1WTOA

Hyperthermophile chromosomal protein sac7d double mutant v26f/m29f in complex with dna gcgatcgc
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
65
structure length
65
Chain Sequence
VKVKFKYKGEEKEVDTSKIKKVWRFGKFVSFTYDDNGKTGRGAVSEKDAPKELLDMLARAEREKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5'-D(*GP*CP*GP*AP*TP*CP*GP*C)-3'
publication title Probing the DNA kink structure induced by the hyperthermophilic chromosomal protein Sac7d
pubmed doi rcsb
source organism Sulfolobus acidocaldarius
molecule tags Dna binding protein/dna
total genus 12
structure length 65
sequence length 65
ec nomenclature
pdb deposition date 2004-11-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02294 7kD_DNA_binding 7kD DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1wtoA00
1HUMA 1RODA 2K01A 4MN3A 2K03A 4HCSA 4QUFA 2VXWA 2K1BA 1PFBA 1CA5A 1G91A 3TN2A 1JICA 1O7ZA 4RAUC 1DZ1A 1WTRA 1G2SA 2Q8RE 1DOKA 4IUVA 1F9SA 5T1IA 5AFWA 5JJZA 4UAIA 1NR2A 2HCIA 4X3TA 2EOTA 1BF4A 1G6ZA 4IUQA 1HRJA 1U4RA 2B2YA 2K05A 4RWSC 4U68A 5EKIA 2FMMA 1X3QA 2SDFA 3IFDA 3G7LA 2B2YC 2N88A 3D6WA 4IURA 5T1GA 4LMQD 1RTOA 1QG7A 5E4WC 1ZXTA 1NCVA 1MSGA 4XT1B 4IUTA 5CMDA 4IUUA 1VMPA 4MHEA 5EJWA 4ZKBB 1WVLA 1HA6A 1IKLA 1B3AA 2L11A 1WTVA 1BO0A 2FFKB 2J7ZA 1DOLA 2NZ1D 3DEOA 4XT3B 2IL8A 4QUCA 1NAPA 2HDMA 1KNEA 3KUPA 4RA8A 1QNKA 3KBXA 2RSNA 3Q6SA 1HHVA 2CVRA 5EQ0A 4HEDA 1F9RA 3QO2A 1LV9A 4IUPA 1ESRA 2B2WC 2L1BA 1RHPA 4CJ1B 5D65A 4HAEA 3I8ZA 1HFGA 4X3KA 1HUNA 2MGSA 3H91A 3GV6A 4O42A 1WD0A 3FPUB 3I3CA 3TZDA 5DNFA 1ICWA 2BDNA 2HCCA 2HDLA 5EPLA 2DY8A 4X3UA 4OIKA 1WTQA 3I90A 2H1EA 2NYZD 1J8IA 1WTPA 1RJTA 5CBAE 1MGSA 2RSOA 2RA4A 3F2UA 4CJ2C 2K28A 1PDQA 2X69A 3UI2A 2RVLA 1X32A 1PFMA 4R9WA 1QE6A 3P7JA 4OIJA 5D14A 1WD1A 2B2UC 4ZLTF 1SDFA 1E0BA 3N52A 3ONAB 4DN4M 1O7YA 1NR4A 1CM9A 1VMCA 1WTWA 1B53A 2XIWA 3GV3A 2K04A 1ILPA 2NWGA 2Q8TA 1O80A 1WTXA 2B2WA 1B4OA 1PLFA 1S4ZA 1WTOA 1SAPA 1B50A 1MSHA 2MPMA 2KOLA 5COYA 1HFNA 1EL0A 1EOTA 1F2LA 3MTSA 1U4PA 2KEEA 2B2TC 4CJ0B 2DY7A 5CBEE 3DEPA 1XYIA 1BNZA 2D9UA 2X6LA 2M2LA 3DM1A 2FINB 1JE4A 2KVMA 2B2VA 2KEDA 5CORA 2L4NA 2JYOA 2MP1A 2L9HA 1IL8A 2HUGA 2B2VC 2FHTA 2N55A 1XX8A 3LWEA 3MWYW 1X3PA 1IKMA 1GUWA 1EQTA 3R93A 1DONA 1KNAA 2B2UA 2JP1A 4ZAIA 4XDXA 2MJ8A 2FJ2A 1CA6A 1RTNA 4R8IA 3HP3A 3I91A 1AZQA 1B2TA 1EIGA 1ILQA 1DOMA 2L12A 1M8AA 1ML0D 2EE1A 2X6GA 4X3SA 4ZKCB 1A15A 1TVXA 3SVMA 1AZPA 1AP0A 1BBXC 1U4LA 2B2TA 3IL8A 1F9QA 1EIHA 2EPBA 1MI2A 4HSVA 1G2TA 1C8CA 1F9PA 4NW2A 1Q3LA 5EPKA 5EPJA 1PFNA 2R3ZA 1J9OA 2KECA 2KUMA 4ZK9B 1U4MA 3FDTA 5E4XA 1SSOA
chains in the Genus database with same CATH superfamily
4GS3A 3QOJA 4KKSA 3L9AX 2JA5G 5T1IA 4TRDA 3K7AB 4X3TA 2EOTA 5D3IB 2WACA 3TBIB 3U4ZA 4KHVA 2K5HA 3W2DA 3GTJH 1H9RA 5LL6S 2NZOA 4IUUA 4C3IG 4ZKBB 3TP6A 2NTSA 4HCEA 4BY7B 2I5MX 4A3GB 2LXKA 3ICEA 3IKJA 2NZ1D 5KYIA 1XMOQ 1ENFA 4DR5Q 1Q12A 1MJCA 3G4SA 4RA8A 4GNXC 1GHKA 2R7FA 3E9IA 2PZTA 3NWSA 3V2TA 4KMUC 1HZBA 3CCSA 1QVFA 3MHBA 4HEDA 4X66L 4KY5A 1SRUA 1UE1A 5TSSA 1VQMA 3KJOA 2IX3A 4DV7Q 2JA7G 4ILWA 1I4RA 1HNXQ 2H1EA 2NYZD 4POFA 2E2JB 5JJKA 1TQOA 3F2UA 4J8QA 4DKAC 1F2YA 3BVZA 1G291 1I94Q 3OTOL 1STGA 4IOAA 1AN8A 3Q23A 1SDFA 1IW7D 1Q8IA 2IW3A 3D4RA 1TWFH 2AUJD 1O80A 1EQVA 4Z9CB 5FO9B 1BOSA 1CTMA 1VQAA 1EL0A 1XMOL 1MJEA 1ASZA 4R4IA 4DR5L 5CBEE 3DEPA 5DEHA 1SYDA 2JSOA 2FINB 2CW0C 2VNUD 5M5WH 1QVGA 4OL7A 1CQVA 4AQYQ 2FHTA 4OX9Q 2VL6A 5BN3A 1GUWA 2A6HD 4XDXA 4DV7L 4OO1H 3VR4A 3J80c 3HOVB 4RGOS 1QOHA 1HNXL 4RCNA 4JYAQ 1K73C 1CT1D 2N78A 4JCVE 3S1MB 5HGTA 1I94L 1UEAB 3MXNA 4BBSG 2DNCA 1A2TA 4C1NI 5J1ZA 4UY8C 5EPKA 1ZKOA 1K8AC 1H95A 1MBYA 3OSOA 2KUMA 2R92H 1K0RA 3OW2A 1IYVA 5IIFA 1NNXA 1YEZA 3S2HH 1F77A 3G6JB 1HNZQ 2F3VA 1TKWB 3CRKC 4YIJA 4A76A 4RAUC 1G2SA 5AFWA 1FJGQ 1VQFA 5IP9H 3CC2A 2KJXA 3HKSA 4L6TB 2B2YA 4AQYL 3OWEB 4B9XA 4OX9L 3HOUG 1SE3A 3S1NB 1B9NA 3QB3A 4TKOB 2HQLA 1TWGB 4LFAQ 3M7GA 2WB1E 5IGCA 3J7YW 1X6OA 1GOZA 2DJGC 1VQBA 4JYAL 1BO0A 4A4IA 4A3CH 2I46A 4TVAB 2HDMA 2HD3A 5M9OA 4PMWA 3RZDH 2WV6D 4XXEA 2YV5A 1JWUD 4DV2Q 1TWCB 2KHSA 2KHIA 2F0EA 1VF5C 2F0NA 3KYHC 1CQFA 1HNZL 2WB1G 4X3KA 5JOBA 1G6PA 3TZDA 4ZUIA 2KENA 1FJGL 1TXYA 1AFPA 1GVPA 5JEAG 2JA6B 4BBRH 3F2CA 1XMQQ 2R93B 1CZGA 4R9WA 2QF7A 3DMUA 3P7JA 5D14A 4JBWA 3GTOH 3KJPA 4K6LA 1EEFD 3ULLA 1I5FA 5HGQA 1NR4A 1ILPA 1W6KA 1B4OA 4A3MG 2KOLA 4JI4Q 1YZ6A 2PNRC 2HIXA 1ET9A 3N6RA 3NENA 4ZYSA 1JC7A 3SDZA 3TP8A 3GTQH 5HY6A 3DM1A 2ID0A 1KAAA 1O7IA 4DV2L 1I4GA 2MQHA 1X3PA 3CP0A 3MVVA 3PO2H 4ZAIA 2PMZE 2E76C 1E22A 2FJ2A 3BZDB 1SJHD 3TSSA 2K5VA 4OWWB 4J6HA 4O2DA 1SNCA 4XYQA 3HOZH 2VUMB 5E3FA 2ZXRA 3DWQA 4N8FA 1XMQL 1AP0A 1VQ6A 3D4WA 3OIQA 3SK6A 2EVBA 2B3GA 4A3DB 2R3ZA 2YU9B 2ZJPA 3F2BA 4OGQC 1KAWA 2MFIA 4JI4L 2K1BA 3GTGH 3MXNB 2B39A 3U4VA 3C1FA 1F9SA 3NP8A 1HA5A 4UAIA 4DV6Q 1MKHA 1PH4A 3E0JA 1E2ZA 1DJRD 1EUJA 3DM3A 1Y14B 1SFOB 4IUTA 3H3VI 1CKNA 2RHQB 4N8X1 2N3SA 4BY1H 1EWIA 4RKLA 3U9OA 4XT3B 3J81j 1DXMA 3KUPA 2GVBA 5C5MA 2B63B 2PW5A 3Q6SA 3KDFB 3QO2A 3NTIA 4XTCS 1CFMA 1EY6A 4RHRA 1PZJD 1JWSD 3CD6A 4LF5Q 4WJ4A 4DA2A 4R1JA 5EPLA 4DV4Q 2DY8A 1X3FA 2PZWA 1PXUA 4DV6L 1A62A 1PH8A 1PH9A 3LNNA 4OIJA 1GKHA 1XNRQ 1B70B 2NUCA 2A68C 3GV3A 3NEMA 1D5ZC 5EKKA 3GTMB 1S4ZA 4C2MH 2F0OA 1MD2D 3GP7A 1VQ8A 1YJWA 2JA6G 1FNUA 2R93G 4PG3A 1V1QA 2F0GA 2B2VC 2F3IA 1PTOC 1X9NA 1JMCA 2D5DA 2B2UA 4JOIC 4NXNQ 4DK3C 3AB9A 1S3OA 4DAYA 4K5VA 3EJIA 1SMYC 4LF5L 4EQNA 4DV4L 1KDBA 1TWAB 1I4PA 2L12A 4A3FB 3M4QA 1LTID 3CCRA 1TVXA 2ZT9C 3P1HA 4XQJA 4K2LA 1VQCA 1IBKQ 4K8IA 4F87A 1Z7TA 1XNRL 2DGYA 2ASBA 1Q3LA 2LFNA 2RF4A 2KCMA 1UE7A 2R7DA 2O5JC 3KLSA 1Q82C 1CA5A 1I3QB 1Y1WB 3HKZE 1WTRA 4O0AA 1H9MA 5F2DA 2HCIA 5IP7H 4ODGA 1MHWC 4FXKC 4HIDA 4A3DG 1A8VA 3AYHB 4NXNL 5FJ8H 4L5RC 3NTKA 3I56A 4MHEA 2F4VQ 1WTHA 3AU7A 1NY4A 3HKZG 5C6AA 3Q24A 5KRUA 1ESFA 1IBKL 4HTHA 1H9JA 2IX1A 2O4XA 3WOEA 2QDBA 4BWGB 1CKNB 4DR3Q 2I07B 3J81E 3DHQA 2RHSB 3S14H 3ZJYC 4AYBB 2A19A 5CV8A 4O42A 2IT1A 3I3CA 3FPUB 4YWKA 1TWHH 2HT1A 2OTLA 3GTPH 1YIJA 2VQEQ 3GTKB 2JJQA 3E3XA 2B63G 2CH4A 5CV9A 4NXMQ 1WD1A 2B2UC 3U50C 3OPOA 4ZQ3A 1VMCA 3A8KE 3I4LA 2F4VL 5IOCA 1HCZA 1UAPA 2NBFA 4PZ6A 4DXGA 2ZTEA 4L8JA 5K5PA 4Q0FA 3H0GG 4I65A 4KY6A 5CR3A 1UEBA 4R8NA 4DR3L 2F52A 2RCNA 1GXDC 1JB7A 1Q7YC 1K83H 1EY9A 3F8TA 3BDLA 3ERSX 4IFDH 3ER0A 5JJIA 2MJ8A 1Y8NB 3I91A 5C3EH 4JI0L 5C44B 1A63A 3CMAA 4GN5A 2VQEL 1M8AA 2M00A 3QR8A 1XNQQ 2L5TA 3NELA 3R2TA 1U4LA 4XIGS 4NXML 2MNAA 1LM0A 4DAYB 3E9HA 2K5DA 1WCMB 1J9OA 1HZAA 1JJ2A 4LUOA 2A68D 4MN3A 2K03A 5JJLA 4OONA 3HOWH 3HOXH 4A3FG 4P2CB 2NVYH 1PV4A 1BBUA 4IUVA 5JJZA 2K7VA 3KF6A 1BF4A 1G6ZA 1HRJA 3T56B 5M5YB 3DWAA 2FMMA 1SE2A 3VYSA 2R7ZG 1ZXTA 1MSGA 2VZAA 4GLAC 4NB3A 1VQNA 1TS2A 3PQIA 1IKLA 1B3AA 1B1ZA 4YHHQ 1PZID 4UP8A 4K5WA 1XNQL 5IGEA 4C3IB 2IL8A 2XNAC 2Y0SB 1EU4A 2QKIC 3QJYA 4KV6A 2NVTH 1N9WA 1F9RA 4EQOA 5C4XG 1ESRA 1IW7C 4JI6Q 3K81C 2IY5B 4FDBA 2MGSA 1OXXK 5C5LA 2C9OA 4X62Q 1KD1C 1Y1VH 5I6YA 1WTQA 3GTLH 1H9KA 1PYWD 3W1BA 2JA7B 5IYDH 1PH6A 4P73A 4C3HG 1C7YA 1Y8PB 3LGJA 4DAVA 1Y69U 2CWPA 3OWFA 5JVH3 4GOPA 1R4QB 2F0MA 1TY0A 1A3UA 2A6HC 3SHLA 4YHHL 4DPGA 3I4NH 3S1RB 1WFQA 4ID6A 5I4DA 1LTLA 3TQYA 5C0XG 2EYMA 4JK1C 1C48A 4JPBW 1XYIA 4A3EB 3TP5A 4OHJA 1HQMC 4C3JG 2O2LD 1IL8A 2AUKA 2WAQB 4JI6L 3TRZA 1QB5D 3GD7A 1X54A 1IHZA 3NSWA 4X62L 2EZVA 5E7NA 1A3VA 3TDQA 5BN5A 1FVIA 2Z4HA 2X6GA 4A3BH 1QCBD 1A15A 4KLKA 3HOYG 1UNSA 2CQOA 5GQOA 2J0TD 3OMGA 1C0AA 1NUCA 4RKBA 3SXHA 3T51B 1RD9D 4A3JH 1YVCA 4DAPA 3PO3G 1FNVA 2NVQH 1UWVA 5J3BA 4KN7C 3NXWA 4V0BA 1EYCA 2KQ3A 3EQLC 1PFBA 2CH4W 3TN2A 3MAQA 3SK5A 3KFUA 2K52A 1U4RA 2Z9HA 2Z1CA 2SDFA 1SBBB 3VR3A 1WCMG 4BS9A 1G8ZD 1LUZA 4CBVA 1TT2A 4J15A 2E2DC 4N9TA 4KJNA 3HOUB 1WVLA 3JAME 3KF6B 1QZHA 4FO2A 4EQPA 3PF5A 3M3YB 3J81L 4UPAA 2RQXA 3W1GA 4G7ZC 2Y0SE 1YNXA 3I4MH 2H4OA 2VS1A 3EA6A 1QNKA 2G9HD 3FKIH 4GOPC 3A8IE 2CVRA 5EQ0A 4OO1I 3JAMi 3K7AH 2D0OA 5E1FA 1GUTA 5CC4A 3E5SA 2CCZA 3K59A 4GZYC 3OYYA 5DNFA 2Q2TA 2E8GA 1PRTF 4X3UA 4JBKA 2WB1B 3S15B 1LT3D 2SEBD 2Y0SG 1MGSA 1BXTA 2K28A 4BY7H 1V1OA 2RVLA 4A3GH 2BA0A 2GA4B 3C2PA 4XQQA 2ENBA 4IQZA 4CDDC 2F0VA 4Y52H 5FLXc 2K04A 1AE3A 3S17B 3IFTA 4A3LG 2NB0A 2F0UA 1MSHA 1X3EA 2HQEA 4OWTB 4L5TA 2D0PA 4UP7A 4A3MB 4ZUJA 5BN4A 1LACA 2M2LA 3BZCA 1R9TH 4GOPB 4POGA 4IPDA 5M3MG 2JA8H 3S2DH 2KHJA 2N55A 2JXMB 1DM0B 2WAQE 2E2JH 3R93A 1JJGA 3W5OA 5FLMH 4IJLA 3U9SA 4NKLA 1CKMA 3WWVA 1EYDA 1A6XA 1I6HH 4DK1A 1STEA 4A3EG 2EXZA 1EIHA 2YTYA 1IZ6A 3MFGA 1C8CA 2WAQG 1GJXA 1HH2P 2IHEA 4R4OA 3TS2A 5K36H 2V4DA 2MO1A 1WI5A 5C0XJ 1TWFB 3FVQA 2EYOA 2OXPA 5DM73 2PMZB 3V05A 4JI1Q 1DZ1A 1O7ZA 5M3FH 2JEAI 5JPNC 3HOVH 5JVG3 2CKZB 2VY3A 3UDIA 2PO4A 2AHOB 5IYCG 5M5WB 1NCVA 1W6JA 1IBMQ 1VMPA 1HNWQ 4EVOA 3K7UC 3G6EA 1EFWA 3EFXD 3HEJA 3K5NA 2F0JA 4A93G 4NP5A 1GD7A 1SMXA 3RZOB 1NMGA 1CHQD 2YTVA 1EQQA 2FMCA 2DNEA 1PZKD 5FOBB 2EY2A 1E2WA 5ELBA 2JA9A 4WFN3 1Y8OB 1VQPA 1FD7D 2R92B 4JI1L 3S1NH 2HCCA 1SYEA 2HDLA 3VYRA 2F0QA 2Z6BA 1SROA 1QILA 4P71A 1TU2B 4M1UB 1VQ9A 3K5OA 3BZKA 1NTGA 4HMJA 4LWCA 2WKCA 4BXXG 2O5IC 4AIMA 5I9OA 1IBML 2B2WA 3T1YQ 3JC66 4A3IH 2LKVA 3MEHA 2PCFB 2L15A 3CCUA 3GO5A 3J80i 3MC0B 3SE0A 4TSSA 2K5WA 2JYOA 1LT4D 2BA1A 2HUGA 3TEHB 1E1OA 5M5XH 3NQIA 4LF6Q 3TMEA 1T5EA 1EYGA 1EIGA 1HXYD 2ATWA 4LFAL 4RHSA 2G9DA 1Z9FA 4L63B 3RNUA 3VYTA 4C56C 1Q86C 2QGQA 3RLNA 2E2IH 3I7FA 1F9PA 3TREA 2ALYB 1EOVA 3A7AB 4BBRB 2G5DA 3T1YL 3GTOB 5I2XA 3PMFA 4JC0A 1TS3A 4HCSA 1D7QA 1V8QA 3VA5A 1SNDA 3K57A 2JK8A 3CC4A 1SNQA 2K4KA 1CUKA 4LUVA 2QA4A 3ND9A 2L0CA 1C4QA 2MHVA 4KN4C 3JAML 1SJED 2B2YC 2N88A 3GTQB 5GAGC 2VUMH 4LMQD 4B3MQ 4LF6L 5EAYA 1PH2A 1I6VC 4XT1B 4HJ7A 4DV5Q 3NHHA 1A2UA 2E75C 2EQSA 3VR2A 1JOQA 4MNOA 1T5XD 2YU9H 1BBWA 3A74A 3MEFA 1KNEA 3BYYB 2PPBC 3CQZH 2ZJQA 1BQQT 4H7BA 4UDUC 3BVMA 3HKZB 3KBXA 5KIXA 4RG1A 5GAHC 4DR7Q 1KTKA 2B2WC 1JE5A 3GV6A 2IHFA 3VA7A 1CSPA 2K75A 1FR3A 2NZHA 3I73A 4OO1G 4OIKA 2IX0A 5A35A 1SFOH 2R6GA 1ICFB 3M9BA 1WTPA 1RJTA 2KCTA 2RA4A 3BS1A 1X32A 3PIPA 1QE6A 4HJAA 4B3ML 3ONAB 4XYOA 1O7YA 1KDAA 4DV5L 3OMCA 1WTOA 2GN5A 3OW7A 2R92G 3RUZA 1EZ6A 3KF8A 5IGBA 2PW7A 3T16A 4DV1Q 4BY1B 4PMCA 1D8LA 3H0GB 4DR7L 3F2DA 1L2FA 5IP9G 1VCIA 1XXGA 3CXCA 1CA6A 4R8IA 1V1PA 2N49A 2C35B 1NMFA 1B8AA 4ABNA 3H09A 4DR1Q 2B2TA 4A75A 3H6MA 1MI2A 3ERQA 4A3CG 1G2TA 1E3PA 5EPJA 2K14A 1ENAA 4QF4A 1R4PB 4O1NA 1ZEQX 3BG3A 2EIFA 3H3VC 3QWNA 4KHZA 5GAEC 4YCUA 5C3WA 1Q81C 1YHBA 2K01A 3EROA 1HJPA 3S16B 1PRTC 1JORA 1TR5A 4C2MB 4DV1L 3C3LA 5JAVA 1EIFA 4C1NK 1E7ZA 1JT8A 4Y7NH 3D6CA 3PIOA 1PH1A 4RWSC 5JEAJ 1WJJA 4JG2A 3G7LA 1B3QA 3I4OA 3K5MA 4BBRG 1PA6A 4GKKQ 2XN9C 2RDFA 5GROA 1W3SA 4F88A 1L0WA 5IT9E 4B3SQ 2R7ZB 1V9PA 1WOCA 4DR1L 4QUCA 3D8GA 1KDCA 4CKBA 4JI2Q 4APVA 1YNND 3PF4A 1YBYA 4HMIA 1SLJA 1I3QH 4IFDI 2RSNA 5HURA 1Y1WH 1KRSA 2MO0A 3CMEA 4RGTA 3HRZC 3QIAA 3J81c 1VQIA 1PTOH 1PRTB 3J80L 3U58A 5C4XB 4K6DA 3MXPA 3UDXA 4B08A 1ICWA 3PO2G 2Z6KA 2VQFQ 4DUZQ 1VQJA 5IYBH 3PUWA 1J6QA 5IGGA 1LT6D 4L5SA 1HZCA 4QY7A 1SYFA 1WYDA 4GN4B 3HOZG 4IALA 1S5CD 3B6YA 4CDEC 1Q46A 3AFQA 4IUNA 1WTWA 4C3HB 4GKKL 1VS0A 2D2CC 2NN6H 1WTXA 2XWJB 4B3SL 2A74C 1HFNA 2B2TC 2VB2X 4JI2L 2QW7A 3A8JE 4PV1C 2IWHA 4G7HC 4PZ7A 1K0SA 5DLQE 3PUZA 1Z6HA 1LYLA 1BVSA 4QGUA 1DONA 2EY1A 4C3JB 1J5EQ 4QB4A 1NJIC 4LFCQ 3K80C 3RLOA 1X55A 1I50H 1PYBA 2VQFL 4DUZL 1GUOA 1AEXA 4BY1G 3IL8A 1PHJA 2F3WA 3ITPA 1EEID 2IPKD 5IODA 4HSVA 1YI2A 1KIXA 5CV5A 3C46A 3HOYB 1V1PB 4DR6Q 1U0LA 3A55A 4CGYB 3R2IA 3J7ZC 4OXPA 2OTJA 4DAMA 3FDTA 3FPPA 4QQBX 4LF7Q 4H13C 4GN3B 1H9SA 1VQEA 1I4QA 3PO3B 1G91A 4JI3Q 2RKSA 5C44H 1LTTD 4U68A 2A1AA 4A3KH 2WP8J 1KLGD 3D6WA 3I55A 2Z8LA 2SOBA 3D0FA 2RDGA 1QG7A 1J5EL 4LFCL 1QUQA 3FHWA 3V96A 4AH6A 4LJZC 2Z6KC 1K83B 1LTBD 3H15A 1UE5A 3CAMA 2ZJRA 3DEOA 3I70A 2YYZA 4TQUS 1HZ9A 4DR6L 2M9VA 5LMNW 4IUPA 3HFZB 2OEOA 3I8ZA 1D1KA 4LF7L 4HJ8A 4YCVA 3STBD 3IAYA 1HUNA 1OXVA 1S72A 2JA5H 3L3OC 2E2HH 1EY8A 4GLVB 4JI3L 3X3NA 3BDOA 4LUZA 2PYKA 1PRTD 2X69A 1EY7A 4QJFA 4C3IH 3N52A 4WJ3M 1D2BA 3E0EA 1CSQA 4CDFC 4FYDA 1SAPA 2MPMA 2R61A 1YNJD 4K8JA 5IY0A 5G3LD 2F0IA 3S1QB 2XWBB 1XPRA 4H02A 5ISRA 1RL2A 3VYUA 2X6LA 1VQDA 4P72A 4R4TA 1XX8A 3LWEA 3PSIA 2JA7H 4S3SA 5IP7G 5M3MB 1II3A 1STYA 3J7A5 3M4OB 5FJ8G 4GKJQ 1B2TA 2PI2E 4H0LC 1DOMA 3C1EA 3SR1A 2EE1A 1K8GA 3SVMA 1BBXC 1HR0W 4K14A 1Y1VB 4B3RQ 2EPBA 2H5XA 4ZCKA 3GTLB 1DCZA 1JB3A 2K5QA 2YTXA 4MIUA 2C5CA 3M7NA 1YHAA 1HUMA 5LMUQ 4PNYA 4X65Q 3AEVA 4K0KQ 2AWOA 3D3RA 3I4NB 1O78A 3S9WA 5A2QL 3EBEA 5IT9L 1CZWA 3IFDA 5T1GA 4IURA 2EYFA 3Q22A 1H9SB 1RCVD 4CHTB 1AW7A 1BCPD 4GKJL 1N34Q 2BOSA 1T9HA 2NVXB 2FFKB 1DOLA 4BBSH 3CCLA 5CV6A 3MXGA 4RMFA 4GNXA 5IWAQ 4B3RL 1FGBD 3EVQA 3HG9A 2LY7A 3T13A 5I6WA 1IL2A 4QIWB 4G57A 3F1ZA 4LF4Q 1QUQB 2QEJC 4FF1A 3FRPB 2GVAA 4R4QA 4A93B 2EYLA 2EY5A 2ZXPA 1LV9A 5C4JH 2EJGC 3E6ZX 1S5BD 3R3OA 1X56A 5LMUL 4X65L 4K0KL 4IFDG 4A3JB 3NQTA 2UUAQ 3K58A 5C3EG 3MZ5A 1J8IA 4WJWA 1DD2A 3HOUH 2RSOA 2A5HA 3ULPA 1TS4A 2OT2A 1CHPD 3S24A 2JN4A 4DV0Q 1CM9A 3RN5A 2NWGA 3AFPA 1N34L 2HHHQ 1B50A 1S5ED 1XPUA 4ME5A 2DJFC 2QILA 5IWAL 4DU9A 1EQRA 1BNZA 2TMPA 3RN2A 3HOWG 1XTCD 3LX0A 2MUYA 4LF4L 3HOXG 5C4ZA 1JE4A 4X66Q 2F0HA 4B3TQ 5KNCA 3I4MB 1N32Q 4LFBQ 1YJNA 3EN2A 3FKIB 4EGVA 1DGSA 1AZQA 2OF1A 1SE4A 5JEAH 1ILQA 3PCOB 2UUAL 5G3LF 4DXFA 4X3SA 2A6ED 3S17H 4HIMA 2XRQD 2BE5D 1PH5A 3OTOQ 2UXBQ 2F0DA 3L0OA 1EY5A 3ND8A 4PQXA 1QZGA 3GTJB 1PTOF 4KHPQ 4LAAA 3BYTB 4FF2A 2AMCB 3D4DA 4DV0L 4A3MH 2XTIA 3SK8A 1EIYB 1UE6A 1LO5D 1G51A 1GM5A 2HHHL 4QCLA 4IPGA 1GO3E 4JI7Q 2QDLA 2N8NA 2UXCQ 2UUCQ 1EYAA 4KTAA 4DNIA 1HQRD 1RKNA 1SE8A 5DAUA 2UU9Q 5IGDA 1KC8C 1AH9A 1Y1VG 2HIVA 5EKIA 3HZXA 4HSPA 3WOFA 4B3TL 1X3QA 2JEBI 1HPCA 2F03A 4LF8Q 2E5LQ 1N32L 4LFBL 1VQGA 2AWNA 5IYDG 2BDOA 2PQAA 1SYBA 4BA1I 1R9TB 3MXUA 3UE0A 5CGKA 2JA8B 5CMDA 3S2DB 1HA6A 1HTPA 2L11A 4RGNA 1RDPD 3KLWA 1KHIA 4WORA 2UXBL 1EZ8A 4KHPL 3I4NG 5FLXE 2KBNA 4MTKA 4QMGA 4QIWE 1QVCA 4G7OC 1X65A 3J7AV 1I6HB 1HHVA 3NBIA 2FXQA 2L1BA 4CJ1B 3PUXA 2SNSA 4JI7L 4MTNA 5KNBA 1XWEA 4IPHA 2UXCL 1RIPA 3FP9A 2UUCL 1BCPF 2ICIA 1E2VA 2Q8IB 4GNXB 5ELOA 3S1MH 4PZ8A 1F2MA 1Z47A 1TS5A 1ENCA 2UU9L 4HR7B 2F0FA 1SNPA 5ELFA 5LMNQ 1N36Q 1BDOA 4LF8L 4A3BG 5EBCA 2E5LL 5M3FB 2A8VA 4ZLTF 1ASYA 2DUDA 3NPPA 2Q2UA 1OXUA 2K6AA 3RZOH 1KXLA 1ZYRD 5KYLA 4A3JG 1I4HA 3UDGA 1U4PA 2KEEA 2A69D 4JW0A 1IBLQ 3IRBA 3SGIA 1P8LA 2XGTA 2L4NA 3S2HB 1LTSD 1TWGH 5LL6X 1K3BC 1BR9A 5EGTA 4DGZA 2JP1A 3J80E 3NBHA 4IFDJ 4IOCA 4FF3A 1FL0A 1LT5D 2TSSA 5LMNL 1N36L 1HNWL 1TWCH 1JQYD 4XQNA 1LABA 1FGUA 3AMUA 3CPWA 3KDFA 2RBMA 3I4MG 2ES2A 3VR5A 1DYQA 4ZK9B 1HTLD 2AKWB 2F0WA 3FKIG 5AJ3Q 4JV5Q 1STAA 3OHXC 3X3MA 3RZDB 2JA6H 1HR0Q 1IBLL 2R93H 1SYCA 1QWYA 4A3IB 2F0LA 3RD4A 1YNNC 1Q1BA 1FYCA 4B9WA 2WFWA 4BY7G 1EY0A 1SR3A 4IO9A 1PH7A 4A3GG 2PQEA 5C3XA 5I2YA 2LXJA 3K5LA 5M5XB 1CKOA 1EWCA 3EIVA 1ONLA 3PV0A 4HJ5A 2UUBQ 5FK9C 1F2ZA 1NE3A 3RLFA 2PQAB 4IJHA 3OIPA 1RHPA 5D65A 5AJ3L 4HAEA 1GUGA 2E2IB 3NK9A 2JA8G 4RFBA 4JV5L 3GDEA 1STHA 3ULJA 2I0QA 1HR0L 4CKCA 2K33A 4DR4Q 3UDFA 4FXDA 2LS01 5FLMG 4JI5Q 3I90A 3CCMA 1D5XC 4A3DH 3BDCA 5EKLA 4CJ2C 3PO2B 1PDQA 1PFMA 5GADC 1VQ7A 2B8GA 3TP7A 4NPSA 3AQQA 3MFYA 5J22A 2WIIB 2XIWA 3PGZA 3HOZB 3BJUA 3P75A 3Q0AA 4N9PA 1GUNA 1B9MA 2V1CC 4U673 2UUBL 1UUPA 3KLSX 4DNTB 3DUZA 2VW9A 5K36G 1FNWA 3FEWX 1A0IA 2ZTDA 3WDNA 5CYUA 4OWXB 2D9UA 1OO9B 1M4VA 1YJ9A 1Q8KA 2B2VA 2KEDA 4IN3A 5M3FG 5EBDA 4JOIA 3HOVG 1C9OA 3K0XA 3CC7A 3CQZB 2K5NA 1KLUD 3GTGB 3NE5B 1KNAA 2BCOA 3D31A 4DR2Q 1CK1A 4DR4L 1JOOA 4RH6A 1TY2A 4DK0A 4JI5L 4OELB 2B63H 5C4HA 1JR0D 2PZUA 4HN7A 5LHY1 2CW0D 1F9QA 3NBHB 3L2PA 4PMBA 4EX5A 2F0SA 4NW2A 2PI2A 4DUYQ 2F0KA 2WKDA 3KK7A 3CRLC 3H0GH 4DK6C 2OWOA 4QUFA 2VXWA 4RGMA 1U9RA 5L37A 1VQOA 1QJOA 1EWHA 2CWAA 2Q8RE 2OQ0A 4V190 2F0PA 1SN8A 4KJOA 3Q8DA 1KRTA 5I9PA 3UI2A 2NN6I 3GTMH 1JOKA 4IPCA 3NUCA 1RTOA 3CPFA 5E4WC 4DR2L 5FLXL 1L1OA 4BA2I 4F8MA 3STBC 5CV4A 2ICEC 5CV7A 4DNRB 2K50A 4DV3Q 1WTVA 2QEXA 4KK7A 1VQLA 5IT9c 1EFID 5C0XI 4A3IG 2AQ2B 1IYJB 1K3RA 4F7XA 2ZM6Q 1N33Q 3KOJA 3S16H 3M4YA 4HIOA 1VDZA 2UXDQ 1EY4A 4DUYL 1E24A 1U5KA 1Q90A 2RDHA 1TWAH 3A0JA 5D3DA 4WRDA 4A3FH 4LF9Q 5ELEA 1YNJC 3CCJA 3QOLA 4P74A 5A2QE 1CI3M 3HGBA 3URYA 5CBAE 2I5HA 3TZUA 2R7ZH 3P20A 5ELCA 2B29A 5J39A 4Y7NB 4JBJA 1GHJA 3BU2A 5ELDA 4KD3A 4X6AH 4DV3L 4GLXA 3J7AF 3A54A 5COYA 3H3VH 1EOTA 1STNA 5JPMC 3LWUA 3R8BA 2ZM6L 4E6IA 1N33L 5C4XH 5FO7B 1LTGD 2UXDL 2I5LX 2LMCB 5FKAC 2E74C 4L5QA 1IKMA 1EQTA 4LF9L 4I7AA 1BUVT 1B44D 2AQ3B 3CKIB 2KA7A 1PVOA 2VUMG 5H1SE 1AE2A 2K32A 5IE8A 1VF7A 4C3HH 1XTDA 1PTOB 2VB3X 1AZPA 1XJVA 4P75A 3DLLA 3VDYA 4CKEA 4LW1A 1L1OC 1YHQA 3H94A 4H44C 4ZRZA 3RR5A 3DWPA 1VQ4A 5C0XH 5E4XA 1BCPC 3GTKH 1B7YB 3KF8B 1JICA 4C3JH 3A5ZB 1DOKA 3S14B 2Z0SA 2XVSA 4IUQA 1SXTA 1S40A 3I72A 2JQOA 4ULLA 4OEMB 2CQAA 4YWLA 2EDGA 1TWHB 4JI0Q 3GTPB 1SNOA 1PFSA 3PUYA 5EJWA 1K9MC 3HOYH 1SNMA 2F4IA 1PYSB 3NWTA 5BR8Q 3J81i 2J7ZA 3PUVA 1OXSC 4KD4A 1L0YB 1I50B 1SYGA 3CCVA 5NUCA 4YY3Q 1LLRD 3W3AA 1KQSA 1L1OB 4IZ8A 3PO3H 2EY6A 1RF2D 2DN8A 1MIUA 4UP9A 1BKBA 3T1HQ 4YCWA 1K8MA 1BCPB 1X3GA 2OQKA 3GQBA 1HFGA 2EYPA 1L0XB 2ZTCA 3A5UA 2QCPX 2NTTA 3H91A 1XPOA 1WD0A 1NBWA 3O13A 4HIKA 1ET6A 4KKUA 4HJ9A 1WCMH 3VR6A 1KABA 2OCEA 3M4PA 2CHBD 3T4AC 2ZXOA 5C3EB 3TS0A 1QNUA 4JI8Q 1E0BA 2Z4IA 4DN4M 1VQ5A 3CW2C 4A3KB 4I7ZC 2L55A 3K6OA 1IYUA 5BR8L 3CF5A 4DFAA 1F2LA 5M5YH 3K8AA 3NTHA 5IGFA 4JVZA 2A6EC 2DY7A 4CJ0B 2BE5C 2KCNA 4YY3L 2KVMA 1JCKB 2XRSD 2IJ0A 2KCCA 2MP1A 3T1HL 3HOWB 3HOXB 2BH8A 4ME3A 4X64Q 4K2KA 2NVYB 1S5DD 2J4XA 1V43A 4K5XA 2BH2A 4ZKCB 2JE6I 2JA5B 2EJFC 4M8AA 1OTCA 2E2HB 4FP5D 2Q2HA 3MA2B 3BVGA 4A3LH 4JI8L 3S1QH 1IXRA 4R4CA 2EJMA 1PFNA 1PTOD 1D5MC 3G71A 2SNMA 4FNFA 1LTAD 2KECA 3FMCA 4NMZA 1U4MA 1Y1WG 4MZ9A 1SMYD 1SSOA 4KKTA 1RODA 4LK1C 3K0YA 4QL5A 2NVTB 1NSNS 5M3MH 2Q2IA 1TIID 3M4OH 1NR2A 1JWMD 3A56A 1A3TA 2K05A 3DXJC 2B8FA 2XSCA 1VQKA 3PIP3 1N8RC 5IYBG 1PMRA 4FXGC 1D6EC 4EQ5A 4AYBE 4X64L 4FF4A 3S1RH 1O7LA 4RCOA 3HS0C 4A3EH 3CCEA 4JBMA 2NN6G 2F0TA 2EYJA 1NAPA 1YITA 3SEBA 4KY7A 1EU3A 2RCFA 3CCQA 1PH3A 5FO8B 4YWMA 2LSSA 4NDXA 4AYBG 4LNQA 3QG1A 2CFMA 1GUSA 1W2BA 4J1MA 5KGUA 1K8OA 4Q5VA 1ZYRC 4CDCC 3ZYYX 1S5FD 2BDNA 3CU7A 2A69C 2A73B 1P16A 5IYCH 3JAMc 2P5ZX 4G4KA 4UHVA 2NVXH 5DM63 1K28A 1M1KC 1STBA 1B53A 5KNDA 3L7ZC 3RMHA 2EXDA 2Q8TA 4A3BB 2F1MA 1PLFA 3KLRA 1I4XA 4A93H 1JJCB 1D1IA 3MTSA 4KI0A 4DF7A 3OOCA 1KL9A 1LTRD 3I2ZA 2PNHA 3T53B 3A7LA 5CORA 3PIO3 1M90C 4ALPA 4BBSB 2NVQB 2L9HA 1Q1EA 1OXTA 3MWYW 5C44G 2WINB 4A3KG 3M3YH 1RTNA 3HP3A 3SK4A 5C4JB 3M85A 1E1TA 3KBGA 1ML0D 3CHBD 4BXXH 2D62A 5KEEA 1SEBD 3UE1A 4FVMA 2AQ1B 1VQHA 3S15H 2EYHA 5ELNA 3G48A
chains in the Genus database with same CATH topology
3QOJA 4KKSA 3L9AX 5T1IA 4TRDA 3K7AB 4X3TA 2EOTA 5D3IB 2WACA 3TBIB 4KHVA 3W2DA 1H9RA 5LL6S 4IUUA 4C3IG 4ZKBB 3TP6A 2NTSA 4HCEA 4BY7B 4A3GB 3IKJA 2NZ1D 5KYIA 1ENFA 1Q12A 4RA8A 1GHKA 2PZTA 3NWSA 3V2TA 4KMUC 3MHBA 4HEDA 4KY5A 5TSSA 2IX3A 4ILWA 1I4RA 2H1EA 2NYZD 2E2JB 1TQOA 3F2UA 4J8QA 1F2YA 3BVZA 1G291 1STGA 1AN8A 3Q23A 1SDFA 1IW7D 1Q8IA 2IW3A 3D4RA 2AUJD 1O80A 1EQVA 4Z9CB 5FO9B 1BOSA 1CTMA 1EL0A 5CBEE 3DEPA 5DEHA 1SYDA 2JSOA 2FINB 2CW0C 2VNUD 4OL7A 1CQVA 2FHTA 5BN3A 1GUWA 2A6HD 4XDXA 4OO1H 3VR4A 3HOVB 4RGOS 1QOHA 4RCNA 1CT1D 3S1MB 5HGTA 1UEAB 3MXNA 2DNCA 1A2TA 4C1NI 5J1ZA 5EPKA 1ZKOA 1MBYA 3OSOA 2KUMA 1IYVA 5IIFA 1F77A 3G6JB 2F3VA 1TKWB 3CRKC 4YIJA 4RAUC 1G2SA 5AFWA 2KJXA 4L6TB 2B2YA 3OWEB 4B9XA 1SE3A 3S1NB 1B9NA 3QB3A 4TKOB 1TWGB 3M7GA 5IGCA 3J7YW 1GOZA 1BO0A 2I46A 2HDMA 5M9OA 4PMWA 2WV6D 4XXEA 1JWUD 1TWCB 2KHSA 2F0EA 1VF5C 2F0NA 1CQFA 4X3KA 5JOBA 3TZDA 4ZUIA 1AFPA 5JEAG 2JA6B 2R93B 1CZGA 4R9WA 2QF7A 3DMUA 3P7JA 5D14A 4JBWA 4K6LA 1EEFD 1NR4A 1ILPA 1W6KA 1B4OA 2KOLA 2PNRC 1ET9A 3N6RA 4ZYSA 1JC7A 3SDZA 3TP8A 3DM1A 2ID0A 1KAAA 1I4GA 1X3PA 3MVVA 4ZAIA 2E76C 2FJ2A 3BZDB 1SJHD 3TSSA 4J6HA 1SNCA 4XYQA 2VUMB 5E3FA 2ZXRA 3DWQA 1AP0A 3D4WA 3OIQA 3SK6A 2EVBA 4A3DB 2R3ZA 2YU9B 4OGQC 2K1BA 2B39A 3C1FA 1F9SA 3NP8A 1HA5A 4UAIA 3E0JA 1E2ZA 1DJRD 1SFOB 4IUTA 4RKLA 3U9OA 4XT3B 1DXMA 3KUPA 5C5MA 2B63B 2PW5A 3Q6SA 3QO2A 3NTIA 4XTCS 1CFMA 1EY6A 4RHRA 1PZJD 1JWSD 4DA2A 5EPLA 2DY8A 2PZWA 1PXUA 3LNNA 4OIJA 2NUCA 2A68C 3GV3A 1D5ZC 5EKKA 3GTMB 1S4ZA 2F0OA 1MD2D 3GP7A 1FNUA 2F0GA 2B2VC 1PTOC 2D5DA 2B2UA 3AB9A 4DAYA 4K5VA 3EJIA 1SMYC 4EQNA 1KDBA 1TWAB 1I4PA 2L12A 4A3FB 1LTID 1TVXA 2ZT9C 3P1HA 4XQJA 4K2LA 4K8IA 4F87A 1Z7TA 1Q3LA 2LFNA 2O5JC 3KLSA 1CA5A 1I3QB 1Y1WB 1WTRA 1H9MA 5F2DA 2HCIA 4ODGA 4FXKC 3NTKA 4MHEA 3AU7A 5C6AA 3Q24A 5KRUA 1ESFA 4HTHA 1H9JA 2IX1A 2O4XA 3WOEA 2QDBA 4BWGB 2I07B 3J81E 3DHQA 4AYBB 5CV8A 4O42A 2IT1A 3FPUB 3I3CA 3GTKB 5CV9A 1WD1A 2B2UC 3OPOA 4ZQ3A 1VMCA 3A8KE 3I4LA 5IOCA 1HCZA 1UAPA 2NBFA 4DXGA 4L8JA 5K5PA 4Q0FA 4I65A 4KY6A 5CR3A 4R8NA 1GXDC 1EY9A 3BDLA 4IFDH 2MJ8A 1Y8NB 3I91A 5C44B 1M8AA 2M00A 2L5TA 3R2TA 1U4LA 4XIGS 2K5DA 1WCMB 1J9OA 2A68D 4MN3A 2K03A 4P2CB 4IUVA 5JJZA 2K7VA 1BF4A 1G6ZA 1HRJA 3T56B 5M5YB 3DWAA 2FMMA 1SE2A 3VYSA 1ZXTA 1MSGA 1TS2A 1IKLA 1B3AA 1B1ZA 1PZID 4K5WA 5IGEA 4C3IB 2IL8A 2XNAC 2Y0SB 1EU4A 2QKIC 3QJYA 4KV6A 1F9RA 4EQOA 1ESRA 1IW7C 2MGSA 1OXXK 5C5LA 2C9OA 5I6YA 1WTQA 1H9KA 1PYWD 2JA7B 4C3HG 1Y8PB 4DAVA 1Y69U 3OWFA 5JVH3 1R4QB 2F0MA 1TY0A 1A3UA 2A6HC 3SHLA 3S1RB 4ID6A 5I4DA 5C0XG 2EYMA 4JK1C 1C48A 1XYIA 4A3EB 3TP5A 4OHJA 1HQMC 4C3JG 2O2LD 1IL8A 2AUKA 2WAQB 1QB5D 3GD7A 1IHZA 3NSWA 2EZVA 1A3VA 3TDQA 5BN5A 2Z4HA 2X6GA 1QCBD 1A15A 1UNSA 2J0TD 3OMGA 1NUCA 4RKBA 3SXHA 3T51B 1RD9D 4DAPA 1FNVA 4KN7C 3NXWA 4V0BA 1EYCA 2KQ3A 3EQLC 1PFBA 3TN2A 3MAQA 3SK5A 1U4RA 2Z1CA 2SDFA 1SBBB 3VR3A 4BS9A 1G8ZD 4CBVA 1TT2A 2E2DC 4N9TA 4KJNA 3HOUB 1WVLA 3JAME 4FO2A 4EQPA 3M3YB 3J81L 2RQXA 4G7ZC 2H4OA 3EA6A 1QNKA 2G9HD 3A8IE 2CVRA 5EQ0A 4OO1I 5E1FA 1GUTA 5CC4A 3E5SA 3K59A 4GZYC 5DNFA 1PRTF 4X3UA 3S15B 2WB1B 1LT3D 2SEBD 1MGSA 1BXTA 2K28A 1V1OA 2RVLA 2BA0A 2GA4B 3C2PA 4XQQA 2ENBA 4IQZA 2F0VA 2K04A 3S17B 3IFTA 2NB0A 2F0UA 1MSHA 2HQEA 4A3MB 4ZUJA 5BN4A 1LACA 2M2LA 2N55A 2JXMB 1DM0B 3R93A 3U9SA 4NKLA 1EYDA 1A6XA 4DK1A 1STEA 2EXZA 1EIHA 3MFGA 1C8CA 1GJXA 5K36H 2V4DA 5C0XJ 1TWFB 3FVQA 2EYOA 2OXPA 5DM73 2PMZB 3V05A 1DZ1A 1O7ZA 2JEAI 5JPNC 5JVG3 2PO4A 5M5WB 1NCVA 1W6JA 1VMPA 4EVOA 3EFXD 3HEJA 3K5NA 2F0JA 4NP5A 3RZOB 1CHQD 2FMCA 2DNEA 1PZKD 5FOBB 2EY2A 1E2WA 5ELBA 4WFN3 1Y8OB 1FD7D 2R92B 2HCCA 1SYEA 2HDLA 3VYRA 2F0QA 1QILA 1TU2B 4M1UB 3K5OA 4HMJA 2WKCA 2O5IC 5I9OA 2B2WA 2LKVA 3MEHA 2PCFB 3GO5A 3MC0B 3SE0A 4TSSA 2K5WA 2JYOA 1LT4D 2BA1A 2HUGA 3NQIA 3TMEA 1T5EA 1EIGA 1HXYD 4RHSA 2G9DA 4L63B 3VYTA 4C56C 1F9PA 3A7AB 4BBRB 3GTOB 5I2XA 3PMFA 1TS3A 4HCSA 1V8QA 3VA5A 1SNDA 3K57A 1SNQA 2L0CA 3ND9A 1C4QA 2MHVA 4KN4C 3JAML 1SJED 2B2YC 2N88A 3GTQB 4LMQD 1I6VC 4XT1B 3NHHA 1A2UA 2E75C 3VR2A 1JOQA 1T5XD 1KNEA 3BYYB 2PPBC 1BQQT 4H7BA 4UDUC 3BVMA 3HKZB 3KBXA 5KIXA 1KTKA 2B2WC 3GV6A 3VA7A 1FR3A 3I73A 4OO1G 4OIKA 2IX0A 5A35A 2R6GA 1WTPA 1RJTA 2RA4A 3BS1A 1X32A 1QE6A 3ONAB 4XYOA 1O7YA 1KDAA 3OMCA 1WTOA 3OW7A 3RUZA 1EZ6A 3KF8A 5IGBA 2PW7A 3T16A 4BY1B 4PMCA 3H0GB 1VCIA 1XXGA 1CA6A 4R8IA 1V1PA 4ABNA 3H09A 2B2TA 3H6MA 1MI2A 3ERQA 1G2TA 5EPJA 1ENAA 4QF4A 1R4PB 4O1NA 1ZEQX 3BG3A 3H3VC 4KHZA 3QWNA 5C3WA 2K01A 3EROA 3S16B 1PRTC 1JORA 1TR5A 4C2MB 3C3LA 5JAVA 4C1NK 3D6CA 4RWSC 5JEAJ 3G7LA 3K5MA 2XN9C 2RDFA 2R7ZB 4F88A 5IT9E 4QUCA 3D8GA 1KDCA 4CKBA 1YNND 4HMIA 4IFDI 2RSNA 5HURA 4RGTA 3HRZC 3QIAA 1PTOH 1PRTB 3J80L 5C4XB 4K6DA 3MXPA 4B08A 1ICWA 3PUWA 5IGGA 1LT6D 1SYFA 4IALA 1S5CD 4IUNA 1WTWA 4C3HB 2D2CC 2NN6H 1WTXA 2XWJB 2A74C 1HFNA 2B2TC 2VB2X 4PV1C 3A8JE 2IWHA 4G7HC 3PUZA 1Z6HA 1DONA 2EY1A 4C3JB 4QB4A 1GUOA 1AEXA 3IL8A 2F3WA 3ITPA 1EEID 2IPKD 5IODA 4HSVA 3C46A 5CV5A 3HOYB 1V1PB 3A55A 4CGYB 3R2IA 3FDTA 3FPPA 4H13C 1H9SA 1I4QA 3PO3B 1G91A 2RKSA 1LTTD 4U68A 2WP8J 1KLGD 3D6WA 2Z8LA 2SOBA 2RDGA 1QG7A 3V96A 4LJZC 1K83B 1LTBD 3DEOA 3I70A 2YYZA 4TQUS 2M9VA 4IUPA 2OEOA 3I8ZA 1D1KA 3IAYA 1HUNA 1OXVA 3L3OC 1EY8A 3X3NA 3BDOA 2PYKA 1PRTD 2X69A 1EY7A 3N52A 1D2BA 4FYDA 1SAPA 2MPMA 2R61A 1YNJD 4K8JA 5G3LD 2F0IA 3S1QB 2XWBB 5ISRA 3VYUA 2X6LA 1XX8A 3LWEA 4S3SA 5M3MB 1II3A 1STYA 3M4OB 1B2TA 4H0LC 1DOMA 3C1EA 3SR1A 2EE1A 3SVMA 1BBXC 4K14A 1Y1VB 2EPBA 3GTLB 1DCZA 1JB3A 2K5QA 4MIUA 2C5CA 3M7NA 1HUMA 4PNYA 2AWOA 3D3RA 3I4NB 1O78A 3S9WA 5A2QL 5IT9L 1CZWA 3IFDA 5T1GA 4IURA 2EYFA 3Q22A 1H9SB 1RCVD 4CHTB 1AW7A 1BCPD 2BOSA 2NVXB 2FFKB 1DOLA 5CV6A 3MXGA 1FGBD 3EVQA 3HG9A 2LY7A 3T13A 5I6WA 4QIWB 4G57A 2QEJC 4FF1A 3FRPB 4A93B 2EYLA 2EY5A 2ZXPA 1LV9A 2EJGC 3E6ZX 1S5BD 3R3OA 4IFDG 4A3JB 3NQTA 3K58A 1J8IA 3MZ5A 4WJWA 1DD2A 2RSOA 2A5HA 1TS4A 2OT2A 1CHPD 1CM9A 2NWGA 1B50A 1S5ED 4ME5A 2QILA 4DU9A 1BNZA 2TMPA 1XTCD 3LX0A 2MUYA 5C4ZA 1JE4A 2F0HA 5KNCA 3I4MB 3FKIB 4EGVA 1AZQA 2OF1A 1SE4A 5JEAH 1ILQA 5G3LF 4DXFA 4X3SA 2A6ED 2XRQD 2BE5D 2F0DA 3ND8A 1EY5A 4PQXA 3GTJB 1PTOF 4LAAA 3BYTB 4FF2A 3D4DA 3SK8A 1LO5D 4QCLA 1EYAA 4KTAA 1HQRD 1RKNA 5DAUA 5IGDA 5EKIA 3HZXA 4HSPA 3WOFA 1X3QA 2JEBI 1HPCA 2F03A 2AWNA 1R9TB 2BDOA 4BA1I 1SYBA 3MXUA 5CGKA 2JA8B 5CMDA 3S2DB 1HA6A 1HTPA 2L11A 4RGNA 1RDPD 4WORA 1EZ8A 5FLXE 4QMGA 4G7OC 3J7AV 1I6HB 1HHVA 3NBIA 2L1BA 4CJ1B 3PUXA 2SNSA 5KNBA 1XWEA 1BCPF 2Q8IB 2ICIA 1E2VA 1F2MA 1Z47A 1TS5A 1ENCA 4HR7B 2F0FA 1SNPA 5ELFA 1BDOA 5EBCA 5M3FB 4ZLTF 3NPPA 1OXUA 2K6AA 1ZYRD 5KYLA 1I4HA 1U4PA 2KEEA 2A69D 2L4NA 3S2HB 1LTSD 5LL6X 1BR9A 5EGTA 4DGZA 2JP1A 3J80E 3NBHA 4IFDJ 4FF3A 2TSSA 1LT5D 1JQYD 4XQNA 1LABA 3AMUA 2RBMA 3VR5A 1DYQA 4ZK9B 1HTLD 2F0WA 1STAA 3OHXC 3X3MA 3RZDB 1SYCA 1QWYA 4A3IB 2F0LA 3RD4A 1YNNC 1Q1BA 1FYCA 4B9WA 1EY0A 2PQEA 5C3XA 5I2YA 3K5LA 5M5XB 1EWCA 1ONLA 3PV0A 5FK9C 1F2ZA 3RLFA 3OIPA 1RHPA 5D65A 2E2IB 4HAEA 1GUGA 3NK9A 4RFBA 1STHA 4CKCA 2K33A 4FXDA 2LS01 3I90A 1D5XC 3BDCA 5EKLA 4CJ2C 3PO2B 1PDQA 1PFMA 2B8GA 3TP7A 3MFYA 5J22A 2WIIB 2XIWA 3HOZB 3P75A 3Q0AA 4N9PA 1GUNA 1B9MA 4U673 1UUPA 3KLSX 4DNTB 3DUZA 5K36G 1FNWA 3FEWX 3WDNA 5CYUA 2D9UA 1OO9B 1M4VA 2B2VA 2KEDA 4IN3A 5EBDA 3GTGB 3CQZB 1KLUD 3NE5B 1KNAA 2BCOA 3D31A 1CK1A 1JOOA 4RH6A 1TY2A 4DK0A 5C4HA 1JR0D 2PZUA 4HN7A 5LHY1 2CW0D 1F9QA 4PMBA 2F0SA 4NW2A 2F0KA 2WKDA 3KK7A 3CRLC 4QUFA 2VXWA 4RGMA 1U9RA 1QJOA 1EWHA 2Q8RE 4V190 2F0PA 4KJOA 5I9PA 3UI2A 2NN6I 1JOKA 3NUCA 1RTOA 5E4WC 5FLXL 4BA2I 4F8MA 5CV4A 2ICEC 5CV7A 4DNRB 1WTVA 4KK7A 1EFID 5C0XI 2AQ2B 4F7XA 3M4YA 1VDZA 1EY4A 1Q90A 2RDHA 5D3DA 4WRDA 5ELEA 1YNJC 3QOLA 5A2QE 1CI3M 3HGBA 3URYA 5CBAE 3TZUA 3P20A 5ELCA 5J39A 4Y7NB 1GHJA 5ELDA 4KD3A 3J7AF 3A54A 5COYA 1EOTA 1STNA 5JPMC 3LWUA 3R8BA 4E6IA 5FO7B 1LTGD 5FKAC 2LMCB 2E74C 1IKMA 1EQTA 1BUVT 1B44D 2AQ3B 3CKIB 2KA7A 2K32A 1VF7A 1PTOB 2VB3X 1AZPA 4CKEA 3H94A 4H44C 4ZRZA 3DWPA 5C0XH 5E4XA 1BCPC 1JICA 1DOKA 3S14B 2XVSA 4IUQA 1SXTA 3I72A 4ULLA 2CQAA 2EDGA 1TWHB 3GTPB 1SNOA 3PUYA 5EJWA 1SNMA 2F4IA 3NWTA 2J7ZA 3PUVA 1OXSC 4KD4A 1L0YB 1I50B 1SYGA 5NUCA 1LLRD 3W3AA 4IZ8A 2EY6A 1RF2D 2DN8A 1K8MA 1BCPB 3GQBA 1HFGA 2EYPA 1L0XB 2QCPX 2NTTA 3H91A 1WD0A 3O13A 1ET6A 4KKUA 3VR6A 1KABA 2CHBD 3T4AC 2ZXOA 5C3EB 1QNUA 1E0BA 2Z4IA 4DN4M 4A3KB 4I7ZC 2L55A 3K6OA 1IYUA 4DFAA 1F2LA 3NTHA 5IGFA 2A6EC 2DY7A 4CJ0B 2BE5C 2KCNA 2KVMA 1JCKB 2XRSD 2IJ0A 2KCCA 2MP1A 3HOWB 3HOXB 4K2KA 2NVYB 1S5DD 2J4XA 1V43A 4K5XA 4ZKCB 2JE6I 2JA5B 2EJFC 4M8AA 2E2HB 4FP5D 3MA2B 3BVGA 2EJMA 1PFNA 1PTOD 1D5MC 2SNMA 4FNFA 1LTAD 2KECA 3FMCA 4NMZA 1U4MA 1SMYD 1SSOA 4KKTA 1RODA 4LK1C 3K0YA 2NVTB 1NSNS 1TIID 1NR2A 1JWMD 3A56A 1A3TA 2K05A 3DXJC 2B8FA 2XSCA 3PIP3 1PMRA 4FXGC 1D6EC 4FF4A 1O7LA 4RCOA 3HS0C 2NN6G 2F0TA 2EYJA 1NAPA 3SEBA 4KY7A 1EU3A 5FO8B 4NDXA 3QG1A 1GUSA 4J1MA 5KGUA 1K8OA 4Q5VA 1ZYRC 3ZYYX 1S5FD 2BDNA 3CU7A 2A69C 2A73B 4G4KA 5DM63 1STBA 1B53A 5KNDA 3L7ZC 3RMHA 4A3BB 2Q8TA 2F1MA 1PLFA 3KLRA 1I4XA 1D1IA 3MTSA 4KI0A 4DF7A 3OOCA 1LTRD 3T53B 3A7LA 5CORA 3PIO3 4BBSB 2NVQB 2L9HA 1Q1EA 1OXTA 3MWYW 2WINB 1RTNA 3HP3A 3SK4A 5C4JB 3M85A 3KBGA 1ML0D 3CHBD 2D62A 5KEEA 1SEBD 4FVMA 2AQ1B 2EYHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1HUM A;  1ROD A;  2K01 A;  4MN3 A;  2K03 A;  4HCS A;  4QUF A;  2VXW A;  2K1B A;  1PFB A;  1CA5 A;  1G91 A;  3TN2 A;  1JIC A;  1O7Z A;  4RAU C;  1DZ1 A;  1WTR A;  1G2S A;  2Q8R E;  1DOK A;  4IUV A;  1F9S A;  5T1I A;  5AFW A;  5JJZ A;  4UAI A;  1NR2 A;  2HCI A;  4X3T A;  2EOT A;  1BF4 A;  1G6Z A;  4IUQ A;  1HRJ A;  1U4R A;  2B2Y A;  2K05 A;  4RWS C;  4U68 A;  5EKI A;  2FMM A;  1X3Q A;  2SDF A;  3IFD A;  3G7L A;  2B2Y C;  2N88 A;  3D6W A;  4IUR A;  5T1G A;  4LMQ D;  1RTO A;  1QG7 A;  5E4W C;  1ZXT A;  1NCV A;  1MSG A;  4XT1 B;  4IUT A;  5CMD A;  4IUU A;  1VMP A;  4MHE A;  5EJW A;  4ZKB B;  1WVL A;  1HA6 A;  1IKL A;  1B3A A;  2L11 A;  1WTV A;  1BO0 A;  2FFK B;  2J7Z A;  1DOL A;  2NZ1 D;  3DEO A;  4XT3 B;  2IL8 A;  4QUC A;  1NAP A;  2HDM A;  1KNE A;  3KUP A;  4RA8 A;  1QNK A;  3KBX A;  2RSN A;  3Q6S A;  1HHV A;  2CVR A;  5EQ0 A;  4HED A;  1F9R A;  3QO2 A;  1LV9 A;  4IUP A;  1ESR A;  2B2W C;  2L1B A;  1RHP A;  4CJ1 B;  5D65 A;  4HAE A;  3I8Z A;  1HFG A;  4X3K A;  1HUN A;  2MGS A;  3H91 A;  3GV6 A;  4O42 A;  1WD0 A;  3FPU B;  3I3C A;  3TZD A;  5DNF A;  1ICW A;  2BDN A;  2HCC A;  2HDL A;  5EPL A;  2DY8 A;  4X3U A;  4OIK A;  1WTQ A;  3I90 A;  2H1E A;  2NYZ D;  1J8I A;  1WTP A;  1RJT A;  5CBA E;  1MGS A;  2RSO A;  2RA4 A;  3F2U A;  4CJ2 C;  2K28 A;  1PDQ A;  2X69 A;  3UI2 A;  2RVL A;  1X32 A;  1PFM A;  4R9W A;  1QE6 A;  3P7J A;  4OIJ A;  5D14 A;  1WD1 A;  2B2U C;  4ZLT F;  1SDF A;  1E0B A;  3N52 A;  3ONA B;  4DN4 M;  1O7Y A;  1NR4 A;  1CM9 A;  1VMC A;  1WTW A;  1B53 A;  2XIW A;  3GV3 A;  2K04 A;  1ILP A;  2NWG A;  2Q8T A;  1O80 A;  1WTX A;  2B2W A;  1B4O A;  1PLF A;  1S4Z A;  1WTO A;  1SAP A;  1B50 A;  1MSH A;  2MPM A;  2KOL A;  5COY A;  1HFN A;  1EL0 A;  1EOT A;  1F2L A;  3MTS A;  1U4P A;  2KEE A;  2B2T C;  4CJ0 B;  2DY7 A;  5CBE E;  3DEP A;  1XYI A;  1BNZ A;  2D9U A;  2X6L A;  2M2L A;  3DM1 A;  2FIN B;  1JE4 A;  2KVM A;  2B2V A;  2KED A;  5COR A;  2L4N A;  2JYO A;  2MP1 A;  2L9H A;  1IL8 A;  2HUG A;  2B2V C;  2FHT A;  2N55 A;  1XX8 A;  3LWE A;  3MWY W;  1X3P A;  1IKM A;  1GUW A;  1EQT A;  3R93 A;  1DON A;  1KNA A;  2B2U A;  2JP1 A;  4ZAI A;  4XDX A;  2MJ8 A;  2FJ2 A;  1CA6 A;  1RTN A;  4R8I A;  3HP3 A;  3I91 A;  1AZQ A;  1B2T A;  1EIG A;  1ILQ A;  1DOM A;  2L12 A;  1M8A A;  1ML0 D;  2EE1 A;  2X6G A;  4X3S A;  4ZKC B;  1A15 A;  1TVX A;  3SVM A;  1AZP A;  1AP0 A;  1BBX C;  1U4L A;  2B2T A;  3IL8 A;  1F9Q A;  1EIH A;  2EPB A;  1MI2 A;  4HSV A;  1G2T A;  1C8C A;  1F9P A;  4NW2 A;  1Q3L A;  5EPK A;  5EPJ A;  1PFN A;  2R3Z A;  1J9O A;  2KEC A;  2KUM A;  4ZK9 B;  1U4M A;  3FDT A;  5E4X A;  1SSO A; 
#chains in the Genus database with same CATH topology
 4GS3 A;  3QOJ A;  4KKS A;  3L9A X;  2JA5 G;  5T1I A;  4TRD A;  3K7A B;  4X3T A;  2EOT A;  5D3I B;  2WAC A;  3TBI B;  3U4Z A;  4KHV A;  2K5H A;  3W2D A;  3GTJ H;  1H9R A;  5LL6 S;  2NZO A;  4IUU A;  4C3I G;  4ZKB B;  3TP6 A;  2NTS A;  4HCE A;  4BY7 B;  2I5M X;  4A3G B;  2LXK A;  3ICE A;  3IKJ A;  2NZ1 D;  5KYI A;  1XMO Q;  1ENF A;  4DR5 Q;  1Q12 A;  1MJC A;  3G4S A;  4RA8 A;  4GNX C;  1GHK A;  2R7F A;  3E9I A;  2PZT A;  3NWS A;  3V2T A;  4KMU C;  1HZB A;  3CCS A;  1QVF A;  3MHB A;  4HED A;  4X66 L;  4KY5 A;  1SRU A;  1UE1 A;  5TSS A;  1VQM A;  3KJO A;  2IX3 A;  4DV7 Q;  2JA7 G;  4ILW A;  1I4R A;  1HNX Q;  2H1E A;  2NYZ D;  4POF A;  2E2J B;  5JJK A;  1TQO A;  3F2U A;  4J8Q A;  4DKA C;  1F2Y A;  3BVZ A;  1G29 1;  1I94 Q;  3OTO L;  1STG A;  4IOA A;  1AN8 A;  3Q23 A;  1SDF A;  1IW7 D;  1Q8I A;  2IW3 A;  3D4R A;  1TWF H;  2AUJ D;  1O80 A;  1EQV A;  4Z9C B;  5FO9 B;  1BOS A;  1CTM A;  1VQA A;  1EL0 A;  1XMO L;  1MJE A;  1ASZ A;  4R4I A;  4DR5 L;  5CBE E;  3DEP A;  5DEH A;  1SYD A;  2JSO A;  2FIN B;  2CW0 C;  2VNU D;  5M5W H;  1QVG A;  4OL7 A;  1CQV A;  4AQY Q;  2FHT A;  4OX9 Q;  2VL6 A;  5BN3 A;  1GUW A;  2A6H D;  4XDX A;  4DV7 L;  4OO1 H;  3VR4 A;  3J80 c;  3HOV B;  4RGO S;  1QOH A;  1HNX L;  4RCN A;  4JYA Q;  1K73 C;  1CT1 D;  2N78 A;  4JCV E;  3S1M B;  5HGT A;  1I94 L;  1UEA B;  3MXN A;  4BBS G;  2DNC A;  1A2T A;  4C1N I;  5J1Z A;  4UY8 C;  5EPK A;  1ZKO A;  1K8A C;  1H95 A;  1MBY A;  3OSO A;  2KUM A;  2R92 H;  1K0R A;  3OW2 A;  1IYV A;  5IIF A;  1NNX A;  1YEZ A;  3S2H H;  1F77 A;  3G6J B;  1HNZ Q;  2F3V A;  1TKW B;  3CRK C;  4YIJ A;  4A76 A;  4RAU C;  1G2S A;  5AFW A;  1FJG Q;  1VQF A;  5IP9 H;  3CC2 A;  2KJX A;  3HKS A;  4L6T B;  2B2Y A;  4AQY L;  3OWE B;  4B9X A;  4OX9 L;  3HOU G;  1SE3 A;  3S1N B;  1B9N A;  3QB3 A;  4TKO B;  2HQL A;  1TWG B;  4LFA Q;  3M7G A;  2WB1 E;  5IGC A;  3J7Y W;  1X6O A;  1GOZ A;  2DJG C;  1VQB A;  4JYA L;  1BO0 A;  4A4I A;  4A3C H;  2I46 A;  4TVA B;  2HDM A;  2HD3 A;  5M9O A;  4PMW A;  3RZD H;  2WV6 D;  4XXE A;  2YV5 A;  1JWU D;  4DV2 Q;  1TWC B;  2KHS A;  2KHI A;  2F0E A;  1VF5 C;  2F0N A;  3KYH C;  1CQF A;  1HNZ L;  2WB1 G;  4X3K A;  5JOB A;  1G6P A;  3TZD A;  4ZUI A;  2KEN A;  1FJG L;  1TXY A;  1AFP A;  1GVP A;  5JEA G;  2JA6 B;  4BBR H;  3F2C A;  1XMQ Q;  2R93 B;  1CZG A;  4R9W A;  2QF7 A;  3DMU A;  3P7J A;  5D14 A;  4JBW A;  3GTO H;  3KJP A;  4K6L A;  1EEF D;  3ULL A;  1I5F A;  5HGQ A;  1NR4 A;  1ILP A;  1W6K A;  1B4O A;  4A3M G;  2KOL A;  4JI4 Q;  1YZ6 A;  2PNR C;  2HIX A;  1ET9 A;  3N6R A;  3NEN A;  4ZYS A;  1JC7 A;  3SDZ A;  3TP8 A;  3GTQ H;  5HY6 A;  3DM1 A;  2ID0 A;  1KAA A;  1O7I A;  4DV2 L;  1I4G A;  2MQH A;  1X3P A;  3CP0 A;  3MVV A;  3PO2 H;  4ZAI A;  2PMZ E;  2E76 C;  1E22 A;  2FJ2 A;  3BZD B;  1SJH D;  3TSS A;  2K5V A;  4OWW B;  4J6H A;  4O2D A;  1SNC A;  4XYQ A;  3HOZ H;  2VUM B;  5E3F A;  2ZXR A;  3DWQ A;  4N8F A;  1XMQ L;  1AP0 A;  1VQ6 A;  3D4W A;  3OIQ A;  3SK6 A;  2EVB A;  2B3G A;  4A3D B;  2R3Z A;  2YU9 B;  2ZJP A;  3F2B A;  4OGQ C;  1KAW A;  2MFI A;  4JI4 L;  2K1B A;  3GTG H;  3MXN B;  2B39 A;  3U4V A;  3C1F A;  1F9S A;  3NP8 A;  1HA5 A;  4UAI A;  4DV6 Q;  1MKH A;  1PH4 A;  3E0J A;  1E2Z A;  1DJR D;  1EUJ A;  3DM3 A;  1Y14 B;  1SFO B;  4IUT A;  3H3V I;  1CKN A;  2RHQ B;  4N8X 1;  2N3S A;  4BY1 H;  1EWI A;  4RKL A;  3U9O A;  4XT3 B;  3J81 j;  1DXM A;  3KUP A;  2GVB A;  5C5M A;  2B63 B;  2PW5 A;  3Q6S A;  3KDF B;  3QO2 A;  3NTI A;  4XTC S;  1CFM A;  1EY6 A;  4RHR A;  1PZJ D;  1JWS D;  3CD6 A;  4LF5 Q;  4WJ4 A;  4DA2 A;  4R1J A;  5EPL A;  4DV4 Q;  2DY8 A;  1X3F A;  2PZW A;  1PXU A;  4DV6 L;  1A62 A;  1PH8 A;  1PH9 A;  3LNN A;  4OIJ A;  1GKH A;  1XNR Q;  1B70 B;  2NUC A;  2A68 C;  3GV3 A;  3NEM A;  1D5Z C;  5EKK A;  3GTM B;  1S4Z A;  4C2M H;  2F0O A;  1MD2 D;  3GP7 A;  1VQ8 A;  1YJW A;  2JA6 G;  1FNU A;  2R93 G;  4PG3 A;  1V1Q A;  2F0G A;  2B2V C;  2F3I A;  1PTO C;  1X9N A;  1JMC A;  2D5D A;  2B2U A;  4JOI C;  4NXN Q;  4DK3 C;  3AB9 A;  1S3O A;  4DAY A;  4K5V A;  3EJI A;  1SMY C;  4LF5 L;  4EQN A;  4DV4 L;  1KDB A;  1TWA B;  1I4P A;  2L12 A;  4A3F B;  3M4Q A;  1LTI D;  3CCR A;  1TVX A;  2ZT9 C;  3P1H A;  4XQJ A;  4K2L A;  1VQC A;  1IBK Q;  4K8I A;  4F87 A;  1Z7T A;  1XNR L;  2DGY A;  2ASB A;  1Q3L A;  2LFN A;  2RF4 A;  2KCM A;  1UE7 A;  2R7D A;  2O5J C;  3KLS A;  1Q82 C;  1CA5 A;  1I3Q B;  1Y1W B;  3HKZ E;  1WTR A;  4O0A A;  1H9M A;  5F2D A;  2HCI A;  5IP7 H;  4ODG A;  1MHW C;  4FXK C;  4HID A;  4A3D G;  1A8V A;  3AYH B;  4NXN L;  5FJ8 H;  4L5R C;  3NTK A;  3I56 A;  4MHE A;  2F4V Q;  1WTH A;  3AU7 A;  1NY4 A;  3HKZ G;  5C6A A;  3Q24 A;  5KRU A;  1ESF A;  1IBK L;  4HTH A;  1H9J A;  2IX1 A;  2O4X A;  3WOE A;  2QDB A;  4BWG B;  1CKN B;  4DR3 Q;  2I07 B;  3J81 E;  3DHQ A;  2RHS B;  3S14 H;  3ZJY C;  4AYB B;  2A19 A;  5CV8 A;  4O42 A;  2IT1 A;  3I3C A;  3FPU B;  4YWK A;  1TWH H;  2HT1 A;  2OTL A;  3GTP H;  1YIJ A;  2VQE Q;  3GTK B;  2JJQ A;  3E3X A;  2B63 G;  2CH4 A;  5CV9 A;  4NXM Q;  1WD1 A;  2B2U C;  3U50 C;  3OPO A;  4ZQ3 A;  1VMC A;  3A8K E;  3I4L A;  2F4V L;  5IOC A;  1HCZ A;  1UAP A;  2NBF A;  4PZ6 A;  4DXG A;  2ZTE A;  4L8J A;  5K5P A;  4Q0F A;  3H0G G;  4I65 A;  4KY6 A;  5CR3 A;  1UEB A;  4R8N A;  4DR3 L;  2F52 A;  2RCN A;  1GXD C;  1JB7 A;  1Q7Y C;  1K83 H;  1EY9 A;  3F8T A;  3BDL A;  3ERS X;  4IFD H;  3ER0 A;  5JJI A;  2MJ8 A;  1Y8N B;  3I91 A;  5C3E H;  4JI0 L;  5C44 B;  1A63 A;  3CMA A;  4GN5 A;  2VQE L;  1M8A A;  2M00 A;  3QR8 A;  1XNQ Q;  2L5T A;  3NEL A;  3R2T A;  1U4L A;  4XIG S;  4NXM L;  2MNA A;  1LM0 A;  4DAY B;  3E9H A;  2K5D A;  1WCM B;  1J9O A;  1HZA A;  1JJ2 A;  4LUO A;  2A68 D;  4MN3 A;  2K03 A;  5JJL A;  4OON A;  3HOW H;  3HOX H;  4A3F G;  4P2C B;  2NVY H;  1PV4 A;  1BBU A;  4IUV A;  5JJZ A;  2K7V A;  3KF6 A;  1BF4 A;  1G6Z A;  1HRJ A;  3T56 B;  5M5Y B;  3DWA A;  2FMM A;  1SE2 A;  3VYS A;  2R7Z G;  1ZXT A;  1MSG A;  2VZA A;  4GLA C;  4NB3 A;  1VQN A;  1TS2 A;  3PQI A;  1IKL A;  1B3A A;  1B1Z A;  4YHH Q;  1PZI D;  4UP8 A;  4K5W A;  1XNQ L;  5IGE A;  4C3I B;  2IL8 A;  2XNA C;  2Y0S B;  1EU4 A;  2QKI C;  3QJY A;  4KV6 A;  2NVT H;  1N9W A;  1F9R A;  4EQO A;  5C4X G;  1ESR A;  1IW7 C;  4JI6 Q;  3K81 C;  2IY5 B;  4FDB A;  2MGS A;  1OXX K;  5C5L A;  2C9O A;  4X62 Q;  1KD1 C;  1Y1V H;  5I6Y A;  1WTQ A;  3GTL H;  1H9K A;  1PYW D;  3W1B A;  2JA7 B;  5IYD H;  1PH6 A;  4P73 A;  4C3H G;  1C7Y A;  1Y8P B;  3LGJ A;  4DAV A;  1Y69 U;  2CWP A;  3OWF A;  5JVH 3;  4GOP A;  1R4Q B;  2F0M A;  1TY0 A;  1A3U A;  2A6H C;  3SHL A;  4YHH L;  4DPG A;  3I4N H;  3S1R B;  1WFQ A;  4ID6 A;  5I4D A;  1LTL A;  3TQY A;  5C0X G;  2EYM A;  4JK1 C;  1C48 A;  4JPB W;  1XYI A;  4A3E B;  3TP5 A;  4OHJ A;  1HQM C;  4C3J G;  2O2L D;  1IL8 A;  2AUK A;  2WAQ B;  4JI6 L;  3TRZ A;  1QB5 D;  3GD7 A;  1X54 A;  1IHZ A;  3NSW A;  4X62 L;  2EZV A;  5E7N A;  1A3V A;  3TDQ A;  5BN5 A;  1FVI A;  2Z4H A;  2X6G A;  4A3B H;  1QCB D;  1A15 A;  4KLK A;  3HOY G;  1UNS A;  2CQO A;  5GQO A;  2J0T D;  3OMG A;  1C0A A;  1NUC A;  4RKB A;  3SXH A;  3T51 B;  1RD9 D;  4A3J H;  1YVC A;  4DAP A;  3PO3 G;  1FNV A;  2NVQ H;  1UWV A;  5J3B A;  4KN7 C;  3NXW A;  4V0B A;  1EYC A;  2KQ3 A;  3EQL C;  1PFB A;  2CH4 W;  3TN2 A;  3MAQ A;  3SK5 A;  3KFU A;  2K52 A;  1U4R A;  2Z9H A;  2Z1C A;  2SDF A;  1SBB B;  3VR3 A;  1WCM G;  4BS9 A;  1G8Z D;  1LUZ A;  4CBV A;  1TT2 A;  4J15 A;  2E2D C;  4N9T A;  4KJN A;  3HOU B;  1WVL A;  3JAM E;  3KF6 B;  1QZH A;  4FO2 A;  4EQP A;  3PF5 A;  3M3Y B;  3J81 L;  4UPA A;  2RQX A;  3W1G A;  4G7Z C;  2Y0S E;  1YNX A;  3I4M H;  2H4O A;  2VS1 A;  3EA6 A;  1QNK A;  2G9H D;  3FKI H;  4GOP C;  3A8I E;  2CVR A;  5EQ0 A;  4OO1 I;  3JAM i;  3K7A H;  2D0O A;  5E1F A;  1GUT A;  5CC4 A;  3E5S A;  2CCZ A;  3K59 A;  4GZY C;  3OYY A;  5DNF A;  2Q2T A;  2E8G A;  1PRT F;  4X3U A;  4JBK A;  2WB1 B;  3S15 B;  1LT3 D;  2SEB D;  2Y0S G;  1MGS A;  1BXT A;  2K28 A;  4BY7 H;  1V1O A;  2RVL A;  4A3G H;  2BA0 A;  2GA4 B;  3C2P A;  4XQQ A;  2ENB A;  4IQZ A;  4CDD C;  2F0V A;  4Y52 H;  5FLX c;  2K04 A;  1AE3 A;  3S17 B;  3IFT A;  4A3L G;  2NB0 A;  2F0U A;  1MSH A;  1X3E A;  2HQE A;  4OWT B;  4L5T A;  2D0P A;  4UP7 A;  4A3M B;  4ZUJ A;  5BN4 A;  1LAC A;  2M2L A;  3BZC A;  1R9T H;  4GOP B;  4POG A;  4IPD A;  5M3M G;  2JA8 H;  3S2D H;  2KHJ A;  2N55 A;  2JXM B;  1DM0 B;  2WAQ E;  2E2J H;  3R93 A;  1JJG A;  3W5O A;  5FLM H;  4IJL A;  3U9S A;  4NKL A;  1CKM A;  3WWV A;  1EYD A;  1A6X A;  1I6H H;  4DK1 A;  1STE A;  4A3E G;  2EXZ A;  1EIH A;  2YTY A;  1IZ6 A;  3MFG A;  1C8C A;  2WAQ G;  1GJX A;  1HH2 P;  2IHE A;  4R4O A;  3TS2 A;  5K36 H;  2V4D A;  2MO1 A;  1WI5 A;  5C0X J;  1TWF B;  3FVQ A;  2EYO A;  2OXP A;  5DM7 3;  2PMZ B;  3V05 A;  4JI1 Q;  1DZ1 A;  1O7Z A;  5M3F H;  2JEA I;  5JPN C;  3HOV H;  5JVG 3;  2CKZ B;  2VY3 A;  3UDI A;  2PO4 A;  2AHO B;  5IYC G;  5M5W B;  1NCV A;  1W6J A;  1IBM Q;  1VMP A;  1HNW Q;  4EVO A;  3K7U C;  3G6E A;  1EFW A;  3EFX D;  3HEJ A;  3K5N A;  2F0J A;  4A93 G;  4NP5 A;  1GD7 A;  1SMX A;  3RZO B;  1NMG A;  1CHQ D;  2YTV A;  1EQQ A;  2FMC A;  2DNE A;  1PZK D;  5FOB B;  2EY2 A;  1E2W A;  5ELB A;  2JA9 A;  4WFN 3;  1Y8O B;  1VQP A;  1FD7 D;  2R92 B;  4JI1 L;  3S1N H;  2HCC A;  1SYE A;  2HDL A;  3VYR A;  2F0Q A;  2Z6B A;  1SRO A;  1QIL A;  4P71 A;  1TU2 B;  4M1U B;  1VQ9 A;  3K5O A;  3BZK A;  1NTG A;  4HMJ A;  4LWC A;  2WKC A;  4BXX G;  2O5I C;  4AIM A;  5I9O A;  1IBM L;  2B2W A;  3T1Y Q;  3JC6 6;  4A3I H;  2LKV A;  3MEH A;  2PCF B;  2L15 A;  3CCU A;  3GO5 A;  3J80 i;  3MC0 B;  3SE0 A;  4TSS A;  2K5W A;  2JYO A;  1LT4 D;  2BA1 A;  2HUG A;  3TEH B;  1E1O A;  5M5X H;  3NQI A;  4LF6 Q;  3TME A;  1T5E A;  1EYG A;  1EIG A;  1HXY D;  2ATW A;  4LFA L;  4RHS A;  2G9D A;  1Z9F A;  4L63 B;  3RNU A;  3VYT A;  4C56 C;  1Q86 C;  2QGQ A;  3RLN A;  2E2I H;  3I7F A;  1F9P A;  3TRE A;  2ALY B;  1EOV A;  3A7A B;  4BBR B;  2G5D A;  3T1Y L;  3GTO B;  5I2X A;  3PMF A;  4JC0 A;  1TS3 A;  4HCS A;  1D7Q A;  1V8Q A;  3VA5 A;  1SND A;  3K57 A;  2JK8 A;  3CC4 A;  1SNQ A;  2K4K A;  1CUK A;  4LUV A;  2QA4 A;  3ND9 A;  2L0C A;  1C4Q A;  2MHV A;  4KN4 C;  3JAM L;  1SJE D;  2B2Y C;  2N88 A;  3GTQ B;  5GAG C;  2VUM H;  4LMQ D;  4B3M Q;  4LF6 L;  5EAY A;  1PH2 A;  1I6V C;  4XT1 B;  4HJ7 A;  4DV5 Q;  3NHH A;  1A2U A;  2E75 C;  2EQS A;  3VR2 A;  1JOQ A;  4MNO A;  1T5X D;  2YU9 H;  1BBW A;  3A74 A;  3MEF A;  1KNE A;  3BYY B;  2PPB C;  3CQZ H;  2ZJQ A;  1BQQ T;  4H7B A;  4UDU C;  3BVM A;  3HKZ B;  3KBX A;  5KIX A;  4RG1 A;  5GAH C;  4DR7 Q;  1KTK A;  2B2W C;  1JE5 A;  3GV6 A;  2IHF A;  3VA7 A;  1CSP A;  2K75 A;  1FR3 A;  2NZH A;  3I73 A;  4OO1 G;  4OIK A;  2IX0 A;  5A35 A;  1SFO H;  2R6G A;  1ICF B;  3M9B A;  1WTP A;  1RJT A;  2KCT A;  2RA4 A;  3BS1 A;  1X32 A;  3PIP A;  1QE6 A;  4HJA A;  4B3M L;  3ONA B;  4XYO A;  1O7Y A;  1KDA A;  4DV5 L;  3OMC A;  1WTO A;  2GN5 A;  3OW7 A;  2R92 G;  3RUZ A;  1EZ6 A;  3KF8 A;  5IGB A;  2PW7 A;  3T16 A;  4DV1 Q;  4BY1 B;  4PMC A;  1D8L A;  3H0G B;  4DR7 L;  3F2D A;  1L2F A;  5IP9 G;  1VCI A;  1XXG A;  3CXC A;  1CA6 A;  4R8I A;  1V1P A;  2N49 A;  2C35 B;  1NMF A;  1B8A A;  4ABN A;  3H09 A;  4DR1 Q;  2B2T A;  4A75 A;  3H6M A;  1MI2 A;  3ERQ A;  4A3C G;  1G2T A;  1E3P A;  5EPJ A;  2K14 A;  1ENA A;  4QF4 A;  1R4P B;  4O1N A;  1ZEQ X;  3BG3 A;  2EIF A;  3H3V C;  3QWN A;  4KHZ A;  5GAE C;  4YCU A;  5C3W A;  1Q81 C;  1YHB A;  2K01 A;  3ERO A;  1HJP A;  3S16 B;  1PRT C;  1JOR A;  1TR5 A;  4C2M B;  4DV1 L;  3C3L A;  5JAV A;  1EIF A;  4C1N K;  1E7Z A;  1JT8 A;  4Y7N H;  3D6C A;  3PIO A;  1PH1 A;  4RWS C;  5JEA J;  1WJJ A;  4JG2 A;  3G7L A;  1B3Q A;  3I4O A;  3K5M A;  4BBR G;  1PA6 A;  4GKK Q;  2XN9 C;  2RDF A;  5GRO A;  1W3S A;  4F88 A;  1L0W A;  5IT9 E;  4B3S Q;  2R7Z B;  1V9P A;  1WOC A;  4DR1 L;  4QUC A;  3D8G A;  1KDC A;  4CKB A;  4JI2 Q;  4APV A;  1YNN D;  3PF4 A;  1YBY A;  4HMI A;  1SLJ A;  1I3Q H;  4IFD I;  2RSN A;  5HUR A;  1Y1W H;  1KRS A;  2MO0 A;  3CME A;  4RGT A;  3HRZ C;  3QIA A;  3J81 c;  1VQI A;  1PTO H;  1PRT B;  3J80 L;  3U58 A;  5C4X B;  4K6D A;  3MXP A;  3UDX A;  4B08 A;  1ICW A;  3PO2 G;  2Z6K A;  2VQF Q;  4DUZ Q;  1VQJ A;  5IYB H;  3PUW A;  1J6Q A;  5IGG A;  1LT6 D;  4L5S A;  1HZC A;  4QY7 A;  1SYF A;  1WYD A;  4GN4 B;  3HOZ G;  4IAL A;  1S5C D;  3B6Y A;  4CDE C;  1Q46 A;  3AFQ A;  4IUN A;  1WTW A;  4C3H B;  4GKK L;  1VS0 A;  2D2C C;  2NN6 H;  1WTX A;  2XWJ B;  4B3S L;  2A74 C;  1HFN A;  2B2T C;  2VB2 X;  4JI2 L;  2QW7 A;  3A8J E;  4PV1 C;  2IWH A;  4G7H C;  4PZ7 A;  1K0S A;  5DLQ E;  3PUZ A;  1Z6H A;  1LYL A;  1BVS A;  4QGU A;  1DON A;  2EY1 A;  4C3J B;  1J5E Q;  4QB4 A;  1NJI C;  4LFC Q;  3K80 C;  3RLO A;  1X55 A;  1I50 H;  1PYB A;  2VQF L;  4DUZ L;  1GUO A;  1AEX A;  4BY1 G;  3IL8 A;  1PHJ A;  2F3W A;  3ITP A;  1EEI D;  2IPK D;  5IOD A;  4HSV A;  1YI2 A;  1KIX A;  5CV5 A;  3C46 A;  3HOY B;  1V1P B;  4DR6 Q;  1U0L A;  3A55 A;  4CGY B;  3R2I A;  3J7Z C;  4OXP A;  2OTJ A;  4DAM A;  3FDT A;  3FPP A;  4QQB X;  4LF7 Q;  4H13 C;  4GN3 B;  1H9S A;  1VQE A;  1I4Q A;  3PO3 B;  1G91 A;  4JI3 Q;  2RKS A;  5C44 H;  1LTT D;  4U68 A;  2A1A A;  4A3K H;  2WP8 J;  1KLG D;  3D6W A;  3I55 A;  2Z8L A;  2SOB A;  3D0F A;  2RDG A;  1QG7 A;  1J5E L;  4LFC L;  1QUQ A;  3FHW A;  3V96 A;  4AH6 A;  4LJZ C;  2Z6K C;  1K83 B;  1LTB D;  3H15 A;  1UE5 A;  3CAM A;  2ZJR A;  3DEO A;  3I70 A;  2YYZ A;  4TQU S;  1HZ9 A;  4DR6 L;  2M9V A;  5LMN W;  4IUP A;  3HFZ B;  2OEO A;  3I8Z A;  1D1K A;  4LF7 L;  4HJ8 A;  4YCV A;  3STB D;  3IAY A;  1HUN A;  1OXV A;  1S72 A;  2JA5 H;  3L3O C;  2E2H H;  1EY8 A;  4GLV B;  4JI3 L;  3X3N A;  3BDO A;  4LUZ A;  2PYK A;  1PRT D;  2X69 A;  1EY7 A;  4QJF A;  4C3I H;  3N52 A;  4WJ3 M;  1D2B A;  3E0E A;  1CSQ A;  4CDF C;  4FYD A;  1SAP A;  2MPM A;  2R61 A;  1YNJ D;  4K8J A;  5IY0 A;  5G3L D;  2F0I A;  3S1Q B;  2XWB B;  1XPR A;  4H02 A;  5ISR A;  1RL2 A;  3VYU A;  2X6L A;  1VQD A;  4P72 A;  4R4T A;  1XX8 A;  3LWE A;  3PSI A;  2JA7 H;  4S3S A;  5IP7 G;  5M3M B;  1II3 A;  1STY A;  3J7A 5;  3M4O B;  5FJ8 G;  4GKJ Q;  1B2T A;  2PI2 E;  4H0L C;  1DOM A;  3C1E A;  3SR1 A;  2EE1 A;  1K8G A;  3SVM A;  1BBX C;  1HR0 W;  4K14 A;  1Y1V B;  4B3R Q;  2EPB A;  2H5X A;  4ZCK A;  3GTL B;  1DCZ A;  1JB3 A;  2K5Q A;  2YTX A;  4MIU A;  2C5C A;  3M7N A;  1YHA A;  1HUM A;  5LMU Q;  4PNY A;  4X65 Q;  3AEV A;  4K0K Q;  2AWO A;  3D3R A;  3I4N B;  1O78 A;  3S9W A;  5A2Q L;  3EBE A;  5IT9 L;  1CZW A;  3IFD A;  5T1G A;  4IUR A;  2EYF A;  3Q22 A;  1H9S B;  1RCV D;  4CHT B;  1AW7 A;  1BCP D;  4GKJ L;  1N34 Q;  2BOS A;  1T9H A;  2NVX B;  2FFK B;  1DOL A;  4BBS H;  3CCL A;  5CV6 A;  3MXG A;  4RMF A;  4GNX A;  5IWA Q;  4B3R L;  1FGB D;  3EVQ A;  3HG9 A;  2LY7 A;  3T13 A;  5I6W A;  1IL2 A;  4QIW B;  4G57 A;  3F1Z A;  4LF4 Q;  1QUQ B;  2QEJ C;  4FF1 A;  3FRP B;  2GVA A;  4R4Q A;  4A93 B;  2EYL A;  2EY5 A;  2ZXP A;  1LV9 A;  5C4J H;  2EJG C;  3E6Z X;  1S5B D;  3R3O A;  1X56 A;  5LMU L;  4X65 L;  4K0K L;  4IFD G;  4A3J B;  3NQT A;  2UUA Q;  3K58 A;  5C3E G;  3MZ5 A;  1J8I A;  4WJW A;  1DD2 A;  3HOU H;  2RSO A;  2A5H A;  3ULP A;  1TS4 A;  2OT2 A;  1CHP D;  3S24 A;  2JN4 A;  4DV0 Q;  1CM9 A;  3RN5 A;  2NWG A;  3AFP A;  1N34 L;  2HHH Q;  1B50 A;  1S5E D;  1XPU A;  4ME5 A;  2DJF C;  2QIL A;  5IWA L;  4DU9 A;  1EQR A;  1BNZ A;  2TMP A;  3RN2 A;  3HOW G;  1XTC D;  3LX0 A;  2MUY A;  4LF4 L;  3HOX G;  5C4Z A;  1JE4 A;  4X66 Q;  2F0H A;  4B3T Q;  5KNC A;  3I4M B;  1N32 Q;  4LFB Q;  1YJN A;  3EN2 A;  3FKI B;  4EGV A;  1DGS A;  1AZQ A;  2OF1 A;  1SE4 A;  5JEA H;  1ILQ A;  3PCO B;  2UUA L;  5G3L F;  4DXF A;  4X3S A;  2A6E D;  3S17 H;  4HIM A;  2XRQ D;  2BE5 D;  1PH5 A;  3OTO Q;  2UXB Q;  2F0D A;  3L0O A;  1EY5 A;  3ND8 A;  4PQX A;  1QZG A;  3GTJ B;  1PTO F;  4KHP Q;  4LAA A;  3BYT B;  4FF2 A;  2AMC B;  3D4D A;  4DV0 L;  4A3M H;  2XTI A;  3SK8 A;  1EIY B;  1UE6 A;  1LO5 D;  1G51 A;  1GM5 A;  2HHH L;  4QCL A;  4IPG A;  1GO3 E;  4JI7 Q;  2QDL A;  2N8N A;  2UXC Q;  2UUC Q;  1EYA A;  4KTA A;  4DNI A;  1HQR D;  1RKN A;  1SE8 A;  5DAU A;  2UU9 Q;  5IGD A;  1KC8 C;  1AH9 A;  1Y1V G;  2HIV A;  5EKI A;  3HZX A;  4HSP A;  3WOF A;  4B3T L;  1X3Q A;  2JEB I;  1HPC A;  2F03 A;  4LF8 Q;  2E5L Q;  1N32 L;  4LFB L;  1VQG A;  2AWN A;  5IYD G;  2BDO A;  2PQA A;  1SYB A;  4BA1 I;  1R9T B;  3MXU A;  3UE0 A;  5CGK A;  2JA8 B;  5CMD A;  3S2D B;  1HA6 A;  1HTP A;  2L11 A;  4RGN A;  1RDP D;  3KLW A;  1KHI A;  4WOR A;  2UXB L;  1EZ8 A;  4KHP L;  3I4N G;  5FLX E;  2KBN A;  4MTK A;  4QMG A;  4QIW E;  1QVC A;  4G7O C;  1X65 A;  3J7A V;  1I6H B;  1HHV A;  3NBI A;  2FXQ A;  2L1B A;  4CJ1 B;  3PUX A;  2SNS A;  4JI7 L;  4MTN A;  5KNB A;  1XWE A;  4IPH A;  2UXC L;  1RIP A;  3FP9 A;  2UUC L;  1BCP F;  2ICI A;  1E2V A;  2Q8I B;  4GNX B;  5ELO A;  3S1M H;  4PZ8 A;  1F2M A;  1Z47 A;  1TS5 A;  1ENC A;  2UU9 L;  4HR7 B;  2F0F A;  1SNP A;  5ELF A;  5LMN Q;  1N36 Q;  1BDO A;  4LF8 L;  4A3B G;  5EBC A;  2E5L L;  5M3F B;  2A8V A;  4ZLT F;  1ASY A;  2DUD A;  3NPP A;  2Q2U A;  1OXU A;  2K6A A;  3RZO H;  1KXL A;  1ZYR D;  5KYL A;  4A3J G;  1I4H A;  3UDG A;  1U4P A;  2KEE A;  2A69 D;  4JW0 A;  1IBL Q;  3IRB A;  3SGI A;  1P8L A;  2XGT A;  2L4N A;  3S2H B;  1LTS D;  1TWG H;  5LL6 X;  1K3B C;  1BR9 A;  5EGT A;  4DGZ A;  2JP1 A;  3J80 E;  3NBH A;  4IFD J;  4IOC A;  4FF3 A;  1FL0 A;  1LT5 D;  2TSS A;  5LMN L;  1N36 L;  1HNW L;  1TWC H;  1JQY D;  4XQN A;  1LAB A;  1FGU A;  3AMU A;  3CPW A;  3KDF A;  2RBM A;  3I4M G;  2ES2 A;  3VR5 A;  1DYQ A;  4ZK9 B;  1HTL D;  2AKW B;  2F0W A;  3FKI G;  5AJ3 Q;  4JV5 Q;  1STA A;  3OHX C;  3X3M A;  3RZD B;  2JA6 H;  1HR0 Q;  1IBL L;  2R93 H;  1SYC A;  1QWY A;  4A3I B;  2F0L A;  3RD4 A;  1YNN C;  1Q1B A;  1FYC A;  4B9W A;  2WFW A;  4BY7 G;  1EY0 A;  1SR3 A;  4IO9 A;  1PH7 A;  4A3G G;  2PQE A;  5C3X A;  5I2Y A;  2LXJ A;  3K5L A;  5M5X B;  1CKO A;  1EWC A;  3EIV A;  1ONL A;  3PV0 A;  4HJ5 A;  2UUB Q;  5FK9 C;  1F2Z A;  1NE3 A;  3RLF A;  2PQA B;  4IJH A;  3OIP A;  1RHP A;  5D65 A;  5AJ3 L;  4HAE A;  1GUG A;  2E2I B;  3NK9 A;  2JA8 G;  4RFB A;  4JV5 L;  3GDE A;  1STH A;  3ULJ A;  2I0Q A;  1HR0 L;  4CKC A;  2K33 A;  4DR4 Q;  3UDF A;  4FXD A;  2LS0 1;  5FLM G;  4JI5 Q;  3I90 A;  3CCM A;  1D5X C;  4A3D H;  3BDC A;  5EKL A;  4CJ2 C;  3PO2 B;  1PDQ A;  1PFM A;  5GAD C;  1VQ7 A;  2B8G A;  3TP7 A;  4NPS A;  3AQQ A;  3MFY A;  5J22 A;  2WII B;  2XIW A;  3PGZ A;  3HOZ B;  3BJU A;  3P75 A;  3Q0A A;  4N9P A;  1GUN A;  1B9M A;  2V1C C;  4U67 3;  2UUB L;  1UUP A;  3KLS X;  4DNT B;  3DUZ A;  2VW9 A;  5K36 G;  1FNW A;  3FEW X;  1A0I A;  2ZTD A;  3WDN A;  5CYU A;  4OWX B;  2D9U A;  1OO9 B;  1M4V A;  1YJ9 A;  1Q8K A;  2B2V A;  2KED A;  4IN3 A;  5M3F G;  5EBD A;  4JOI A;  3HOV G;  1C9O A;  3K0X A;  3CC7 A;  3CQZ B;  2K5N A;  1KLU D;  3GTG B;  3NE5 B;  1KNA A;  2BCO A;  3D31 A;  4DR2 Q;  1CK1 A;  4DR4 L;  1JOO A;  4RH6 A;  1TY2 A;  4DK0 A;  4JI5 L;  4OEL B;  2B63 H;  5C4H A;  1JR0 D;  2PZU A;  4HN7 A;  5LHY 1;  2CW0 D;  1F9Q A;  3NBH B;  3L2P A;  4PMB A;  4EX5 A;  2F0S A;  4NW2 A;  2PI2 A;  4DUY Q;  2F0K A;  2WKD A;  3KK7 A;  3CRL C;  3H0G H;  4DK6 C;  2OWO A;  4QUF A;  2VXW A;  4RGM A;  1U9R A;  5L37 A;  1VQO A;  1QJO A;  1EWH A;  2CWA A;  2Q8R E;  2OQ0 A;  4V19 0;  2F0P A;  1SN8 A;  4KJO A;  3Q8D A;  1KRT A;  5I9P A;  3UI2 A;  2NN6 I;  3GTM H;  1JOK A;  4IPC A;  3NUC A;  1RTO A;  3CPF A;  5E4W C;  4DR2 L;  5FLX L;  1L1O A;  4BA2 I;  4F8M A;  3STB C;  5CV4 A;  2ICE C;  5CV7 A;  4DNR B;  2K50 A;  4DV3 Q;  1WTV A;  2QEX A;  4KK7 A;  1VQL A;  5IT9 c;  1EFI D;  5C0X I;  4A3I G;  2AQ2 B;  1IYJ B;  1K3R A;  4F7X A;  2ZM6 Q;  1N33 Q;  3KOJ A;  3S16 H;  3M4Y A;  4HIO A;  1VDZ A;  2UXD Q;  1EY4 A;  4DUY L;  1E24 A;  1U5K A;  1Q90 A;  2RDH A;  1TWA H;  3A0J A;  5D3D A;  4WRD A;  4A3F H;  4LF9 Q;  5ELE A;  1YNJ C;  3CCJ A;  3QOL A;  4P74 A;  5A2Q E;  1CI3 M;  3HGB A;  3URY A;  5CBA E;  2I5H A;  3TZU A;  2R7Z H;  3P20 A;  5ELC A;  2B29 A;  5J39 A;  4Y7N B;  4JBJ A;  1GHJ A;  3BU2 A;  5ELD A;  4KD3 A;  4X6A H;  4DV3 L;  4GLX A;  3J7A F;  3A54 A;  5COY A;  3H3V H;  1EOT A;  1STN A;  5JPM C;  3LWU A;  3R8B A;  2ZM6 L;  4E6I A;  1N33 L;  5C4X H;  5FO7 B;  1LTG D;  2UXD L;  2I5L X;  2LMC B;  5FKA C;  2E74 C;  4L5Q A;  1IKM A;  1EQT A;  4LF9 L;  4I7A A;  1BUV T;  1B44 D;  2AQ3 B;  3CKI B;  2KA7 A;  1PVO A;  2VUM G;  5H1S E;  1AE2 A;  2K32 A;  5IE8 A;  1VF7 A;  4C3H H;  1XTD A;  1PTO B;  2VB3 X;  1AZP A;  1XJV A;  4P75 A;  3DLL A;  3VDY A;  4CKE A;  4LW1 A;  1L1O C;  1YHQ A;  3H94 A;  4H44 C;  4ZRZ A;  3RR5 A;  3DWP A;  1VQ4 A;  5C0X H;  5E4X A;  1BCP C;  3GTK H;  1B7Y B;  3KF8 B;  1JIC A;  4C3J H;  3A5Z B;  1DOK A;  3S14 B;  2Z0S A;  2XVS A;  4IUQ A;  1SXT A;  1S40 A;  3I72 A;  2JQO A;  4ULL A;  4OEM B;  2CQA A;  4YWL A;  2EDG A;  1TWH B;  4JI0 Q;  3GTP B;  1SNO A;  1PFS A;  3PUY A;  5EJW A;  1K9M C;  3HOY H;  1SNM A;  2F4I A;  1PYS B;  3NWT A;  5BR8 Q;  3J81 i;  2J7Z A;  3PUV A;  1OXS C;  4KD4 A;  1L0Y B;  1I50 B;  1SYG A;  3CCV A;  5NUC A;  4YY3 Q;  1LLR D;  3W3A A;  1KQS A;  1L1O B;  4IZ8 A;  3PO3 H;  2EY6 A;  1RF2 D;  2DN8 A;  1MIU A;  4UP9 A;  1BKB A;  3T1H Q;  4YCW A;  1K8M A;  1BCP B;  1X3G A;  2OQK A;  3GQB A;  1HFG A;  2EYP A;  1L0X B;  2ZTC A;  3A5U A;  2QCP X;  2NTT A;  3H91 A;  1XPO A;  1WD0 A;  1NBW A;  3O13 A;  4HIK A;  1ET6 A;  4KKU A;  4HJ9 A;  1WCM H;  3VR6 A;  1KAB A;  2OCE A;  3M4P A;  2CHB D;  3T4A C;  2ZXO A;  5C3E B;  3TS0 A;  1QNU A;  4JI8 Q;  1E0B A;  2Z4I A;  4DN4 M;  1VQ5 A;  3CW2 C;  4A3K B;  4I7Z C;  2L55 A;  3K6O A;  1IYU A;  5BR8 L;  3CF5 A;  4DFA A;  1F2L A;  5M5Y H;  3K8A A;  3NTH A;  5IGF A;  4JVZ A;  2A6E C;  2DY7 A;  4CJ0 B;  2BE5 C;  2KCN A;  4YY3 L;  2KVM A;  1JCK B;  2XRS D;  2IJ0 A;  2KCC A;  2MP1 A;  3T1H L;  3HOW B;  3HOX B;  2BH8 A;  4ME3 A;  4X64 Q;  4K2K A;  2NVY B;  1S5D D;  2J4X A;  1V43 A;  4K5X A;  2BH2 A;  4ZKC B;  2JE6 I;  2JA5 B;  2EJF C;  4M8A A;  1OTC A;  2E2H B;  4FP5 D;  2Q2H A;  3MA2 B;  3BVG A;  4A3L H;  4JI8 L;  3S1Q H;  1IXR A;  4R4C A;  2EJM A;  1PFN A;  1PTO D;  1D5M C;  3G71 A;  2SNM A;  4FNF A;  1LTA D;  2KEC A;  3FMC A;  4NMZ A;  1U4M A;  1Y1W G;  4MZ9 A;  1SMY D;  1SSO A;  4KKT A;  1ROD A;  4LK1 C;  3K0Y A;  4QL5 A;  2NVT B;  1NSN S;  5M3M H;  2Q2I A;  1TII D;  3M4O H;  1NR2 A;  1JWM D;  3A56 A;  1A3T A;  2K05 A;  3DXJ C;  2B8F A;  2XSC A;  1VQK A;  3PIP 3;  1N8R C;  5IYB G;  1PMR A;  4FXG C;  1D6E C;  4EQ5 A;  4AYB E;  4X64 L;  4FF4 A;  3S1R H;  1O7L A;  4RCO A;  3HS0 C;  4A3E H;  3CCE A;  4JBM A;  2NN6 G;  2F0T A;  2EYJ A;  1NAP A;  1YIT A;  3SEB A;  4KY7 A;  1EU3 A;  2RCF A;  3CCQ A;  1PH3 A;  5FO8 B;  4YWM A;  2LSS A;  4NDX A;  4AYB G;  4LNQ A;  3QG1 A;  2CFM A;  1GUS A;  1W2B A;  4J1M A;  5KGU A;  1K8O A;  4Q5V A;  1ZYR C;  4CDC C;  3ZYY X;  1S5F D;  2BDN A;  3CU7 A;  2A69 C;  2A73 B;  1P16 A;  5IYC H;  3JAM c;  2P5Z X;  4G4K A;  4UHV A;  2NVX H;  5DM6 3;  1K28 A;  1M1K C;  1STB A;  1B53 A;  5KND A;  3L7Z C;  3RMH A;  2EXD A;  2Q8T A;  4A3B B;  2F1M A;  1PLF A;  3KLR A;  1I4X A;  4A93 H;  1JJC B;  1D1I A;  3MTS A;  4KI0 A;  4DF7 A;  3OOC A;  1KL9 A;  1LTR D;  3I2Z A;  2PNH A;  3T53 B;  3A7L A;  5COR A;  3PIO 3;  1M90 C;  4ALP A;  4BBS B;  2NVQ B;  2L9H A;  1Q1E A;  1OXT A;  3MWY W;  5C44 G;  2WIN B;  4A3K G;  3M3Y H;  1RTN A;  3HP3 A;  3SK4 A;  5C4J B;  3M85 A;  1E1T A;  3KBG A;  1ML0 D;  3CHB D;  4BXX H;  2D62 A;  5KEE A;  1SEB D;  3UE1 A;  4FVM A;  2AQ1 B;  1VQH A;  3S15 H;  2EYH A;  5ELN A;  3G48 A; 
#chains in the Genus database with same CATH homology
 3QOJ A;  4KKS A;  3L9A X;  5T1I A;  4TRD A;  3K7A B;  4X3T A;  2EOT A;  5D3I B;  2WAC A;  3TBI B;  4KHV A;  3W2D A;  1H9R A;  5LL6 S;  4IUU A;  4C3I G;  4ZKB B;  3TP6 A;  2NTS A;  4HCE A;  4BY7 B;  4A3G B;  3IKJ A;  2NZ1 D;  5KYI A;  1ENF A;  1Q12 A;  4RA8 A;  1GHK A;  2PZT A;  3NWS A;  3V2T A;  4KMU C;  3MHB A;  4HED A;  4KY5 A;  5TSS A;  2IX3 A;  4ILW A;  1I4R A;  2H1E A;  2NYZ D;  2E2J B;  1TQO A;  3F2U A;  4J8Q A;  1F2Y A;  3BVZ A;  1G29 1;  1STG A;  1AN8 A;  3Q23 A;  1SDF A;  1IW7 D;  1Q8I A;  2IW3 A;  3D4R A;  2AUJ D;  1O80 A;  1EQV A;  4Z9C B;  5FO9 B;  1BOS A;  1CTM A;  1EL0 A;  5CBE E;  3DEP A;  5DEH A;  1SYD A;  2JSO A;  2FIN B;  2CW0 C;  2VNU D;  4OL7 A;  1CQV A;  2FHT A;  5BN3 A;  1GUW A;  2A6H D;  4XDX A;  4OO1 H;  3VR4 A;  3HOV B;  4RGO S;  1QOH A;  4RCN A;  1CT1 D;  3S1M B;  5HGT A;  1UEA B;  3MXN A;  2DNC A;  1A2T A;  4C1N I;  5J1Z A;  5EPK A;  1ZKO A;  1MBY A;  3OSO A;  2KUM A;  1IYV A;  5IIF A;  1F77 A;  3G6J B;  2F3V A;  1TKW B;  3CRK C;  4YIJ A;  4RAU C;  1G2S A;  5AFW A;  2KJX A;  4L6T B;  2B2Y A;  3OWE B;  4B9X A;  1SE3 A;  3S1N B;  1B9N A;  3QB3 A;  4TKO B;  1TWG B;  3M7G A;  5IGC A;  3J7Y W;  1GOZ A;  1BO0 A;  2I46 A;  2HDM A;  5M9O A;  4PMW A;  2WV6 D;  4XXE A;  1JWU D;  1TWC B;  2KHS A;  2F0E A;  1VF5 C;  2F0N A;  1CQF A;  4X3K A;  5JOB A;  3TZD A;  4ZUI A;  1AFP A;  5JEA G;  2JA6 B;  2R93 B;  1CZG A;  4R9W A;  2QF7 A;  3DMU A;  3P7J A;  5D14 A;  4JBW A;  4K6L A;  1EEF D;  1NR4 A;  1ILP A;  1W6K A;  1B4O A;  2KOL A;  2PNR C;  1ET9 A;  3N6R A;  4ZYS A;  1JC7 A;  3SDZ A;  3TP8 A;  3DM1 A;  2ID0 A;  1KAA A;  1I4G A;  1X3P A;  3MVV A;  4ZAI A;  2E76 C;  2FJ2 A;  3BZD B;  1SJH D;  3TSS A;  4J6H A;  1SNC A;  4XYQ A;  2VUM B;  5E3F A;  2ZXR A;  3DWQ A;  1AP0 A;  3D4W A;  3OIQ A;  3SK6 A;  2EVB A;  4A3D B;  2R3Z A;  2YU9 B;  4OGQ C;  2K1B A;  2B39 A;  3C1F A;  1F9S A;  3NP8 A;  1HA5 A;  4UAI A;  3E0J A;  1E2Z A;  1DJR D;  1SFO B;  4IUT A;  4RKL A;  3U9O A;  4XT3 B;  1DXM A;  3KUP A;  5C5M A;  2B63 B;  2PW5 A;  3Q6S A;  3QO2 A;  3NTI A;  4XTC S;  1CFM A;  1EY6 A;  4RHR A;  1PZJ D;  1JWS D;  4DA2 A;  5EPL A;  2DY8 A;  2PZW A;  1PXU A;  3LNN A;  4OIJ A;  2NUC A;  2A68 C;  3GV3 A;  1D5Z C;  5EKK A;  3GTM B;  1S4Z A;  2F0O A;  1MD2 D;  3GP7 A;  1FNU A;  2F0G A;  2B2V C;  1PTO C;  2D5D A;  2B2U A;  3AB9 A;  4DAY A;  4K5V A;  3EJI A;  1SMY C;  4EQN A;  1KDB A;  1TWA B;  1I4P A;  2L12 A;  4A3F B;  1LTI D;  1TVX A;  2ZT9 C;  3P1H A;  4XQJ A;  4K2L A;  4K8I A;  4F87 A;  1Z7T A;  1Q3L A;  2LFN A;  2O5J C;  3KLS A;  1CA5 A;  1I3Q B;  1Y1W B;  1WTR A;  1H9M A;  5F2D A;  2HCI A;  4ODG A;  4FXK C;  3NTK A;  4MHE A;  3AU7 A;  5C6A A;  3Q24 A;  5KRU A;  1ESF A;  4HTH A;  1H9J A;  2IX1 A;  2O4X A;  3WOE A;  2QDB A;  4BWG B;  2I07 B;  3J81 E;  3DHQ A;  4AYB B;  5CV8 A;  4O42 A;  2IT1 A;  3FPU B;  3I3C A;  3GTK B;  5CV9 A;  1WD1 A;  2B2U C;  3OPO A;  4ZQ3 A;  1VMC A;  3A8K E;  3I4L A;  5IOC A;  1HCZ A;  1UAP A;  2NBF A;  4DXG A;  4L8J A;  5K5P A;  4Q0F A;  4I65 A;  4KY6 A;  5CR3 A;  4R8N A;  1GXD C;  1EY9 A;  3BDL A;  4IFD H;  2MJ8 A;  1Y8N B;  3I91 A;  5C44 B;  1M8A A;  2M00 A;  2L5T A;  3R2T A;  1U4L A;  4XIG S;  2K5D A;  1WCM B;  1J9O A;  2A68 D;  4MN3 A;  2K03 A;  4P2C B;  4IUV A;  5JJZ A;  2K7V A;  1BF4 A;  1G6Z A;  1HRJ A;  3T56 B;  5M5Y B;  3DWA A;  2FMM A;  1SE2 A;  3VYS A;  1ZXT A;  1MSG A;  1TS2 A;  1IKL A;  1B3A A;  1B1Z A;  1PZI D;  4K5W A;  5IGE A;  4C3I B;  2IL8 A;  2XNA C;  2Y0S B;  1EU4 A;  2QKI C;  3QJY A;  4KV6 A;  1F9R A;  4EQO A;  1ESR A;  1IW7 C;  2MGS A;  1OXX K;  5C5L A;  2C9O A;  5I6Y A;  1WTQ A;  1H9K A;  1PYW D;  2JA7 B;  4C3H G;  1Y8P B;  4DAV A;  1Y69 U;  3OWF A;  5JVH 3;  1R4Q B;  2F0M A;  1TY0 A;  1A3U A;  2A6H C;  3SHL A;  3S1R B;  4ID6 A;  5I4D A;  5C0X G;  2EYM A;  4JK1 C;  1C48 A;  1XYI A;  4A3E B;  3TP5 A;  4OHJ A;  1HQM C;  4C3J G;  2O2L D;  1IL8 A;  2AUK A;  2WAQ B;  1QB5 D;  3GD7 A;  1IHZ A;  3NSW A;  2EZV A;  1A3V A;  3TDQ A;  5BN5 A;  2Z4H A;  2X6G A;  1QCB D;  1A15 A;  1UNS A;  2J0T D;  3OMG A;  1NUC A;  4RKB A;  3SXH A;  3T51 B;  1RD9 D;  4DAP A;  1FNV A;  4KN7 C;  3NXW A;  4V0B A;  1EYC A;  2KQ3 A;  3EQL C;  1PFB A;  3TN2 A;  3MAQ A;  3SK5 A;  1U4R A;  2Z1C A;  2SDF A;  1SBB B;  3VR3 A;  4BS9 A;  1G8Z D;  4CBV A;  1TT2 A;  2E2D C;  4N9T A;  4KJN A;  3HOU B;  1WVL A;  3JAM E;  4FO2 A;  4EQP A;  3M3Y B;  3J81 L;  2RQX A;  4G7Z C;  2H4O A;  3EA6 A;  1QNK A;  2G9H D;  3A8I E;  2CVR A;  5EQ0 A;  4OO1 I;  5E1F A;  1GUT A;  5CC4 A;  3E5S A;  3K59 A;  4GZY C;  5DNF A;  1PRT F;  4X3U A;  3S15 B;  2WB1 B;  1LT3 D;  2SEB D;  1MGS A;  1BXT A;  2K28 A;  1V1O A;  2RVL A;  2BA0 A;  2GA4 B;  3C2P A;  4XQQ A;  2ENB A;  4IQZ A;  2F0V A;  2K04 A;  3S17 B;  3IFT A;  2NB0 A;  2F0U A;  1MSH A;  2HQE A;  4A3M B;  4ZUJ A;  5BN4 A;  1LAC A;  2M2L A;  2N55 A;  2JXM B;  1DM0 B;  3R93 A;  3U9S A;  4NKL A;  1EYD A;  1A6X A;  4DK1 A;  1STE A;  2EXZ A;  1EIH A;  3MFG A;  1C8C A;  1GJX A;  5K36 H;  2V4D A;  5C0X J;  1TWF B;  3FVQ A;  2EYO A;  2OXP A;  5DM7 3;  2PMZ B;  3V05 A;  1DZ1 A;  1O7Z A;  2JEA I;  5JPN C;  5JVG 3;  2PO4 A;  5M5W B;  1NCV A;  1W6J A;  1VMP A;  4EVO A;  3EFX D;  3HEJ A;  3K5N A;  2F0J A;  4NP5 A;  3RZO B;  1CHQ D;  2FMC A;  2DNE A;  1PZK D;  5FOB B;  2EY2 A;  1E2W A;  5ELB A;  4WFN 3;  1Y8O B;  1FD7 D;  2R92 B;  2HCC A;  1SYE A;  2HDL A;  3VYR A;  2F0Q A;  1QIL A;  1TU2 B;  4M1U B;  3K5O A;  4HMJ A;  2WKC A;  2O5I C;  5I9O A;  2B2W A;  2LKV A;  3MEH A;  2PCF B;  3GO5 A;  3MC0 B;  3SE0 A;  4TSS A;  2K5W A;  2JYO A;  1LT4 D;  2BA1 A;  2HUG A;  3NQI A;  3TME A;  1T5E A;  1EIG A;  1HXY D;  4RHS A;  2G9D A;  4L63 B;  3VYT A;  4C56 C;  1F9P A;  3A7A B;  4BBR B;  3GTO B;  5I2X A;  3PMF A;  1TS3 A;  4HCS A;  1V8Q A;  3VA5 A;  1SND A;  3K57 A;  1SNQ A;  2L0C A;  3ND9 A;  1C4Q A;  2MHV A;  4KN4 C;  3JAM L;  1SJE D;  2B2Y C;  2N88 A;  3GTQ B;  4LMQ D;  1I6V C;  4XT1 B;  3NHH A;  1A2U A;  2E75 C;  3VR2 A;  1JOQ A;  1T5X D;  1KNE A;  3BYY B;  2PPB C;  1BQQ T;  4H7B A;  4UDU C;  3BVM A;  3HKZ B;  3KBX A;  5KIX A;  1KTK A;  2B2W C;  3GV6 A;  3VA7 A;  1FR3 A;  3I73 A;  4OO1 G;  4OIK A;  2IX0 A;  5A35 A;  2R6G A;  1WTP A;  1RJT A;  2RA4 A;  3BS1 A;  1X32 A;  1QE6 A;  3ONA B;  4XYO A;  1O7Y A;  1KDA A;  3OMC A;  1WTO A;  3OW7 A;  3RUZ A;  1EZ6 A;  3KF8 A;  5IGB A;  2PW7 A;  3T16 A;  4BY1 B;  4PMC A;  3H0G B;  1VCI A;  1XXG A;  1CA6 A;  4R8I A;  1V1P A;  4ABN A;  3H09 A;  2B2T A;  3H6M A;  1MI2 A;  3ERQ A;  1G2T A;  5EPJ A;  1ENA A;  4QF4 A;  1R4P B;  4O1N A;  1ZEQ X;  3BG3 A;  3H3V C;  4KHZ A;  3QWN A;  5C3W A;  2K01 A;  3ERO A;  3S16 B;  1PRT C;  1JOR A;  1TR5 A;  4C2M B;  3C3L A;  5JAV A;  4C1N K;  3D6C A;  4RWS C;  5JEA J;  3G7L A;  3K5M A;  2XN9 C;  2RDF A;  2R7Z B;  4F88 A;  5IT9 E;  4QUC A;  3D8G A;  1KDC A;  4CKB A;  1YNN D;  4HMI A;  4IFD I;  2RSN A;  5HUR A;  4RGT A;  3HRZ C;  3QIA A;  1PTO H;  1PRT B;  3J80 L;  5C4X B;  4K6D A;  3MXP A;  4B08 A;  1ICW A;  3PUW A;  5IGG A;  1LT6 D;  1SYF A;  4IAL A;  1S5C D;  4IUN A;  1WTW A;  4C3H B;  2D2C C;  2NN6 H;  1WTX A;  2XWJ B;  2A74 C;  1HFN A;  2B2T C;  2VB2 X;  4PV1 C;  3A8J E;  2IWH A;  4G7H C;  3PUZ A;  1Z6H A;  1DON A;  2EY1 A;  4C3J B;  4QB4 A;  1GUO A;  1AEX A;  3IL8 A;  2F3W A;  3ITP A;  1EEI D;  2IPK D;  5IOD A;  4HSV A;  3C46 A;  5CV5 A;  3HOY B;  1V1P B;  3A55 A;  4CGY B;  3R2I A;  3FDT A;  3FPP A;  4H13 C;  1H9S A;  1I4Q A;  3PO3 B;  1G91 A;  2RKS A;  1LTT D;  4U68 A;  2WP8 J;  1KLG D;  3D6W A;  2Z8L A;  2SOB A;  2RDG A;  1QG7 A;  3V96 A;  4LJZ C;  1K83 B;  1LTB D;  3DEO A;  3I70 A;  2YYZ A;  4TQU S;  2M9V A;  4IUP A;  2OEO A;  3I8Z A;  1D1K A;  3IAY A;  1HUN A;  1OXV A;  3L3O C;  1EY8 A;  3X3N A;  3BDO A;  2PYK A;  1PRT D;  2X69 A;  1EY7 A;  3N52 A;  1D2B A;  4FYD A;  1SAP A;  2MPM A;  2R61 A;  1YNJ D;  4K8J A;  5G3L D;  2F0I A;  3S1Q B;  2XWB B;  5ISR A;  3VYU A;  2X6L A;  1XX8 A;  3LWE A;  4S3S A;  5M3M B;  1II3 A;  1STY A;  3M4O B;  1B2T A;  4H0L C;  1DOM A;  3C1E A;  3SR1 A;  2EE1 A;  3SVM A;  1BBX C;  4K14 A;  1Y1V B;  2EPB A;  3GTL B;  1DCZ A;  1JB3 A;  2K5Q A;  4MIU A;  2C5C A;  3M7N A;  1HUM A;  4PNY A;  2AWO A;  3D3R A;  3I4N B;  1O78 A;  3S9W A;  5A2Q L;  5IT9 L;  1CZW A;  3IFD A;  5T1G A;  4IUR A;  2EYF A;  3Q22 A;  1H9S B;  1RCV D;  4CHT B;  1AW7 A;  1BCP D;  2BOS A;  2NVX B;  2FFK B;  1DOL A;  5CV6 A;  3MXG A;  1FGB D;  3EVQ A;  3HG9 A;  2LY7 A;  3T13 A;  5I6W A;  4QIW B;  4G57 A;  2QEJ C;  4FF1 A;  3FRP B;  4A93 B;  2EYL A;  2EY5 A;  2ZXP A;  1LV9 A;  2EJG C;  3E6Z X;  1S5B D;  3R3O A;  4IFD G;  4A3J B;  3NQT A;  3K58 A;  1J8I A;  3MZ5 A;  4WJW A;  1DD2 A;  2RSO A;  2A5H A;  1TS4 A;  2OT2 A;  1CHP D;  1CM9 A;  2NWG A;  1B50 A;  1S5E D;  4ME5 A;  2QIL A;  4DU9 A;  1BNZ A;  2TMP A;  1XTC D;  3LX0 A;  2MUY A;  5C4Z A;  1JE4 A;  2F0H A;  5KNC A;  3I4M B;  3FKI B;  4EGV A;  1AZQ A;  2OF1 A;  1SE4 A;  5JEA H;  1ILQ A;  5G3L F;  4DXF A;  4X3S A;  2A6E D;  2XRQ D;  2BE5 D;  2F0D A;  3ND8 A;  1EY5 A;  4PQX A;  3GTJ B;  1PTO F;  4LAA A;  3BYT B;  4FF2 A;  3D4D A;  3SK8 A;  1LO5 D;  4QCL A;  1EYA A;  4KTA A;  1HQR D;  1RKN A;  5DAU A;  5IGD A;  5EKI A;  3HZX A;  4HSP A;  3WOF A;  1X3Q A;  2JEB I;  1HPC A;  2F03 A;  2AWN A;  1R9T B;  2BDO A;  4BA1 I;  1SYB A;  3MXU A;  5CGK A;  2JA8 B;  5CMD A;  3S2D B;  1HA6 A;  1HTP A;  2L11 A;  4RGN A;  1RDP D;  4WOR A;  1EZ8 A;  5FLX E;  4QMG A;  4G7O C;  3J7A V;  1I6H B;  1HHV A;  3NBI A;  2L1B A;  4CJ1 B;  3PUX A;  2SNS A;  5KNB A;  1XWE A;  1BCP F;  2Q8I B;  2ICI A;  1E2V A;  1F2M A;  1Z47 A;  1TS5 A;  1ENC A;  4HR7 B;  2F0F A;  1SNP A;  5ELF A;  1BDO A;  5EBC A;  5M3F B;  4ZLT F;  3NPP A;  1OXU A;  2K6A A;  1ZYR D;  5KYL A;  1I4H A;  1U4P A;  2KEE A;  2A69 D;  2L4N A;  3S2H B;  1LTS D;  5LL6 X;  1BR9 A;  5EGT A;  4DGZ A;  2JP1 A;  3J80 E;  3NBH A;  4IFD J;  4FF3 A;  2TSS A;  1LT5 D;  1JQY D;  4XQN A;  1LAB A;  3AMU A;  2RBM A;  3VR5 A;  1DYQ A;  4ZK9 B;  1HTL D;  2F0W A;  1STA A;  3OHX C;  3X3M A;  3RZD B;  1SYC A;  1QWY A;  4A3I B;  2F0L A;  3RD4 A;  1YNN C;  1Q1B A;  1FYC A;  4B9W A;  1EY0 A;  2PQE A;  5C3X A;  5I2Y A;  3K5L A;  5M5X B;  1EWC A;  1ONL A;  3PV0 A;  5FK9 C;  1F2Z A;  3RLF A;  3OIP A;  1RHP A;  5D65 A;  2E2I B;  4HAE A;  1GUG A;  3NK9 A;  4RFB A;  1STH A;  4CKC A;  2K33 A;  4FXD A;  2LS0 1;  3I90 A;  1D5X C;  3BDC A;  5EKL A;  4CJ2 C;  3PO2 B;  1PDQ A;  1PFM A;  2B8G A;  3TP7 A;  3MFY A;  5J22 A;  2WII B;  2XIW A;  3HOZ B;  3P75 A;  3Q0A A;  4N9P A;  1GUN A;  1B9M A;  4U67 3;  1UUP A;  3KLS X;  4DNT B;  3DUZ A;  5K36 G;  1FNW A;  3FEW X;  3WDN A;  5CYU A;  2D9U A;  1OO9 B;  1M4V A;  2B2V A;  2KED A;  4IN3 A;  5EBD A;  3GTG B;  3CQZ B;  1KLU D;  3NE5 B;  1KNA A;  2BCO A;  3D31 A;  1CK1 A;  1JOO A;  4RH6 A;  1TY2 A;  4DK0 A;  5C4H A;  1JR0 D;  2PZU A;  4HN7 A;  5LHY 1;  2CW0 D;  1F9Q A;  4PMB A;  2F0S A;  4NW2 A;  2F0K A;  2WKD A;  3KK7 A;  3CRL C;  4QUF A;  2VXW A;  4RGM A;  1U9R A;  1QJO A;  1EWH A;  2Q8R E;  4V19 0;  2F0P A;  4KJO A;  5I9P A;  3UI2 A;  2NN6 I;  1JOK A;  3NUC A;  1RTO A;  5E4W C;  5FLX L;  4BA2 I;  4F8M A;  5CV4 A;  2ICE C;  5CV7 A;  4DNR B;  1WTV A;  4KK7 A;  1EFI D;  5C0X I;  2AQ2 B;  4F7X A;  3M4Y A;  1VDZ A;  1EY4 A;  1Q90 A;  2RDH A;  5D3D A;  4WRD A;  5ELE A;  1YNJ C;  3QOL A;  5A2Q E;  1CI3 M;  3HGB A;  3URY A;  5CBA E;  3TZU A;  3P20 A;  5ELC A;  5J39 A;  4Y7N B;  1GHJ A;  5ELD A;  4KD3 A;  3J7A F;  3A54 A;  5COY A;  1EOT A;  1STN A;  5JPM C;  3LWU A;  3R8B A;  4E6I A;  5FO7 B;  1LTG D;  5FKA C;  2LMC B;  2E74 C;  1IKM A;  1EQT A;  1BUV T;  1B44 D;  2AQ3 B;  3CKI B;  2KA7 A;  2K32 A;  1VF7 A;  1PTO B;  2VB3 X;  1AZP A;  4CKE A;  3H94 A;  4H44 C;  4ZRZ A;  3DWP A;  5C0X H;  5E4X A;  1BCP C;  1JIC A;  1DOK A;  3S14 B;  2XVS A;  4IUQ A;  1SXT A;  3I72 A;  4ULL A;  2CQA A;  2EDG A;  1TWH B;  3GTP B;  1SNO A;  3PUY A;  5EJW A;  1SNM A;  2F4I A;  3NWT A;  2J7Z A;  3PUV A;  1OXS C;  4KD4 A;  1L0Y B;  1I50 B;  1SYG A;  5NUC A;  1LLR D;  3W3A A;  4IZ8 A;  2EY6 A;  1RF2 D;  2DN8 A;  1K8M A;  1BCP B;  3GQB A;  1HFG A;  2EYP A;  1L0X B;  2QCP X;  2NTT A;  3H91 A;  1WD0 A;  3O13 A;  1ET6 A;  4KKU A;  3VR6 A;  1KAB A;  2CHB D;  3T4A C;  2ZXO A;  5C3E B;  1QNU A;  1E0B A;  2Z4I A;  4DN4 M;  4A3K B;  4I7Z C;  2L55 A;  3K6O A;  1IYU A;  4DFA A;  1F2L A;  3NTH A;  5IGF A;  2A6E C;  2DY7 A;  4CJ0 B;  2BE5 C;  2KCN A;  2KVM A;  1JCK B;  2XRS D;  2IJ0 A;  2KCC A;  2MP1 A;  3HOW B;  3HOX B;  4K2K A;  2NVY B;  1S5D D;  2J4X A;  1V43 A;  4K5X A;  4ZKC B;  2JE6 I;  2JA5 B;  2EJF C;  4M8A A;  2E2H B;  4FP5 D;  3MA2 B;  3BVG A;  2EJM A;  1PFN A;  1PTO D;  1D5M C;  2SNM A;  4FNF A;  1LTA D;  2KEC A;  3FMC A;  4NMZ A;  1U4M A;  1SMY D;  1SSO A;  4KKT A;  1ROD A;  4LK1 C;  3K0Y A;  2NVT B;  1NSN S;  1TII D;  1NR2 A;  1JWM D;  3A56 A;  1A3T A;  2K05 A;  3DXJ C;  2B8F A;  2XSC A;  3PIP 3;  1PMR A;  4FXG C;  1D6E C;  4FF4 A;  1O7L A;  4RCO A;  3HS0 C;  2NN6 G;  2F0T A;  2EYJ A;  1NAP A;  3SEB A;  4KY7 A;  1EU3 A;  5FO8 B;  4NDX A;  3QG1 A;  1GUS A;  4J1M A;  5KGU A;  1K8O A;  4Q5V A;  1ZYR C;  3ZYY X;  1S5F D;  2BDN A;  3CU7 A;  2A69 C;  2A73 B;  4G4K A;  5DM6 3;  1STB A;  1B53 A;  5KND A;  3L7Z C;  3RMH A;  4A3B B;  2Q8T A;  2F1M A;  1PLF A;  3KLR A;  1I4X A;  1D1I A;  3MTS A;  4KI0 A;  4DF7 A;  3OOC A;  1LTR D;  3T53 B;  3A7L A;  5COR A;  3PIO 3;  4BBS B;  2NVQ B;  2L9H A;  1Q1E A;  1OXT A;  3MWY W;  2WIN B;  1RTN A;  3HP3 A;  3SK4 A;  5C4J B;  3M85 A;  3KBG A;  1ML0 D;  3CHB D;  2D62 A;  5KEE A;  1SEB D;  4FVM A;  2AQ1 B;  2EYH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...