 4TU7A 2BE7D 5J2PB 2DEJA 4WZMA 1TMJA 5E3AA 2IA0A 4KAIA 1JIHA 2PIIA 4L75A 2R7QA 4OI3A 4RUBA 3GFYA 1B3TA 1G3OA 4ZVTB 3CC7S 3D54A 1CS4B 4NCGA 2KZZA 2O3DA 1L3UA 1UVKA 2PSZA 2HGMA 2M70A 1NDPA 4X2BA 1Q95G 1QE1A 1CJTB 4DBQA 4F0HA 2MLZA 1UKUA 4OV1A 5IC4B 2LECA 2DNZA 1TK5A 3QT5A 1EARA 4B9VA 3ZZOA 2C22A 1IM4A 2AYGA 1RTDA 1F60B 4IR1A 2AYBA 4AT1B 2AIRB 3V2UC 2GMHA 2GCFA 4MK9A 1VBYA 3C16A 5I4MA 2BRKA 1YQHA 3ITHB 1RWNB 4RBTA 2FIUA 1I94F 3RR7A 3W63A 3US5A 3TZWA 3UN3A 2BVZA 3Q83A 2QE5A 3SXLA 4ICLB 4CO5A 1TKXB 2LU1A 1VMBA 1NK5A 1SVDA 1T05A 1UWAA 2ZVIA 1XNRJ 4ZA1A 1VQ4S 2AGQA 3D7SB 5A2QU 2Q79A 2ZH9A 1F5AA 1FE4A 3AJ2A 1U1LA 4EZ9A 3QZ7A 3PW4A 4LF5F 4ZCLA 4Q0BB 2MZTA 3I5AA 3KNAA 2Z4PA 1ZZNA 1EQMA 3DOLA 3A3OB 3HHLB 2GHVC 4DV1J 3VTIA 3MR2A 2AJ0A 3ZTSA 4DG1B 1N36F 1JLGB 4PG5A 3ZTQA 4URSA 5K14A 3TP2A 2FB0A 4S0MA 2DGVA 2IM2A 1SUQB 1WF0A 2V2ZA 1MN9A 2E1PA 1LWFA 4QIWD 1WOPA 2FY1A 2XZWA 2WZ1A 3CCJS 4ZJQA 2R3VA 4WIIA 1S1UA 4FF3A 2W8LA 5HANA 1Y5NB 4X4RA 5J1PA 4A8SA 2F7VA 1U0HA 2HHWA 1HI1A 3OT9A 1UWBB 5D0RA 2IBOA 3MMCB 2ZBPA 4YEAA 3M2RA 1SJRA 3L09A 4J9PA 3KLEA 2KM8B 1WACA 5DQHA 3FBEA 2HWTA 2JEFA 1UZHA 3H98A 1VOMA 4A4JA 5HROB 3BGFA 1RBOB 4NLRA 1CBKA 2YKQA 3W8GA 3F73A 3MEEA 2QV6A 4DUTA 4RU2A 4DR1J 4NCAA 3WX8A 2VB6A 2H3EB 4BWJA 4PXCA 4DQRA 2IM0A 1YGYA 1EZZB 2APOA 1IR2A 3TW0A 4BHQA 2ZZTA 4HVZA 1FNMA 1XEZA 2E5JA 1U25A 3BSOA 1WC1A 3MECB 2C3YA 2W2MP 2ZOFA 5T7LB 4DR4F 4L6V3 3D5MA 4KC5A 4CLTA 3HM9A 4USTA 3KLGA 3R97A 2Q6CA 1CC7A 4K2XA 3TOQA 1WOOA 1BHNA 4G1QB 3SQOP 1BQXA 1DQ9A 2HS0A 2X7IA 3K89A 1DZ5A 2BYCA 2Q6BA 5E0OA 1S49A 3OW2R 2L9NA 2QG9B 3EVOA 2V50A 3UR3C 2ATLA 1VS3A 4F36A 1YSJA 2GGPA 1CULA 3GR0A 2WAQD 3N9UC 1O5JA 3CW2C 2RH3A 3IS9B 2B4VA 4FP9A 4ED0A 1S9GA 2VQEF 4O4GB 5LXYA 1F9HA 2CQHA 1QSLA 2CDRB 3KK1B 1UTAA 3A1YG 3CIZA 3AJDA 2ERRA 5HJYA 4DV3F 3UDEA 4Y00A 1VC5A 1QD1A 2V8PA 4OX7A 1C0UA 3MEDA 5IS2A 1H0HB 3EXYA 2AQ4A 2CNOB 4YY3J 4HHHA 4KH1B 4LMZA 3M4XA 2LEAA 4LFCJ 2VBYA 1L3TA 2VG5A 5GMKa 4RW7A 4ZVPB 1NKCA 3QGPA 4LSNB 2J6TA 4G65A 1HYSA 3ETMA 3PO4A 2JC0A 2UUBF 3TUZC 5ETTA 2XY7A 4DJBA 1S77D 2HWIA 4AYBD 2EBEA 4CLWA 1YG0A 2LQ8A 3T5HA 4FXWA 3KJVB 2FHKA 3U1NA 1YBAA 1LW2B 1FXDA 4LF4J 2WVFA 3P96A 3ILOA 4KHPF 3T1HJ 2XNRA 1LWCA 3I0RB 5KFYA 4DSEA 2L08A 4RPFA 4USIA 4DR4J 1EP4A 4XIUA 2VL1A 2GVZB 2DITA 2FVCA 2YWWA 2ZM6F 1NRKA 5IC6B 4WFXA 2ALYB 4DU7A 4JB8B 4HR2A 5B09A 3G2XA 4Y6IA 4OI6A 4N76A 1M5HA 2ZH1A 1NZAA 5DQIA 1IR0A 4RW4A 1HBNA 3CD0A 1X9WA 3D1OA 3AD9C 1SC1B 2QA4G 2RILA 3E01A 4RZRA 4PR6A 1ROFA 3DGPA 1L5UA 5HMZA 3SDEB 3DU6A 1X9MA 4DMZA 1KS2A 1WHXA 2VQEJ 4YB5A 2KL8A 2GV1A 3K8WA 2N7YA 3P5BP 1H38A 3L9ZA 3BS9A 2EFNA 4UW2A 4BDPA 1X7VA 2RNEA 1JMTA 1FNXH 3GWCA 5A8KB 3DDNA 4ZHRA 1S57A 3I5CA 1WEXA 3QJPA 1H2VZ 1AROP 3MR6A 4KO0B 5IT9U 5E3PA 1KHWA 2JC1A 1RWOB 3OD2A 3RAXA 4DSLA 4OZ1A 2R4FA 2CJAA 1MN7A 4JOUA 2AJFE 2W9CA 5J2MB 2B4PA 1LV5A 3QYYA 1ZOTA 2YNFA 3UCUP 3KK3A 4ECWA 2Q66A 5B0FA 4NASA 2B9XA 3IG1B 4IR9A 4W4MA 5E3RA 1CVJA 3M2VA 1QUPA 2F3JA 1RJJA 2CDQA 4CH7A 3MD1A 4JV5J 3G71S 1TR0A 1HW8A 3MOZA 3CC2S 5HP1A 2DIVA 1CJVB 5KFXA 4ZDNA 3P45B 5FLXY 3VAMA 1JLQB 3LP0B 1IJFB 2HQDA 1CJKB 4C4WA 5HVHA 1Q5YA 4I4BA 2D9OA 2HIQA 1H2UX 5F3ZA 4KHRA 1VIOA 4WP9A 3PYEA 4USHA 2EFQA 4AXJA 4ZVRB 2JLGA 1SBRA 1VBKA 1LK5A 2IJFA 4USWA 2C2ZB 2IVYA 2J0WA 3TNVA 2VBZA 1GQEA 4UT4A 2HFSA 2B8QA 4NRUA 3FVYA 2QA1A 3NP5A 2YNHA 2KKHA 1FD8A 4PEOA 1ZAVA 4NLGA 4ZVQB 1JJ2R 2NSBA 2ZD1B 2UUAF 5HBMB 1NDKA 3HD2A 4ANDA 1TAUA 2WCXA 1KONA 1KR4A 4MFBB 4OYWA 2W25A 1SKUB 3PRDA 1ZS6A 3SCJE 1Q82T 5KFEA 5KFVA 2B51A 4Q2LA 4MAKA 2ZDPA 5KOXA 1H3DA 4USUA 2XLIA 3LWMA 1IXKA 1VIXA 1NJZA 4DV7F 5GMDA 3CF5Q 1IBMF 1UEKA 1U09A 4MH8A 4UZBA 2MZ1A 2YKNA 1B7YB 1KHVA 3BGRA 2E1RA 4B3SF 1J5EF 1KFSA 3Q8UA 2EW9A 1NZ8A 1LXNA 4WE1A 2CYYA 3NOGA 2CRLA 4O44B 1AXQA 1S12A 2I9SA 3TX8A 5DDRC 4M5KA 2DNHA 5L9XA 2G2OA 4Y28C 1R31A 4I2PB 2V8DA 3MCMA 2HHTA 4A47A 3LW5C 5EN1A 2I0XA 1NKEA 2W01A 2QT7A 3CDAA 4N5SA 5B0CA 4ZOSA 3CJ3A 3LALA 4KH0B 3FQLA 2OD6A 4PQAA 4CRJA 1Y9OA 2BE9B 1VQ7S 3DKDA 2D3ZA 1WTBA 3D66A 1SB6A 3AD7C 4JI0J 3W65A 3PR4A 1UVLA 5A0YB 3QFHA 4DI6A 1SV5A 3DHWC 4LVNP 5C42B 1NH7A 2XWYA 3OL9A 1PCAA 2F9JA 4ZK7M 2BJDA 3MXHP 4E8UA 1FDNA 1GH8A 4X4QA 5IM0A 4LSLA 4HL9A 2VU5A 3ZC4A 1VHIA 4PXEA 3VV2B 5J2NA 4I6YA 3UO0A 3KHRA 4LF9F 1L3KA 2QSWA 3G8QA 2R8JA 1RTZA 2MTLA 1A9NB 2VOOA 8RUCA 1X5OA 1N5QA 1OPZA 4DLGA 4A8YA 4OX6A 1JLFA 3UE2A 2E9TA 2YPYA 2BQUA 2DHXA 3I0SA 1M0SA 1QE1B 2X3DA 3BSCA 1JK9B 3OFEA 4B3RF 2I38A 4IQXA 2NXCA 5CYMB 4JI5J 3R1LA 1VJQA 1SPBP 1REVA 5DDOC 1XR7A 3QIPA 4F67A 4OYPA 1Z2LA 4FS2A 5C25A 3AQPA 2XMVA 4JI7J 2FHOB 4J90A 1VQYA 3KYLA 3FSIA 2EVZA 3QJLA 2NR0A 1RT3A 3FBBA 2OTJS 5DLFA 1HQUA 4U7CA 1XMBA 4LRFA 3D28A 4NI2B 2CNNB 3ILLA 2FUG9 2HQGA 2ZHBA 1SKSA 3T5KA 4B3MF 4M1KA 2LCWA 3RZAA 4YR0A 3CJ2A 4DU8A 4OZ5A 4DL7A 3EMTA 1JLBA 4ZPVR 4F4KA 4MYTA 2GMLA 3JYTA 3J81j 1QTNB 2G0CA 1NB7A 4IG3A 3MAQA 3DOLB 2MQNA 1B4SA 3OFGA 3DRXA 2IY5B 4O3OA 3R27A 3QAEA 1E6VA 3QO9B 4WK3A 5A8RA 4MIAA 3M32B 5GADI 2HZAA 5K14B 5CYQB 3WDOA 1KVKA 3CULA 2MZRA 3O44A 4WKRA 1U1MA 1RAEB 2NLWA 2XMMA 3GJTB 1FJGJ 1DAXA 4PUOA 3A8KA 2DH9A 3Q86A 3AY0A 4X84A 1FRIA 4N8OA 2M7SA 4RNOA 3W66A 1J5OB 2Z30B 4KV8A 2NZCA 2W24A 2OPQB 4K4XA 4ED1A 3ZO7A 3J7Z5 3BJYA 2J8AA 3QT7A 1VQNS 3CJ0A 2RHQB 4LBPA 3CO9A 4XAKA 5F41A 4HDHA 4TYAA 4KRWA 3MGJA 2PI5A 5JMNA 1JNRB 4JI8F 4CM2A 3AT1B 4N7TA 2JH3A 4G1PA 1TFYA 1GX6A 4K4WA 2PMWA 3K5OA 2QEXS 3GSIA 3G4SS 2QA2A 2HQ3A 3KLFA 2ROPA 1IKYB 1PKUA 5A8WA 4PQUA 2EFOA 5J1EB 4MTPA 1NDLA 1OQ3A 1UVMA 3BQ1A 3AB2B 4OX9J 4B3MJ 1DTTB 1S9EA 3V81A 1FKOB 4IOCQ 3OL6A 3HT0A 3GYXB 4NLVA 4F3QA 2JZ5A 1NSKL 4IDKA 1L3VA 3BYPA 4ERDA 5D78A 1PJ6A 4YN3B 1VQ8S 1RTHA 2ZJRQ 3M7VA 2RVJA 5DM6Q 2J9DA 3DOKA 3HI9A 3IGNA 4ALZA 3C19A 4KT0C 4OZ0A 1IBLJ 2W2QP 4O3PA 4WFAQ 3K5PA 3CCLS 3LQVA 3PYDA 3CJQA 2P5VA 3MTJA 2IVFB 4B9SA 2VONA 3HO1A 3GILA 1JXEA 3UD4P 1ULRA 3R6LB 4HKQA 3R7BB 1Y11A 1N8RT 4YQWA 1FXLA 3P8BB 5I42B 1N6QA 3SIPB 4LFAJ 1KTQA 2ZITA 1ZPVA 3RBXA 4Y2KA 1YRUA 2UUCF 1FWLA 3RR8A 1U8SA 4J9VA 2LLZA 2VUGA 4W98A 4F7VA 3MURP 4CI0B 3CE8A 1UVNA 1NCLA 1OS5A 1PSDA 1S9FA 2CA9A 4CM0A 5KFZA 1YHQS 2BEFA 2YQ0A 3NKYA 3BB5A 3EGVA 4J9RA 3FMBA 4LREA 2FJEB 2HLUA 1OIAA 2B4UA 5DM7Q 1N34F 4QCLA 3NOCA 4PG7A 1HD0A 4Q5VA 4NPOA 2ACYA 1N33J 3T5JA 3ADAC 3QBCA 3NNHA 1RWPB 1IKVB 1H7WA 3KLVA 5EWFA 3NNCA 4U8VA 4I7FA 4CO2A 2CPJA 3H5UA 1UJ4A 2VC0A 2HVEA 5KFCA 2G2YA 2YNGB 3VAKA 2D3UA 4KPCA 3L7PA 1S1TB 2KU7A 3M8ZA 1X5SA 4OI4A 3LP2A 3QLHB 2UXDF 3NWRA 3R3TA 2E7XA 3N5FA 2RKIB 4DUYJ 2ZZMA 2E44A 1VBXA 1QUVA 3PZPA 1FFSB 4K59A 2VG6B 2VBWA 2RQ4A 4CLZA 3QATA 2VZ9A 2AJQA 4YR2A 2K06A 1OWXA 5KFWA 3TX0A 3TUIC 3QAUA 2HLTA 1F5BA 5JXSA 1KLMB 4KKOB 1VQMS 3UN2A 2AYEA 4M63A 1U1PA 1U6ZA 3DHXA 2JSXA 4H4OA 3J7YI 4PZVA 1JLAB 5JJBA 4Y2CA 2MKKA 2OPPA 1JB0C 2DNOA 4RU9A 2OELA 3BKTA 3KLHB 4B9NA 3SQGB 3JQJA 4QIGA 1CSJA 5AE1A 4B08A 4LBHA 3V6KA 2BJ8A 1P1LA 1NNDA 1XNQJ 3LF0A 1ZM4A 2VFRA 3PIOQ 4NX9A 2J9DE 1JKHA 2HKEA 2WK4A 2MPUA 2J7UA 4OL8A 1K0TA 3Q8PB 3GR1A 2DNMA 1WG1A 4DQSA 3KLIB 5KT2A 3HHLC 3QJJA 2Z58B 3U1MA 4F4WA 1TKTA 2FDNA 2HRYA 3MUTP 1QTMA 4LF6F 3DDIA 4QR1A 3KTQA 2YKMA 2ZH6A 4U95A 3TQEA 2XMKA 2ZUGA 3R5CA 1NO8A 4NLQA 1CC8A 5KG1A 2UVVA 3QZ8A 3M2VB 3LPYA 2KTQA 1IM6A 2QLWA 4ETXA 4RNHA 1S4FA 2XY5A 2XS2A 1URNA 2KG0A 2HYIB 1QSYA 2QN6B 4ZN3A 3C15B 1SKRA 1XMQJ 3H8YA 1HMVA 2UXCJ 4IYQA 2RDIA 2FZCB 3CJKB 4ZCIA 3FZ2A 1PGZA 1PBAA 1RT5A 4FYXB 2HIYA 3UNYA 4JI4F 2M88A 4DR3F 5L1JA 1UJ5A 3TO8A 1KOOA 4PAAA 3PJXA 2XYHB 4IFVA 1ACMB 3J80Y 2LA4A 2HMIB 2VPZB 1RT6B 1U6FA 1WHWA 3ENWA 4L3KA 3D2WA 2R8GA 4USVA 1T95A 3UR0A 2GFFA 1R8BA 3LUYA 4UUXA 2D41A 3NG8A 1K0VA 3CDUA 2V4RA 3TARA 1NHUA 3RB4A 2B7CB 4WP3A 1SKWA 2D3OR 2R2SA 4PCQA 2AX1A 5JUMA 2BRLA 3X1LB 2DNGA 2IAJB 4HH1A 1BC6A 1K44A 3CCUS 3R5JB 4ZIWA 2MXYA 2CZ4A 4GKJF 2CPXA 1I51B 3OUYB 3IR6B 3M8QB 1RA7A 2OJ3A 2AEJA 1WI8A 1NLKL 5D6GA 2CQ3A 1RT1A 3K7RA 1PBUA 2ASLA 1SL2A 1IKWA 1TL3A 5C2GA 3FKBA 2YKNB 4M5DB 3I55S 2Y1JA 5IT0A 1K8AT 2YVSA 4C7QA 5EWGA 3C2PA 1V5IB 2HK3A 4FVCA 4TXSA 1O51A 2O5DA 3Q89A 5AE3A 3PV8A 3O3LA 3A8IA 5KFHA 1S1XB 3MM9A 1DQ8A 1RB0A 3DLEB 1CQMA 2V63A 3DM2B 1ZTTA 2VC1A 1YZ7A 1GK8A 2I6WA 3R7NB 1S76D 3FBFA 4EI2A 2KYZA 2FGOA 4J9NA 5DLGA 2VICA 3KKFA 1LFWA 1DBDA 3HF5A 5CCLA 2XQCA 2VODA 1B0VA 3D9BA 4NLXA 4FYWB 4QYZJ 3QFWA 1R3NA 5DG7A 3QT6A 3DGVA 2L9WA 2XSJB 1HHQA 4WFZA 1WSRA 3DNCA 3MM7A 2LVWA 5IM0B 4L73A 3GJQB 4OYMA 4ED7A 2YX1A 3GSDA 1KBRA 4IO1A 1AFJA 3DLKB 2KFYA 3TRGA 4ZITA 1XMOJ 2AEFA 2H51B 2Z56B 2OEJA 5KOWA 3K59A 2H48B 1NKBA 3GJRB 2V34A 1AZSA 3VGUA 1HPZB 3UD5A 3FRZA 2E1CA 1Z4UA 1N54B 1NK7A 4C11B 3KJNB 4MK7A 2FVPA 2CQ4A 2FVRA 3UVJA 2GQ2A 2DT9A 4C8KA 1AUDA 1FKPB 5K5MA 2DO0A 1OY6A 3SSSA 3PW5A 1S1WA 2PA8D 2RT3A 3QIPB 2OFHX 2AP6A 2F9DA 1KTVA 2B9YA 3VAFA 2QZ8A 1FRJA 1Z2ZA 5G4DA 3M8WA 4OHVA 3UDCA 1NDCA 1X4FA 1FKAF 4ECVA 1I1GA 4RW8A 4LFBF 3OXFA 1QJHA 3JSMA 1YRXA 2DHSA 1R0BG 2MMYA 2N4DA 2PO4A 1T03A 2GW8A 1FT8A 2N82B 2AF6A 4AL5A 1KD1T 4LRDA 2XWXA 2R7TA 1W25A 2AJ1A 3R5GA 1Y10A 3DFEA 3JYTB 1NK6A 1UW9A 5DQGA 4M5LA 3MR7A 4GC7A 4YFUA 3KK2A 3L4BC 1MROB 3P49B 2JRSA 3MCSA 4JI1F 5GAEU 3RW6A 4X4SA 1UVIA 3HK2A 4C2MA 2LKZA 1E6VB 4KYZA 3T9ZA 1R8HA 3Q8VA 1WTFA 2RUGA 2H65B 3I56S 2GC8A 1C0TB 4LRAA 4N8NA 4DDFA 3ET6A 3ENAA 4QIVA 5BYSA 5ETLA 2N3OA 3BGLA 3VHQA 4QIFA 1R0AB 1BXNA 2VFTA 3H4BA 2AYMA 4DPYA 3VF0B 5D3GA 1B64A 4LIRA 3GV8B 1GTHA 1HIYA 1VGYA 2N4CA 5KG4A 4U7UK 2LU2A 5ETKA 2J6UA 2AX0A 5DG8A 4JP8A 4Y2MA 2KJVA 3R8YA 3D67A 5DETA 1RADB 1HNXJ 1OMSA 2RJZA 3MEGA 2HHXA 5D4NA 3DRPA 3N6NA 3HFKA 3BZQA 1HWIA 1ZETA 4QWDA 4ECXA 2RF2A 2BE2B 5KG3A 4FDFA 4PWDB 1DTQB 3EYZA 4H4MA 3M2UA 3FCVA 1YJRA 3FSXA 1WEYA 3GIKA 2IDLA 4X65J 3LPEA 1WDDA 3OXGA 3CD7A 3FFIB 4K4TA 4WU3A 1SC4B 4MKAA 2QGFB 5KG7A 2UP1A 4KFBB 3GMGA 2DNLA 2LP4A 2ZDOA 4DPXA 4NLWA 3QT8A 5F8LA 4IDKB 3OLBA 3U7JA 3H42A 1WKLA 1FJCA 3T1YF 2BOAA 1RTHB 2J9EA 9RUBA 3GFHA 4OJ3A 2GVDA 4C8ZA 3W5YA 3M30B 2QMXA 3CTRA 5CD4A 4ECUA 4DL3A 1GMUA 3CWJA 2XYPB 2JX2A 1S6PB 1S1VA 1R6YA 1HD1A 3HHKA 4RW6B 3TJ8A 5G0RA 3MM6A 4X4PA 4HHJA 2XMJA 1EETA 3QQCD 2CVEA 2HGNA 2K8GA 5EDWA 1SC3B 4CT9A 2VJVA 4F4AA 1RAJA 1OPIA 4HH0A 5H9EJ 2NCKL 1HHTP 4M5IA 4HT7A 1W2IA 4ZLPA 3PM9A 1W2BR 1RWUA 1PAUB 4A8OA 5KG5A 2GIRA 4DV2F 3DMJB 2FD2A 3UW1A 1JLEA 4LR7A 3NAIA 1TVRB 2ZC3A 2WOMA 3MTKA 2DGTA 1WF1A 2WW8A 2W9AA 2VFSA 1FCAA 3MI7X 4QZVB 4DV0F 1P9YA 2JHEA 3V6HA 3I4PA 1TK8A 4P2FA 3W62A 4WJBA 3BEGB 3N6MA 3B54A 2XHCA 3GIRA 1OYDA 5L38A 4X66F 4ILMA 5H9FJ 4Z7YA 2DR9A 2MJUA 3NS7B 3ZNJ1 4KGZB 2V4JA 3O6QA 3M1VA 2ADBA 4R5PA 2IMOA 4A8WA 1HKAA 4DR2F 4FN5A 1VJWA 1XERA 4P74A 1DLOA 4DUZF 2IC3B 4NXNF 4ZVUB 1U48A 3CCZA 3GLJA 3W5ZA 4IFYB 2M0GB 3CDEA 3GJSB 1HNZF 1BD6A 3DRSB 2HEKA 3TZXA 4UQGA 2KO1A 3HHNB 1S99A 4UOGA 1QAYA 3SI8A 2VKRA 2LXIA 2R7SA 2V5HG 2G1DA 2MKHA 3JS9A 4UUWA 3EZUA 2YKAA 1BQNA 4CH1A 2W8KA 3RGIA 1HQEA 3OR2B 1RHQB 4N41A 1EB0A 4X64F 1UFWA 2ZE2A 2HHUA 2ZHOA 3HPOA 1GXLA 2XI2A 4DV2J 3BPDA 4F4YA 1DFDA 2OPRB 3NEKA 1F0XA 3UCGA 2OHDA 2IRXA 3B4MA 4KJIA 2LDIA 1H7XA 2FC9A 3FZBA 2EEYA 1K47A 2AT1B 1PYOB 4WFBQ 2A0FB 1FVQA 1SQEA 2UU9J 2HG4A 4GMKA 3DXBA 2MHEA 4MIWA 3PCOB 2VIHA 1WJ9A 4IH7A 2B9EA 1WC4A 1T3OA 2HBQB 2QL7B 3R5DA 4RBUA 4CLFA 3LP1A 1TV6B 3IFEA 1HL6A 1YRTA 4RW9B 1J27A 1BQMB 3PJ9A 3CCWA 1HBOA 2RU3A 1Y5LB 5KFKA 1WKKA 3J7AN 2K1RA 2I8EA 2QLXA 2DR6A 2DR7A 1HI8A 1HBUB 2QX0A 3C66A 1RA6A 5IT4A 3H20A 1HHSA 3D1QA 2J0QD 1JXVA 3MPUB 4M5HA 1NK8A 2DRBA 3RG6A 4EU0A 3B78A 5HAOA 2YXLA 2BJ1A 4FS1A 1FJEB 1RT5B 2F8EX 3G82B 1RTJA 3CJRA 5HQ8A 5IOLA 2KJWA 3M8RA 3MWBA 3PTWA 4C8OA 2MYFA 2H1YA 2FJXA 1KQFB 2M4MA 3EGWB 1F2HA 2VFVA 3TA1A 4KGVB 2PDAA 3O1LA 4B3TJ 2MQMA 2BJEA 4JUZA 3BH6B 2XULA 3FDSA 3MMBB 3UWTA 3PX0A 5KT7A 2EC0A 4P2SA 4NXMJ 2IJNA 4JI2J 3V4IA 3IBCB 1OY8A 3CJ5A 2BANA 4CQ1A 4OIXA 4DX8H 4DR5F 2UXBF 2HZCA 3AODA 3V6DB 3DRRB 3CD5A 5KT4A 1Q86T 3CCMS 1MU2A 5F8NA 5F3TA 2CPIA 3HMJG 3RBEA 2B6AB 4CLPA 4RJVA 3DOMB 3QGGA 2YWEA 4P7VA 3PXGa 3T19A 1UPPA 2BW7A 3D0HE 2MZJA 1VC6A 4B3OB 1IKWB 2OEMA 2HQIA 3AFGA 2VDHA 3FBCA 2RSQA 1ZM2A 4D3GA 4P2XA 3PDNA 4FF1A 4EEYA 5KFGA 1HWUA 2G0JA 3GB0A 4CLSA 5KFMA 4IO9Q 3A8EA 1ZZFA 1VBZA 1RT7B 4LR9A 2X51A 3ZTPA 3MM9B 4QR0A 1VRUA 4AUKA 4QWEA 3QGIA 2V8GA 1WORA 4AQYJ 3ELHA 3HCXA 4OQJA 5BYQA 1HNVA 1IBKJ 2ZH2A 1WSVA 2MQOA 2WVCA 1FRMA 3W2WB 4WXOA 3OTDA 5LMUF 3NL0A 2HURA 3IMQJ 1S79A 4TY9A 4ZJLA 4E98A 2F5GA 4I2QA 3BKFA 1RTIA 1RT4A 4RR5A 4Y2AA 3DRYA 2ACMA 1SL1A 4CO3A 3DYAB 4X62J 1EQ0A 3GONA 3MM7B 2C2NA 2VV5A 5EX0A 3SV4A 4UY8T 1FO1A 1HR0J 2UXBJ 1Y7PA 2FZGB 3HSZA 3KFWX 4CNZA 4MT1A 1CJUB 3MUMP 2NUUG 3MHYA 4DOZA 3U27A 2MY7A 2GNKA 2KXHA 3NLCA 6AT1B 2MGZB 2HSEB 1X0PA 1ZYQA 4A8KA 1AB8A 1N32J 2FJWA 3POTB 5K8PA 4DR6J 4TY8B 3AHPA 4HYKA 1NU4A 2K3KA 1EKRA 3MPYA 2ZKUA 2MEWA 1VI7A 4Q43A 1URRA 2V8HA 3TA0A 2AV5A 1KLNA 4NEYA 3BO2A 2E9ZA 5J2QB 3BH7B 1WG4A 3R1HA 2JNJA 3TI0A 3TAMA 4IRCA 5KFQA 3Q2TC 1LNQA 2XS7A 3SV3A 2CQ1A 3S01A 3VAJA 4OYAA 3I82A 1X4CA 4NLDA 4X4NA 2HNZA 2OEKA 3MFIA 4RUAA 4F02A 4DEZA 1D9FA 3MM8A 4DPOA 2ZKTA 4PXDA 1U1OA 3IGVA 2BJ3A 3I32A 3MM5A 2CQPA 3OXLA 4EYHB 2C2MB 2E5IA 2DNQA 3JSMB 4UOHA 2RRNA 4J9OA 2WONA 2JFDA 2GO9A 5DDQC 3P3DA 4K0KF 2NPFA 3UD3P 1M90T 2PA3A 3S8SA 4ATNA 1AFIA 2CJBA 3VZHA 2RU9A 3ZZZA 1VFJA 3PRBA 3CJSA 2VKZG 3DI6A 1XWLA 1FRXA 2FPHX 4H4KC 3KK2B 4IKAA 5KG2A 1P27B 1CLFA 2RE1A 3GQCA 1RKJA 5C24B 2DD8S 4C3KA 4DX5A 1RHUB 1Q53A 3EUNA 1BGXT 1X4BA 2MKSA 5EUHA 4CYUB 3SCLE 1NJXA 2JEJA 5LJ3Y 4CT8A 3KUGA 4BBYA 4DL5A 3I9V9 4U67Q 1T94A 4PXBA 4EBDA 3ET6B 5HO4A 3IWNC 1RP5A 2HS4A 4DN9A 3M9MB 1RK8A 5DG9A 1Y5IB 1N5VA 2BA9A 1UFLA 4DV4J 4YS2A 2VG7B 4HACA 4HLBA 2B5JB 3LH2S 4WPAA 3MPDA 1APSA 1FJ7A 1X4AA 1CG2A 2PC6A 1RUSA 2NREA 5F9LA 3W7BA 5KTQA 2HNYA 4Y2IA 1Y3KA 3M8PA 1G1XA 2FZKB 1S59A 3MPWA 4BS2A 3BN7A 4QYZK 2QSFA 4ER8A 5IV3A 4DV5F 2AMCB 4B9UA 4GO5X 5HSPA 3O8WA 2E5LF 1D9DA 3NBPA 3B6BA 3QNWB 5T41A 3TEGA 1TU0B 3N01A 4XK8C 5J2PA 1V3ZA 2W7AA 2GQCA 3OQ2A 1VRTB 1UA1A 4DL2A 1ICEB 3TEHB 4YDDB 6FDRA 5D0GA 1TL7B 3CCES 1UW4A 1BMQB 2R7RA 2C2EA 3D1HA 2C2RA 4K0KJ 1X31C 3ZZRA 4OZ2A 4EBEA 3THTA 1CJTA 3Q8RB 3ETOA 1O0PA 5E2QA 4RUCA 2CQIA 4ZVGA 3RB3A 1D9AA 3ISNC 4LVOP 2DGUA 3TZZA 1JLCB 2GA7A 4WFYA 2Y0BB 1FDDA 1NMEB 5KFBA 3BM7A 2GVDB 2G1HA 4LJMA 1NSPA 1I94J 4O0IA 3ITHA 3G87A 5KFLA 2DISA 3VR1A 1S6QB 5KFDA 1TL5A 2WVEA 5GMEA 3OSNA 3UQSA 2QYCA 4ICLA 1TKXA 3UNGC 1D09B 3TJAA 2HPUA 2ATCB 4F26A 1M5KC 4M5JA 3ZTRA 5HQMA 1TUGB 1U4BA 1TL1B 1EETB 1S7HA 4LF5J 2HFNA 2ZJQQ 1RLCL 5HLFB 4ILLA 4I67A 4V19J 3RRGA 4YUDA 1XC9A 2UVUA 2CKWA 3SBMA 2D7SA 3H5YA 1N52B 4HDGA 5IQQA 2LXUA 1JQGA 1FF2A 4MKBA 3OTOF 1YZ6A 2MQ8A 1RDRA 3SEOA 1SH0A 2WB1D 3H5SA 3UI3A 4DSJA 1N36J 1KQSR 1SJQA 2E7VA 2P6SA 4ECYA 3K8VA 3L7UA 2WW4A 3SFUA 4LF8F 3OTEA 1JLEB 1S0OA 4DG1A 3D0GE 2X1BA 4A8MP 4MJKA 4FXDA 2WOMB 3W3SA 2W2NP 3HKWA 2QL9B 2XYGB 1KSPA 3S1TA 4BCAA 2KXFA 2XMAA 1SUQA 1M1HA 3T9NA 3ZNUA 1I5OB 1NSQA 1HWKA 5IWAF 4P73A 4CIOA 1LWEB 5LMNF 3K0JA 2YTCA 1WELA 1VYAA 4F0KA 2CG4A 2AWZA 1WG5A 3F0NA 2OIHA 1R0CB 2F1FA 1IBCB 2X3GA 4L3NA 1UWBA 4WZQA 2N7CA 5HMXA 3MMCA 3MR5A 4IOAQ 2EFPA 1SH2A 2BABA 1RZMA 4J9QA 2CQDA 4M94A 2CPYA 4ZPAA 4PG8A 1VQ6S 2CPZA 5ETNA 4Q2MA 2KB2A 3EICA 2MSSA 4ENOA 1TL4A 4AL6A 3OR1B 5LOQA 1LW0B 2MZQA 4C8MA 2K2PA 4DS4A 1FHTA 1WD6A 2CJYB 2EKYA 1S4EA 2DCLA 3D4JA 2HNDB 4O3NA 2B0GA 4EGLA 3G6YA 3MECA 3RU0A 2WVDA 4LIWA 5T7LA 3ZZPA 3MAAB 1EIYB 4UOFA 4JYAF 3PEJA 3JTOA 4AXIA 4Y65A 2V0NA 4G1QA 1RT2B 3FNNA 3GE9A 1M1KT 3TA2A 3M9NB 2CJ9A 1S5ZA 1ZAXA 4DN0A 3BQ0A 3TVKA 4DV6F 5KT6A 3WC2A 4ES1A 2QTWA 3FK4A 3OVSA 3WHIA 1PG5B 5KG0A 1AW0A 3HKZD 3C14A 3IS9A 2BDPA 4DV3J 2LYVA 1V3SA 1AT1B 3RTVA 1R6VA 1JJHA 1RAGB 5LMNJ 3LWLA 5I3UB 1AA1B 3BKUA 5D4OA 3IRXB 1KQGB 1R7IA 4ZJOA 3HVTA 3HSDA 1HBOB 3IM9A 3W2VA 4F04B 1K9MT 4ZN1A 2NQPA 5H9EK 2PE8A 1MMDA 3TQ1A 2GS8A 5AT1B 2RDDA 3JTNA 2JLEA 3A4TA 2PMZD 1KKHA 3EPGA 3I4HX 2EG1A 3MMJA 1IWAA 2UUBJ 4LSNA 4YHHF 2A1BA 3HZGA 5AE2A 3MR3A 4FYYB 2YNIB 5B0AA 2VBXA 4I68A 3PHEA 1YJ7A 2DRAA 4D3HA 3HVAA 3WX4A 4ZIVA 1RHJB 4KHPJ 3CO0P 3KJVA 2RD5C 5C7PA 1SL0A 3CCQS 4DR7F 1K1QA 2H5EA 3I0RA 2ZM6J 3SCKE 2V2QA 4NZ7A 1RHKB 1C1BB 4ED6A 5FLXU 3C46A 2VPXB 5H9FK 2XS5A 4MK8A 3V4IB 3H7HB 5CA5A 2HFZA 4F2RA 3LAMA 2HHHF 2JFKA 4DFPA 4ZPTR 1NM2A 5MLCV 2FTRA 5SUHA 1UCNA 2BANB 2J9CA 3GCXP 2Y8WA 4HTJA 3FCWA 2Q1LA 2F4VF 3DN9A 2DHGA 3VAHA 4ZVFA 1KEKA 4NLTA 2RAQA 2OMLA 4XPCA 3HULA 1X4GA 2JL9A 1C2PA 1LXJA 3KUEA 2VD3A 3B4DA 4Z37A 5I3QA 2MZSA 3SDEA 1FESA 4WYWA 4Q44A 4ED8A 5GAGI 1FRHA 5LSOA 3DLJA 4FKXA 2CAJA 2KFZA 2NZ4A 4QW8A 1G6BA 1FWPA 5FDLB 2J5AA 3NRBA 3QRRA 1F3FA 1XR6A 5A8KA 1KVJA 2XGPA 3HSJA 1HNWF 2CQBA 4TNOA 2YX7A 4ZLNA 3H90A 1SC6A 4KO0A 1LWXA 2XM3A 2XSFA 2LMIA 1YI2S 1G2EA 2V94A 1VQ9S 3MMAB 3LAKA 4CH0S 1M5OC 4M5GA 3KMSA 1N5YB 1U1KA 3RB6A 4JI3F 1FFWB 5J2MA 3IA0A 3LA0A 2BR0A 1WUUA 4RBVA 3E8OA 2ILZA 4DF8A 4PRFA 1RKIA 2Y0SD 4FF4A 1U1QA 3IG1A 4PWUA 1GNKA 3N79A 5BR8F 1QY7A 5B08A 1NJYA 2DH8A 3NCQA 1BY9A 4HI2A 4LF7F 3CMQA 2HRUA 5JVGQ 2QL5B 5F0WA 3CPWR 1KP6A 1QDUB 3IR7B 4L74A 4IG0B 3QWUA 1CJVA 5B0EA 4JV2A 1GXTA 2AHOB 4CTAB 5F8GA 1JLQA 3LP0A 3CJ4A 1S7IA 4PPZA 4OYBA 3MEKA 1TKZA 5E5NA 1T9TA 4GKKF 1UEUA 3VQSA 1QLNA 2F8MA 1FK9B 3J7A1 2DR8A 1ZH5A 2Y1LB 3EZOA 4GVBB 1Q5VA 4OV6A 5DZ7A 3FQKA 4J9MA 1WHYA 2GQQA 2G2ZA 1FVSA 3R5BA 4MYUA 4R8UB 3AD8C 4ZPCA 1UA0A 4E0DA 2KDOA 5K8OA 3W9JA 2UUAJ 4PKDB 1RAFB 3FRYA 2V68A 2VHGA 4K50A 3DXSX 4O23A 1OO0B 2ZD1A 4J7CA 4C48A 2FY8A 1PJ5A 5HBMA 4EO8A 1T9XA 4MMOA 3AA9A 4ID8A 5EWEA 2EKNA 2ZBCA 4O4RA 1KRPA 1REGX 1FTRA 1NAQA 2KI2A 3ICLA 3EX7B 1GX5A 4A48A 4NCGB 1VLYA 4DV7J 1IBMJ 2HBZB 2C42A 1BE4A 2CQ0A 2WHOA 5FJ4A 5U47A 1NSAA 4B3SJ 2DEIA 1HQ2A 3Q23A 1J5EJ 3DDKA 2WB4A 4JBCA 4WF9Q 1WC3A 2B9WA 3BSNA 2FJDB 3BGUA 1IQTA 1DY3A 2XMTA 3BSAA 3BO4A 1RTDB 4NCBA 1NUEA 4NL5A 2W9BA 4LQ3A 4DL4A 4N77A 5JVHQ 3C16B 4LF7J 4KBIA 4DQQA 2JEGA 1C1CA 1ZM3A 2YH0A 3PFEA 1LKZA 3K5NA 1JJCB 2P6TA 1W26A 1T05B 2MLYA 3C3LA 4OMFG 3HVWA 4Z2XA 1KWMA 4X4UA 4GRSA 2MLXA 2FJAB 4P52A 5ITHA 4GKKJ 3RAQA 1XNRF 3J81Y 2V2VA 7FDRA 1IR1A 3CC4S 4QR2A 1RU1A 4YB1P 4QPXA 2C3MA 2KVQE 3GPAA 4ZP8A 1TK0A 5C42A 3CB4A 4QBUA 3UPFA 2QMWA 2HWHA 3I96A 4L72B 2JWNA 4ANEA 1R8PA 4IOBA 1IKXA 4DV1F 3M8PB 2WVBA 3FGVA 2AGOA 1FEHA 1T9YA 1TMMA 3V6JA 3CXCR 3JSYA 4NMXA 1VQKS 2BZ2A 2VJUA 2XMUA 1FX2A 3PG9A 4LF9J 2EK6A 3AB4B 2DJWA 4OHXA 2EI5A 2ZWPA 5IV4A 4A8XA 1LWFB 4K5SA 5HK4A 2G9OA 4ZPBA 3LO3A 2R2RA 1VR6A 1S1UB 1TKDA 1Q8BA 5DGBA 2HHPA 4DLEA 2FJBB 5ETQA 1KOHA 2IA6A 2R9LA 2DGSA 1U0HB 2MKYA 1OY9A 1RCOB 3FEZA 4B3RJ 3VVUA 3M2RB 3KLEB 4R25A 4JV1A 2W2OP 5IQ6A 1DARA 1C4CA 3V4MA 4WCEQ 3BO3A 3D3CJ 2LEPA 5CYMA 5KT5A 1VLOA 3MEEB 4V1Ak 2XLJA 2RQMA 3Q2SC 4ES3A 3LGHA 2QA4S 2B7BB 1EKSA 1XQIA 4DR1F 1ZA1B 5B0DA 4KE5A 3PYGA 2PEBA 1Y3JA 1ITPA 2P2CB 4NI2A 4IRKA 1Q7YT 4OI1A 8ATCB 5K20B 1FDBA 3GV7B 1U1RA 1XTZA 2RUSA 3KLGB 2W2PP 3IP0A 2NYIA 3CCRS 5A2QY 1RABB 4F2SA 2OFGX 2R7XA 3HHLD 1S6OA 2ZFHA 3F44A 1V6HA 3HZEA 4ED5A 3UDVA 2DNKA 5GVQA 3A8JA 2CZ9A 3MUVP 1DURA 5GADU 4EK2A 2E1AA 1HA1A 3QO9A 2YQ1A 2GGPB 1CULB 3M32A 5KAKA 3KOAA 2XB2D 4TYBA 3BQ2A 1Q4RA 1SJ3P 5CYQA 3E3XA 4WU2A 1S9GB 1U02A 9ATCB 2XO6A 1DRZA 2KT2A 4YB7A 1Y4ZB 2IM3A 2LDYA 2MKJA 3JXOA 1C0UB 2DVIA 2HQCA 2HFUA 1FI4A 3MEDB 2KT5A 2KN4A 5A6PA 5LSRA 3Q8YA 4TVAB 4DQPA 1J5OA 2XCPA 1P9QC 2OPQA 1GAOA 4CCHA 3M9OB 1YBUA 4JI8J 4Q8FA 3GIJA 2EC2A 2KRBA 4YY3F 3H4DA 2VG5B 4RW7B 3NS6A 2GJFA 3LGNA 2ZH5A 1RLDA 4DX6A 1LOUA 4LFCF 2AW0A 2WTFA 2AGPA 1HYSB 1F2GA 2BM1A 2GAGC 2XO7A 2E5GA 3W8PA 3TZYA 1NPRA 2L41A 3HXMA 2XY6A 1B0TA 2A2CA 2H5JB 2ZUAA 2PI4A 2YX4A 2IRYA 2WSFC 3WIUA 1IKYA 4EMDA 2L3MA 2DO4A 3C6TA 2LEBA 5J1EA 5BXIA 5HVGA 1YX2A 4NE9C 4QQBA 4LSZB 1LWCB 3MD3A 1RSCA 2LQJA 1H73A 3C8YA 4LF4F 1EP4B 1DTTA 4EBCA 4K4UA 3T1HF 1FKOA 3HSGA 2J0XA 4ZVOB 2ZOMA 3PX4A 8AT1B 4FPRA 5B7WA 5AXMA 1PC5A 2ZNZA 4C3LA 3P4UB 1H6KX 4RW4B 1S97A 1OQ6A 1HBNB 2CNLB 1Q8LA 3IN5A 2OH2A 2GX8A 1V5VA 3H25A 2J76E 3E01B 3IC1A 3TR5A 3DGPB 1UVJA 4OI2A 5IZHA 2O66A 2IDEA 2UUCJ 2LXFA 3A3NB 3C14B 4L76A 5M2RA 2B43A 1L3SA 1D8YA 1NBEB 4J9UE 5I42A 2CZVC 2O67A 1RWMB 5I3PA 2R42A 2XLKA 1T8EA 4I1TA 2ASDA 3FJ2A 2DNNA 4QYRA 3GV5B 2FLOA 1D0EA 2B4OA 4YMEA 4ZHRB 4P71A 3AAWB 2U1AA 1Q7LB 3HVTB 3W2VB 5CQGA 1N34J 3SSRA 2F4FA 4ZP9A 3P6YC 5SZTA 3EDRB 2Y1IA 1EX8A 2YKOA 1YITS 2W4DA 2W9CB 2R7UA 2BW2A 4NLYA 5EX3A 2BJ7A 1RWVB 2YNFB 3WC0A 4QWBA 3AXKA 3KK3B 1IKVA 2QFIA 4F8RA 1FA0A 3PO5A 2V6AA 1VQPS 4ZVHA 3R7SB 2YNGA 3GTYX 3FC9A 3K2YA 4DQIA 2Q43A 3T3FA 4ECZA 4J91A 5A6WA 5HI7A 5KG6A 3MAHA 2UXDJ 1S48A 2J0SD 1S1TA 2OI2A 1X5PA 3QLHA 2Y9HA 5AXNA 5HP1B 2KYXA 4JV5F 3M6VA 3CCSS 2RKIA 2RS2A 1U47A 2BBEA 1NK0A 1F3VA 3HD1A 2VG6A 5CCMA 3AQOA 3PW0A 2E66A 2DCUB 1A6LA 3J80U 3EXCX 5B0GA 1X8DA 1YKWA 3J7YU 4OZ3A 5KFPA 1KLMA 4KKOA 3G96A 4M95A 2C2DA 3IWLA 4I6AA 3CD6S 1JLAA 1UP1A 1FXRA 4HT5A 4U6PA 3NGSA 2X1AA 5KFAA 2YNHB 3KLHA 2BKNA 4NZ0A 1ZAWA 2G0IA 1K73T 3SQGA 1GMWD 4GVLA 3HVRA 4CO1A 4C9DA 2F40A 3CT9A 1K1SA 4I6WA 4TLQA 2DGQA 2YWHA 4R0EA 1H72C 5GAHU 2VPWB 4OJHA 4KSEB 4P75A 3PFOA 1FX4A 3VWSA 3PRVA 4K4YA 3NNAA 3KG4A 4N56A 3AOBA 5IT9Y 3KXDA 4E2FB 4FPIA 5DDPC 4OLOA 2VA2A 3KLIA 4URGA 1Z1ZA 1U24A 2IFXA 3H0PA 5M2UA 4LF6J 1KVIA 1WOSA 5L9NA 3BGRB 4H4KA 4DS5A 4OZNA 2YKPA 2LFVA 5ETVA 2Z8QA 4W90B 4WE1B 1WC6A 1RBLA 1MMNA 3CCTA 3EZ5A 3NGTA 3UCZP 2DHAA 2RMLA 2IJRA 4PYAA 1R8AA 2E29A 3W61A 2ZNYA 2BUNA 3MCOA 3CSKA 4PPDA 3SCIE 3NS5A 2W1BA 3C15A 1BLUA 1M5PC 3S6EA 2XEXA 1MWQA 3CJKA 4UTGA 4JI4J 4WP8A 1TZ0A 4DR3J 2ZH4A 2BXJA 3Q22A 1TKZB 2MB0B 4KR0B 2DNYA 4NEZA 4LR8A 1KC8T 4HI1A 1SV5B 4PYDA 4OX8A 2OPSA 2HMIA 2CQGA 2CIMA 1RT6A 4JI0F 4DCJB 2YPZA 1Q81T 4BWMA 1GXUA 3JB9k 4EO6A 4LSLB 4OZLA 4BLGA 1NHKL 2R8HA 2QLBB 2GO8A 5AJ3F 3VCDA 3QMQA 4ITSA 4WTYA 1UZDA 2LQBA 1U2CA 2ZEJA 5J2NB 4DX7A 1ELOA 4PWWA 4B9MA 5HN0A 1RI7A 4P72A 1MW7A 4DCPB 5K9FA 4GKJJ 3PVXA 2IAJA 3OBIA 5KFNA 1VC0A 3ZZYA 1U26A 1JLFB 3GYNA 4C0OC 1T9WA 2ASJA 4I0WA 3QIDA 3OUYA 3M8QA 4ID5A 4RNNA 5KFOA 3I0SB 2NUHA 4CLKA 4ELVA 1NXIA 3BV8A 1WF2A 1HFEL 2VF3A 3CJ8A 2E1MC 4M5DA 4ETZA 4A8QA 3W1YC 4R0JA 1REVB 3PW7A 2A6OA 4JI5F 2K7KA 2W9BB 3EGNA 1Q8KA 5C25B 2IYIA 4V19X 3GP9A 1PJ7A 2D3O1 4NA2A 2GAHC 2COLA 3W64A 1RT3B 3Q24A 3CMES 4QPTA 1S1XA 3VZIA 2OMOA 4JI7F 3LOUA 1ZA2B 3DLEA 1C1CB 1HQUB 3DM2A 4QU6A 3UDLA 3H59A 2OSRA 2CPEA 1RHRB 3ZXWA 3OV7A 5E41A 3RJMB 4J5OA 3PKYA 2DXFA 2HFOA 1U0SA 2Z0GA 3D0IE 5D8HB 1JLBB 4ED4A 2M9KA 4EWTA 1M5VC 2XBPA 1SIWB 2CNKB 3G86A 4IG3B 1R89A 5CH7B 4O3QA 4EYIB 1Q16B 4I69A 1RAHB 4U9RA 1IKXB 1FEEA 3CGIA 2XSJA 5B0BA 5A8RB 1IJEB 4TU9A 5AJ3J 1BWEA 1TTHB 2EXUA 5HJXA 2Z2YB 1ZTWA 5ETSA 1LQ9A 5DZ6A 3DLKA 3TJ9A 3HDSA 3HFZB 4K7QA 5AXKA 1LFPA 4NLPA 4PUOB 1N5TA 1N0VC 3IAM9 2VPYB 3SZ2A 4YDXA 2BOPA 1FJGF 4ES2A 2FLPA 4ECRA 3OHBA 1S0MA 2YQ3A 4KV8B 1NK9A 2LQ9A 2NPIA 4CLYA 1HPZA 5M2PA 2HW3A 1VRQC 3R2DJ 3F56A 2R7VA 2YWKA 4TKTA 3TANA 2V2KA 2NXJA 1UMJA 4C11A 1VQ5S 4DPUA 1S0VA 1WEZA 4DSKA 1EAYC 3JTPA 4K4ZA 3NMRA 2SXLA 4FYVB 1D1UA 3BBBA 3T6JA 1FKPA 2A18A 2E7WA 1O6XA 3R6GB 5E3QA 2J7WA 2XTJP 2H54B 3MZIA 1DHMA 4C3MA 4J9LA 4Q8EA 3X3UA 2KRRA 3KLFB 3FSYA 4OHWA 3K58A 3OFFA 2CQCA 2ZOGA 2CFXA 3C6UA 5A8WB 3TVYA 2BM0A 3V5RA 4PQUB 2I5JA 1QAXA 3ULHA 4LFBJ 4AE5A 5K8NA 4YOEA 3IR5B 1T9UA 4OJGA 1D3WA 4DPTA 3D3BJ 1S9EB 3V81B 1F6TA 1Y0HA 2DXEA 2L48A 1TUVA 5D4LA 3CNQP 5E33A 4X4VA 2HVHA 3NWGA 4OX9F 2RRAA 1MNEA 1RHMB 1MSWD 4YR3A 3THVA 4ZVSB 1X4DA 3ISZA 4F3MA 2RQKA 4JI1J 1MWZA 4CNYA 3DOKB 4HTIA 1SJFA 4YP3A 1N4LA 5CABA 1MROA 4P7TA 4DFMA 4B02A 5ADZA 4GO7X 4FBTA 4RUHA 4F3OA 3BGOP 1IBLF 1WC0A 2FLNA 3TAQA 4Q7AA 4TU8A 1C0TA 1X5TA 2VQFF 1N6QB 2FC8A 3ILJA 4LUBA 2V9WA 3BBCA 2GHPA 1F5CA 2EFGA 2NYHA 2VH7A 4LFAF 1R0AA 2B3TB 3VGTA 3I9ZA 2D9PA 1M5SA 2DTJA 1HLWA 3RRHA 1S10A 1XBWA 2HHQA 4C8NA 4WIQA 5FIIA 5KFJA 4XO0A 1RE1B 2HFVA 1S6UA 4G6VB 3I87A 4OLPA 1RAAB 5D0HA 3G6VA 5F0UA 1HBMA 1WHVA 2AKWB 3FEXB 1YJ9S 2GJ2A 2M8HA 2PT0A 3GYGA 4LT6A 2BV3A 4RO0A 4ZLJA 1N33F 4UZCA 1T0TV 4I7FB 5HQLA 2ZWOA 3OL7A 3OVBA 2BE2A 2H4WB 1VK3A 4QJVA 4BC9A 4C6AA 3CJTA 4PWDA 1DTQA 4BC7A 2QLFB 4XDDA 4ECSA 3C6TB 3WBZA 2FVQA 1W7WA 1PC4A 3LP2B 3M6XA 3TWZA 2C1EB 1N56A 3FFIA 1R43A 1X9SA 4KFBA 1EJ7L 3JAMU 2MY8A 3I31A 2XZTB 2R2TA 3T1YJ 3HX9A 4DUYF 5KFTA 2CG8A 2CWXA 4NLUA 2BMBA 2PFFB 2P8IA 5A76A 4ED2A 3FCHA 5EHHA 4F50A 3M30A 4H4OB 1HWLA 5LSLA 4ECTA 5C2CA 2OTLS 2PGCA 2ASYA 1YIJS 1UEVA 1FERA 4F4XA 2OPPB 2C3PA 1D8ZA 2NXNA 2OUGA 2HBRB 4KHMA 4UOCA 1YWXA 1P6TA 1RWKB 1S6PA 2VQFJ 4RW6A 3RBDA 3IM8A 2D1CA 2WSEC 2ROGA 1S0NA 1J2VA 1GTEA 1SQFA 3DC2A 4EFAC 3AXMA 3L7OA 3OVAA 3BDEA 1YVFA 1VQSA 5F8HA 1X0FA 4P2MA 1VISA 5HMWA 3SFGA 1JKHB 3KUHA 4KGKA 4DL0C 2R2UA 1RXOB 1XNQF 2LA6A 4AL7A 4P10A 1FRKA 4RL1A 3G6XA 2JVRA 3G9CA 2HAFA 3K5MA 2AEMA 3ZZTA 3G8SA 1Q1KA 3DMJA 4NA3A 2DY1A 1TKTB 1TVRA 1RWXB 4DV0J 1MMLA 4IQMA 1JWWA 4IUFA 3CUNA 4NMLA 3CCVS 2EWHA 1FDAA 1VQOS 1GT8A 2YKMB 5E7OB 3HFVA 1NPKA 2RDJA 2XI3A 4X66J 1KQKA 2ZZNA 2Y3YA 4F0MA 1EHWA 1UFKA 3MF5A 2BKOA 3DLBA 2M8DB 3ZZ0A 4C98A 1Q78A 4DR2J 4QOTA 1F1BB 2XGQA 2DBBA 4NLOA 2CQ2A 1X4EA 4UY85 2QO3A 2HBYB 4DUZJ 4NXNJ 2C28A 4Y0FA 3HHDA 4OJ1A 2RIJA 3EPIA 1HMVB 3J7ZT 2IC3A 5BYRA 4QIEA 1HNZJ 2UV8G 1XMQF 3M6WA 1SH3A 2UXCF 4O3RA 1NEEA 4IFYA 2CVIA 3WQPA 2RS8A 3DRSA 3CDBA 1FRLA 1LK7A 4IFVB 4NYPA 3KNGA 2C2KB 3VGSA 4H54A 2YBVA 1U7LA 4LRCA 5THWA 3OFHA 2CJKA 4CZCA 4ZPDA 2VOPA 5CAAA 2DGOA 4DZ6A 2MQQA 4MIBA 1YJNS 2J7KA 2VDIA 2R7WA 2DRDA 4USMA 2RQCA 1UPMB 3WZ0A 4IRDA 2R8KA 4EUVA 3OPKA 4X64J 1QAIA 4C97A 3VVTA 3KMQA 3OR2A 2B56A 4DL6A 1T02A 2P9EA 4ECQA 3HT3A 1YTYA 3NGDA 5H1SV 1I6JA 1RYRA 5GAHI 3ZTOA 2OPRA 4NRTA 2CJXB 2YH1A 5ETPA 3OTCA 3H2LA 5KFSA 1JX4A 1NK4A 2IVMA 4ANCA 1RT1B 1DQAA 2CPHA 1TL3B 2YWFA 1VHFA 1WI6A 5CHCB 4NOHA 2XMWA 2DKOB 3QGHA 2HZVA 1IN0A 5E3CA 4CLLA 3IRWP 1Y00A 3H2VE 4K4VA 5L46A 3NAHA 5F8MA 3PIPQ 5LXRA 3GU0A 3KDOA 1TV6A 1UETA 3IWXA 2BX6A 4RW9A 2O1PA 3PEHA 1BQMA 1IQZA 3ONQA 2BACA 2FHJA 3HJVA 5D77A 1HBUA 1OJ4A 5LT5A 4ELUA 1T7PA 3O5TB 4PABA 2ADCA 1X4HA 1JXLA 1JNZB 2BQRA 2QRRA 3PKMA 4FBUA 5D0EA 3H40A 3G82A 2I2YA 3MFHA 4IH6A 1FE0A 3DLLQ 4C8YA 5ETMA 4WTOB 2KM8C 1PO6A 3FMWA 3VQTA 2Z2MA 3A12A 3RAMA 4QU7A 2OPSB 2PEHA 2KHDA 2KVIA 4ELTA 3R9LA 4NYOA 3ZFVA 4I56A 2AU0A 4OYZA 2JVOA 2ZC4A 2IRUA 4ZCKA 2AJ4A 2MJNA 1YJVA 2DY9A 4AFFA 4K4SA 1OSDA 4CO4A 3MMBA 2E5HA 4CWBA 2V8VA 3OHAA 2ZHAA 4DR5J 3FUYA 2YWGA 4A8FA 2WRMA 5DO2A 3H5XA 2MQLA 2M3DA 3T5LA 3B8HA 3OSPA 1XMOF 3VAGA 3V6DA 3CDWA 5D4PA 1G4CA 3RW7A 2MHNA 1AZSB 3DRRA 2G4BA 1O8BA 1IVZA 2UVWA 3KG0A 2B6AA 3ISND 4WK1A 4ID5B 3KWMA 3DOMA 3NGUA 1AUSL 3UVJB 5KFFA 2M5YA 4B3OA 2AZ3A 3B82A 1HNIA 5FD1A 3WIVA 1GEHA 4B9TA 2KFNA 3BREA 2AJ2A 1S1WB 2IBKA 2HK2A 2W4PA 2C3OA 4DSIA 3BBFA 1U2RA 1RT7A 2U2FA 4JI6F 5IFMA 3MCNA 4RW8B 2BJ9A 1QAJA
chains in the Genus database with same CATH topology
4R5PA 4IR9A 2ZH3A 2IMOA 3S7RA 4A8WA 4PG6A 4ES3A 4DR2F 4FN5A 4B17A 1VJWA 5E3RA 6FD1A 1VQLS 2QA4S 2B7BB 1XERA 2VASA 3N0VA 1CVJA 2UZAA 3M2VA 1DLOA 4DUZF 2IC3B 4NXNF 1T03B 3MPVA 1QUPA 1E6YA 2F3JA 1RJJA 1U48A 3W2WA 1HWJA 3CCZA 2ZH7A 2CDQA 4DR1F 3IBWA 4CH7A 3MD1A 5B0DA 2WBRA 4IFYB 3G71S 4KE5A 3OL8A 2M0GB 1TR0A 3CDEA 1U1NA 3ENQA 3O2IA 1HW8A 3MOZA 1Y3JA 1HNZF 3CC2S 1NJWA 1BD6A 3GIIA 3DRSB 5HP1A 4UQGA 2DIVA 4IRKA 2KO1A 5KFXA 1Q7YT 4ZDNA 4OI1A 3HHNB 1S99A 3SI8A 1QAYA 1FDBA 3VAIA 3SYZA 3GV7B 2QIFA 5FLXY 2VKRA 3VAMA 1JLQB 2IYGA 4I64A 3LP0B 1U1RA 1XTZA 3KLGB 1IJFB 3GG0A 4C4WA 2LXIA 1HW9A 5GAEI 2NYIA 4I4BA 3CCRS 5A2QY 2V5HG 2R7SA 1TAQA 4F2SA 2D9OA 2HIQA 1H2UX 2QFJA 2G1DA 5F3ZA 2OFGX 4KHRA 1G7CB 1VIOA 3DYAA 3HHLD 1S6OA 4USHA 2MKHA 2ZFHA 3F44A 5KFIA 1V6HA 2R7XA 3HZEA 3R5AA 2EFQA 4AXJA 4M8LA 2O01C 2JLGA 1SBRA 4ED5A 2L9DA 2RRBA 2MKIA 1LK5A 2IJFA 4UUWA 2DNKA 3EZUA 5L1LA 3PNIA 2YKAA 2IVYA 1BQNA 2J0WA 4CH1A 3TNVA 2W8KA 4ZMMA 2VBZA 5GVQA 1GQEA 4DFKA 3MUVP 1HQEA 3OR2B 1DURA 5GADU 4XPEA 2OP5A 2E1AA 1HA1A 5L39A 2PD1A 4N41A 3QO9A 4X64F 1YJUA 4NRUA 2GGPB 3FVYA 2QA1A 2GHWA 3M32A 3NP5A 1UFWA 5KAKA 2XB2D 2ZE2A 3KOAA 2YNHA 4TYBA 5D3GB 3BQ2A 1Q4RA 2HHUA 1SJ3P 5CYQA 3E3XA 2ZHOA 4WU2A 2MGZA 3HPOA 1NH8A 2KKHA 5CXTA 1FD8A 1S9GB 1GXLA 1ZAVA 4RX6A 2XI2A 4NLGA 1JJ2R 3POTA 2NSBA 2ZD1B 3JSBA 3G6ES 4F4YA 4RWXA 2UUAF 5HBMB 1DRZA 2KT2A 4TY8A 1DFDA 2OPRB 1F0XA 3UCGA 4YB7A 2IRXA 1Y4ZB 2OD4A 2IM3A 2LDYA 3B4MA 2MKJA 4KJIA 1TAUA 2LDIA 1H7XA 2FC9A 2WCXA 3FZBA 1KONA 1KR4A 1C0UB 4MFBB 2DVIA 3RYLA 3MEGB 2W25A 3MEDB 2KT5A 4RLEA 4WFBQ 2HS3A 2KN4A 5A6PA 2IHR1 1FVQA 2ILYA 1SQEA 3PRDA 3SCJE 4QWAA 1Q82T 3PY8A 5LSRA 2FHMA 5KFEA 5L1IA 5J2QA 5KFVA 4DQPA 1J5OA 1HNXF 2B51A 2HG4A 3DLGA 1P9QC 4Q2LA 2XCPA 2OPQA 4MAKA 1GAOA 2ZDPA 4GMKA 3DXBA 3DRPB 2A3JA 2MHEA 4MIWA 5KOXA 1H3DA 4CCHA 2XLIA 3LWMA 1IXKA 3M9OB 2KT3A 4Q8FA 3OJUA 2OO4A 1VIXA 2JLFA 2RF2B 3GIJA 3Q8QB 4IH7A 1NJZA 1T3OA 4DV7F 3R5DA 5AXLA 4RBUA 2KRBA 3CF5Q 4USJC 4YY3F 3H4DA 2VG5B 1IBMF 4RW7B 3LP1A 1TV6B 3IFEA 3NS6A 4H4MB 1U09A 4MH8A 3C6UB 1HL6A 3LGNA 2MZ1A 1YRTA 3M2UB 4RW9B 2ZH5A 4EZ6A 2YKNA 1KHVA 2I5JB 3BGRA 1LOUA 1BQMB 2E1RA 4LFCF 3CCWA 1HBOA 2AW0A 1Y5LB 3NCPA 5KFKA 2RU3A 2K1RA 2I8EA 4B3SF 1J5EF 1KFSA 2WTFA 2QLXA 2EW9A 1Q79A 3FEYB 2AGPA 2DR7A 1HYSB 1LXNA 4KQZA 4WE1A 4ZKAA 2BM1A 1F2GA 2CYYA 1HI8A 1HBUB 2E5GA 2XO7A 2GIQA 3C66A 2CRLA 4O44B 1AXQA 1RA6A 4QW9A 5IT4A 3H20A 1HHSA 5KFRA 3D1QA 2L41A 2I9SA 2J0QD 3TX8A 3HXMA 2XY6A 1B0TA 4X4TA 4X65F 2A2CA 5DDRC 2PI4A 2YX4A 2IRYA 2WSFC 1HARA 1NK8A 2DRBA 2DNHA 1IKYA 4FVMA 5L9XA 4Y28C 4EU0A 2L3MA 2DO4A 3C6TA 3B78A 1R31A 2LEBA 5J1EA 4FS1A 4I2PB 1UJ6A 2V8DA 4QQBA 3PJWA 1FJEB 1RT5B 2F8EX 2HHTA 1LWCB 2NXUA 3MD3A 4A47A 5F8IA 2LQJA 4WFNQ 1RTJA 3LW5C 3C8YA 5EN1A 2I0XA 3RB0A 5HQ8A 4LF4F 1NKEA 1EP4B 1DTTA 2X1GA 2QT7A 3L95X 4EBCA 3CDAA 4N5SA 4K4UA 3T1HF 5B0CA 1FKOA 2KJWA 4ZOSA 3M8RA 3MWBA 3CJ3A 4URQU 4GC6A 2UVUA 4C8OA 2J0XA 2MYFA 4XDCA 1PILA 2ZOMA 4LQ9A 2JDJA 4KTQA 3LALA 4N47A 5C24A 2FJXA 3PX4A 1KQFB 2M4MA 4ZP7A 3EGWB 3FQLA 3DLHA 2OD6A 2VFVA 3TA1A 4FPRA 4PQAA 3THPA 1Y9OA 1VQ7S 2PDAA 3O1LA 1S1VB 5B7WA 5AXMA 1PC5A 2ZNZA 4C3LA 3BF4A 2MQMA 2BJEA 4JUZA 1H6KX 2D3ZA 5G0RB 2K7JA 3IO1A 4RW4B 1WTBA 1SB6A 3MM6B 1S97A 1OQ6A 2XULA 1HBNB 3HHEA 2DGWA 3FDSA 3MMBB 4UQTA 3UWTA 3PR4A 1Q8LA 5A0YB 5KT7A 3IN5A 3PX0A 1UVLA 2EC0A 1SV5A 2OH2A 4JV0A 4P2SA 3DHWC 4LVNP 2IJNA 5C42B 4B9LA 4DHVA 2DK2A 3V4IA 2GX8A 5MAOA 1NH7A 2XWYA 3OL9A 3H25A 2F9JA 1HI0P 2J76E 3E01B 3IC1A 3NGKA 3BDPA 3TR5A 3CJ5A 4ZK7M 2BJDA 4TN2A 3MXHP 4E8UA 2BANA 4CQ1A 4OIXA 4DX8H 4DR5F 1N5SA 2UXBF 4Q0BA 1UVJA 2HZCA 4OI2A 1FDNA 1GH8A 5IZHA 2VG7A 4X4QA 3G8TA 3V6DB 2O66A 4Y3CA 2C3UA 2B5JA 5IM0A 1F9FA 4HEA9 3DRRB 3HHLA 4HL9A 3CD5A 4LSLA 5KT4A 1Q86T 2LXFA 4RWWA 5M2RA 3CCMS 2B43A 1L3SA 1D8YA 1MU2A 5F8NA 4OZJA 3ZC4A 5I42A 5F3TA 2CZVC 2CPIA 3TVZA 2I1RA 2O67A 4PXEA 4OFZA 3HMJG 3L3CA 5J2NA 3KHGA 5I3PA 4I6YA 3RBEA 2B6AB 3KHRA 3LANA 3AH6A 2XLKA 4LF9F 1L3KA 2QSWA 1JLGA 1T8EA 4QWCA 3QGGA 4I1TA 2YWEA 3G8QA 4P7VA 3TAPA 2ASDA 3FJ2A 2HHVA 2DNNA 2VFUA 4QYRA 3PXGa 3T19A 2R8JA 3GV5B 2FLOA 1D0EA 2B4OA 4YMEA 4ZHRB 3GZ7A 1A9NB 3D0HE 3IXQA 2VOOA 1HBMB 2MZJA 3QPIA 1VC6A 3AAWB 4B3OB 1X5OA 3GFZA 1IKWB 1N5QA 1OPZA 4DLGA 4A8YA 4OX6A 3GIMA 2U1AA 1Q7LB 2V9KA 2HQIA 3HVTB 4KB7A 3Q8SB 1U2FA 3W2VB 5CQGA 2RSQA 1YJTA 1JLFA 1ZM2A 3SSRA 4D3GA 4KGMA 1CQNA 3E51A 3PDNA 3UE2A 2E9TA 4ZP9A 4FF1A 3P6YC 5SZTA 2Y1IA 2JOQA 1SI9A 2BQUA 2R8IA 1P1TA 2YKOA 2NS1B 5KFGA 1HWUA 4EEYA 4NA1A 1KNZA 1VRTA 1YITS 4FNIA 2DHXA 2W4DA 3GB0A 3I0SA 1M0SA 1QE1B 3BSCA 2W9CB 2R7UA 1JK9B 2BW2A 3BR8A 5KFMA 2H9ZA 3A8EA 3OFEA 4NLYA 5EX3A 4IO9Q 1ZZFA 4B3RF 1VBZA 2I38A 1RT7B 2YNFB 3WC0A 4IQXA 2X51A 4QWBA 2KG1A 3KHHA 5CYMB 3KK3B 3R1LA 3MM9B 4QR0A 1VRUA 4AUKA 2DPIA 3PX6A 1REVA 1IKVA 5DDOC 4QWEA 2V4JB 3QGIA 3M1VB 2V8GA 1XR7A 3QIPA 4R5PB 4F8RA 4F67A 1FA0A 1R8CA 1Z2LA 3PO5A 2Z2LA 1VQPS 2DNRA 4ZVHA 4OQJA 5BYQA 3GFXA 4FS2A 3T6BA 1DLOB 5C25A 1HNVA 3AQPA 2YNGA 2XMVA 2ZH2A 2FHOB 3Q23A 2MQOA 3K2YA 3N5BA 4DQIA 2Q43A 3MDFA 3T3FA 3OJSA 4ECZA 1VQYA 1FRMA 5A6WA 3KYLA 3W2WB 4WKYA 5HI7A 3FSIA 5KG6A 2EVZA 2FVSA 3MAHA 5HROA 3QJLA 2NR0A 1RT3A 1N0UA 4WXWA 4WXOA 4DSFA 3OTDA 1S48A 5L8RC 2J0SD 2EG2A 1S1TA 5LMUF 3NL0A 1X5PA 2OTJS 5DLFA 1R27B 3QLHA 5AXNA 1HQUA 4U7CA 5HP1B 1XMBA 3D28A 1JLCA 2FUG9 2KYXA 1S79A 2ZHBA 4TY9A 1SKSA 2NSCA 4JV5F 5LL6d 4E98A 1B0PA 3T5KA 3I6PA 3M6VA 3CCSS 4B3MF 2RKIA 2RS2A 4M1KA 2LCWA 4I2QA 1RTIA 5KT3A 1RT4A 2DPJA 1U47A 4Y2AA 3DRYA 3UFCX 2BBEA 4RKUC 1NK0A 3RZAA 4YR0A 4OHZA 3PACA 2JEIA 3CJ2A 2V4QA 1U45A 2VG6A 4FXVA 3AQOA 5CCMA 4OZ5A 4DL7A 3PW0A 1TFWA 2E66A 1JLBA 2DCUB 4ZPVR 1S6QA 4F4KA 4MYTA 2GMLA 3JYTA 4CO3A 1SL1A 3DYAB 1A6LA 2OSQA 4ZS6A 2G0CA 1NB7A 4IG3A 3EXCX 3MM7B 5B0GA 1X8DA 3MAQA 2VA3A 3J7YU 2VV5A 3DOLB 5KFPA 5EX0A 2ABYA 1KLMA 4KKOA 3G96A 3SV4A 4M95A 3Q0AA 2C2DA 3IWLA 4I6AA 1TL1A 1BQNB 4UY8T 4A46A 1FO1A 2MQNA 3OFGA 3CD6S 1JLAA 1UP1A 3DRXA 1Y7PA 5HLFA 4O3OA 3KFWX 4CNZA 1HQEB 1FXRA 3R27A 2P9CA 4HT5A 3MUMP 4TLRA 3PW2A 2NUUG 2W7OA 3QAEA 5CZVA 4U6PA 1E6VA 3MHYA 2R7OA 3QO9B 4WK3A 5A8RA 3HLUA 2X1AA 4MIAA 3M32B 5KFAA 4DOZA 5GADI 3U27A 2M52A 2MY7A 2ZE2B 5HL7Q 2YNHB 4MKYA 2GNKA 3KLHA 2KXHA 5K14B 5CYQB 3WDOA 4NZ0A 1ZAWA 3NLCA 3CVKA 3CULA 2MGZB 1MWYA 1X0PA 1K73T 1ZYQA 4A8KA 3SQGA 2MZRA 3O44A 4WKRA 2FJWA 3POTB 1U1MA 5K8PA 3SMZA 4TY8B 3AHPA 2NLWA 2XMMA 4HYKA 3HVRA 1NU4A 2K3KA 1DAXA 3MPYA 4CO1A 2A10A 4C9DA 2ZKUA 2F40A 1VI7A 4Q43A 3CT9A 4PUOA 1H2TZ 1URRA 2DH9A 1A7GE 5C5JA 1K1SA 2V8HA 3AY0A 3TA0A 4X84A 4I6WA 4OHYA 2KZMA 1FRIA 2AV5A 1KLNA 4TLQA 2DGQA 2YWHA 4R0EA 4N8OA 5K8MA 2XHWA 5KFUA 3BO2A 2M7SA 5GAHU 2VPWB 4OJHA 4KSEB 4RNOA 5J2QB 2E9ZA 2FJVA 1WG4A 1J5OB 3R1HA 4KV8A 3PFOA 2W24A 3TI0A 2OPQB 2OLWA 4O4GA 3TAMA 3VWSA 4IRCA 4K4YA 3NNAA 3KG4A 5KFQA 3Q2TC 3N4WA 3KK1A 4K4XA 4ED1A 4N56A 2XS7A 4Q45A 2D74B 2UU9F 1U49A 5IT9Y 3J7Z5 4DR6F 3SV3A 2CQ1A 3BJYA 2J8AA 3S01A 3VAJA 5DS7A 3I82A 1VQNS 5DDPC 3CJ0A 1X4CA 2DGXA 1JJ4A 3CO9A 4OLOA 4NLDA 4XAKA 2VA2A 3KLIA 5F41A 4URGA 4HDHA 1IUJA 4X4NA 1Z1ZA 4TYAA 4KRWA 3MGJA 2F8HA 2HNZA 3DU5A 1U24A 2CPDA 3LP1B 4WYLA 2MQPA 2W7PA 2PI5A 1JNRB 2IFXA 4JI8F 5M2UA 3MFIA 1KVIA 4RUAA 1ZPWX 1U6BA 1LWEA 4DEZA 4F02A 1D9FA 3MM8A 4DPOA 2ZKTA 5L9NA 2PN6A 4PXDA 3BGRB 4H4KA 2JH3A 1U1OA 2AD9A 2K1RB 4G1PA 3IGVA 4DS5A 4OZNA 2YKPA 1TFYA 1GX6A 2EBGA 3HJFA 2Z8QA 3I32A 3MM5A 1T3NA 4W90B 4K4WA 4WE1B 3K5OA 2CQPA 2QEXS 3CIMA 3OXLA 4EYHB 1MMNA 3EGZA 2E5IA 3CCTA 3EZ5A 2DNQA 2DR5A 3G4SS 5DRKA 3JSMB 2QA2A 3UCZP 2HQ3A 3KLFA 1ZBTA 4NLSA 2RRNA 4J9OA 2DHAA 2WONA 2JFDA 2GO9A 2ROPA 5DDQC 3P3DA 1IKYB 2RMLA 4P6QA 4K0KF 2NPFA