1WTPA

Hyperthermophile chromosomal protein sac7d single mutant m29f in complex with dna gcga(ubr)cgc
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
63
structure length
63
Chain Sequence
VKVKFKYKGEEKEVDTSKIKKVWRVGKFVSFTYDDNGKTGRGAVSEKDAPKELLDMLARAERE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Probing the DNA kink structure induced by the hyperthermophilic chromosomal protein Sac7d
pubmed doi rcsb
source organism Sulfolobus acidocaldarius
molecule tags Dna binding protein/dna
molecule keywords 5'-D(*GP*CP*GP*AP*(BRU)P*CP*GP*C)-3'
total genus 13
structure length 63
sequence length 63
chains with identical sequence B
ec nomenclature
pdb deposition date 2004-11-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02294 7kD_DNA_binding 7kD DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1wtpA00
2MJ8A 5CBEE 4ZLTF 1RTOA 3N52A 1B4OA 5EJWA 1CA5A 1KNEA 1PFMA 2N88A 2VXWA 1DOMA 4RA8A 2JP1A 1AZPA 2MPMA 3QO2A 2EOTA 2FFKB 2L1BA 4IUUA 1NR2A 5T1IA 1AP0A 4ZKBB 2B2TC 1ZXTA 2JYOA 1F9QA 4O42A 4RAUC 2XIWA 5EPKA 2K1BA 3KUPA 2HUGA 3I8ZA 4R8IA 1IKLA 2B2VC 3P7JA 1RODA 1O7ZA 1NCVA 1EL0A 2FMMA 2KVMA 1B2TA 1E0BA 2K03A 4XDXA 1DONA 1G6ZA 2HCCA 5EQ0A 1NR4A 2B2VA 2B2WC 2L12A 1CM9A 5AFWA 1SSOA 1EQTA 2KUMA 2KOLA 1O7YA 2RSOA 3ONAB 1DZ1A 2D9UA 2CVRA 3GV6A 1XX8A 2RA4A 4HEDA 4IUVA 3Q6SA 1A15A 1PLFA 2B2YA 2K28A 3H91A 2IL8A 1ICWA 1SDFA 1TVXA 1AZQA 1PDQA 4X3TA 4QUFA 1IL8A 2SDFA 3IFDA 2X6LA 4CJ1B 1Q3LA 4MN3A 2X6GA 1JE4A 1EIGA 2K05A 1F9PA 1MSGA 2NYZD 1ESRA 2B2UA 4IURA 1G91A 1HFNA 3D6WA 5D14A 2FHTA 2NWGA 4HSVA 1IKMA 5CBAE 1S4ZA 3I91A 2Q8TA 2MP1A 4U68A 5COYA 1WTQA 2DY8A 2MGSA 4ZK9B 1ILPA 4CJ2C 3TZDA 1RJTA 1U4LA 2EE1A 5JJZA 4OIJA 1WVLA 2N55A 3F2UA 1U4MA 3I90A 3MTSA 5D65A 2K04A 1BBXC 2L9HA 4OIKA 1HHVA 1J9OA 2R3ZA 2X69A 3R93A 1G2TA 2DY7A 1G2SA 3I3CA 1MSHA 4UAIA 5CMDA 2B2TA 5E4WC 1HFGA 4ZAIA 1WTXA 2BDNA 2KEDA 5EPJA 1PFBA 1QE6A 1B3AA 1LV9A 1QG7A 2KECA 1MGSA 2J7ZA 2NZ1D 4XT1B 1CA6A 2RSNA 4QUCA 3G7LA 3UI2A 4X3SA 1B50A 1B53A 3DM1A 1BNZA 1ML0D 2B2YC 2HDMA 3MWYW 4XT3B 1M8AA 4IUQA 1VMCA 1X32A 3FDTA 4ZKCB 3SVMA 1HUMA 1NAPA 1X3PA 4X3UA 3FPUB 2HDLA 2B2WA 5E4XA 1HA6A 1DOLA 2KEEA 1DOKA 2RVLA 4CJ0B 4DN4M 2FINB 4X3KA 3DEOA 2L11A 1KNAA 4HAEA 1WD1A 1WTOA 4NW2A 1WD0A 1C8CA 1BF4A 3HP3A 1XYIA 1GUWA 2FJ2A 3GV3A 1MI2A 4MHEA 1F9SA 1BO0A 1QNKA 2HCIA 4LMQD 4R9WA 5EPLA 1VMPA 1HRJA 2H1EA 5EKIA 1EIHA 3LWEA 2B2UC 5CORA 1WTPA 1O80A 2L4NA 1F2LA 4IUPA 1PFNA 1SAPA 4RWSC 1F9RA 3KBXA 1RTNA 3DEPA 1U4RA 4HCSA 5T1GA 1X3QA 1JICA 3IL8A 3TN2A 2EPBA 1WTRA 1U4PA 1HUNA 1ILQA 1EOTA 1RHPA 2Q8RE 4IUTA 2M2LA 5DNFA 2K01A 1WTWA 1J8IA 1WTVA
chains in the Genus database with same CATH superfamily
1SE3A 3K8AA 3GTLH 3F1ZA 3F2CA 3H3VH 1G8ZD 4BS9A 3LGJA 1PMRA 2UUAL 1HJPA 3D4DA 2HUGA 3NPPA 3F2DA 2F0NA 4JI8L 3RNUA 1CHQD 1NTGA 4OELB 1LTID 2RCNA 3M3YB 3HG9A 3DWAA 4EVOA 4IFDH 3KF8A 5JEAJ 3CMEA 4CDDC 1YVCA 1EQVA 4MTKA 5GAHC 2NBFA 3HOZG 4IUVA 4FF4A 2E2JB 5FO9B 4X64L 2Y0SE 3S14H 3A7AB 4B3SL 3K5LA 2VQFQ 4TVAB 1LO5D 5E7NA 5ELEA 2SOBA 3K81C 2NYZD 4F88A 4QMGA 1NUCA 4K6DA 4A3FG 2MP1A 5FK9C 3M4OH 1TR5A 2MGSA 1GUGA 1LTSD 3IKJA 3S15H 4HCEA 1G2SA 4UAIA 3R2TA 2BDNA 5CV5A 4GOPA 3S2HH 1LV9A 1Q12A 5FO8B 3JAMc 1X54A 5EBCA 2LXJA 2IX0A 1QCBD 2NZHA 1N32L 1JJ2A 1IZ6A 1NE3A 5M5XB 3S17H 2EIFA 3CRLC 1XNQQ 4HAEA 2JQOA 2Z4HA 2EZVA 3GTJB 2KCMA 2LFNA 2FJ2A 2PZUA 2VL6A 3E0EA 4QQBX 1QNKA 2CWPA 2HQEA 2UXCQ 1JOKA 1SNOA 3MVVA 1E2ZA 3SXHA 4P72A 3QIAA 1AE2A 4HIOA 2KCCA 1WOCA 4R8NA 1QWYA 3GTQH 3CW2C 2NVXB 4GS3A 3J80i 4GZYC 2UUBL 1GHKA 1T5EA 4ZLTF 1E2WA 2LKVA 4DUYL 4KV6A 2MQHA 3HOVH 3GO5A 1XNRL 4LFBL 1FJGL 3VA7A 2K50A 3KUPA 2UXBQ 1TWCB 2R7ZH 4JPBW 2G5DA 1EWHA 5I2XA 1O7ZA 1XMQQ 3I56A 4ALPA 4AYBG 2AWNA 5JVG3 4LFAL 2A68D 1VQBA 2WKCA 2Y0SB 3T51B 1UNSA 2JXMB 3J80c 1PZID 5C4XH 2RA4A 2ZJPA 1XWEA 4R4OA 1AW7A 1U9RA 4K8JA 3EN2A 3SDZA 4A3IH 2A69C 4X3TA 2VW9A 1TWFH 1LTLA 4YHHL 1LACA 3EA6A 1SROA 1M1KC 4YCUA 4XTCS 1PTOH 1FGBD 2NWGA 3L7ZC 1IW7C 3WOEA 5CBAE 1WTQA 3M4PA 4YCVA 1CZGA 1KLGD 3K7AB 1XPOA 4CKEA 4B3RQ 2ZXPA 2NVTB 1PHJA 2XTIA 3UDIA 1ESFA 2QF7A 4U673 3R93A 5HGQA 1QVGA 1BBUA 4WRDA 2AQ2B 2I07B 4OWXB 1SNCA 2F0JA 4C1NK 1XMQL 3D0FA 2JA6G 4GNXC 2LXKA 4K8IA 2RDFA 2VQEL 3D3RA 4TRDA 3AMUA 3HOZB 3EIVA 4OO1G 4X3UA 2E8GA 2F03A 4A3GH 4Q0FA 4HJ9A 4X3KA 4CGYB 2QDBA 4YCWA 4A3JG 2DJFC 3I7FA 3NQTA 2DN8A 1HXYD 4MHEA 3BYTB 3W3AA 1VQ4A 1VQHA 4ZYSA 3K58A 1A2UA 2EDGA 4HIMA 2L4NA 1PFNA 4R4TA 1SNQA 2PYKA 1SAPA 3EQLC 1XNQL 4IUNA 1HNWL 1U4RA 3K7UC 3G4SA 4UP9A 4ZCKA 1PRTF 5C4XG 4G7HC 5C4HA 1GUSA 1HH2P 3DM3A 5C4JH 5LMNW 5DM63 1N33Q 3S1RB 1HQRD 2K01A 2L15A 3PO2B 5CBEE 3D31A 5GADC 5C3EH 5J3BA 3GTMH 4EQPA 3C1EA 2MFIA 4IUUA 3RR5A 4K2KA 3I70A 4RCNA 4EGVA 1BXTA 3TQYA 4GN3B 1LTTD 2SEBD 2QCPX 5IGGA 1Y8PB 4OGQC 3BJUA 2A5HA 4K0KQ 1HR0W 4XQQA 2MUYA 1RIPA 5BR8L 3J81c 4JI6L 2I5LX 3GP7A 1HNWQ 4A3LG 3RMHA 3IAYA 2Y0SG 2RSOA 2A6EC 4Y52H 1N36Q 1B8AA 3NEMA 5K36H 1QNUA 1JQYD 1PDQA 1HQMC 1EU4A 4YWKA 4KKTA 1LTBD 3A54A 1TQOA 5C5LA 1PTOB 2RCFA 4U68A 1X3FA 3DWPA 2ZJQA 1Y14B 3PSIA 5CYUA 2E2IH 2VQEQ 3T56B 4OIJA 4DV1L 4X64Q 5FKAC 1LM0A 2D0PA 2K52A 3GTJH 4DV0L 1HR0L 5C3WA 1FYCA 4OO1H 1VQEA 3HOWH 2JEBI 2UUAQ 3E6ZX 5C3EB 1C0AA 3CCLA 4XT1B 2GVBA 2ZTEA 2CH4W 4HMIA 3V05A 1B53A 4B3RL 1ML0D 1QJOA 3MWYW 1V1QA 3C2PA 1G51A 3KJPA 1X32A 3A56A 2EY1A 5IYDG 3K6OA 2KEEA 1KABA 1MIUA 3I4NB 4HJ8A 1XYIA 3PV0A 3ICEA 1A3VA 1SMYD 1VMPA 4KI0A 4L5SA 1YNJD 1RD9D 1WTPA 1EYCA 3S16B 5IT9L 4DAYB 3TS0A 1B7YB 1W6KA 3AFQA 4RHRA 1D1KA 4RWSC 3J81L 2DJGC 1I4GA 1LYLA 2WB1G 5M5WH 4NP5A 4QF4A 1S72A 2CHBD 5A2QE 1IBMQ 2EPBA 1UEAB 3W2DA 4GKJL 1WTRA 1U4PA 3BDCA 4PMBA 2E2IB 4IUTA 2IJ0A 2MJ8A 5CR3A 5IYCG 4DR1L 3M85A 4FXKC 1AN8A 2D62A 3A5ZB 2VB3X 2R7ZG 4A3IB 3SE0A 2E76C 3S16H 1CK1A 1JWSD 2JEAI 1PRTD 4BY7B 3OIQA 3CRKC 2HQLA 1SLJA 2QGQA 3H09A 3PF4A 2EVBA 3E3XA 2WFWA 1STHA 2KVMA 5IYCH 3A7LA 1STEA 1V43A 4HN7A 5ELCA 2A8VA 1NR4A 4A3EH 2AQ3B 2B2WC 2L12A 1TWAH 2F0TA 1EEFD 2CVRA 1STAA 1XX8A 5I2YA 2DGYA 1C9OA 4G57A 4JBJA 2EYPA 1YNJC 2A69D 4DGZA 1S5DD 2Z4IA 5GAGC 5IP9G 1YJWA 3GTGB 4JBWA 2NVYH 2PO4A 2WB1E 1FVIA 1LTGD 2X6LA 1Q3LA 4R4IA 1ET9A 1WCMG 4RG1A 3CCJA 3KF6A 4KN7C 2XN9C 5ELNA 1K3RA 1RF2D 2JA7B 2Q8TA 1DD2A 4GOPB 5COYA 1BQQT 3ULJA 3CD6A 3A5UA 5GROA 4ZUIA 1M4VA 4WORA 3QOJA 1BR9A 5D65A 2OTLA 3MHBA 5CV4A 1Y8OB 1ZYRC 3CC2A 3ZYYX 5C0XI 3I2ZA 2DNEA 3PUWA 2K5DA 2NZ1D 4OL7A 5IT9c 5M3MH 4XYOA 2PMZB 3FDTA 4ZKCB 2NVQH 1GD7A 4HR7B 4WJWA 5IYBH 1PTOD 2VUMH 2F0KA 1R9TH 2EY6A 4IPGA 2L11A 3J81j 4DAYA 1E3PA 1VQGA 3I4OA 4K5XA 4JW0A 4A3FH 4GKJQ 4EQNA 4JI5Q 2XSCA 3W1BA 4RHSA 1BKBA 3LWEA 5CORA 1JOQA 1JE5A 2B39A 3G6JB 3H6MA 1Z47A 3IRBA 4XIGS 4IJHA 4DK1A 3J80L 4GOPC 2EQSA 4A3KG 3BZKA 4JI4L 3SK6A 2NVQB 1HPCA 3I4MH 3VA5A 1K83H 5KYIA 5ELBA 4JV5Q 3X3MA 5C0XG 2NB0A 4ZRZA 1EOTA 4J8QA 2Q8RE 4O1NA 5ELOA 5EPJA 1AP0A 2F0LA 3N52A 1KHIA 5EJWA 4IPDA 1PFMA 4NPSA 1BCPB 1M90C 4GLVB 3ER0A 2HT1A 1F9QA 1ZEQX 5FJ8H 5LL6X 4B9XA 5JJIA 1VDZA 1Y69U 5M3MB 1N33L 2PW5A 1X55A 4C2MH 4DV2L 4BY7G 3RD4A 4K5WA 3EBEA 1E2VA 3FKIH 5C0XJ 3HOVB 1QZGA 1EQTA 1B70B 4IALA 3T53B 4X66L 4JBKA 3S1QB 3AB9A 4F87A 4IFDI 4JI3L 4RGNA 2EJFC 3J80E 1I6HH 2AHOB 3OWEB 1A15A 4A3KB 1CTMA 4KHPL 1X6OA 4N8X1 1SDFA 4JI5L 3J7YW 1E7ZA 1OO9B 2F1MA 2SDFA 2WAQB 3H0GB 5DAUA 4IQZA 3T1HQ 4C3JH 4ME5A 4DR6Q 3H94A 2EXZA 3GTLB 3DLLA 2KHJA 4L8JA 2M00A 2CW0C 4A3DB 1WCMB 1A3TA 2MNAA 1L1OB 1K83B 4LF6L 1JT8A 5JJZA 3EJIA 4L5TA 2JA5H 2N55A 3MTSA 3NWTA 1DJRD 2PMZE 2A6HC 5HGTA 2VY3A 2WINB 4IPHA 5M3MG 3LWUA 1EIYB 1CA6A 2RSNA 4LF6Q 5BR8Q 3U9SA 4A4IA 4DV2Q 3RZDH 1PZKD 1KXLA 4OWTB 1M8AA 2PQAA 4QCLA 2DUDA 2HDLA 4N9PA 2RVLA 4CJ0B 2IHFA 1IW7D 2FINB 1VQ8A 2A6HD 4A3CG 1WTOA 1VQAA 1ENCA 2LY7A 3J81i 5LHY1 2EYLA 4DFAA 1CKOA 2CW0D 2V1CC 2ICEC 2EXDA 4F8MA 4DAMA 1C48A 4JI7L 3QWNA 4YIJA 1X9NA 2I46A 3KBXA 4HIKA 5IT9E 5T1GA 1PA6A 4B3SQ 3GTMB 1JICA 2F0UA 4DR3Q 1CQVA 1JC7A 4DNRB 3M4YA 4LFCL 1WFQA 5JOBA 1VQ9A 1UE1A 4PNYA 3HOUB 3PGZA 2I5MX 3G71A 4RGMA 1I6VC 1KNEA 4H44C 3D4WA 3C3LA 4QL5A 1JWMD 1IBKQ 3QO2A 5J22A 5AJ3L 2WKDA 4ULLA 4JV5L 3I8ZA 5KEEA 1KLUD 3AYHB 2F4IA 5M3FB 4LFCQ 1SYEA 1YJNA 1EY8A 2UU9L 3LNNA 2QKIC 1UWVA 2B2VA 1CUKA 3N6RA 4LUZA 4AYBE 1TS5A 1IYUA 2RQXA 2UUCL 3I4LA 2JA8H 1HCZA 4RFBA 4OXPA 2AKWB 2DNCA 1JJGA 2HHHL 4KD4A 3PIPA 1PV4A 4A3KH 2N78A 4APVA 3S1MH 4LF9L 4CJ1B 1JE4A 4C3HH 4L5RC 2ATWA 5D14A 2FHTA 3GDEA 3CCQA 4GLXA 1K0RA 3HOWB 1F2ZA 3I91A 4NXMQ 1D2BA 4YHHQ 2DY8A 1TWFB 1BOSA 2HHHQ 1RJTA 1VQCA 3FHWA 4R4QA 2L9HA 4A3FB 1V8QA 3WDNA 1I5FA 1AH9A 3U4ZA 2YU9B 5JPMC 4E6IA 1DXMA 4LFAQ 3BG3A 3KDFB 5EAYA 1BBWA 1GKHA 1STBA 3V2TA 4DN4M 1CKNB 1A6XA 4DK0A 1WD0A 1C8CA 3SGIA 2NUCA 2XNAC 2SNMA 1Q90A 5NUCA 1HRJA 1PH8A 2PNHA 3HKZG 3TS2A 1VF5C 4GNXA 4A93H 3KLWA 1F2LA 2WACA 1GOZA 3JAML 3HOYH 1PYWD 3K59A 2K33A 1K3BC 3PQIA 4LUOA 4Y7NH 3S2DH 4GN4B 1TS4A 1VQJA 3PUZA 2AWOA 3NENA 1JB7A 1HUNA 1RHPA 1Q8IA 4FYDA 4UDUC 2OQ0A 1WTVA 1HTLD 1I50H 2K4KA 1J5EL 4DV4Q 4HJAA 1CT1D 5IGBA 5M5YB 3PO3B 2MPMA 3A8KE 5T1IA 4A3GB 5BN3A 3NBIA 4DXGA 4L5QA 5JAVA 3GTQB 5GAEC 4HJ7A 1VQKA 2IX1A 1OXXK 1PH3A 3HS0C 3P7JA 1VQPA 2QDLA 4CBVA 2F0VA 3NUCA 4NKLA 3HKSA 4A3DH 4K5VA 1LUZA 4ZQ3A 2F3WA 3CCMA 2BCOA 4RKBA 1DZ1A 1SE2A 3I72A 4HSPA 1V9PA 4HEDA 4H02A 3MZ5A 5J39A 4FNFA 2JA6B 4JBMA 3Q23A 3H15A 4MN3A 2X6GA 4EQ5A 4C3HB 4IURA 1ESRA 5I9PA 1HFNA 4YY3Q 1SMYC 3M3YH 4JI8Q 4K0KL 2D5DA 1U4LA 1YEZA 3DMUA 4KHPQ 3U58A 1EU3A 1EY9A 1S5ED 3BZCA 5JJKA 1FNVA 3P1HA 4LNQA 2J7ZA 3S9WA 2F0OA 1IYVA 1B9NA 5IGDA 3CU7A 5JPNC 2HDMA 2ZXRA 3EFXD 3K5MA 3C46A 4IUQA 3ULLA 1ZKOA 4WJ3M 1A3UA 3BVZA 1BCPC 2GA4B 1IXRA 2PZTA 3FPUB 4RKLA 3I55A 1S5BD 5C44B 1VF7A 4FF3A 4DNTB 2JJQA 4RGOS 1PH4A 3KLSA 1BO0A 1YI2A 4C3HG 3DHQA 3U50C 4DR7L 4L63B 5K5PA 2F0MA 3S2HB 1OXUA 4JYAL 2VUMB 1A2TA 3HKZB 1FL0A 3B6YA 4DA2A 4I65A 3TN2A 2ZTDA 1Y1WB 4JI3Q 3Q22A 3FKIG 4IFDG 3URYA 3CCEA 1PYBA 1LABA 2E2HB 2EY2A 3OHXC 1SJHD 4RA8A 3KYHC 4LF4Q 3HRZC 5EPKA 2J4XA 2B63H 3HOVG 1SXTA 1TS2A 4R8IA 1TWGH 3OOCA 3PUVA 4C3IH 1H9KA 4BBSG 3AFPA 2BDOA 4B3TL 2IWHA 1G6ZA 3VR5A 1ZYRD 3F8TA 5AFWA 5CC4A 1SN8A 1IBKL 2F4VL 1UEBA 2KCNA 1E24A 4DV7Q 5D3DA 4KJOA 2Z6BA 3HOYG 1PLFA 4N8FA 1GUWA 2F0PA 2IL8A 5FLXL 4QUFA 3GTKB 3MFGA 1XPRA 1CHPD 4DR3L 1TWCH 1F9PA 2I5HA 2OT2A 1YNXA 2K7VA 4ILWA 1IKMA 4QIWB 2KBNA 2NVYB 2TSSA 1JOOA 2TMPA 1KAAA 1PFSA 4L6TB 4DV7L 5IY0A 1QUQA 1PH5A 1FD7D 1IHZA 1HHVA 2XWJB 1J9OA 2DY7A 4BXXG 3I3CA 5KNDA 2VNUD 1RKNA 2NN6I 3UE0A 3E0JA 2N8NA 3JAMi 3SHLA 4QJFA 4EQOA 1GXDC 3L3OC 4JI1Q 2AQ1B 5KIXA 1GUOA 4NDXA 2CWAA 2F3IA 1V1OA 1I3QB 1C4QA 5C44H 3A8IE 4UHVA 1EZ6A 1DM0B 3HKZE 1P8LA 2WIIB 1K9MC 2D0OA 2YTXA 3S14B 4LMQD 2PQEA 2MHVA 1R4QB 5FLMH 5ELDA 5JEAG 1O80A 4FVMA 4MZ9A 4A3IG 4MNOA 2E5LL 2K32A 5I4DA 1GUNA 4ME3A 1SYFA 4K2LA 2IT1A 2Z0SA 2LS01 4DK6C 3A8JE 1PH2A 1O78A 5LMUQ 4DK3C 5IGFA 4A3EG 4DR7Q 2R7DA 3NTHA 1Y1VB 1Q1BA 1IL2A 3T13A 1KD1C 3I4MB 4BBSH 3QOLA 2NN6H 4YWMA 4KMUC 4P73A 2JP1A 2L0CA 1TS3A 3VR3A 4X62L 1AZPA 1F2YA 4C2MB 5D3IB 2FMCA 1EEID 5H1SE 2PQAB 2KJXA 1TWGB 4N9TA 3CP0A 1RODA 4ID6A 1JWUD 2QEJC 1XNRQ 4XDXA 1HZBA 1EFID 1YHBA 3GTOB 4TKOB 5EQ0A 1X56A 4CHTB 1I3QH 1D1IA 4DV3Q 4BBSB 1PH1A 2F0DA 1K8GA 1SYBA 3Q6SA 1V1PA 1XJVA 1AZQA 2IY5B 1TY0A 1N36L 2ICIA 1S40A 1LT3D 2A6ED 3CKIB 3MXPA 1QUQB 1TXYA 3NBHB 2F3VA 4A3BH 3RN5A 2UXCL 4BY1G 3VYUA 2NVXH 4UY8C 3TZDA 1XPUA 1EWCA 4RGTA 3I90A 1BBXC 5IYDH 4DF7A 3MXUA 1OXSC 4IN3A 1HZ9A 3WWVA 1HR0Q 1PRTB 2UXDQ 1F77A 2CQAA 3GD7A 3HFZB 4KKSA 2KHIA 1N32Q 2KECA 3HOXB 1VQ6A 4B08A 2MO1A 3FP9A 2PI2A 3NP8A 4RMFA 1D5MC 2F0GA 4DU9A 1TY2A 2WB1B 1UUPA 4MTNA 4JI4Q 5E4XA 4DR6L 2B3GA 1K8AC 2O2LD 3ERSX 4KD3A 2EYFA 3M9BA 1J5EQ 4BY1H 2ASBA 2KHSA 3S15B 1KDCA 3E5SA 3PIO3 5LMUL 4XYQA 1O7LA 3UDFA 4HIDA 1WCMH 1W6JA 5EKIA 3HOXH 4Q5VA 2OTJA 2O5IC 3AQQA 5IGEA 4NXML 1F9RA 4PMCA 3DEPA 1VQ5A 1A0IA 4FDBA 3ND8A 3KJOA 3OMGA 1SNPA 2EY5A 2G9HD 3S1MB 5CV8A 1JCKB 1K73C 2OXPA 1MKHA 1CQFA 2M2LA 1Y1VH 1J8IA 1S3OA 5CGKA 3S1NH 2WAQE 1FJGQ 1PRTC 2V4DA 1X65A 1WJJA 2QA4A 2RDGA 4B3MQ 4FXDA 3I73A 1I4RA 4EX5A 4FO2A 3Q24A 1H9SA 3T4AC 3W5OA 1A62A 4LWCA 5FLXc 1HNXL 4OWWB 2NN6G 2R6GA 4GNXB 1V1PB 1GJXA 1XTDA 3GTOH 1DONA 5M5YH 1Z9FA 2B8GA 5AJ3Q 1JMCA 1O7YA 1LTRD 2D9UA 2VZAA 2CCZA 1N8RC 3RZOB 1ICWA 1XTCD 5C6AA 1SEBD 1IL8A 1FR3A 3NXWA 2EYMA 2K05A 1MSGA 4HJ5A 4A3MH 3TP8A 2OWOA 1MBYA 3PUXA 1OTCA 4BBRB 3V96A 2GVAA 2WAQG 4I7AA 5C4XB 3F2UA 1U4MA 5IOCA 1JJCB 1EY0A 3UDGA 1I4PA 3MXNA 3PUYA 4OONA 2B2TA 5E4WC 4XXEA 1IBLQ 2A1AA 2RDHA 1CZWA 1GVPA 1I4XA 2C35B 1QG7A 3HZXA 3UI2A 3QB3A 1II3A 1CKNA 3GTPB 1D8LA 2B2YC 1YBYA 3HOUG 2HIXA 1B3QA 5M5XH 4YY3L 3DEOA 2UXDL 4CDCC 3KFUA 4DUZL 1EY4A 1BCPF 4DV0Q 2HCIA 4LF7Q 3CCVA 1N34L 4IFDJ 3U9OA 2K5QA 2JN4A 3BZDB 1X3EA 3OW7A 1E1TA 4B3TQ 3JAME 1DYQA 1STNA 4JI2L 2A74C 3RLOA 2BE5D 1H95A 2O4XA 3BVGA 4JI7Q 2JE6I 2H4OA 1EFWA 4H7BA 3I4NG 4RH6A 1GM5A 2NVTH 2K5WA 2YYZA 3GQBA 1VQMA 2VXWA 2ZXOA 2D2CC 3PCOB 2FFKB 3OTOQ 2K5HA 4DV1Q 1QVFA 4JOIA 3S24A 4WJ4A 5KRUA 1ET6A 3D8GA 1I4QA 2R93B 5C3EG 1UE5A 2Z8LA 4QB4A 5C4JB 3CPFA 1OXVA 4ZUJA 2HCCA 3I4NH 1D7QA 4BWGB 4A3EB 3RUZA 5C0XH 5DEHA 1HNZL 1SYDA 4DV5L 3Q0AA 3ONAB 1SE4A 3GV6A 4DR4Q 2E2DC 1K8OA 4AH6A 4UP7A 2G9DA 3D4RA 1UE7A 4KY7A 4DAPA 2BA1A 4C1NI 2K5NA 1BVSA 3IFDA 3DXJC 5FLMG 2KCTA 1ONLA 1TKWB 4A3MB 4HSVA 5CV7A 3PO2G 3MA2B 1NMGA 4BBRH 1KRTA 1N9WA 4ZK9B 1KTKA 3K7AH 1ENFA 1LT4D 1ENAA 4J6HA 1GO3E 4DKAC 3EVQA 3J7ZC 3K5OA 1YHQA 3T16A 2R3ZA 2K6AA 3FRPB 4AYBB 5KNCA 4DV5Q 3RLNA 3VYTA 4B9WA 2R92B 2KEDA 2JK8A 5DM73 2C9OA 4QUCA 2N49A 2Q2HA 4GLAC 1D5ZC 4XT3B 1JORA 2JA7G 2B2WA 3T1HL 2R61A 1TIID 3TZUA 4JI2Q 1IBLL 5F2DA 1SE8A 1B44D 4C3IB 4DR4L 4DR5Q 1DCZA 3DUZA 2JA9A 4LAAA 2QILA 2H1EA 4LF8Q 1W3SA 3SK5A 4P75A 2YTVA 2H5XA 4I7ZC 2EYOA 4K14A 2VQFL 2JA8G 1X3QA 4R4CA 2E2HH 1KQSA 1EYDA 4LF5L 2A68C 5M9OA 1IYJB 3ERQA 1CFMA 1NSNS 5DNFA 1D6EC 1E22A 2B63B 1RTOA 1SR3A 1B4OA 4KTAA 4LFBQ 2KENA 4DAVA 1UE6A 4Y7NB 3RZOH 4DV6L 1NR2A 3GTGH 1EY5A 2XIWA 1H9RA 3JC66 5LMNQ 2OCEA 1PH7A 1QB5D 4X65L 3HGBA 3A74A 3OW2A 1Y1VG 2E5LQ 2R93G 1JR0D 4GKKL 1I94Q 1SSOA 5BN5A 1N34Q 1HTPA 3K5NA 2GN5A 4AQYQ 5KNBA 4IPCA 1Q1EA 4NMZA 2K28A 2PCFB 1RDPD 3K0YA 4GKKQ 1G91A 2QEXA 4NXNQ 3D6WA 4P71A 1S4ZA 4A3JH 2EYHA 2RHSB 2J0TD 1ILPA 4CJ2C 4AQYL 4A3CH 1WVLA 3Q8DA 5IYBG 1CI3M 4AIMA 5E1FA 1LLRD 2RBMA 1SRUA 1L0WA 4JG2A 5LL6S 4KHVA 1MSHA 1SMXA 2HD3A 2HIVA 5IP7H 1HFGA 1QVCA 1QOHA 1EYGA 3CCSA 3H3VI 3S17B 1B3AA 2ENBA 1GHJA 4QGUA 1U0LA 3G7LA 4BY1B 5IP7G 3RZDB 1JB3A 1EZ8A 1FGUA 4X65Q 3QG1A 2Z1CA 3SEBA 4LF4L 3FKIB 4R1JA 3PMFA 4BA2I 3NHHA 4JC0A 2ZTCA 4BA1I 1WTHA 3GTKH 4KY6A 5EKLA 3PO2H 3HP3A 1DGSA 1U5KA 2F0SA 3CCUA 1C7YA 4A3BG 2OF1A 3ND9A 4A3MG 5FOBB 1F9SA 3NE5B 3K57A 3OYYA 4X66Q 4NXNL 4JOIC 1EYAA 5IP9H 4FF2A 1VQOA 3SR1A 2PNRC 1QILA 1SYCA 1LT5D 4PZ7A 5IGCA 2L55A 3IL8A 4OEMB 5LMNL 2WV6D 1XMOL 1STGA 2ZT9C 1SJED 4JI0L 4A3DG 1P16A 2N3SA 3R3OA 1YIJA 4PG3A 1DOMA 3CHBD 3NK9A 4C56C 5JJLA 1VQFA 4KK7A 1A8VA 2L1BA 3T1YQ 3AEVA 2VS1A 4KKUA 5FJ8G 2B63G 2RKSA 1PVOA 1FNWA 4O42A 4A93B 3C1FA 2K1BA 2EYJA 3RLFA 1TWHH 4CDFC 3UE1A 4HTHA 1B2TA 1Y8NB 1E0BA 2K03A 2B29A 4IZ8A 1Q7YC 4OHJA 1VQNA 2BE5C 2Z6KA 1CM9A 3BYYB 4DR1Q 2KUMA 4PZ8A 3FEWX 1YZ6A 2JA5B 1I50B 3KF8B 4G7OC 3NWSA 5EKKA 1KDBA 3HEJA 4JI0Q 3MC0B 2B2YA 1Z6HA 1VQ7A 5C4ZA 3WOFA 3OMCA 1EIFA 1YJ9A 4A75A 2K75A 2F52A 1UAPA 3VYRA 1PXUA 1YNND 5HY6A 3STBD 1F2MA 3LX0A 3J7AV 1NMFA 1FNUA 5C44G 3HOUH 1L2FA 3S1QH 1L0YB 1QZHA 2K04A 4X62Q 1LTAD 1TU2B 1SNMA 5CV6A 2BOSA 5E3FA 4DPGA 1STYA 2RHQB 1LT6D 1X3GA 1XXGA 2JA6H 5KYLA 3H0GH 3TP6A 1Q46A 4YWLA 4C3JB 3TDQA 5M3FH 1CSQA 5BN4A 1ICFB 1NAPA 2CFMA 4S3SA 3TP5A 2E2JH 2I0QA 4KLKA 2JA5G 4M8AA 1R9TB 1WD1A 3F2BA 4BBRG 2P5ZX 1BF4A 2A19A 3NSWA 4G4KA 2EJGC 1S5FD 3GV3A 5CV9A 4OO1I 1G291 1CSPA 3GTPH 1VCIA 4LW1A 4R9WA 2B2UC 4CKBA 4DV3L 3NTKA 4P74A 3P20A 1GUTA 3ULPA 3CXCA 2IX3A 4IO9A 1EY6A 5C3XA 1R4PB 4KJNA 3KK7A 3UDXA 3S2DB 1KDAA 2CKZB 5I6WA 3MXNB 2AUKA 2JSOA 5JVH3 4FF1A 4JCVE 5IWAQ 1H9MA 3TREA 1PZJD 4Z9CB 4XQNA 3QJYA 4C3IG 1CA5A 1G6PA 1PTOC 2F0HA 5J1ZA 2M9VA 1Q86C 4DUZQ 3K80C 4K6LA 4G7ZC 4ZKBB 3SK4A 1B9MA 4A76A 3S1NB 1TWHB 5IODA 1IKLA 4OX9Q 1NY4A 4ODGA 1NCVA 1KIXA 2B8FA 1EL0A 2FMMA 1RCVD 3KLSX 1EQRA 5EBDA 1PH9A 3R8BA 3TP7A 4DUYQ 4LF7L 2E74C 2C5CA 4MIUA 1SFOH 3FMCA 3H91A 4ABNA 1MJEA 1HA5A 4LUVA 2NZOA 2PW7A 1K8MA 5G3LF 4HMJA 1NBWA 3L9AX 4KHZA 3J7A5 3NTIA 2IPKD 4GN5A 4IJLA 2VUMG 2BH8A 4B3ML 1SFOB 2X69A 1NJIC 3VR2A 4DV6Q 3KOJA 2F4VQ 3M7GA 3OPOA 4J15A 5M3FG 1PH6A 3W1GA 3AU7A 3CAMA 1PFBA 4KN4C 2XVSA 2QW7A 3FPPA 2IW3A 4LF5Q 4O2DA 3DM1A 2UXBL 1TT2A 1VMCA 4OX9L 5GQOA 1X3PA 2O5JC 4IOAA 1HA6A 2F0WA 3K0XA 3NBHA 4F7XA 1W2BA 3PIOA 2XRSD 1VS0A 1KNAA 1EY7A 3VR4A 4FP5D 5A2QL 5ELFA 2LSSA 2R92G 3IFTA 2AUJD 2JA8B 3NQIA 5EPLA 2NTSA 5IWAL 1EIHA 1VQIA 4M1UB 3ZJYC 3CCRA 3H3VC 2E75C 2KQ3A 1ASZA 2Q2IA 4IUPA 2UU9Q 1RTNA 2VB2X 3U4VA 2YV5A 1SYGA 4O0AA 1NNXA 4PQXA 4PZ6A 5I9OA 3CQZB 1BCPD 1BDOA 1SNDA 3MXGA 4A3LH 1WTWA 4LF8L 4WFN3 1Q8KA 3TRZA 3VYSA 5ISRA 2K14A 2N88A 1BUVT 1KAWA 3BDLA 1MJCA 2EOTA 1KC8C 5M5WB 3E9HA 3EROA 4IOCA 3S1RH 2B2TC 1ZXTA 2JYOA 3A0JA 1YITA 1O7IA 1EQQA 1WYDA 4JI6Q 4H0LC 3PF5A 1S5CD 2OQKA 3CQZH 1T5XD 1MHWC 2F0QA 5KGUA 1L0XB 4DXFA 1D5XC 3OTOL 3CC4A 3CPWA 3ITPA 2F0EA 3BDOA 2KA7A 4H13C 4DNIA 2R7ZB 4DV4L 4DR5L 2L5TA 1T9HA 4POFA 1YNNC 3A55A 3FVQA 1YHAA 3MFYA 4A93G 3E9IA 2FXQA 3HOXG 3D6CA 2Q8IB 1HNZQ 4XQJA 3TBIB 1H9SB 2PZWA 2MO0A 3R2IA 3QR8A 3MEFA 2ID0A 2BH2A 4A3GG 2RF4A 4OIKA 2SNSA 1G2TA 3T1YL 1EOVA 4QIWE 3BS1A 1L1OA 4ZAIA 3SK8A 1QE6A 4RCOA 3H0GG 1AE3A 3DWQA 4POGA 4X3SA 1B50A 4BXXH 4A3BB 4PMWA 1CKMA 1HUMA 1DOLA 2Q2UA 1DOKA 4JK1C 1I4HA 5IE8A 1MI2A 1HZAA 3M4QA 3J7AF 1EUJA 3VDYA 1K28A 2BA0A 3L2PA 4FXGC 3J81E 3HOYB 3OWFA 1EWIA 5TSSA 4TSSA 2ZM6L 1K0SA 1J6QA 3X3NA 3M7NA 2R93H 1ILQA 4TQUS 4BY7H 1B1ZA 3OSOA 3PO3H 3TEHB 3CC7A 1L1OC 4RAUC 1XMOQ 4DR2L 3PO3G 3P75A 1PTOF 2B2VC 3PIP3 2ALYB 1TWAB 1I6HB 3BVMA 3KLRA 4LJZC 2LMCB 1IBML 1E1OA 1OXTA 4V0BA 5HURA 3KBGA 2EJMA 1A63A 2KOLA 2CQOA 5EGTA 2F0FA 3VR6A 4JYAQ 3I4MG 2XGTA 3G48A 2CH4A 1Z7TA 5IIFA 3KDFA 1SBBB 2XRQD 1VQDA 3TSSA 2K5VA 1TVXA 1AFPA 1H9JA 3TMEA 5FLXE 5JEAH 2YU9H 5C5MA 1EIGA 1I94L 2PI2E 2B2UA 3NELA 3L0OA 2AMCB 2XWBB 2R92H 3O13A 4UP8A 1RL2A 4DR2Q 3M4OB 5I6YA 1HNXQ 2NTTA 4P2CB 2EE1A 1Q82C 1Y1WH 3KF6B 5L37A 2JA7H 1Q81C 4A3JB 1KL9A 2Q2TA 4PV1C 3MAQA 4LK1C 5CMDA 4V190 2UUBQ 1WTXA 5G3LD 4CDEC 3CF5A 4JI1L 3RN2A 1MGSA 1BNZA 5A35A 3CMAA 3HOWG 2PPBC 2R7FA 3BU2A 3SVMA 2ES2A 2OEOA 3STBC 1MD2D 4UPAA 2YTYA 1Y1WG 2WP8J 2ZM6Q 4QY7A 4NB3A 4NW2A 4CKCA 4JVZA 4C3JG 5DLQE 2UUCQ 1ASYA 2A73B 1KRSA 4X6AH 2ZJRA 2Z9HA 1PYSB 5FO7B 5K36G 4HCSA 1VQLA 4LF9Q 3HOZH 4J1MA 1AEXA 1WI5A 4KY5A 3MEHA 3G6EA 2F0IA 2IHEA 1HZCA 3OIPA 2Z6KC
chains in the Genus database with same CATH topology
1SE3A 1G8ZD 4BS9A 1PMRA 3D4DA 2HUGA 3NPPA 2F0NA 1CHQD 1LTID 3M3YB 3HG9A 3DWAA 4EVOA 4IFDH 3KF8A 5JEAJ 1EQVA 2NBFA 4IUVA 4FF4A 2E2JB 5FO9B 3A7AB 3K5LA 1LO5D 5ELEA 2SOBA 2NYZD 4F88A 4QMGA 1NUCA 4K6DA 2MP1A 5FK9C 1TR5A 2MGSA 1GUGA 1LTSD 3IKJA 4HCEA 1G2SA 4UAIA 3R2TA 2BDNA 5CV5A 1LV9A 1Q12A 5FO8B 5EBCA 2IX0A 1QCBD 5M5XB 3CRLC 4HAEA 2Z4HA 2EZVA 3GTJB 2LFNA 2FJ2A 2PZUA 1QNKA 2HQEA 1JOKA 1SNOA 3MVVA 1E2ZA 3SXHA 3QIAA 2KCCA 4R8NA 1QWYA 2NVXB 4GZYC 1GHKA 1T5EA 4ZLTF 1E2WA 2LKVA 4KV6A 3GO5A 3VA7A 3KUPA 1TWCB 1EWHA 5I2XA 1O7ZA 2AWNA 5JVG3 2A68D 2WKCA 2Y0SB 3T51B 1UNSA 2JXMB 1PZID 2RA4A 1XWEA 1AW7A 1U9RA 4K8JA 3SDZA 2A69C 4X3TA 1LACA 3EA6A 4XTCS 1PTOH 1FGBD 2NWGA 3L7ZC 1IW7C 3WOEA 5CBAE 1WTQA 1CZGA 1KLGD 3K7AB 4CKEA 2ZXPA 2NVTB 1ESFA 2QF7A 4U673 3R93A 4WRDA 2AQ2B 2I07B 1SNCA 2F0JA 4C1NK 4K8IA 2RDFA 3D3RA 4TRDA 3AMUA 3HOZB 4OO1G 4X3UA 2F03A 4Q0FA 4X3KA 4CGYB 2QDBA 3NQTA 2DN8A 1HXYD 4MHEA 3BYTB 3W3AA 4ZYSA 3K58A 1A2UA 2EDGA 2L4NA 1PFNA 1SNQA 2PYKA 1SAPA 3EQLC 4IUNA 1U4RA 1PRTF 4G7HC 5C4HA 1GUSA 5DM63 3S1RB 1HQRD 2K01A 3PO2B 5CBEE 3D31A 4EQPA 3C1EA 4IUUA 4K2KA 3I70A 4RCNA 4EGVA 1BXTA 1LTTD 2SEBD 2QCPX 5IGGA 1Y8PB 4OGQC 2A5HA 4XQQA 2MUYA 3GP7A 3RMHA 3IAYA 2RSOA 2A6EC 5K36H 1QNUA 1JQYD 1PDQA 1HQMC 1EU4A 4KKTA 1LTBD 3A54A 1TQOA 5C5LA 1PTOB 4U68A 3DWPA 5CYUA 3T56B 4OIJA 5FKAC 5C3WA 1FYCA 4OO1H 2JEBI 3E6ZX 5C3EB 4XT1B 4HMIA 3V05A 1B53A 1ML0D 1QJOA 3MWYW 3C2PA 1X32A 3A56A 2EY1A 3K6OA 2KEEA 1KABA 3I4NB 1XYIA 3PV0A 1A3VA 1SMYD 1VMPA 4KI0A 1YNJD 1RD9D 1WTPA 1EYCA 3S16B 5IT9L 1W6KA 4RHRA 1D1KA 4RWSC 3J81L 1I4GA 4NP5A 4QF4A 2CHBD 5A2QE 2EPBA 1UEAB 3W2DA 1WTRA 1U4PA 3BDCA 4PMBA 2E2IB 4IUTA 2IJ0A 2MJ8A 5CR3A 3M85A 4FXKC 1AN8A 2D62A 2VB3X 4A3IB 3SE0A 2E76C 1CK1A 1JWSD 2JEAI 1PRTD 4BY7B 3OIQA 3CRKC 3H09A 2EVBA 1STHA 2KVMA 3A7LA 1STEA 1V43A 4HN7A 5ELCA 1NR4A 2AQ3B 2B2WC 2L12A 2F0TA 1EEFD 2CVRA 1STAA 1XX8A 5I2YA 4G57A 2EYPA 1YNJC 4DGZA 2A69D 1S5DD 2Z4IA 3GTGB 4JBWA 2PO4A 1LTGD 2X6LA 1Q3LA 1ET9A 4KN7C 2XN9C 1DD2A 1RF2D 2JA7B 2Q8TA 5COYA 1BQQT 4ZUIA 1M4VA 4WORA 3QOJA 1BR9A 5D65A 3MHBA 5CV4A 1Y8OB 1ZYRC 3ZYYX 5C0XI 2DNEA 3PUWA 2K5DA 2NZ1D 4OL7A 4XYOA 2PMZB 3FDTA 4ZKCB 4HR7B 4WJWA 1PTOD 2F0KA 2EY6A 2L11A 4DAYA 4K5XA 4EQNA 2XSCA 4RHSA 3LWEA 5CORA 1JOQA 2B39A 3G6JB 3H6MA 1Z47A 4XIGS 4DK1A 3J80L 3SK6A 2NVQB 1HPCA 3VA5A 5KYIA 5ELBA 3X3MA 5C0XG 2NB0A 4ZRZA 1EOTA 4J8QA 2Q8RE 4O1NA 5EPJA 1AP0A 2F0LA 3N52A 5EJWA 1PFMA 1BCPB 1F9QA 1ZEQX 5LL6X 4B9XA 1VDZA 1Y69U 5M3MB 2PW5A 3RD4A 4K5WA 1E2VA 5C0XJ 3HOVB 1EQTA 4IALA 3T53B 3S1QB 3AB9A 4F87A 4IFDI 4RGNA 2EJFC 3J80E 3OWEB 1A15A 4A3KB 1CTMA 3J7YW 1SDFA 1OO9B 2F1MA 2SDFA 2WAQB 3H0GB 5DAUA 4IQZA 4ME5A 3H94A 2EXZA 3GTLB 4L8JA 2M00A 2CW0C 4A3DB 1WCMB 1A3TA 1K83B 5JJZA 3EJIA 2N55A 3MTSA 3NWTA 1DJRD 2A6HC 5HGTA 2WINB 3LWUA 1CA6A 2RSNA 3U9SA 1PZKD 1M8AA 4QCLA 2HDLA 4N9PA 2RVLA 4CJ0B 1IW7D 2FINB 2A6HD 1WTOA 1ENCA 2LY7A 5LHY1 2EYLA 4DFAA 2CW0D 2ICEC 4F8MA 1C48A 3QWNA 4YIJA 2I46A 3KBXA 5IT9E 5T1GA 3GTMB 1JICA 2F0UA 1CQVA 1JC7A 4DNRB 3M4YA 5JOBA 4PNYA 3HOUB 4RGMA 1I6VC 1KNEA 4H44C 3D4WA 3C3LA 1JWMD 3QO2A 5J22A 2WKDA 4ULLA 3I8ZA 5KEEA 1KLUD 2F4IA 5M3FB 1SYEA 1EY8A 3LNNA 2QKIC 2B2VA 3N6RA 1TS5A 1IYUA 2RQXA 3I4LA 1HCZA 4RFBA 2DNCA 4KD4A 4CJ1B 1JE4A 5D14A 2FHTA 3HOWB 1F2ZA 3I91A 1D2BA 2DY8A 1TWFB 1BOSA 1RJTA 2L9HA 4A3FB 1V8QA 3WDNA 2YU9B 5JPMC 4E6IA 1DXMA 3BG3A 1STBA 3V2TA 4DN4M 1A6XA 4DK0A 1WD0A 1C8CA 2NUCA 2XNAC 2SNMA 1Q90A 5NUCA 1HRJA 1VF5C 1F2LA 2WACA 1GOZA 3JAML 1PYWD 3K59A 2K33A 1TS4A 3PUZA 2AWOA 1HUNA 1RHPA 1Q8IA 4FYDA 4UDUC 1WTVA 1HTLD 1CT1D 5IGBA 5M5YB 3PO3B 2MPMA 3A8KE 5T1IA 4A3GB 5BN3A 3NBIA 4DXGA 5JAVA 3GTQB 2IX1A 1OXXK 3HS0C 3P7JA 4CBVA 2F0VA 3NUCA 4NKLA 4K5VA 4ZQ3A 2F3WA 2BCOA 4RKBA 1DZ1A 1SE2A 3I72A 4HSPA 4HEDA 3MZ5A 5J39A 4FNFA 2JA6B 3Q23A 4MN3A 2X6GA 4C3HB 4IURA 1ESRA 5I9PA 1HFNA 1SMYC 2D5DA 1U4LA 3DMUA 1EU3A 1EY9A 1S5ED 1FNVA 3P1HA 2J7ZA 3S9WA 2F0OA 1IYVA 1B9NA 5IGDA 3CU7A 5JPNC 2HDMA 2ZXRA 3EFXD 3K5MA 3C46A 4IUQA 1ZKOA 1A3UA 3BVZA 1BCPC 2GA4B 3FPUB 2PZTA 4RKLA 1S5BD 5C44B 1VF7A 4FF3A 4DNTB 4RGOS 3KLSA 1BO0A 4C3HG 3DHQA 4L63B 5K5PA 2F0MA 3S2HB 1OXUA 2VUMB 1A2TA 3HKZB 4DA2A 4I65A 3TN2A 1Y1WB 3Q22A 4IFDG 3URYA 1LABA 2E2HB 2EY2A 3OHXC 1SJHD 4RA8A 3HRZC 5EPKA 2J4XA 1SXTA 1TS2A 4R8IA 3OOCA 3PUVA 1H9KA 2BDOA 2IWHA 1G6ZA 3VR5A 1ZYRD 5AFWA 5CC4A 2KCNA 5D3DA 4KJOA 1PLFA 1GUWA 2F0PA 2IL8A 5FLXL 4QUFA 3GTKB 3MFGA 1CHPD 1F9PA 2OT2A 2K7VA 4ILWA 1IKMA 4QIWB 2NVYB 2TSSA 1JOOA 2TMPA 1KAAA 4L6TB 1FD7D 1IHZA 1HHVA 2XWJB 1J9OA 2DY7A 2VNUD 3I3CA 5KNDA 1RKNA 2NN6I 3E0JA 3SHLA 4EQOA 1GXDC 3L3OC 2AQ1B 5KIXA 1GUOA 4NDXA 1V1OA 1I3QB 1C4QA 3A8IE 1EZ6A 1DM0B 2WIIB 3S14B 4LMQD 2PQEA 2MHVA 1R4QB 5ELDA 5JEAG 1O80A 4FVMA 2K32A 5I4DA 1GUNA 1SYFA 4K2LA 2IT1A 2LS01 3A8JE 1O78A 5IGFA 3NTHA 1Y1VB 1Q1BA 3T13A 3I4MB 3QOLA 2NN6H 4KMUC 2JP1A 2L0CA 1TS3A 3VR3A 1AZPA 1F2YA 4C2MB 5D3IB 2FMCA 1EEID 2KJXA 1TWGB 4N9TA 1RODA 4ID6A 1JWUD 2QEJC 4XDXA 1EFID 3GTOB 4TKOB 5EQ0A 4CHTB 1D1IA 4BBSB 2F0DA 1SYBA 3Q6SA 1V1PA 1AZQA 1TY0A 2ICIA 1LT3D 2A6ED 3CKIB 3MXPA 2F3VA 3VYUA 3TZDA 1EWCA 4RGTA 3I90A 1BBXC 4DF7A 3MXUA 1OXSC 4IN3A 1PRTB 1F77A 2CQAA 3GD7A 4KKSA 2KECA 3HOXB 4B08A 3NP8A 1D5MC 2F0GA 4DU9A 1TY2A 2WB1B 1UUPA 5E4XA 2O2LD 4KD3A 2EYFA 2KHSA 3S15B 1KDCA 3E5SA 3PIO3 4XYQA 1O7LA 1W6JA 5EKIA 4Q5VA 2O5IC 5IGEA 1F9RA 4PMCA 3DEPA 3ND8A 3OMGA 1SNPA 2EY5A 2G9HD 3S1MB 5CV8A 1JCKB 2OXPA 1J8IA 1CQFA 2M2LA 5CGKA 1PRTC 2V4DA 4FXDA 2RDGA 3I73A 1I4RA 4FO2A 3Q24A 1H9SA 3T4AC 2NN6G 2R6GA 1V1PB 1GJXA 1DONA 2B8GA 1O7YA 1LTRD 2D9UA 3RZOB 1ICWA 1XTCD 5C6AA 1SEBD 1IL8A 1FR3A 3NXWA 2EYMA 2K05A 1MSGA 3TP8A 1MBYA 3PUXA 4BBRB 3V96A 5C4XB 3F2UA 1U4MA 5IOCA 1EY0A 1I4PA 3MXNA 3PUYA 4XXEA 2B2TA 5E4WC 2RDHA 1CZWA 1I4XA 1QG7A 3HZXA 3UI2A 3QB3A 1II3A 3GTPB 2B2YC 3DEOA 1EY4A 1BCPF 2HCIA 4IFDJ 3U9OA 2K5QA 3BZDB 3OW7A 3JAME 1DYQA 1STNA 2A74C 2BE5D 2O4XA 3BVGA 2JE6I 2H4OA 4H7BA 4RH6A 2K5WA 2YYZA 3GQBA 2VXWA 2ZXOA 2D2CC 2FFKB 5KRUA 1ET6A 3D8GA 1I4QA 2R93B 2Z8LA 4QB4A 5C4JB 1OXVA 4ZUJA 2HCCA 4BWGB 4A3EB 3RUZA 5C0XH 5DEHA 1SYDA 3Q0AA 3ONAB 1SE4A 3GV6A 1K8OA 2E2DC 2G9DA 3D4RA 4KY7A 4DAPA 4C1NI 2BA1A 3IFDA 3DXJC 1ONLA 1TKWB 4A3MB 4HSVA 5CV7A 3MA2B 4ZK9B 1KTKA 1ENFA 1LT4D 1ENAA 4J6HA 3EVQA 3K5OA 3T16A 2R3ZA 2K6AA 3FRPB 4AYBB 5KNCA 3VYTA 4B9WA 2R92B 2KEDA 5DM73 2C9OA 4QUCA 1D5ZC 4XT3B 1JORA 2B2WA 2R61A 1TIID 3TZUA 5F2DA 1B44D 4C3IB 1DCZA 3DUZA 4LAAA 2QILA 2H1EA 3SK5A 4I7ZC 2EYOA 4K14A 1X3QA 1EYDA 2A68C 5M9OA 3ERQA 1CFMA 1NSNS 5DNFA 1D6EC 2B63B 1RTOA 1B4OA 4KTAA 4DAVA 4Y7NB 1NR2A 1EY5A 2XIWA 1H9RA 1QB5D 3HGBA 1JR0D 1SSOA 5BN5A 1HTPA 3K5NA 5KNBA 1Q1EA 4NMZA 2K28A 2PCFB 1RDPD 3K0YA 1G91A 3D6WA 1S4ZA 2EYHA 2J0TD 1ILPA 4CJ2C 1WVLA 1CI3M 5E1FA 1LLRD 2RBMA 5LL6S 4KHVA 1MSHA 1HFGA 1QOHA 3S17B 1B3AA 2ENBA 1GHJA 3G7LA 4BY1B 3RZDB 1JB3A 1EZ8A 3QG1A 2Z1CA 3SEBA 3FKIB 3PMFA 4BA2I 3NHHA 4BA1I 4KY6A 5EKLA 3HP3A 2F0SA 2OF1A 3ND9A 5FOBB 1F9SA 3NE5B 3K57A 1EYAA 4FF2A 3SR1A 2PNRC 1QILA 1SYCA 1LT5D 5IGCA 2L55A 3IL8A 2WV6D 1STGA 2ZT9C 1SJED 3R3OA 1DOMA 3CHBD 3NK9A 4C56C 4KK7A 2L1BA 4KKUA 2RKSA 1FNWA 4O42A 4A93B 3C1FA 2K1BA 2EYJA 3RLFA 4HTHA 1B2TA 1Y8NB 1E0BA 2K03A 4IZ8A 4OHJA 2BE5C 1CM9A 3BYYB 2KUMA 3FEWX 2JA5B 1I50B 4G7OC 3NWSA 5EKKA 1KDBA 3HEJA 3MC0B 2B2YA 1Z6HA 5C4ZA 3WOFA 3OMCA 1UAPA 3VYRA 1PXUA 1YNND 1F2MA 3LX0A 3J7AV 1FNUA 1L0YB 2K04A 1LTAD 1TU2B 1SNMA 5CV6A 2BOSA 5E3FA 1STYA 1LT6D 1XXGA 5KYLA 3TP6A 4C3JB 3TDQA 5BN4A 4S3SA 1NAPA 3TP5A 4M8AA 1R9TB 1WD1A 1BF4A 3NSWA 4G4KA 2EJGC 1S5FD 3GV3A 5CV9A 4OO1I 1G291 1VCIA 4R9WA 2B2UC 4CKBA 3NTKA 3P20A 1GUTA 2IX3A 1EY6A 5C3XA 1R4PB 4KJNA 3KK7A 3S2DB 1KDAA 5I6WA 2AUKA 2JSOA 5JVH3 4FF1A 1H9MA 1PZJD 4Z9CB 4XQNA 3QJYA 4C3IG 1CA5A 1PTOC 2F0HA 5J1ZA 2M9VA 4K6LA 4G7ZC 4ZKBB 3SK4A 1B9MA 3S1NB 1TWHB 5IODA 1IKLA 4ODGA 1NCVA 2B8FA 1EL0A 2FMMA 1RCVD 3KLSX 5EBDA 3R8BA 3TP7A 2E74C 2C5CA 4MIUA 3FMCA 3H91A 4ABNA 1HA5A 2PW7A 1K8MA 5G3LF 4HMJA 3L9AX 4KHZA 3NTIA 2IPKD 1SFOB 2X69A 3VR2A 3M7GA 3OPOA 3AU7A 1PFBA 4KN4C 2XVSA 3FPPA 2IW3A 3DM1A 1TT2A 1VMCA 1X3PA 2O5JC 1HA6A 2F0WA 3NBHA 4F7XA 2XRSD 1KNAA 1EY7A 3VR4A 4FP5D 5A2QL 5ELFA 3IFTA 2AUJD 2JA8B 3NQIA 5EPLA 2NTSA 1EIHA 4M1UB 3H3VC 2E75C 2KQ3A 4IUPA 1RTNA 2VB2X 1SYGA 4PQXA 5I9OA 3CQZB 1BCPD 1BDOA 1SNDA 3MXGA 1WTWA 4WFN3 3VYSA 5ISRA 2N88A 1BUVT 3BDLA 2EOTA 5M5WB 3EROA 2B2TC 1ZXTA 2JYOA 4H0LC 1S5CD 1T5XD 2F0QA 5KGUA 1L0XB 4DXFA 1D5XC 3ITPA 2F0EA 3BDOA 2KA7A 4H13C 2R7ZB 2L5TA 1YNNC 3A55A 3FVQA 3MFYA 3D6CA 2Q8IB 4XQJA 3TBIB 1H9SB 2PZWA 3R2IA 2ID0A 4OIKA 2SNSA 1G2TA 3BS1A 4ZAIA 3SK8A 1QE6A 4RCOA 3DWQA 4X3SA 1B50A 4A3BB 4PMWA 1HUMA 1DOLA 1DOKA 4JK1C 1I4HA 1MI2A 3J7AF 2BA0A 4FXGC 3J81E 3HOYB 3OWFA 5TSSA 4TSSA 3X3NA 3M7NA 1ILQA 4TQUS 1B1ZA 3OSOA 4RAUC 1PTOF 2B2VC 3P75A 3PIP3 1TWAB 1I6HB 3BVMA 3KLRA 4LJZC 2LMCB 1OXTA 4V0BA 5HURA 3KBGA 2EJMA 2KOLA 5EGTA 2F0FA 3VR6A 1Z7TA 5IIFA 1SBBB 2XRQD 3TSSA 1TVXA 1AFPA 1H9JA 3TMEA 5FLXE 5JEAH 5C5MA 1EIGA 2B2UA 2XWBB 3O13A 3M4OB 5I6YA 2NTTA 4P2CB 2EE1A 4A3JB 4PV1C 3MAQA 4LK1C 5CMDA 4V190 1WTXA 5G3LD 1MGSA 1BNZA 5A35A 2PPBC 3SVMA 2OEOA 1MD2D 2WP8J 4NW2A 4CKCA 4C3JG 2A73B 5FO7B 5K36G 4HCSA 4J1MA 1AEXA 4KY5A 3MEHA 2F0IA 3OIPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2MJ8 A;  5CBE E;  4ZLT F;  1RTO A;  3N52 A;  1B4O A;  5EJW A;  1CA5 A;  1KNE A;  1PFM A;  2N88 A;  2VXW A;  1DOM A;  4RA8 A;  2JP1 A;  1AZP A;  2MPM A;  3QO2 A;  2EOT A;  2FFK B;  2L1B A;  4IUU A;  1NR2 A;  5T1I A;  1AP0 A;  4ZKB B;  2B2T C;  1ZXT A;  2JYO A;  1F9Q A;  4O42 A;  4RAU C;  2XIW A;  5EPK A;  2K1B A;  3KUP A;  2HUG A;  3I8Z A;  4R8I A;  1IKL A;  2B2V C;  3P7J A;  1ROD A;  1O7Z A;  1NCV A;  1EL0 A;  2FMM A;  2KVM A;  1B2T A;  1E0B A;  2K03 A;  4XDX A;  1DON A;  1G6Z A;  2HCC A;  5EQ0 A;  1NR4 A;  2B2V A;  2B2W C;  2L12 A;  1CM9 A;  5AFW A;  1SSO A;  1EQT A;  2KUM A;  2KOL A;  1O7Y A;  2RSO A;  3ONA B;  1DZ1 A;  2D9U A;  2CVR A;  3GV6 A;  1XX8 A;  2RA4 A;  4HED A;  4IUV A;  3Q6S A;  1A15 A;  1PLF A;  2B2Y A;  2K28 A;  3H91 A;  2IL8 A;  1ICW A;  1SDF A;  1TVX A;  1AZQ A;  1PDQ A;  4X3T A;  4QUF A;  1IL8 A;  2SDF A;  3IFD A;  2X6L A;  4CJ1 B;  1Q3L A;  4MN3 A;  2X6G A;  1JE4 A;  1EIG A;  2K05 A;  1F9P A;  1MSG A;  2NYZ D;  1ESR A;  2B2U A;  4IUR A;  1G91 A;  1HFN A;  3D6W A;  5D14 A;  2FHT A;  2NWG A;  4HSV A;  1IKM A;  5CBA E;  1S4Z A;  3I91 A;  2Q8T A;  2MP1 A;  4U68 A;  5COY A;  1WTQ A;  2DY8 A;  2MGS A;  4ZK9 B;  1ILP A;  4CJ2 C;  3TZD A;  1RJT A;  1U4L A;  2EE1 A;  5JJZ A;  4OIJ A;  1WVL A;  2N55 A;  3F2U A;  1U4M A;  3I90 A;  3MTS A;  5D65 A;  2K04 A;  1BBX C;  2L9H A;  4OIK A;  1HHV A;  1J9O A;  2R3Z A;  2X69 A;  3R93 A;  1G2T A;  2DY7 A;  1G2S A;  3I3C A;  1MSH A;  4UAI A;  5CMD A;  2B2T A;  5E4W C;  1HFG A;  4ZAI A;  1WTX A;  2BDN A;  2KED A;  5EPJ A;  1PFB A;  1QE6 A;  1B3A A;  1LV9 A;  1QG7 A;  2KEC A;  1MGS A;  2J7Z A;  2NZ1 D;  4XT1 B;  1CA6 A;  2RSN A;  4QUC A;  3G7L A;  3UI2 A;  4X3S A;  1B50 A;  1B53 A;  3DM1 A;  1BNZ A;  1ML0 D;  2B2Y C;  2HDM A;  3MWY W;  4XT3 B;  1M8A A;  4IUQ A;  1VMC A;  1X32 A;  3FDT A;  4ZKC B;  3SVM A;  1HUM A;  1NAP A;  1X3P A;  4X3U A;  3FPU B;  2HDL A;  2B2W A;  5E4X A;  1HA6 A;  1DOL A;  2KEE A;  1DOK A;  2RVL A;  4CJ0 B;  4DN4 M;  2FIN B;  4X3K A;  3DEO A;  2L11 A;  1KNA A;  4HAE A;  1WD1 A;  1WTO A;  4NW2 A;  1WD0 A;  1C8C A;  1BF4 A;  3HP3 A;  1XYI A;  1GUW A;  2FJ2 A;  3GV3 A;  1MI2 A;  4MHE A;  1F9S A;  1BO0 A;  1QNK A;  2HCI A;  4LMQ D;  4R9W A;  5EPL A;  1VMP A;  1HRJ A;  2H1E A;  5EKI A;  1EIH A;  3LWE A;  2B2U C;  5COR A;  1WTP A;  1O80 A;  2L4N A;  1F2L A;  4IUP A;  1PFN A;  1SAP A;  4RWS C;  1F9R A;  3KBX A;  1RTN A;  3DEP A;  1U4R A;  4HCS A;  5T1G A;  1X3Q A;  1JIC A;  3IL8 A;  3TN2 A;  2EPB A;  1WTR A;  1U4P A;  1HUN A;  1ILQ A;  1EOT A;  1RHP A;  2Q8R E;  4IUT A;  2M2L A;  5DNF A;  2K01 A;  1WTW A;  1J8I A;  1WTV A; 
#chains in the Genus database with same CATH topology
 1SE3 A;  3K8A A;  3GTL H;  3F1Z A;  3F2C A;  3H3V H;  1G8Z D;  4BS9 A;  3LGJ A;  1PMR A;  2UUA L;  1HJP A;  3D4D A;  2HUG A;  3NPP A;  3F2D A;  2F0N A;  4JI8 L;  3RNU A;  1CHQ D;  1NTG A;  4OEL B;  1LTI D;  2RCN A;  3M3Y B;  3HG9 A;  3DWA A;  4EVO A;  4IFD H;  3KF8 A;  5JEA J;  3CME A;  4CDD C;  1YVC A;  1EQV A;  4MTK A;  5GAH C;  2NBF A;  3HOZ G;  4IUV A;  4FF4 A;  2E2J B;  5FO9 B;  4X64 L;  2Y0S E;  3S14 H;  3A7A B;  4B3S L;  3K5L A;  2VQF Q;  4TVA B;  1LO5 D;  5E7N A;  5ELE A;  2SOB A;  3K81 C;  2NYZ D;  4F88 A;  4QMG A;  1NUC A;  4K6D A;  4A3F G;  2MP1 A;  5FK9 C;  3M4O H;  1TR5 A;  2MGS A;  1GUG A;  1LTS D;  3IKJ A;  3S15 H;  4HCE A;  1G2S A;  4UAI A;  3R2T A;  2BDN A;  5CV5 A;  4GOP A;  3S2H H;  1LV9 A;  1Q12 A;  5FO8 B;  3JAM c;  1X54 A;  5EBC A;  2LXJ A;  2IX0 A;  1QCB D;  2NZH A;  1N32 L;  1JJ2 A;  1IZ6 A;  1NE3 A;  5M5X B;  3S17 H;  2EIF A;  3CRL C;  1XNQ Q;  4HAE A;  2JQO A;  2Z4H A;  2EZV A;  3GTJ B;  2KCM A;  2LFN A;  2FJ2 A;  2PZU A;  2VL6 A;  3E0E A;  4QQB X;  1QNK A;  2CWP A;  2HQE A;  2UXC Q;  1JOK A;  1SNO A;  3MVV A;  1E2Z A;  3SXH A;  4P72 A;  3QIA A;  1AE2 A;  4HIO A;  2KCC A;  1WOC A;  4R8N A;  1QWY A;  3GTQ H;  3CW2 C;  2NVX B;  4GS3 A;  3J80 i;  4GZY C;  2UUB L;  1GHK A;  1T5E A;  4ZLT F;  1E2W A;  2LKV A;  4DUY L;  4KV6 A;  2MQH A;  3HOV H;  3GO5 A;  1XNR L;  4LFB L;  1FJG L;  3VA7 A;  2K50 A;  3KUP A;  2UXB Q;  1TWC B;  2R7Z H;  4JPB W;  2G5D A;  1EWH A;  5I2X A;  1O7Z A;  1XMQ Q;  3I56 A;  4ALP A;  4AYB G;  2AWN A;  5JVG 3;  4LFA L;  2A68 D;  1VQB A;  2WKC A;  2Y0S B;  3T51 B;  1UNS A;  2JXM B;  3J80 c;  1PZI D;  5C4X H;  2RA4 A;  2ZJP A;  1XWE A;  4R4O A;  1AW7 A;  1U9R A;  4K8J A;  3EN2 A;  3SDZ A;  4A3I H;  2A69 C;  4X3T A;  2VW9 A;  1TWF H;  1LTL A;  4YHH L;  1LAC A;  3EA6 A;  1SRO A;  1M1K C;  4YCU A;  4XTC S;  1PTO H;  1FGB D;  2NWG A;  3L7Z C;  1IW7 C;  3WOE A;  5CBA E;  1WTQ A;  3M4P A;  4YCV A;  1CZG A;  1KLG D;  3K7A B;  1XPO A;  4CKE A;  4B3R Q;  2ZXP A;  2NVT B;  1PHJ A;  2XTI A;  3UDI A;  1ESF A;  2QF7 A;  4U67 3;  3R93 A;  5HGQ A;  1QVG A;  1BBU A;  4WRD A;  2AQ2 B;  2I07 B;  4OWX B;  1SNC A;  2F0J A;  4C1N K;  1XMQ L;  3D0F A;  2JA6 G;  4GNX C;  2LXK A;  4K8I A;  2RDF A;  2VQE L;  3D3R A;  4TRD A;  3AMU A;  3HOZ B;  3EIV A;  4OO1 G;  4X3U A;  2E8G A;  2F03 A;  4A3G H;  4Q0F A;  4HJ9 A;  4X3K A;  4CGY B;  2QDB A;  4YCW A;  4A3J G;  2DJF C;  3I7F A;  3NQT A;  2DN8 A;  1HXY D;  4MHE A;  3BYT B;  3W3A A;  1VQ4 A;  1VQH A;  4ZYS A;  3K58 A;  1A2U A;  2EDG A;  4HIM A;  2L4N A;  1PFN A;  4R4T A;  1SNQ A;  2PYK A;  1SAP A;  3EQL C;  1XNQ L;  4IUN A;  1HNW L;  1U4R A;  3K7U C;  3G4S A;  4UP9 A;  4ZCK A;  1PRT F;  5C4X G;  4G7H C;  5C4H A;  1GUS A;  1HH2 P;  3DM3 A;  5C4J H;  5LMN W;  5DM6 3;  1N33 Q;  3S1R B;  1HQR D;  2K01 A;  2L15 A;  3PO2 B;  5CBE E;  3D31 A;  5GAD C;  5C3E H;  5J3B A;  3GTM H;  4EQP A;  3C1E A;  2MFI A;  4IUU A;  3RR5 A;  4K2K A;  3I70 A;  4RCN A;  4EGV A;  1BXT A;  3TQY A;  4GN3 B;  1LTT D;  2SEB D;  2QCP X;  5IGG A;  1Y8P B;  4OGQ C;  3BJU A;  2A5H A;  4K0K Q;  1HR0 W;  4XQQ A;  2MUY A;  1RIP A;  5BR8 L;  3J81 c;  4JI6 L;  2I5L X;  3GP7 A;  1HNW Q;  4A3L G;  3RMH A;  3IAY A;  2Y0S G;  2RSO A;  2A6E C;  4Y52 H;  1N36 Q;  1B8A A;  3NEM A;  5K36 H;  1QNU A;  1JQY D;  1PDQ A;  1HQM C;  1EU4 A;  4YWK A;  4KKT A;  1LTB D;  3A54 A;  1TQO A;  5C5L A;  1PTO B;  2RCF A;  4U68 A;  1X3F A;  3DWP A;  2ZJQ A;  1Y14 B;  3PSI A;  5CYU A;  2E2I H;  2VQE Q;  3T56 B;  4OIJ A;  4DV1 L;  4X64 Q;  5FKA C;  1LM0 A;  2D0P A;  2K52 A;  3GTJ H;  4DV0 L;  1HR0 L;  5C3W A;  1FYC A;  4OO1 H;  1VQE A;  3HOW H;  2JEB I;  2UUA Q;  3E6Z X;  5C3E B;  1C0A A;  3CCL A;  4XT1 B;  2GVB A;  2ZTE A;  2CH4 W;  4HMI A;  3V05 A;  1B53 A;  4B3R L;  1ML0 D;  1QJO A;  3MWY W;  1V1Q A;  3C2P A;  1G51 A;  3KJP A;  1X32 A;  3A56 A;  2EY1 A;  5IYD G;  3K6O A;  2KEE A;  1KAB A;  1MIU A;  3I4N B;  4HJ8 A;  1XYI A;  3PV0 A;  3ICE A;  1A3V A;  1SMY D;  1VMP A;  4KI0 A;  4L5S A;  1YNJ D;  1RD9 D;  1WTP A;  1EYC A;  3S16 B;  5IT9 L;  4DAY B;  3TS0 A;  1B7Y B;  1W6K A;  3AFQ A;  4RHR A;  1D1K A;  4RWS C;  3J81 L;  2DJG C;  1I4G A;  1LYL A;  2WB1 G;  5M5W H;  4NP5 A;  4QF4 A;  1S72 A;  2CHB D;  5A2Q E;  1IBM Q;  2EPB A;  1UEA B;  3W2D A;  4GKJ L;  1WTR A;  1U4P A;  3BDC A;  4PMB A;  2E2I B;  4IUT A;  2IJ0 A;  2MJ8 A;  5CR3 A;  5IYC G;  4DR1 L;  3M85 A;  4FXK C;  1AN8 A;  2D62 A;  3A5Z B;  2VB3 X;  2R7Z G;  4A3I B;  3SE0 A;  2E76 C;  3S16 H;  1CK1 A;  1JWS D;  2JEA I;  1PRT D;  4BY7 B;  3OIQ A;  3CRK C;  2HQL A;  1SLJ A;  2QGQ A;  3H09 A;  3PF4 A;  2EVB A;  3E3X A;  2WFW A;  1STH A;  2KVM A;  5IYC H;  3A7L A;  1STE A;  1V43 A;  4HN7 A;  5ELC A;  2A8V A;  1NR4 A;  4A3E H;  2AQ3 B;  2B2W C;  2L12 A;  1TWA H;  2F0T A;  1EEF D;  2CVR A;  1STA A;  1XX8 A;  5I2Y A;  2DGY A;  1C9O A;  4G57 A;  4JBJ A;  2EYP A;  1YNJ C;  2A69 D;  4DGZ A;  1S5D D;  2Z4I A;  5GAG C;  5IP9 G;  1YJW A;  3GTG B;  4JBW A;  2NVY H;  2PO4 A;  2WB1 E;  1FVI A;  1LTG D;  2X6L A;  1Q3L A;  4R4I A;  1ET9 A;  1WCM G;  4RG1 A;  3CCJ A;  3KF6 A;  4KN7 C;  2XN9 C;  5ELN A;  1K3R A;  1RF2 D;  2JA7 B;  2Q8T A;  1DD2 A;  4GOP B;  5COY A;  1BQQ T;  3ULJ A;  3CD6 A;  3A5U A;  5GRO A;  4ZUI A;  1M4V A;  4WOR A;  3QOJ A;  1BR9 A;  5D65 A;  2OTL A;  3MHB A;  5CV4 A;  1Y8O B;  1ZYR C;  3CC2 A;  3ZYY X;  5C0X I;  3I2Z A;  2DNE A;  3PUW A;  2K5D A;  2NZ1 D;  4OL7 A;  5IT9 c;  5M3M H;  4XYO A;  2PMZ B;  3FDT A;  4ZKC B;  2NVQ H;  1GD7 A;  4HR7 B;  4WJW A;  5IYB H;  1PTO D;  2VUM H;  2F0K A;  1R9T H;  2EY6 A;  4IPG A;  2L11 A;  3J81 j;  4DAY A;  1E3P A;  1VQG A;  3I4O A;  4K5X A;  4JW0 A;  4A3F H;  4GKJ Q;  4EQN A;  4JI5 Q;  2XSC A;  3W1B A;  4RHS A;  1BKB A;  3LWE A;  5COR A;  1JOQ A;  1JE5 A;  2B39 A;  3G6J B;  3H6M A;  1Z47 A;  3IRB A;  4XIG S;  4IJH A;  4DK1 A;  3J80 L;  4GOP C;  2EQS A;  4A3K G;  3BZK A;  4JI4 L;  3SK6 A;  2NVQ B;  1HPC A;  3I4M H;  3VA5 A;  1K83 H;  5KYI A;  5ELB A;  4JV5 Q;  3X3M A;  5C0X G;  2NB0 A;  4ZRZ A;  1EOT A;  4J8Q A;  2Q8R E;  4O1N A;  5ELO A;  5EPJ A;  1AP0 A;  2F0L A;  3N52 A;  1KHI A;  5EJW A;  4IPD A;  1PFM A;  4NPS A;  1BCP B;  1M90 C;  4GLV B;  3ER0 A;  2HT1 A;  1F9Q A;  1ZEQ X;  5FJ8 H;  5LL6 X;  4B9X A;  5JJI A;  1VDZ A;  1Y69 U;  5M3M B;  1N33 L;  2PW5 A;  1X55 A;  4C2M H;  4DV2 L;  4BY7 G;  3RD4 A;  4K5W A;  3EBE A;  1E2V A;  3FKI H;  5C0X J;  3HOV B;  1QZG A;  1EQT A;  1B70 B;  4IAL A;  3T53 B;  4X66 L;  4JBK A;  3S1Q B;  3AB9 A;  4F87 A;  4IFD I;  4JI3 L;  4RGN A;  2EJF C;  3J80 E;  1I6H H;  2AHO B;  3OWE B;  1A15 A;  4A3K B;  1CTM A;  4KHP L;  1X6O A;  4N8X 1;  1SDF A;  4JI5 L;  3J7Y W;  1E7Z A;  1OO9 B;  2F1M A;  2SDF A;  2WAQ B;  3H0G B;  5DAU A;  4IQZ A;  3T1H Q;  4C3J H;  4ME5 A;  4DR6 Q;  3H94 A;  2EXZ A;  3GTL B;  3DLL A;  2KHJ A;  4L8J A;  2M00 A;  2CW0 C;  4A3D B;  1WCM B;  1A3T A;  2MNA A;  1L1O B;  1K83 B;  4LF6 L;  1JT8 A;  5JJZ A;  3EJI A;  4L5T A;  2JA5 H;  2N55 A;  3MTS A;  3NWT A;  1DJR D;  2PMZ E;  2A6H C;  5HGT A;  2VY3 A;  2WIN B;  4IPH A;  5M3M G;  3LWU A;  1EIY B;  1CA6 A;  2RSN A;  4LF6 Q;  5BR8 Q;  3U9S A;  4A4I A;  4DV2 Q;  3RZD H;  1PZK D;  1KXL A;  4OWT B;  1M8A A;  2PQA A;  4QCL A;  2DUD A;  2HDL A;  4N9P A;  2RVL A;  4CJ0 B;  2IHF A;  1IW7 D;  2FIN B;  1VQ8 A;  2A6H D;  4A3C G;  1WTO A;  1VQA A;  1ENC A;  2LY7 A;  3J81 i;  5LHY 1;  2EYL A;  4DFA A;  1CKO A;  2CW0 D;  2V1C C;  2ICE C;  2EXD A;  4F8M A;  4DAM A;  1C48 A;  4JI7 L;  3QWN A;  4YIJ A;  1X9N A;  2I46 A;  3KBX A;  4HIK A;  5IT9 E;  5T1G A;  1PA6 A;  4B3S Q;  3GTM B;  1JIC A;  2F0U A;  4DR3 Q;  1CQV A;  1JC7 A;  4DNR B;  3M4Y A;  4LFC L;  1WFQ A;  5JOB A;  1VQ9 A;  1UE1 A;  4PNY A;  3HOU B;  3PGZ A;  2I5M X;  3G71 A;  4RGM A;  1I6V C;  1KNE A;  4H44 C;  3D4W A;  3C3L A;  4QL5 A;  1JWM D;  1IBK Q;  3QO2 A;  5J22 A;  5AJ3 L;  2WKD A;  4ULL A;  4JV5 L;  3I8Z A;  5KEE A;  1KLU D;  3AYH B;  2F4I A;  5M3F B;  4LFC Q;  1SYE A;  1YJN A;  1EY8 A;  2UU9 L;  3LNN A;  2QKI C;  1UWV A;  2B2V A;  1CUK A;  3N6R A;  4LUZ A;  4AYB E;  1TS5 A;  1IYU A;  2RQX A;  2UUC L;  3I4L A;  2JA8 H;  1HCZ A;  4RFB A;  4OXP A;  2AKW B;  2DNC A;  1JJG A;  2HHH L;  4KD4 A;  3PIP A;  1PV4 A;  4A3K H;  2N78 A;  4APV A;  3S1M H;  4LF9 L;  4CJ1 B;  1JE4 A;  4C3H H;  4L5R C;  2ATW A;  5D14 A;  2FHT A;  3GDE A;  3CCQ A;  4GLX A;  1K0R A;  3HOW B;  1F2Z A;  3I91 A;  4NXM Q;  1D2B A;  4YHH Q;  2DY8 A;  1TWF B;  1BOS A;  2HHH Q;  1RJT A;  1VQC A;  3FHW A;  4R4Q A;  2L9H A;  4A3F B;  1V8Q A;  3WDN A;  1I5F A;  1AH9 A;  3U4Z A;  2YU9 B;  5JPM C;  4E6I A;  1DXM A;  4LFA Q;  3BG3 A;  3KDF B;  5EAY A;  1BBW A;  1GKH A;  1STB A;  3V2T A;  4DN4 M;  1CKN B;  1A6X A;  4DK0 A;  1WD0 A;  1C8C A;  3SGI A;  2NUC A;  2XNA C;  2SNM A;  1Q90 A;  5NUC A;  1HRJ A;  1PH8 A;  2PNH A;  3HKZ G;  3TS2 A;  1VF5 C;  4GNX A;  4A93 H;  3KLW A;  1F2L A;  2WAC A;  1GOZ A;  3JAM L;  3HOY H;  1PYW D;  3K59 A;  2K33 A;  1K3B C;  3PQI A;  4LUO A;  4Y7N H;  3S2D H;  4GN4 B;  1TS4 A;  1VQJ A;  3PUZ A;  2AWO A;  3NEN A;  1JB7 A;  1HUN A;  1RHP A;  1Q8I A;  4FYD A;  4UDU C;  2OQ0 A;  1WTV A;  1HTL D;  1I50 H;  2K4K A;  1J5E L;  4DV4 Q;  4HJA A;  1CT1 D;  5IGB A;  5M5Y B;  3PO3 B;  2MPM A;  3A8K E;  5T1I A;  4A3G B;  5BN3 A;  3NBI A;  4DXG A;  4L5Q A;  5JAV A;  3GTQ B;  5GAE C;  4HJ7 A;  1VQK A;  2IX1 A;  1OXX K;  1PH3 A;  3HS0 C;  3P7J A;  1VQP A;  2QDL A;  4CBV A;  2F0V A;  3NUC A;  4NKL A;  3HKS A;  4A3D H;  4K5V A;  1LUZ A;  4ZQ3 A;  2F3W A;  3CCM A;  2BCO A;  4RKB A;  1DZ1 A;  1SE2 A;  3I72 A;  4HSP A;  1V9P A;  4HED A;  4H02 A;  3MZ5 A;  5J39 A;  4FNF A;  2JA6 B;  4JBM A;  3Q23 A;  3H15 A;  4MN3 A;  2X6G A;  4EQ5 A;  4C3H B;  4IUR A;  1ESR A;  5I9P A;  1HFN A;  4YY3 Q;  1SMY C;  3M3Y H;  4JI8 Q;  4K0K L;  2D5D A;  1U4L A;  1YEZ A;  3DMU A;  4KHP Q;  3U58 A;  1EU3 A;  1EY9 A;  1S5E D;  3BZC A;  5JJK A;  1FNV A;  3P1H A;  4LNQ A;  2J7Z A;  3S9W A;  2F0O A;  1IYV A;  1B9N A;  5IGD A;  3CU7 A;  5JPN C;  2HDM A;  2ZXR A;  3EFX D;  3K5M A;  3C46 A;  4IUQ A;  3ULL A;  1ZKO A;  4WJ3 M;  1A3U A;  3BVZ A;  1BCP C;  2GA4 B;  1IXR A;  2PZT A;  3FPU B;  4RKL A;  3I55 A;  1S5B D;  5C44 B;  1VF7 A;  4FF3 A;  4DNT B;  2JJQ A;  4RGO S;  1PH4 A;  3KLS A;  1BO0 A;  1YI2 A;  4C3H G;  3DHQ A;  3U50 C;  4DR7 L;  4L63 B;  5K5P A;  2F0M A;  3S2H B;  1OXU A;  4JYA L;  2VUM B;  1A2T A;  3HKZ B;  1FL0 A;  3B6Y A;  4DA2 A;  4I65 A;  3TN2 A;  2ZTD A;  1Y1W B;  4JI3 Q;  3Q22 A;  3FKI G;  4IFD G;  3URY A;  3CCE A;  1PYB A;  1LAB A;  2E2H B;  2EY2 A;  3OHX C;  1SJH D;  4RA8 A;  3KYH C;  4LF4 Q;  3HRZ C;  5EPK A;  2J4X A;  2B63 H;  3HOV G;  1SXT A;  1TS2 A;  4R8I A;  1TWG H;  3OOC A;  3PUV A;  4C3I H;  1H9K A;  4BBS G;  3AFP A;  2BDO A;  4B3T L;  2IWH A;  1G6Z A;  3VR5 A;  1ZYR D;  3F8T A;  5AFW A;  5CC4 A;  1SN8 A;  1IBK L;  2F4V L;  1UEB A;  2KCN A;  1E24 A;  4DV7 Q;  5D3D A;  4KJO A;  2Z6B A;  3HOY G;  1PLF A;  4N8F A;  1GUW A;  2F0P A;  2IL8 A;  5FLX L;  4QUF A;  3GTK B;  3MFG A;  1XPR A;  1CHP D;  4DR3 L;  1TWC H;  1F9P A;  2I5H A;  2OT2 A;  1YNX A;  2K7V A;  4ILW A;  1IKM A;  4QIW B;  2KBN A;  2NVY B;  2TSS A;  1JOO A;  2TMP A;  1KAA A;  1PFS A;  4L6T B;  4DV7 L;  5IY0 A;  1QUQ A;  1PH5 A;  1FD7 D;  1IHZ A;  1HHV A;  2XWJ B;  1J9O A;  2DY7 A;  4BXX G;  3I3C A;  5KND A;  2VNU D;  1RKN A;  2NN6 I;  3UE0 A;  3E0J A;  2N8N A;  3JAM i;  3SHL A;  4QJF A;  4EQO A;  1GXD C;  3L3O C;  4JI1 Q;  2AQ1 B;  5KIX A;  1GUO A;  4NDX A;  2CWA A;  2F3I A;  1V1O A;  1I3Q B;  1C4Q A;  5C44 H;  3A8I E;  4UHV A;  1EZ6 A;  1DM0 B;  3HKZ E;  1P8L A;  2WII B;  1K9M C;  2D0O A;  2YTX A;  3S14 B;  4LMQ D;  2PQE A;  2MHV A;  1R4Q B;  5FLM H;  5ELD A;  5JEA G;  1O80 A;  4FVM A;  4MZ9 A;  4A3I G;  4MNO A;  2E5L L;  2K32 A;  5I4D A;  1GUN A;  4ME3 A;  1SYF A;  4K2L A;  2IT1 A;  2Z0S A;  2LS0 1;  4DK6 C;  3A8J E;  1PH2 A;  1O78 A;  5LMU Q;  4DK3 C;  5IGF A;  4A3E G;  4DR7 Q;  2R7D A;  3NTH A;  1Y1V B;  1Q1B A;  1IL2 A;  3T13 A;  1KD1 C;  3I4M B;  4BBS H;  3QOL A;  2NN6 H;  4YWM A;  4KMU C;  4P73 A;  2JP1 A;  2L0C A;  1TS3 A;  3VR3 A;  4X62 L;  1AZP A;  1F2Y A;  4C2M B;  5D3I B;  2FMC A;  1EEI D;  5H1S E;  2PQA B;  2KJX A;  1TWG B;  4N9T A;  3CP0 A;  1ROD A;  4ID6 A;  1JWU D;  2QEJ C;  1XNR Q;  4XDX A;  1HZB A;  1EFI D;  1YHB A;  3GTO B;  4TKO B;  5EQ0 A;  1X56 A;  4CHT B;  1I3Q H;  1D1I A;  4DV3 Q;  4BBS B;  1PH1 A;  2F0D A;  1K8G A;  1SYB A;  3Q6S A;  1V1P A;  1XJV A;  1AZQ A;  2IY5 B;  1TY0 A;  1N36 L;  2ICI A;  1S40 A;  1LT3 D;  2A6E D;  3CKI B;  3MXP A;  1QUQ B;  1TXY A;  3NBH B;  2F3V A;  4A3B H;  3RN5 A;  2UXC L;  4BY1 G;  3VYU A;  2NVX H;  4UY8 C;  3TZD A;  1XPU A;  1EWC A;  4RGT A;  3I90 A;  1BBX C;  5IYD H;  4DF7 A;  3MXU A;  1OXS C;  4IN3 A;  1HZ9 A;  3WWV A;  1HR0 Q;  1PRT B;  2UXD Q;  1F77 A;  2CQA A;  3GD7 A;  3HFZ B;  4KKS A;  2KHI A;  1N32 Q;  2KEC A;  3HOX B;  1VQ6 A;  4B08 A;  2MO1 A;  3FP9 A;  2PI2 A;  3NP8 A;  4RMF A;  1D5M C;  2F0G A;  4DU9 A;  1TY2 A;  2WB1 B;  1UUP A;  4MTN A;  4JI4 Q;  5E4X A;  4DR6 L;  2B3G A;  1K8A C;  2O2L D;  3ERS X;  4KD3 A;  2EYF A;  3M9B A;  1J5E Q;  4BY1 H;  2ASB A;  2KHS A;  3S15 B;  1KDC A;  3E5S A;  3PIO 3;  5LMU L;  4XYQ A;  1O7L A;  3UDF A;  4HID A;  1WCM H;  1W6J A;  5EKI A;  3HOX H;  4Q5V A;  2OTJ A;  2O5I C;  3AQQ A;  5IGE A;  4NXM L;  1F9R A;  4PMC A;  3DEP A;  1VQ5 A;  1A0I A;  4FDB A;  3ND8 A;  3KJO A;  3OMG A;  1SNP A;  2EY5 A;  2G9H D;  3S1M B;  5CV8 A;  1JCK B;  1K73 C;  2OXP A;  1MKH A;  1CQF A;  2M2L A;  1Y1V H;  1J8I A;  1S3O A;  5CGK A;  3S1N H;  2WAQ E;  1FJG Q;  1PRT C;  2V4D A;  1X65 A;  1WJJ A;  2QA4 A;  2RDG A;  4B3M Q;  4FXD A;  3I73 A;  1I4R A;  4EX5 A;  4FO2 A;  3Q24 A;  1H9S A;  3T4A C;  3W5O A;  1A62 A;  4LWC A;  5FLX c;  1HNX L;  4OWW B;  2NN6 G;  2R6G A;  4GNX B;  1V1P B;  1GJX A;  1XTD A;  3GTO H;  1DON A;  5M5Y H;  1Z9F A;  2B8G A;  5AJ3 Q;  1JMC A;  1O7Y A;  1LTR D;  2D9U A;  2VZA A;  2CCZ A;  1N8R C;  3RZO B;  1ICW A;  1XTC D;  5C6A A;  1SEB D;  1IL8 A;  1FR3 A;  3NXW A;  2EYM A;  2K05 A;  1MSG A;  4HJ5 A;  4A3M H;  3TP8 A;  2OWO A;  1MBY A;  3PUX A;  1OTC A;  4BBR B;  3V96 A;  2GVA A;  2WAQ G;  4I7A A;  5C4X B;  3F2U A;  1U4M A;  5IOC A;  1JJC B;  1EY0 A;  3UDG A;  1I4P A;  3MXN A;  3PUY A;  4OON A;  2B2T A;  5E4W C;  4XXE A;  1IBL Q;  2A1A A;  2RDH A;  1CZW A;  1GVP A;  1I4X A;  2C35 B;  1QG7 A;  3HZX A;  3UI2 A;  3QB3 A;  1II3 A;  1CKN A;  3GTP B;  1D8L A;  2B2Y C;  1YBY A;  3HOU G;  2HIX A;  1B3Q A;  5M5X H;  4YY3 L;  3DEO A;  2UXD L;  4CDC C;  3KFU A;  4DUZ L;  1EY4 A;  1BCP F;  4DV0 Q;  2HCI A;  4LF7 Q;  3CCV A;  1N34 L;  4IFD J;  3U9O A;  2K5Q A;  2JN4 A;  3BZD B;  1X3E A;  3OW7 A;  1E1T A;  4B3T Q;  3JAM E;  1DYQ A;  1STN A;  4JI2 L;  2A74 C;  3RLO A;  2BE5 D;  1H95 A;  2O4X A;  3BVG A;  4JI7 Q;  2JE6 I;  2H4O A;  1EFW A;  4H7B A;  3I4N G;  4RH6 A;  1GM5 A;  2NVT H;  2K5W A;  2YYZ A;  3GQB A;  1VQM A;  2VXW A;  2ZXO A;  2D2C C;  3PCO B;  2FFK B;  3OTO Q;  2K5H A;  4DV1 Q;  1QVF A;  4JOI A;  3S24 A;  4WJ4 A;  5KRU A;  1ET6 A;  3D8G A;  1I4Q A;  2R93 B;  5C3E G;  1UE5 A;  2Z8L A;  4QB4 A;  5C4J B;  3CPF A;  1OXV A;  4ZUJ A;  2HCC A;  3I4N H;  1D7Q A;  4BWG B;  4A3E B;  3RUZ A;  5C0X H;  5DEH A;  1HNZ L;  1SYD A;  4DV5 L;  3Q0A A;  3ONA B;  1SE4 A;  3GV6 A;  4DR4 Q;  2E2D C;  1K8O A;  4AH6 A;  4UP7 A;  2G9D A;  3D4R A;  1UE7 A;  4KY7 A;  4DAP A;  2BA1 A;  4C1N I;  2K5N A;  1BVS A;  3IFD A;  3DXJ C;  5FLM G;  2KCT A;  1ONL A;  1TKW B;  4A3M B;  4HSV A;  5CV7 A;  3PO2 G;  3MA2 B;  1NMG A;  4BBR H;  1KRT A;  1N9W A;  4ZK9 B;  1KTK A;  3K7A H;  1ENF A;  1LT4 D;  1ENA A;  4J6H A;  1GO3 E;  4DKA C;  3EVQ A;  3J7Z C;  3K5O A;  1YHQ A;  3T16 A;  2R3Z A;  2K6A A;  3FRP B;  4AYB B;  5KNC A;  4DV5 Q;  3RLN A;  3VYT A;  4B9W A;  2R92 B;  2KED A;  2JK8 A;  5DM7 3;  2C9O A;  4QUC A;  2N49 A;  2Q2H A;  4GLA C;  1D5Z C;  4XT3 B;  1JOR A;  2JA7 G;  2B2W A;  3T1H L;  2R61 A;  1TII D;  3TZU A;  4JI2 Q;  1IBL L;  5F2D A;  1SE8 A;  1B44 D;  4C3I B;  4DR4 L;  4DR5 Q;  1DCZ A;  3DUZ A;  2JA9 A;  4LAA A;  2QIL A;  2H1E A;  4LF8 Q;  1W3S A;  3SK5 A;  4P75 A;  2YTV A;  2H5X A;  4I7Z C;  2EYO A;  4K14 A;  2VQF L;  2JA8 G;  1X3Q A;  4R4C A;  2E2H H;  1KQS A;  1EYD A;  4LF5 L;  2A68 C;  5M9O A;  1IYJ B;  3ERQ A;  1CFM A;  1NSN S;  5DNF A;  1D6E C;  1E22 A;  2B63 B;  1RTO A;  1SR3 A;  1B4O A;  4KTA A;  4LFB Q;  2KEN A;  4DAV A;  1UE6 A;  4Y7N B;  3RZO H;  4DV6 L;  1NR2 A;  3GTG H;  1EY5 A;  2XIW A;  1H9R A;  3JC6 6;  5LMN Q;  2OCE A;  1PH7 A;  1QB5 D;  4X65 L;  3HGB A;  3A74 A;  3OW2 A;  1Y1V G;  2E5L Q;  2R93 G;  1JR0 D;  4GKK L;  1I94 Q;  1SSO A;  5BN5 A;  1N34 Q;  1HTP A;  3K5N A;  2GN5 A;  4AQY Q;  5KNB A;  4IPC A;  1Q1E A;  4NMZ A;  2K28 A;  2PCF B;  1RDP D;  3K0Y A;  4GKK Q;  1G91 A;  2QEX A;  4NXN Q;  3D6W A;  4P71 A;  1S4Z A;  4A3J H;  2EYH A;  2RHS B;  2J0T D;  1ILP A;  4CJ2 C;  4AQY L;  4A3C H;  1WVL A;  3Q8D A;  5IYB G;  1CI3 M;  4AIM A;  5E1F A;  1LLR D;  2RBM A;  1SRU A;  1L0W A;  4JG2 A;  5LL6 S;  4KHV A;  1MSH A;  1SMX A;  2HD3 A;  2HIV A;  5IP7 H;  1HFG A;  1QVC A;  1QOH A;  1EYG A;  3CCS A;  3H3V I;  3S17 B;  1B3A A;  2ENB A;  1GHJ A;  4QGU A;  1U0L A;  3G7L A;  4BY1 B;  5IP7 G;  3RZD B;  1JB3 A;  1EZ8 A;  1FGU A;  4X65 Q;  3QG1 A;  2Z1C A;  3SEB A;  4LF4 L;  3FKI B;  4R1J A;  3PMF A;  4BA2 I;  3NHH A;  4JC0 A;  2ZTC A;  4BA1 I;  1WTH A;  3GTK H;  4KY6 A;  5EKL A;  3PO2 H;  3HP3 A;  1DGS A;  1U5K A;  2F0S A;  3CCU A;  1C7Y A;  4A3B G;  2OF1 A;  3ND9 A;  4A3M G;  5FOB B;  1F9S A;  3NE5 B;  3K57 A;  3OYY A;  4X66 Q;  4NXN L;  4JOI C;  1EYA A;  5IP9 H;  4FF2 A;  1VQO A;  3SR1 A;  2PNR C;  1QIL A;  1SYC A;  1LT5 D;  4PZ7 A;  5IGC A;  2L55 A;  3IL8 A;  4OEM B;  5LMN L;  2WV6 D;  1XMO L;  1STG A;  2ZT9 C;  1SJE D;  4JI0 L;  4A3D G;  1P16 A;  2N3S A;  3R3O A;  1YIJ A;  4PG3 A;  1DOM A;  3CHB D;  3NK9 A;  4C56 C;  5JJL A;  1VQF A;  4KK7 A;  1A8V A;  2L1B A;  3T1Y Q;  3AEV A;  2VS1 A;  4KKU A;  5FJ8 G;  2B63 G;  2RKS A;  1PVO A;  1FNW A;  4O42 A;  4A93 B;  3C1F A;  2K1B A;  2EYJ A;  3RLF A;  1TWH H;  4CDF C;  3UE1 A;  4HTH A;  1B2T A;  1Y8N B;  1E0B A;  2K03 A;  2B29 A;  4IZ8 A;  1Q7Y C;  4OHJ A;  1VQN A;  2BE5 C;  2Z6K A;  1CM9 A;  3BYY B;  4DR1 Q;  2KUM A;  4PZ8 A;  3FEW X;  1YZ6 A;  2JA5 B;  1I50 B;  3KF8 B;  4G7O C;  3NWS A;  5EKK A;  1KDB A;  3HEJ A;  4JI0 Q;  3MC0 B;  2B2Y A;  1Z6H A;  1VQ7 A;  5C4Z A;  3WOF A;  3OMC A;  1EIF A;  1YJ9 A;  4A75 A;  2K75 A;  2F52 A;  1UAP A;  3VYR A;  1PXU A;  1YNN D;  5HY6 A;  3STB D;  1F2M A;  3LX0 A;  3J7A V;  1NMF A;  1FNU A;  5C44 G;  3HOU H;  1L2F A;  3S1Q H;  1L0Y B;  1QZH A;  2K04 A;  4X62 Q;  1LTA D;  1TU2 B;  1SNM A;  5CV6 A;  2BOS A;  5E3F A;  4DPG A;  1STY A;  2RHQ B;  1LT6 D;  1X3G A;  1XXG A;  2JA6 H;  5KYL A;  3H0G H;  3TP6 A;  1Q46 A;  4YWL A;  4C3J B;  3TDQ A;  5M3F H;  1CSQ A;  5BN4 A;  1ICF B;  1NAP A;  2CFM A;  4S3S A;  3TP5 A;  2E2J H;  2I0Q A;  4KLK A;  2JA5 G;  4M8A A;  1R9T B;  1WD1 A;  3F2B A;  4BBR G;  2P5Z X;  1BF4 A;  2A19 A;  3NSW A;  4G4K A;  2EJG C;  1S5F D;  3GV3 A;  5CV9 A;  4OO1 I;  1G29 1;  1CSP A;  3GTP H;  1VCI A;  4LW1 A;  4R9W A;  2B2U C;  4CKB A;  4DV3 L;  3NTK A;  4P74 A;  3P20 A;  1GUT A;  3ULP A;  3CXC A;  2IX3 A;  4IO9 A;  1EY6 A;  5C3X A;  1R4P B;  4KJN A;  3KK7 A;  3UDX A;  3S2D B;  1KDA A;  2CKZ B;  5I6W A;  3MXN B;  2AUK A;  2JSO A;  5JVH 3;  4FF1 A;  4JCV E;  5IWA Q;  1H9M A;  3TRE A;  1PZJ D;  4Z9C B;  4XQN A;  3QJY A;  4C3I G;  1CA5 A;  1G6P A;  1PTO C;  2F0H A;  5J1Z A;  2M9V A;  1Q86 C;  4DUZ Q;  3K80 C;  4K6L A;  4G7Z C;  4ZKB B;  3SK4 A;  1B9M A;  4A76 A;  3S1N B;  1TWH B;  5IOD A;  1IKL A;  4OX9 Q;  1NY4 A;  4ODG A;  1NCV A;  1KIX A;  2B8F A;  1EL0 A;  2FMM A;  1RCV D;  3KLS X;  1EQR A;  5EBD A;  1PH9 A;  3R8B A;  3TP7 A;  4DUY Q;  4LF7 L;  2E74 C;  2C5C A;  4MIU A;  1SFO H;  3FMC A;  3H91 A;  4ABN A;  1MJE A;  1HA5 A;  4LUV A;  2NZO A;  2PW7 A;  1K8M A;  5G3L F;  4HMJ A;  1NBW A;  3L9A X;  4KHZ A;  3J7A 5;  3NTI A;  2IPK D;  4GN5 A;  4IJL A;  2VUM G;  2BH8 A;  4B3M L;  1SFO B;  2X69 A;  1NJI C;  3VR2 A;  4DV6 Q;  3KOJ A;  2F4V Q;  3M7G A;  3OPO A;  4J15 A;  5M3F G;  1PH6 A;  3W1G A;  3AU7 A;  3CAM A;  1PFB A;  4KN4 C;  2XVS A;  2QW7 A;  3FPP A;  2IW3 A;  4LF5 Q;  4O2D A;  3DM1 A;  2UXB L;  1TT2 A;  1VMC A;  4OX9 L;  5GQO A;  1X3P A;  2O5J C;  4IOA A;  1HA6 A;  2F0W A;  3K0X A;  3NBH A;  4F7X A;  1W2B A;  3PIO A;  2XRS D;  1VS0 A;  1KNA A;  1EY7 A;  3VR4 A;  4FP5 D;  5A2Q L;  5ELF A;  2LSS A;  2R92 G;  3IFT A;  2AUJ D;  2JA8 B;  3NQI A;  5EPL A;  2NTS A;  5IWA L;  1EIH A;  1VQI A;  4M1U B;  3ZJY C;  3CCR A;  3H3V C;  2E75 C;  2KQ3 A;  1ASZ A;  2Q2I A;  4IUP A;  2UU9 Q;  1RTN A;  2VB2 X;  3U4V A;  2YV5 A;  1SYG A;  4O0A A;  1NNX A;  4PQX A;  4PZ6 A;  5I9O A;  3CQZ B;  1BCP D;  1BDO A;  1SND A;  3MXG A;  4A3L H;  1WTW A;  4LF8 L;  4WFN 3;  1Q8K A;  3TRZ A;  3VYS A;  5ISR A;  2K14 A;  2N88 A;  1BUV T;  1KAW A;  3BDL A;  1MJC A;  2EOT A;  1KC8 C;  5M5W B;  3E9H A;  3ERO A;  4IOC A;  3S1R H;  2B2T C;  1ZXT A;  2JYO A;  3A0J A;  1YIT A;  1O7I A;  1EQQ A;  1WYD A;  4JI6 Q;  4H0L C;  3PF5 A;  1S5C D;  2OQK A;  3CQZ H;  1T5X D;  1MHW C;  2F0Q A;  5KGU A;  1L0X B;  4DXF A;  1D5X C;  3OTO L;  3CC4 A;  3CPW A;  3ITP A;  2F0E A;  3BDO A;  2KA7 A;  4H13 C;  4DNI A;  2R7Z B;  4DV4 L;  4DR5 L;  2L5T A;  1T9H A;  4POF A;  1YNN C;  3A55 A;  3FVQ A;  1YHA A;  3MFY A;  4A93 G;  3E9I A;  2FXQ A;  3HOX G;  3D6C A;  2Q8I B;  1HNZ Q;  4XQJ A;  3TBI B;  1H9S B;  2PZW A;  2MO0 A;  3R2I A;  3QR8 A;  3MEF A;  2ID0 A;  2BH2 A;  4A3G G;  2RF4 A;  4OIK A;  2SNS A;  1G2T A;  3T1Y L;  1EOV A;  4QIW E;  3BS1 A;  1L1O A;  4ZAI A;  3SK8 A;  1QE6 A;  4RCO A;  3H0G G;  1AE3 A;  3DWQ A;  4POG A;  4X3S A;  1B50 A;  4BXX H;  4A3B B;  4PMW A;  1CKM A;  1HUM A;  1DOL A;  2Q2U A;  1DOK A;  4JK1 C;  1I4H A;  5IE8 A;  1MI2 A;  1HZA A;  3M4Q A;  3J7A F;  1EUJ A;  3VDY A;  1K28 A;  2BA0 A;  3L2P A;  4FXG C;  3J81 E;  3HOY B;  3OWF A;  1EWI A;  5TSS A;  4TSS A;  2ZM6 L;  1K0S A;  1J6Q A;  3X3N A;  3M7N A;  2R93 H;  1ILQ A;  4TQU S;  4BY7 H;  1B1Z A;  3OSO A;  3PO3 H;  3TEH B;  3CC7 A;  1L1O C;  4RAU C;  1XMO Q;  4DR2 L;  3PO3 G;  3P75 A;  1PTO F;  2B2V C;  3PIP 3;  2ALY B;  1TWA B;  1I6H B;  3BVM A;  3KLR A;  4LJZ C;  2LMC B;  1IBM L;  1E1O A;  1OXT A;  4V0B A;  5HUR A;  3KBG A;  2EJM A;  1A63 A;  2KOL A;  2CQO A;  5EGT A;  2F0F A;  3VR6 A;  4JYA Q;  3I4M G;  2XGT A;  3G48 A;  2CH4 A;  1Z7T A;  5IIF A;  3KDF A;  1SBB B;  2XRQ D;  1VQD A;  3TSS A;  2K5V A;  1TVX A;  1AFP A;  1H9J A;  3TME A;  5FLX E;  5JEA H;  2YU9 H;  5C5M A;  1EIG A;  1I94 L;  2PI2 E;  2B2U A;  3NEL A;  3L0O A;  2AMC B;  2XWB B;  2R92 H;  3O13 A;  4UP8 A;  1RL2 A;  4DR2 Q;  3M4O B;  5I6Y A;  1HNX Q;  2NTT A;  4P2C B;  2EE1 A;  1Q82 C;  1Y1W H;  3KF6 B;  5L37 A;  2JA7 H;  1Q81 C;  4A3J B;  1KL9 A;  2Q2T A;  4PV1 C;  3MAQ A;  4LK1 C;  5CMD A;  4V19 0;  2UUB Q;  1WTX A;  5G3L D;  4CDE C;  3CF5 A;  4JI1 L;  3RN2 A;  1MGS A;  1BNZ A;  5A35 A;  3CMA A;  3HOW G;  2PPB C;  2R7F A;  3BU2 A;  3SVM A;  2ES2 A;  2OEO A;  3STB C;  1MD2 D;  4UPA A;  2YTY A;  1Y1W G;  2WP8 J;  2ZM6 Q;  4QY7 A;  4NB3 A;  4NW2 A;  4CKC A;  4JVZ A;  4C3J G;  5DLQ E;  2UUC Q;  1ASY A;  2A73 B;  1KRS A;  4X6A H;  2ZJR A;  2Z9H A;  1PYS B;  5FO7 B;  5K36 G;  4HCS A;  1VQL A;  4LF9 Q;  3HOZ H;  4J1M A;  1AEX A;  1WI5 A;  4KY5 A;  3MEH A;  3G6E A;  2F0I A;  2IHE A;  1HZC A;  3OIP A;  2Z6K C; 
#chains in the Genus database with same CATH homology
 1SE3 A;  1G8Z D;  4BS9 A;  1PMR A;  3D4D A;  2HUG A;  3NPP A;  2F0N A;  1CHQ D;  1LTI D;  3M3Y B;  3HG9 A;  3DWA A;  4EVO A;  4IFD H;  3KF8 A;  5JEA J;  1EQV A;  2NBF A;  4IUV A;  4FF4 A;  2E2J B;  5FO9 B;  3A7A B;  3K5L A;  1LO5 D;  5ELE A;  2SOB A;  2NYZ D;  4F88 A;  4QMG A;  1NUC A;  4K6D A;  2MP1 A;  5FK9 C;  1TR5 A;  2MGS A;  1GUG A;  1LTS D;  3IKJ A;  4HCE A;  1G2S A;  4UAI A;  3R2T A;  2BDN A;  5CV5 A;  1LV9 A;  1Q12 A;  5FO8 B;  5EBC A;  2IX0 A;  1QCB D;  5M5X B;  3CRL C;  4HAE A;  2Z4H A;  2EZV A;  3GTJ B;  2LFN A;  2FJ2 A;  2PZU A;  1QNK A;  2HQE A;  1JOK A;  1SNO A;  3MVV A;  1E2Z A;  3SXH A;  3QIA A;  2KCC A;  4R8N A;  1QWY A;  2NVX B;  4GZY C;  1GHK A;  1T5E A;  4ZLT F;  1E2W A;  2LKV A;  4KV6 A;  3GO5 A;  3VA7 A;  3KUP A;  1TWC B;  1EWH A;  5I2X A;  1O7Z A;  2AWN A;  5JVG 3;  2A68 D;  2WKC A;  2Y0S B;  3T51 B;  1UNS A;  2JXM B;  1PZI D;  2RA4 A;  1XWE A;  1AW7 A;  1U9R A;  4K8J A;  3SDZ A;  2A69 C;  4X3T A;  1LAC A;  3EA6 A;  4XTC S;  1PTO H;  1FGB D;  2NWG A;  3L7Z C;  1IW7 C;  3WOE A;  5CBA E;  1WTQ A;  1CZG A;  1KLG D;  3K7A B;  4CKE A;  2ZXP A;  2NVT B;  1ESF A;  2QF7 A;  4U67 3;  3R93 A;  4WRD A;  2AQ2 B;  2I07 B;  1SNC A;  2F0J A;  4C1N K;  4K8I A;  2RDF A;  3D3R A;  4TRD A;  3AMU A;  3HOZ B;  4OO1 G;  4X3U A;  2F03 A;  4Q0F A;  4X3K A;  4CGY B;  2QDB A;  3NQT A;  2DN8 A;  1HXY D;  4MHE A;  3BYT B;  3W3A A;  4ZYS A;  3K58 A;  1A2U A;  2EDG A;  2L4N A;  1PFN A;  1SNQ A;  2PYK A;  1SAP A;  3EQL C;  4IUN A;  1U4R A;  1PRT F;  4G7H C;  5C4H A;  1GUS A;  5DM6 3;  3S1R B;  1HQR D;  2K01 A;  3PO2 B;  5CBE E;  3D31 A;  4EQP A;  3C1E A;  4IUU A;  4K2K A;  3I70 A;  4RCN A;  4EGV A;  1BXT A;  1LTT D;  2SEB D;  2QCP X;  5IGG A;  1Y8P B;  4OGQ C;  2A5H A;  4XQQ A;  2MUY A;  3GP7 A;  3RMH A;  3IAY A;  2RSO A;  2A6E C;  5K36 H;  1QNU A;  1JQY D;  1PDQ A;  1HQM C;  1EU4 A;  4KKT A;  1LTB D;  3A54 A;  1TQO A;  5C5L A;  1PTO B;  4U68 A;  3DWP A;  5CYU A;  3T56 B;  4OIJ A;  5FKA C;  5C3W A;  1FYC A;  4OO1 H;  2JEB I;  3E6Z X;  5C3E B;  4XT1 B;  4HMI A;  3V05 A;  1B53 A;  1ML0 D;  1QJO A;  3MWY W;  3C2P A;  1X32 A;  3A56 A;  2EY1 A;  3K6O A;  2KEE A;  1KAB A;  3I4N B;  1XYI A;  3PV0 A;  1A3V A;  1SMY D;  1VMP A;  4KI0 A;  1YNJ D;  1RD9 D;  1WTP A;  1EYC A;  3S16 B;  5IT9 L;  1W6K A;  4RHR A;  1D1K A;  4RWS C;  3J81 L;  1I4G A;  4NP5 A;  4QF4 A;  2CHB D;  5A2Q E;  2EPB A;  1UEA B;  3W2D A;  1WTR A;  1U4P A;  3BDC A;  4PMB A;  2E2I B;  4IUT A;  2IJ0 A;  2MJ8 A;  5CR3 A;  3M85 A;  4FXK C;  1AN8 A;  2D62 A;  2VB3 X;  4A3I B;  3SE0 A;  2E76 C;  1CK1 A;  1JWS D;  2JEA I;  1PRT D;  4BY7 B;  3OIQ A;  3CRK C;  3H09 A;  2EVB A;  1STH A;  2KVM A;  3A7L A;  1STE A;  1V43 A;  4HN7 A;  5ELC A;  1NR4 A;  2AQ3 B;  2B2W C;  2L12 A;  2F0T A;  1EEF D;  2CVR A;  1STA A;  1XX8 A;  5I2Y A;  4G57 A;  2EYP A;  1YNJ C;  4DGZ A;  2A69 D;  1S5D D;  2Z4I A;  3GTG B;  4JBW A;  2PO4 A;  1LTG D;  2X6L A;  1Q3L A;  1ET9 A;  4KN7 C;  2XN9 C;  1DD2 A;  1RF2 D;  2JA7 B;  2Q8T A;  5COY A;  1BQQ T;  4ZUI A;  1M4V A;  4WOR A;  3QOJ A;  1BR9 A;  5D65 A;  3MHB A;  5CV4 A;  1Y8O B;  1ZYR C;  3ZYY X;  5C0X I;  2DNE A;  3PUW A;  2K5D A;  2NZ1 D;  4OL7 A;  4XYO A;  2PMZ B;  3FDT A;  4ZKC B;  4HR7 B;  4WJW A;  1PTO D;  2F0K A;  2EY6 A;  2L11 A;  4DAY A;  4K5X A;  4EQN A;  2XSC A;  4RHS A;  3LWE A;  5COR A;  1JOQ A;  2B39 A;  3G6J B;  3H6M A;  1Z47 A;  4XIG S;  4DK1 A;  3J80 L;  3SK6 A;  2NVQ B;  1HPC A;  3VA5 A;  5KYI A;  5ELB A;  3X3M A;  5C0X G;  2NB0 A;  4ZRZ A;  1EOT A;  4J8Q A;  2Q8R E;  4O1N A;  5EPJ A;  1AP0 A;  2F0L A;  3N52 A;  5EJW A;  1PFM A;  1BCP B;  1F9Q A;  1ZEQ X;  5LL6 X;  4B9X A;  1VDZ A;  1Y69 U;  5M3M B;  2PW5 A;  3RD4 A;  4K5W A;  1E2V A;  5C0X J;  3HOV B;  1EQT A;  4IAL A;  3T53 B;  3S1Q B;  3AB9 A;  4F87 A;  4IFD I;  4RGN A;  2EJF C;  3J80 E;  3OWE B;  1A15 A;  4A3K B;  1CTM A;  3J7Y W;  1SDF A;  1OO9 B;  2F1M A;  2SDF A;  2WAQ B;  3H0G B;  5DAU A;  4IQZ A;  4ME5 A;  3H94 A;  2EXZ A;  3GTL B;  4L8J A;  2M00 A;  2CW0 C;  4A3D B;  1WCM B;  1A3T A;  1K83 B;  5JJZ A;  3EJI A;  2N55 A;  3MTS A;  3NWT A;  1DJR D;  2A6H C;  5HGT A;  2WIN B;  3LWU A;  1CA6 A;  2RSN A;  3U9S A;  1PZK D;  1M8A A;  4QCL A;  2HDL A;  4N9P A;  2RVL A;  4CJ0 B;  1IW7 D;  2FIN B;  2A6H D;  1WTO A;  1ENC A;  2LY7 A;  5LHY 1;  2EYL A;  4DFA A;  2CW0 D;  2ICE C;  4F8M A;  1C48 A;  3QWN A;  4YIJ A;  2I46 A;  3KBX A;  5IT9 E;  5T1G A;  3GTM B;  1JIC A;  2F0U A;  1CQV A;  1JC7 A;  4DNR B;  3M4Y A;  5JOB A;  4PNY A;  3HOU B;  4RGM A;  1I6V C;  1KNE A;  4H44 C;  3D4W A;  3C3L A;  1JWM D;  3QO2 A;  5J22 A;  2WKD A;  4ULL A;  3I8Z A;  5KEE A;  1KLU D;  2F4I A;  5M3F B;  1SYE A;  1EY8 A;  3LNN A;  2QKI C;  2B2V A;  3N6R A;  1TS5 A;  1IYU A;  2RQX A;  3I4L A;  1HCZ A;  4RFB A;  2DNC A;  4KD4 A;  4CJ1 B;  1JE4 A;  5D14 A;  2FHT A;  3HOW B;  1F2Z A;  3I91 A;  1D2B A;  2DY8 A;  1TWF B;  1BOS A;  1RJT A;  2L9H A;  4A3F B;  1V8Q A;  3WDN A;  2YU9 B;  5JPM C;  4E6I A;  1DXM A;  3BG3 A;  1STB A;  3V2T A;  4DN4 M;  1A6X A;  4DK0 A;  1WD0 A;  1C8C A;  2NUC A;  2XNA C;  2SNM A;  1Q90 A;  5NUC A;  1HRJ A;  1VF5 C;  1F2L A;  2WAC A;  1GOZ A;  3JAM L;  1PYW D;  3K59 A;  2K33 A;  1TS4 A;  3PUZ A;  2AWO A;  1HUN A;  1RHP A;  1Q8I A;  4FYD A;  4UDU C;  1WTV A;  1HTL D;  1CT1 D;  5IGB A;  5M5Y B;  3PO3 B;  2MPM A;  3A8K E;  5T1I A;  4A3G B;  5BN3 A;  3NBI A;  4DXG A;  5JAV A;  3GTQ B;  2IX1 A;  1OXX K;  3HS0 C;  3P7J A;  4CBV A;  2F0V A;  3NUC A;  4NKL A;  4K5V A;  4ZQ3 A;  2F3W A;  2BCO A;  4RKB A;  1DZ1 A;  1SE2 A;  3I72 A;  4HSP A;  4HED A;  3MZ5 A;  5J39 A;  4FNF A;  2JA6 B;  3Q23 A;  4MN3 A;  2X6G A;  4C3H B;  4IUR A;  1ESR A;  5I9P A;  1HFN A;  1SMY C;  2D5D A;  1U4L A;  3DMU A;  1EU3 A;  1EY9 A;  1S5E D;  1FNV A;  3P1H A;  2J7Z A;  3S9W A;  2F0O A;  1IYV A;  1B9N A;  5IGD A;  3CU7 A;  5JPN C;  2HDM A;  2ZXR A;  3EFX D;  3K5M A;  3C46 A;  4IUQ A;  1ZKO A;  1A3U A;  3BVZ A;  1BCP C;  2GA4 B;  3FPU B;  2PZT A;  4RKL A;  1S5B D;  5C44 B;  1VF7 A;  4FF3 A;  4DNT B;  4RGO S;  3KLS A;  1BO0 A;  4C3H G;  3DHQ A;  4L63 B;  5K5P A;  2F0M A;  3S2H B;  1OXU A;  2VUM B;  1A2T A;  3HKZ B;  4DA2 A;  4I65 A;  3TN2 A;  1Y1W B;  3Q22 A;  4IFD G;  3URY A;  1LAB A;  2E2H B;  2EY2 A;  3OHX C;  1SJH D;  4RA8 A;  3HRZ C;  5EPK A;  2J4X A;  1SXT A;  1TS2 A;  4R8I A;  3OOC A;  3PUV A;  1H9K A;  2BDO A;  2IWH A;  1G6Z A;  3VR5 A;  1ZYR D;  5AFW A;  5CC4 A;  2KCN A;  5D3D A;  4KJO A;  1PLF A;  1GUW A;  2F0P A;  2IL8 A;  5FLX L;  4QUF A;  3GTK B;  3MFG A;  1CHP D;  1F9P A;  2OT2 A;  2K7V A;  4ILW A;  1IKM A;  4QIW B;  2NVY B;  2TSS A;  1JOO A;  2TMP A;  1KAA A;  4L6T B;  1FD7 D;  1IHZ A;  1HHV A;  2XWJ B;  1J9O A;  2DY7 A;  2VNU D;  3I3C A;  5KND A;  1RKN A;  2NN6 I;  3E0J A;  3SHL A;  4EQO A;  1GXD C;  3L3O C;  2AQ1 B;  5KIX A;  1GUO A;  4NDX A;  1V1O A;  1I3Q B;  1C4Q A;  3A8I E;  1EZ6 A;  1DM0 B;  2WII B;  3S14 B;  4LMQ D;  2PQE A;  2MHV A;  1R4Q B;  5ELD A;  5JEA G;  1O80 A;  4FVM A;  2K32 A;  5I4D A;  1GUN A;  1SYF A;  4K2L A;  2IT1 A;  2LS0 1;  3A8J E;  1O78 A;  5IGF A;  3NTH A;  1Y1V B;  1Q1B A;  3T13 A;  3I4M B;  3QOL A;  2NN6 H;  4KMU C;  2JP1 A;  2L0C A;  1TS3 A;  3VR3 A;  1AZP A;  1F2Y A;  4C2M B;  5D3I B;  2FMC A;  1EEI D;  2KJX A;  1TWG B;  4N9T A;  1ROD A;  4ID6 A;  1JWU D;  2QEJ C;  4XDX A;  1EFI D;  3GTO B;  4TKO B;  5EQ0 A;  4CHT B;  1D1I A;  4BBS B;  2F0D A;  1SYB A;  3Q6S A;  1V1P A;  1AZQ A;  1TY0 A;  2ICI A;  1LT3 D;  2A6E D;  3CKI B;  3MXP A;  2F3V A;  3VYU A;  3TZD A;  1EWC A;  4RGT A;  3I90 A;  1BBX C;  4DF7 A;  3MXU A;  1OXS C;  4IN3 A;  1PRT B;  1F77 A;  2CQA A;  3GD7 A;  4KKS A;  2KEC A;  3HOX B;  4B08 A;  3NP8 A;  1D5M C;  2F0G A;  4DU9 A;  1TY2 A;  2WB1 B;  1UUP A;  5E4X A;  2O2L D;  4KD3 A;  2EYF A;  2KHS A;  3S15 B;  1KDC A;  3E5S A;  3PIO 3;  4XYQ A;  1O7L A;  1W6J A;  5EKI A;  4Q5V A;  2O5I C;  5IGE A;  1F9R A;  4PMC A;  3DEP A;  3ND8 A;  3OMG A;  1SNP A;  2EY5 A;  2G9H D;  3S1M B;  5CV8 A;  1JCK B;  2OXP A;  1J8I A;  1CQF A;  2M2L A;  5CGK A;  1PRT C;  2V4D A;  4FXD A;  2RDG A;  3I73 A;  1I4R A;  4FO2 A;  3Q24 A;  1H9S A;  3T4A C;  2NN6 G;  2R6G A;  1V1P B;  1GJX A;  1DON A;  2B8G A;  1O7Y A;  1LTR D;  2D9U A;  3RZO B;  1ICW A;  1XTC D;  5C6A A;  1SEB D;  1IL8 A;  1FR3 A;  3NXW A;  2EYM A;  2K05 A;  1MSG A;  3TP8 A;  1MBY A;  3PUX A;  4BBR B;  3V96 A;  5C4X B;  3F2U A;  1U4M A;  5IOC A;  1EY0 A;  1I4P A;  3MXN A;  3PUY A;  4XXE A;  2B2T A;  5E4W C;  2RDH A;  1CZW A;  1I4X A;  1QG7 A;  3HZX A;  3UI2 A;  3QB3 A;  1II3 A;  3GTP B;  2B2Y C;  3DEO A;  1EY4 A;  1BCP F;  2HCI A;  4IFD J;  3U9O A;  2K5Q A;  3BZD B;  3OW7 A;  3JAM E;  1DYQ A;  1STN A;  2A74 C;  2BE5 D;  2O4X A;  3BVG A;  2JE6 I;  2H4O A;  4H7B A;  4RH6 A;  2K5W A;  2YYZ A;  3GQB A;  2VXW A;  2ZXO A;  2D2C C;  2FFK B;  5KRU A;  1ET6 A;  3D8G A;  1I4Q A;  2R93 B;  2Z8L A;  4QB4 A;  5C4J B;  1OXV A;  4ZUJ A;  2HCC A;  4BWG B;  4A3E B;  3RUZ A;  5C0X H;  5DEH A;  1SYD A;  3Q0A A;  3ONA B;  1SE4 A;  3GV6 A;  1K8O A;  2E2D C;  2G9D A;  3D4R A;  4KY7 A;  4DAP A;  4C1N I;  2BA1 A;  3IFD A;  3DXJ C;  1ONL A;  1TKW B;  4A3M B;  4HSV A;  5CV7 A;  3MA2 B;  4ZK9 B;  1KTK A;  1ENF A;  1LT4 D;  1ENA A;  4J6H A;  3EVQ A;  3K5O A;  3T16 A;  2R3Z A;  2K6A A;  3FRP B;  4AYB B;  5KNC A;  3VYT A;  4B9W A;  2R92 B;  2KED A;  5DM7 3;  2C9O A;  4QUC A;  1D5Z C;  4XT3 B;  1JOR A;  2B2W A;  2R61 A;  1TII D;  3TZU A;  5F2D A;  1B44 D;  4C3I B;  1DCZ A;  3DUZ A;  4LAA A;  2QIL A;  2H1E A;  3SK5 A;  4I7Z C;  2EYO A;  4K14 A;  1X3Q A;  1EYD A;  2A68 C;  5M9O A;  3ERQ A;  1CFM A;  1NSN S;  5DNF A;  1D6E C;  2B63 B;  1RTO A;  1B4O A;  4KTA A;  4DAV A;  4Y7N B;  1NR2 A;  1EY5 A;  2XIW A;  1H9R A;  1QB5 D;  3HGB A;  1JR0 D;  1SSO A;  5BN5 A;  1HTP A;  3K5N A;  5KNB A;  1Q1E A;  4NMZ A;  2K28 A;  2PCF B;  1RDP D;  3K0Y A;  1G91 A;  3D6W A;  1S4Z A;  2EYH A;  2J0T D;  1ILP A;  4CJ2 C;  1WVL A;  1CI3 M;  5E1F A;  1LLR D;  2RBM A;  5LL6 S;  4KHV A;  1MSH A;  1HFG A;  1QOH A;  3S17 B;  1B3A A;  2ENB A;  1GHJ A;  3G7L A;  4BY1 B;  3RZD B;  1JB3 A;  1EZ8 A;  3QG1 A;  2Z1C A;  3SEB A;  3FKI B;  3PMF A;  4BA2 I;  3NHH A;  4BA1 I;  4KY6 A;  5EKL A;  3HP3 A;  2F0S A;  2OF1 A;  3ND9 A;  5FOB B;  1F9S A;  3NE5 B;  3K57 A;  1EYA A;  4FF2 A;  3SR1 A;  2PNR C;  1QIL A;  1SYC A;  1LT5 D;  5IGC A;  2L55 A;  3IL8 A;  2WV6 D;  1STG A;  2ZT9 C;  1SJE D;  3R3O A;  1DOM A;  3CHB D;  3NK9 A;  4C56 C;  4KK7 A;  2L1B A;  4KKU A;  2RKS A;  1FNW A;  4O42 A;  4A93 B;  3C1F A;  2K1B A;  2EYJ A;  3RLF A;  4HTH A;  1B2T A;  1Y8N B;  1E0B A;  2K03 A;  4IZ8 A;  4OHJ A;  2BE5 C;  1CM9 A;  3BYY B;  2KUM A;  3FEW X;  2JA5 B;  1I50 B;  4G7O C;  3NWS A;  5EKK A;  1KDB A;  3HEJ A;  3MC0 B;  2B2Y A;  1Z6H A;  5C4Z A;  3WOF A;  3OMC A;  1UAP A;  3VYR A;  1PXU A;  1YNN D;  1F2M A;  3LX0 A;  3J7A V;  1FNU A;  1L0Y B;  2K04 A;  1LTA D;  1TU2 B;  1SNM A;  5CV6 A;  2BOS A;  5E3F A;  1STY A;  1LT6 D;  1XXG A;  5KYL A;  3TP6 A;  4C3J B;  3TDQ A;  5BN4 A;  4S3S A;  1NAP A;  3TP5 A;  4M8A A;  1R9T B;  1WD1 A;  1BF4 A;  3NSW A;  4G4K A;  2EJG C;  1S5F D;  3GV3 A;  5CV9 A;  4OO1 I;  1G29 1;  1VCI A;  4R9W A;  2B2U C;  4CKB A;  3NTK A;  3P20 A;  1GUT A;  2IX3 A;  1EY6 A;  5C3X A;  1R4P B;  4KJN A;  3KK7 A;  3S2D B;  1KDA A;  5I6W A;  2AUK A;  2JSO A;  5JVH 3;  4FF1 A;  1H9M A;  1PZJ D;  4Z9C B;  4XQN A;  3QJY A;  4C3I G;  1CA5 A;  1PTO C;  2F0H A;  5J1Z A;  2M9V A;  4K6L A;  4G7Z C;  4ZKB B;  3SK4 A;  1B9M A;  3S1N B;  1TWH B;  5IOD A;  1IKL A;  4ODG A;  1NCV A;  2B8F A;  1EL0 A;  2FMM A;  1RCV D;  3KLS X;  5EBD A;  3R8B A;  3TP7 A;  2E74 C;  2C5C A;  4MIU A;  3FMC A;  3H91 A;  4ABN A;  1HA5 A;  2PW7 A;  1K8M A;  5G3L F;  4HMJ A;  3L9A X;  4KHZ A;  3NTI A;  2IPK D;  1SFO B;  2X69 A;  3VR2 A;  3M7G A;  3OPO A;  3AU7 A;  1PFB A;  4KN4 C;  2XVS A;  3FPP A;  2IW3 A;  3DM1 A;  1TT2 A;  1VMC A;  1X3P A;  2O5J C;  1HA6 A;  2F0W A;  3NBH A;  4F7X A;  2XRS D;  1KNA A;  1EY7 A;  3VR4 A;  4FP5 D;  5A2Q L;  5ELF A;  3IFT A;  2AUJ D;  2JA8 B;  3NQI A;  5EPL A;  2NTS A;  1EIH A;  4M1U B;  3H3V C;  2E75 C;  2KQ3 A;  4IUP A;  1RTN A;  2VB2 X;  1SYG A;  4PQX A;  5I9O A;  3CQZ B;  1BCP D;  1BDO A;  1SND A;  3MXG A;  1WTW A;  4WFN 3;  3VYS A;  5ISR A;  2N88 A;  1BUV T;  3BDL A;  2EOT A;  5M5W B;  3ERO A;  2B2T C;  1ZXT A;  2JYO A;  4H0L C;  1S5C D;  1T5X D;  2F0Q A;  5KGU A;  1L0X B;  4DXF A;  1D5X C;  3ITP A;  2F0E A;  3BDO A;  2KA7 A;  4H13 C;  2R7Z B;  2L5T A;  1YNN C;  3A55 A;  3FVQ A;  3MFY A;  3D6C A;  2Q8I B;  4XQJ A;  3TBI B;  1H9S B;  2PZW A;  3R2I A;  2ID0 A;  4OIK A;  2SNS A;  1G2T A;  3BS1 A;  4ZAI A;  3SK8 A;  1QE6 A;  4RCO A;  3DWQ A;  4X3S A;  1B50 A;  4A3B B;  4PMW A;  1HUM A;  1DOL A;  1DOK A;  4JK1 C;  1I4H A;  1MI2 A;  3J7A F;  2BA0 A;  4FXG C;  3J81 E;  3HOY B;  3OWF A;  5TSS A;  4TSS A;  3X3N A;  3M7N A;  1ILQ A;  4TQU S;  1B1Z A;  3OSO A;  4RAU C;  1PTO F;  2B2V C;  3P75 A;  3PIP 3;  1TWA B;  1I6H B;  3BVM A;  3KLR A;  4LJZ C;  2LMC B;  1OXT A;  4V0B A;  5HUR A;  3KBG A;  2EJM A;  2KOL A;  5EGT A;  2F0F A;  3VR6 A;  1Z7T A;  5IIF A;  1SBB B;  2XRQ D;  3TSS A;  1TVX A;  1AFP A;  1H9J A;  3TME A;  5FLX E;  5JEA H;  5C5M A;  1EIG A;  2B2U A;  2XWB B;  3O13 A;  3M4O B;  5I6Y A;  2NTT A;  4P2C B;  2EE1 A;  4A3J B;  4PV1 C;  3MAQ A;  4LK1 C;  5CMD A;  4V19 0;  1WTX A;  5G3L D;  1MGS A;  1BNZ A;  5A35 A;  2PPB C;  3SVM A;  2OEO A;  1MD2 D;  2WP8 J;  4NW2 A;  4CKC A;  4C3J G;  2A73 B;  5FO7 B;  5K36 G;  4HCS A;  4J1M A;  1AEX A;  4KY5 A;  3MEH A;  2F0I A;  3OIP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...