1WTPA

Hyperthermophile chromosomal protein sac7d single mutant m29f in complex with dna gcga(ubr)cgc
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
63
structure length
63
Chain Sequence
VKVKFKYKGEEKEVDTSKIKKVWRVGKFVSFTYDDNGKTGRGAVSEKDAPKELLDMLARAERE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Probing the DNA kink structure induced by the hyperthermophilic chromosomal protein Sac7d
pubmed doi rcsb
source organism Sulfolobus acidocaldarius
molecule tags Dna binding protein/dna
molecule keywords 5'-D(*GP*CP*GP*AP*(BRU)P*CP*GP*C)-3'
total genus 13
structure length 63
sequence length 63
chains with identical sequence B
ec nomenclature
pdb deposition date 2004-11-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02294 7kD_DNA_binding 7kD DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1wtpA00
2B2TC 4OIKA 1M8AA 4IUVA 1IKMA 2JP1A 1ICWA 1RTNA 4X3SA 3ONAB 1RJTA 1WD0A 1NCVA 2B2TA 1CM9A 2K1BA 1U4PA 2KEDA 2L9HA 2HUGA 3MTSA 2NYZD 5CBAE 1F9PA 1G91A 5D14A 1X3PA 4X3UA 1EL0A 2HCIA 1WTPA 1PFMA 2RA4A 1B4OA 3DM1A 4LMQD 1U4RA 4NW2A 1F2LA 2X6GA 1DOMA 3I91A 1F9QA 2K03A 1CA6A 4XDXA 2K05A 3N52A 1B50A 2EOTA 1B2TA 3UI2A 1U4MA 2B2WC 4XT1B 4CJ2C 2KOLA 1AZPA 2L1BA 1BBXC 1EQTA 5EPLA 1WTRA 2EPBA 2RVLA 5EKIA 2KEEA 1TVXA 4MN3A 1PDQA 4IUTA 4DN4M 1ESRA 1IL8A 4UAIA 1G2TA 2L11A 2HCCA 1DOKA 1Q3LA 2RSOA 4ZKBB 2K28A 1WTWA 3I8ZA 1WD1A 2RSNA 4XT3B 3LWEA 3DEPA 2SDFA 4R9WA 4RWSC 4QUFA 1AP0A 5E4XA 1HFGA 1DZ1A 5EPKA 1HRJA 3I3CA 1ML0D 5E4WC 3HP3A 1KNAA 1O7ZA 2B2UC 4OIJA 3KBXA 2DY8A 2NZ1D 1HFNA 2JYOA 1QE6A 2CVRA 1X3QA 4QUCA 1XYIA 1BNZA 1G6ZA 1RHPA 1HHVA 4ZKCB 4CJ0B 2MJ8A 1MI2A 2D9UA 1JICA 2FJ2A 1PLFA 1ILQA 2FFKB 1O80A 4IUPA 4RA8A 3H91A 5D65A 5AFWA 4ZK9B 2BDNA 1EIGA 3FPUB 4HEDA 2L4NA 3IFDA 4X3TA 4R8IA 3SVMA 2Q8RE 2K01A 1F9SA 3D6WA 4HCSA 2L12A 5DNFA 3IL8A 4RAUC 5EJWA 2XIWA 2IL8A 4MHEA 4HAEA 2EE1A 1MSHA 1G2SA 1VMCA 2DY7A 3KUPA 2B2VC 1HUNA 2VXWA 3DEOA 5T1GA 1VMPA 2FINB 2KVMA 1J9OA 2B2WA 4X3KA 4CJ1B 1WVLA 1B53A 1AZQA 1SAPA 4IUUA 2M2LA 3GV6A 1ILPA 1S4ZA 1QNKA 1RODA 4IURA 3TZDA 2KUMA 1O7YA 2J7ZA 2NWGA 2X6LA 3QO2A 2FMMA 2H1EA 4ZLTF 1EOTA 2R3ZA 5JJZA 3F2UA 5CMDA 1GUWA 2N88A 3MWYW 1B3AA 1NR2A 1X32A 4U68A 1SDFA 1HUMA 1ZXTA 5EQ0A 1XX8A 1WTQA 1U4LA 2KECA 2MGSA 1PFBA 5CORA 4IUQA 1RTOA 2K04A 2N55A 4ZAIA 1WTVA 2MPMA 1HA6A 1IKLA 1NAPA 5CBEE 2B2YA 1C8CA 1CA5A 1LV9A 3Q6SA 1KNEA 2FHTA 5T1IA 2X69A 1BO0A 2B2UA 4HSVA 1J8IA 1WTOA 5COYA 1BF4A 1DOLA 1JE4A 2MP1A 1DONA 1F9RA 2HDMA 2B2VA 1PFNA 1NR4A 1A15A 2HDLA 1WTXA 3TN2A 3P7JA 3FDTA 3R93A 3GV3A 3I90A 1MSGA 1SSOA 4O42A 1QG7A 2Q8TA 1E0BA 1EIHA 1MGSA 3G7LA 2B2YC 5EPJA
chains in the Genus database with same CATH superfamily
1EZ8A 1M8AA 1BQQT 1ICWA 1PTOB 3ULJA 3ONAB 3GDEA 3K7AB 1CM9A 4A3LG 3MTSA 2KCCA 4JYAQ 1JMCA 2WINB 1BVSA 4OO1I 4DR7Q 2OEOA 4DV1Q 5IIFA 3FPPA 4PNYA 5I2XA 1LTBD 2EOTA 5IOCA 4HTHA 1U4MA 1B2TA 4DAYA 1NSNS 2KOLA 3HOVG 4GS3A 2JA5B 2HIVA 1ICFB 2MO1A 4Y7NH 3FMCA 2OQ0A 4PMCA 3NEMA 4EGVA 1IBLL 2K28A 1YZ6A 5FLXE 1JQYD 3NENA 1Y14B 5M5XH 4A3CH 5AJ3Q 1AP0A 2I5MX 4TVAB 2D0PA 1I3QB 2A69C 1JJCB 3E0JA 5E4WC 4WFN3 2JA9A 4JI8L 2WB1B 2K5HA 4R8NA 5I4DA 3PO3B 1R4QB 3CCQA 2WAQB 2PQAA 2WB1E 5IWAQ 4KY5A 2C5CA 3HFZB 1STEA 3TSSA 3KYHC 1AH9A 2PYKA 3GO5A 2K01A 1TY0A 3IL8A 1XJVA 1N32L 4RHSA 3S1NH 1CQVA 1S5DD 3OSOA 1HXYD 5IYCH 1UE6A 1CKNB 1LTRD 1PVOA 1JJGA 2IPKD 1KLUD 2AKWB 1TIID 3K0XA 1I94Q 4IOAA 1ILPA 3BZKA 3S1RB 1M4VA 3ULPA 3W5OA 1NJIC 1ZYRD 1CI3M 1HNXQ 3BVGA 1OXXK 4DFAA 3RZOB 4ID6A 1EWCA 4K0KQ 1ZXTA 3V2TA 3M7GA 3HOWG 4Y52H 1Q1BA 1CKNA 1AE3A 2NZHA 2F0LA 2CCZA 1BCPB 1EU3A 5M3FH 1C8CA 1KAWA 1SXTA 4A3JB 4NXNL 5T1IA 4HSVA 1TKWB 1D5MC 2PPBC 1VQIA 2R7ZG 4OELB 4UP7A 2AQ1B 1ONLA 2VW9A 3R93A 2UXDL 4MTNA 4ME3A 1Z47A 1VQMA 1MSGA 4DXFA 3BG3A 2R7ZB 4OEMB 1FNUA 5EAYA 5EBDA 3HOUH 1CHPD 1TWHH 3BDCA 4OIKA 4X3SA 1I50B 1DYQA 4FXGC 2Z6KC 5EGTA 1NCVA 5FO9B 4C3HG 2XNAC 4A3BG 3W1GA 1G291 4A3JH 4J6HA 4XIGS 2PMZE 1RIPA 1VF5C 2QCPX 1WTPA 5K36G 4OX9L 4H0LC 1JT8A 2X6GA 2MUYA 1SEBD 1VQDA 1TS2A 3G6EA 4CHTB 3QIAA 3NPPA 1UE1A 3F8TA 2H4OA 2HQLA 3D8GA 3I4LA 2ZJQA 2JA6H 4LUVA 2K5WA 2IWHA 1HZBA 2KEEA 3E9IA 5FLXc 3OIQA 2BE5C 4JBJA 4QY7A 5JVG3 1VQ7A 5M5WH 4M1UB 4ABNA 2YTYA 1HZCA 4FVMA 2VY3A 5EPKA 2I07B 1H9MA 1L0WA 2PO4A 5A2QL 5E3FA 4A76A 3MXUA 1STAA 4ZKCB 3KLRA 3IKJA 4I7ZC 2DN8A 1TWGH 2BH2A 4AYBB 1RL2A 5IT9L 3A55A 1Y69U 4OHJA 2WAQG 4P2CB 1K8GA 1AZPA 2F4IA 4GKJQ 1I4QA 2N78A 1I3QH 5M5YH 2L15A 1LM0A 3KUPA 1D6EC 2B2WA 3D3RA 2YYZA 2CWPA 2M2LA 2JA5H 2DNEA 1O7YA 5F2DA 2OT2A 3FVQA 2VB3X 4XYOA 4B9XA 2R92G 4HJAA 2BDOA 3MFGA 3C3LA 2K75A 3K80C 1Z9FA 1SR3A 1SYCA 2PI2E 4AQYL 2FXQA 4L5SA 3O13A 1XTCD 3QOJA 2KCNA 1SMYD 4DR7L 4JI2Q 1XPOA 2G9HD 1O7LA 3NE5B 3BDOA 3X3MA 3A0JA 1VQGA 4DNRB 4AYBG 1YIJA 3GTPH 5C4XB 1F77A 1I94L 2E2JB 1MJCA 2R92H 1KLGD 1QUQA 1PTOH 2F0TA 1FVIA 2QF7A 2KCMA 4BBRG 1NE3A 2E2IH 3K8AA 3WDNA 4X62Q 1SE8A 3KOJA 3SDZA 3WWVA 1KRSA 4MNOA 3GTGB 2VB2X 2QEJC 1SYDA 2UU9Q 4C2MB 4XT1B 3S16H 2JA6B 1UEAB 1IW7C 2Z6KA 3JAMi 4MN3A 1Y8OB 4OGQC 5JJLA 1SE3A 1N36Q 1I5FA 2F0NA 4BBRH 4IO9A 1B3QA 3QOLA 3KBGA 4QGUA 2O2LD 4XT3B 3LWEA 4KN4C 1I4PA 3M4OB 4ZYSA 3AB9A 1EIYB 1ML0D 3HP3A 4OIJA 4BY1B 5I6WA 3T1YQ 3F2BA 4GLVB 4FF4A 1X3QA 4PG3A 1RHPA 4XQJA 3MZ5A 2D9UA 2FJ2A 1PLFA 1ILQA 4IUPA 2EYLA 1TS4A 1SE4A 2UXBL 5C3WA 1ASYA 5JJIA 2EJMA 4H13C 1Q86C 1HR0Q 1HTLD 1Q81C 3CD6A 4XQQA 3U4ZA 4IUNA 3JC66 1PHJA 1DCZA 2K7VA 3CC2A 3J80i 4KJNA 4CDCC 3DWQA 4RCOA 5CV5A 3L3OC 3OYYA 2G9DA 1RODA 4ZUIA 4PZ7A 2AUJD 2FMCA 1SFOB 2XGTA 3ITPA 2VUMH 2EYMA 1SDFA 2MNAA 3I4NG 4R4TA 1UE7A 2VS1A 5IGFA 2CW0C 5C3EG 2YU9H 2NTSA 1MIUA 3A5UA 1EUJA 2DGYA 1D5XC 4K2KA 1PRTB 2EYOA 1PH4A 4TRDA 4C3JB 1WTXA 3FDTA 4Q0FA 4JW0A 3HOYB 1UUPA 3I90A 2F0DA 4R1JA 4ZCKA 5I2YA 1OXTA 5EKLA 2WB1G 1LACA 3CMAA 1UNSA 4IFDJ 3SK6A 5BN3A 1GHJA 3NTIA 3HOYG 1RTNA 3S17B 2EYHA 4B3ML 5FOBB 4JI3Q 1TS3A 2B2TA 4B3RL 2AHOB 3TP5A 1DD2A 1VQLA 1CT1D 1H9KA 1CKMA 3S15H 4GZYC 1X3PA 2BOSA 2PZUA 4X3UA 1H9SB 5GAGC 3L2PA 3PGZA 4YCVA 1MD2D 1STBA 1BCPC 3D0FA 3MXNB 4FXKC 1XNRQ 4GOPC 4H02A 4NDXA 1CA6A 5JVH3 3RN5A 3HKZG 3U50C 3UDIA 4RH6A 1G6PA 5M9OA 3K7AH 1LLRD 4BXXG 4DN4M 2KQ3A 4BXXH 1TY2A 1KRTA 1HFGA 2PZWA 3K0YA 1W6JA 1I4GA 4APVA 4A3BB 1XNQL 1MHWC 3E0EA 3EFXD 5J1ZA 2Z8LA 2NVXH 4DK1A 2ZT9C 3RNUA 3N6RA 3EVQA 3DMUA 2XSCA 1BNZA 2XWJB 4HJ8A 3VYUA 1TWFH 2EXZA 2JXMB 2YTVA 1S5ED 2XRQD 5GADC 1D1KA 1SYFA 1NBWA 1E2WA 3D6WA 3BVZA 3TP7A 4FDBA 5CR3A 2AWNA 2WKDA 1KC8C 3TZUA 3BZCA 4HMIA 3K7UC 4ALPA 3PIPA 3U9SA 3PO3H 2H5XA 5IYDH 1A62A 2H1EA 5IP9H 3G48A 2J0TD 1C9OA 5IWAL 3ND8A 3JAME 4S3SA 2GVBA 3MWYW 2KHIA 4RMFA 2EY5A 3VA5A 1STHA 2LFNA 4B3TL 4HR7B 5KNBA 2JA8H 1PFSA 2MPMA 5AJ3L 1HA6A 1LV9A 4YWMA 3HOZG 2LSSA 2PQEA 4G57A 4JI2L 4BBRB 3SE0A 5C5MA 2HDLA 1HNWQ 3P7JA 5IP9G 1JWMD 1XNQQ 5IT9c 4A3MH 3I4MB 3E9HA 2WAQE 1S3OA 2N8NA 5HGQA 1JCKB 2AMCB 2GA4B 5DLQE 3OOCA 1VQNA 2OWOA 3A8KE 2RA4A 3DM1A 4LFCQ 1IYJB 4NMZA 5NUCA 5KIXA 2CHBD 4BY7B 1CFMA 5C3EH 4L6TB 3VR3A 3CRLC 2M9VA 3L0OA 3RMHA 4JI0L 2ES2A 1UEBA 4ZQ3A 1A2TA 3K5OA 1WTRA 1B70B 2ZXOA 1YVCA 3CMEA 2P5ZX 4DA2A 4LFBQ 2C35B 4DK3C 1WTWA 5J22A 1Q8IA 1PH7A 4LF4L 1K83H 4JCVE 2WACA 1FJGL 3CAMA 4YY3L 4A3GG 2CKZB 5TSSA 4MTKA 1V1QA 1GXDC 2KHJA 4JI8Q 2PMZB 1O7ZA 5M3MB 2E5LL 5LMNL 4HIDA 1I6HB 3G6JB 3KF8B 5ELEA 1V1PB 4X65Q 1LYLA 4DV2L 4ZK9B 2EJGC 4P73A 4QIWE 3J81E 1TWAH 4DR5L 2F0QA 4KMUC 4B3SL 4HCSA 1QVGA 1V43A 4GNXA 1T9HA 3ICEA 5C44G 4MHEA 4N8X1 1G2SA 1RKNA 4O2DA 2NVTH 1MBYA 1EU4A 1B53A 4UP9A 1BBUA 1F2YA 1PZKD 4ILWA 3VR4A 3SK4A 4TSSA 1XTDA 1PH6A 2IHEA 4DK6C 2J7ZA 1QZGA 2V4DA 2R3ZA 1I4XA 2ZM6L 1Y1WH 3KDFB 3STBD 5I9OA 2N88A 3KJPA 4PQXA 1B3AA 1X32A 4LF6L 1WOCA 4F7XA 1Y1WG 3F2DA 1LO5D 4EQ5A 4C2MH 2N55A 4DR6L 4KHPQ 3Q6SA 1BDOA 1LT6D 4FF1A 1SJHD 2Q8IB 4A3EG 2B2UA 1Y1VB 1QVFA 3TN2A 3GTQB 5ISRA 3M4PA 1RCVD 1HR0W 1GUTA 1YJNA 4DR1L 2HHHL 5EPJA 1TQOA 3UDXA 1LUZA 1S5BD 3CCVA 1OO9B 3T1HQ 1E24A 2NYZD 4DAVA 3H0GH 5G3LD 1LTTD 1F9PA 3S14H 5FLMG 3U4VA 1VF7A 2CH4A 4CDFC 2UXCQ 2PCFB 2XWBB 3TQYA 3HOUB 4XDXA 3FRPB 2ZTCA 3UI2A 1X6OA 2R7DA 2UXCL 4BS9A 1STGA 1S5FD 1B8AA 3GTOH 3I4OA 3NHHA 3RR5A 4KY7A 1SFOH 1FYCA 2RSNA 2QEXA 4WJ4A 2E5LQ 5E4XA 2ATWA 3GQBA 2QDLA 1HRJA 5C3XA 2NBFA 2KJXA 2DY8A 5KRUA 1XYIA 1G6ZA 4DR4Q 4XXEA 1MI2A 4A3CG 5CV6A 3HKZE 1EIGA 3IRBA 5M5WB 3IFDA 4OWXB 4RHRA 1R9TH 5DNFA 3JAMc 2IL8A 2J4XA 3GTJH 4HAEA 3M3YB 3MEHA 1LTGD 5ELFA 5LMNW 4LW1A 1A8VA 3VR2A 2IX0A 2HQEA 2L0CA 1XNRL 4DV1L 1GUNA 1X55A 5JEAJ 4JBMA 4POFA 3QO2A 2X6LA 3J81c 3FKIH 2LXKA 4C3HH 1Y1VG 4LF5L 4LF9Q 1NR2A 2ASBA 5IODA 3QG1A 1PFBA 2NTTA 1STNA 4C3IG 4IZ8A 4A3KH 5CBEE 3NTKA 4KTAA 1PTOD 2FHTA 1J5EL 4B3SQ 1OXUA 1Q46A 1JWUD 2ZTEA 3EROA 5J3BA 5D3IB 3SK8A 4IN3A 1NNXA 1ZKOA 5C5LA 3H6MA 1E3PA 3ER0A 5CV4A 2JA7B 1MGSA 4QIWB 5M3FG 1TT2A 2OCEA 2IX3A 4X64Q 3S16B 4NB3A 2XN9C 4DV7Q 3J7ZC 4A3KB 1SNDA 2KEDA 1FJGQ 1JOKA 3CU7A 3TMEA 1QJOA 1AN8A 1SN8A 2HCIA 5I6YA 2SNSA 3AMUA 5IE8A 2JQOA 1UWVA 1I4HA 3UDFA 4DUZQ 4QQBX 2K03A 2R7FA 2TSSA 3V96A 4IFDG 2Z1CA 1YITA 3LGJA 2EY2A 1YJ9A 2KA7A 1HZ9A 4BA2I 2E2IB 4FO2A 1PDQA 3UE0A 4JPBW 2F0KA 3OWEB 1VQ5A 4A3LH 3VDYA 1GD7A 1YHQA 1IBLQ 5GQOA 4PV1C 3EQLC 4C3JG 3VYRA 2AQ2B 2SDFA 4QUFA 4UDUC 4AYBE 3CCEA 3GTJB 1SLJA 2Z4IA 5M3MH 2A6HC 4YHHQ 4A3GB 3BYTB 1PRTD 2B2UC 2UXDQ 3CP0A 1JE5A 3B6YA 1HHVA 2XVSA 4BY7G 2A1AA 5D65A 4F8MA 3G4SA 4Q5VA 3CC4A 4HJ5A 1HPCA 1H95A 1NMFA 5KGUA 3SEBA 4R8IA 5IYCG 2MFIA 3DLLA 4PZ6A 2EJFC 1EYDA 3NBIA 3I4MH 3M3YH 2VXWA 1WVLA 1HNXL 3H09A 1AZQA 3GV6A 1B9NA 4DU9A 3TZDA 4KHZA 3M9BA 5JJZA 3F2UA 1K9MC 4JK1C 1GVPA 4P72A 3NXWA 2CQAA 5EQ0A 1A3VA 1EEFD 1GHKA 3H3VC 1QILA 4CKBA 1KIXA 3A54A 1IKLA 3CF5A 3TEHB 5I9PA 3BS1A 1OXSC 3MEFA 1J8IA 4DKAC 4BA1I 1A15A 1E2ZA 3PO2B 2IX1A 2JJQA 1EFWA 3HOUG 2VUMB 2YV5A 4DGZA 1EIHA 2DJGC 3W1BA 3PIO3 1VQ6A 1IKMA 1IZ6A 1RJTA 1T5EA 3FKIG 4DR5Q 2F0GA 2K5QA 3I72A 1O7IA 1U0LA 4A4IA 1K0SA 1PH9A 3EA6A 3AU7A 1X3EA 1S40A 4C3HB 4LMQD 4CBVA 3W3AA 5FJ8H 3D31A 1YNXA 2F0OA 2NZOA 4Z9CB 4K8IA 5E1FA 4RG1A 1DGSA 4JI5Q 2B2WC 2QA4A 4FYDA 1BBXC 1N8RC 4RCNA 3CPFA 5EKIA 4LF4Q 5IP7G 3T16A 1ESRA 4L63B 3HZXA 2B8FA 1JORA 1K3BC 1K83B 4A3JG 1WD1A 1SNPA 4HN7A 2UUBL 1AFPA 3KBXA 1YJWA 2KENA 5CV8A 1VQOA 2JA6G 3G71A 3J7AF 1B1ZA 2E2HB 4OWTB 2BH8A 4LNQA 2Q2HA 3CHBD 1V1PA 2IJ0A 4IFDH 2Q8RE 1F9SA 3GTMB 1P8LA 2PZTA 1EYGA 3CC7A 2EE1A 3CCSA 1L1OB 1SYEA 2Z0SA 2KVMA 4KKUA 4YHHL 3CPWA 4DV5Q 1JR0D 2Q2UA 4AH6A 1SAPA 3R8BA 3MFYA 1Y8NB 1A3TA 5H1SE 4HJ7A 4ZLTF 3GTKB 2VQFL 5M3MG 5GAHC 3R2IA 1Q82C 2NVQH 2Z9HA 4U68A 1LABA 2MHVA 4LFAL 2ZJRA 4IUQA 3FEWX 1RTOA 4JV5L 1QUQB 2K04A 4ODGA 1RD9D 1C7YA 2B2YA 2E8GA 1XMQL 4UY8C 5JOBA 1F9RA 1NR4A 5LMUQ 4CKEA 2NUCA 1WCMG 3KLWA 1EWHA 1VQKA 1GUOA 3DWAA 5D3DA 4QJFA 3QJYA 4IPGA 3T13A 3RUZA 2WP8J 1JC7A 5G3LF 2L9HA 1ENCA 4K8JA 5FO8B 2R61A 2DUDA 1JB7A 2RCNA 5LMNQ 4FP5D 5BR8Q 4LF7L 3GTOB 1DOMA 3BVMA 3RN2A 1VCIA 1GUGA 5L37A 2UUCL 4LK1C 3NWTA 4IALA 2F03A 1GM5A 1KXLA 2L1BA 3S1QB 4JOIA 3D6CA 1KAAA 1CK1A 1G2TA 2L11A 3OMGA 4ME5A 1VQFA 4JI7Q 4YCWA 3J80c 4MIUA 1KTKA 5ELNA 3M4OH 1A3UA 4ULLA 3PUYA 2D5DA 2JA7H 3J80E 4BY1H 2RQXA 4KKSA 1VQPA 1TR5A 2A69D 1BBWA 2NN6H 3P20A 5HGTA 1BR9A 3KJOA 2I46A 1PH1A 3D4RA 3OWFA 1H9JA 4XQNA 1YNJC 2PQAB 3TRZA 4QL5A 4B3MQ 3K5LA 3Q24A 4RAUC 3L7ZC 4IJLA 3RZOH 2QKIC 4JVZA 1VQCA 2ENBA 4JOIC 3C2PA 3ND9A 5C44B 4P75A 1K8OA 1DJRD 2DJFC 1S4ZA 2JA8G 2Z4HA 3QB3A 1PXUA 2K5NA 3T53B 2PNHA 3PIOA 3ZYYX 2EYJA 1X65A 2D0OA 3OW7A 4A3IH 1FNVA 3KFUA 4LFAQ 4TKOB 3IFTA 5C4XH 4RKLA 4ZAIA 4DK0A 1K8MA 1NAPA 5K5PA 1NY4A 4KLKA 3P1HA 4GKJL 1ZYRC 3HOWB 4FNFA 4DPGA 1BO0A 4O0AA 4B3RQ 1PZID 5IGDA 1ENAA 4DUYL 1BXTA 2B2VA 1P16A 4G7OC 4UHVA 3H94A 3HOYH 1E0BA 3HOXG 4JI5L 2R92B 1K28A 2B2YC 3BZDB 3H15A 3T1HL 4A3IG 1B7YB 5ELCA 3BDLA 3KLSX 2IHFA 3S1QH 2JEBI 5CBAE 3HEJA 3I55A 3S15B 1VQHA 3EIVA 2CQOA 5JEAH 2BA1A 2I5HA 3Q0AA 3H3VI 3T56B 1TWCB 3C1EA 1LTID 2JA8B 2ICEC 4IJHA 5ELDA 2YU9B 3EN2A 5IGBA 1I6VC 2RDHA 1K3RA 5C0XJ 2A5HA 4A93B 5CV9A 2NVYB 1IL8A 2K32A 1CHQD 2SEBD 5IYBH 2SOBA 3I8ZA 3HOZB 3J7AV 3HG9A 2DNCA 5CGKA 1L1OA 4G7ZC 1IYVA 2ID0A 5C44H 2NZ1D 1BCPD 4QUCA 4K5WA 4GOPB 1JICA 4FF3A 2FFKB 1L0XB 5C6AA 4J1MA 4HEDA 1ASZA 4OO1H 5KNDA 3ERQA 2AUKA 3SVMA 3CCRA 3K5NA 1A63A 2B39A 1IW7D 3JAML 1ZEQX 1MJEA 4DR6Q 4KHPL 1SRUA 4LF8L 4DV0Q 4A3FB 3PUVA 1VMPA 4CJ1B 1K8AC 4QCLA 4KKTA 2Y0SB 2A19A 4A3DB 4PZ8A 3W2DA 4HIOA 1QNUA 1VQBA 4BY1G 5GAEC 5CMDA 4DR1Q 4LFBL 2M00A 2RDFA 4A3FG 4AIMA 3PV0A 3BJUA 3U58A 1WTQA 1N33Q 1Q8KA 2Y0SG 4DUYQ 4A3FH 3CQZH 4HSPA 5LL6S 3Q23A 2UUCQ 4GKKL 4I65A 4BBSG 3NP8A 2ICIA 3FKIB 1RDPD 4NP5A 5LHY1 1L1OC 5COYA 5BR8L 1BF4A 4LF7Q 2JN4A 4KN7C 2EZVA 1PFNA 5IYDG 4JI1L 3P75A 3H0GG 1G51A 1E1OA 3MXPA 1CSPA 1TWCH 2A8VA 3G7LA 1X56A 3HKZB 4GNXB 1HR0L 3PO2G 3LWUA 2K4KA 3OHXC 2UXBQ 1YNJD 3SHLA 1K0RA 2EY1A 5D14A 1EL0A 4HIMA 4JC0A 1U9RA 4WRDA 1CQFA 5C4XG 1FD7D 5C4ZA 5KYIA 2IY5B 3WOEA 1DM0B 4JI0Q 4DXGA 3AYHB 4L5RC 4RGMA 1EQTA 5FLMH 1XXGA 1IHZA 4LF6Q 3CW2C 4LUOA 1SE2A 4PMBA 4K2LA 2OTJA 1DOKA 3HOXH 2HIXA 2K52A 2ZTDA 1X3GA 3R2TA 3PUZA 3KF6A 1LT3D 3DM3A 4A3MB 2UU9L 2B63B 1PYWD 3I7FA 2N49A 1HFNA 2TMPA 5BN4A 3S2HB 1X9NA 2E2HH 5JEAG 1IL2A 1Q7YC 1X3FA 4DF7A 1PH3A 1W6KA 2RHQB 1EYCA 4KI0A 3HOXB 2L4NA 2ZJPA 3GTQH 4JV5Q 1JB3A 3GP7A 3TP8A 1F2ZA 2NVTB 1VMCA 3RLNA 4G7HC 2F0IA 1TWHB 2KBNA 3S1MB 1C48A 2F0JA 3NBHB 3M85A 4DR3Q 5C0XG 5DEHA 1BOSA 1OTCA 3S14B 1J5EQ 2F4VQ 1SNMA 2FMMA 2F52A 2MQHA 2CWAA 3S9WA 4JI4Q 1GUWA 5HY6A 3AQQA 4PMWA 4A3DG 1JOOA 2A6EC 1Z7TA 5C4JH 4N9PA 1X54A 2E2DC 4F87A 2L5TA 2GVAA 4I7AA 3STBC 1VQAA 3CQZB 1CA5A 3HOWH 2XTIA 4OO1G 1KNEA 3DXJC 3J81j 4IPHA 5DM73 1Y1VH 1PH8A 1DOLA 1EWIA 2K14A 3UDGA 1E2VA 2RF4A 1EY5A 3ERSX 3NELA 2R7ZH 2Q8TA 3T4AC 1SNCA 3PQIA 1YI2A 2OTLA 2JEAI 5FKAC 4RGOS 3E3XA 1SYBA 4J15A 2VL6A 2WV6D 4XTCS 1V1OA 2A6ED 5IGCA 2EIFA 1NTGA 3J7A5 1IBMQ 1YBYA 2F0EA 2LMCB 5EKKA 3S24A 5LMUL 2YTXA 4NKLA 1HNZL 3UE1A 1EY9A 1U4RA 1ENFA 4A3EH 1V8QA 1QZHA 4BY7H 1R9TB 5DAUA 1WYDA 1FGUA 3I91A 5K36H 1UE5A 1B50A 1ESFA 3A8IE 5JAVA 3PIP3 5KYLA 4CKCA 5A35A 5J39A 2BE5D 1PTOF 4KD4A 4EX5A 4A93H 1CSQA 4KY6A 5KEEA 2VQFQ 2RCFA 5ELBA 3NBHA 3DUZA 2QILA 4RKBA 1SYGA 2EQSA 2WFWA 2UUBQ 3TDQA 5KNCA 1JJ2A 2I0QA 4DR2Q 2JA5G 1QE6A 1ET6A 2F3IA 3A8JE 4OWWB 3I4MG 1WTHA 1XMOQ 4R4IA 4P71A 1PYBA 3H91A 2BDNA 3NQTA 2AWOA 4BWGB 3MA2B 3GTLH 4X3TA 4LWCA 2O4XA 2B63G 3HKSA 3SR1A 4XYQA 2NVQB 2F0MA 3M4YA 4AQYQ 2K5VA 2DY7A 4IOCA 3V05A 2B2VC 3DEOA 5T1GA 1KQSA 3VA7A 3OTOL 3KF6B 1YNND 1PYSB 1EFID 2K5DA 2RHSB 4YIJA 1E22A 2K6AA 2CFMA 3NQIA 2KUMA 4IQZA 2NWGA 3OTOQ 1C4QA 4YCUA 1AEXA 2EY6A 4DV3L 2F0FA 2E74C 1HH2P 2B63H 2MGSA 2KECA 5CORA 3VYSA 1LT5D 4TQUS 1QOHA 5CYUA 3QWNA 3URYA 1EYAA 2RDGA 4F88A 3AFPA 3E5SA 2OXPA 4KJOA 1WTOA 4GN5A 3HOVB 2HDMA 2CH4W 2F1MA 3Q8DA 2LKVA 5DM63 1I4RA 4K5XA 2F4VL 4GKKQ 1VS0A 4DAMA 3TBIB 4JI3L 4NXMQ 4J8QA 4X66L 2F0SA 5FJ8G 1KDAA 4B08A 1LT4D 4C3IB 1KABA 1PV4A 4A3DH 2EDGA 4MZ9A 5JPNC 2B3GA 3H3VH 1VDZA 2UUAL 2R93B 4DNTB 1PRTC 1SNQA 2VZAA 1F9QA 2NVXB 3MC0B 1A2UA 3N52A 4DV6L 1UAPA 2HT1A 2C9OA 2EPBA 2ZXPA 3TS0A 1TVXA 3VYTA 1W2BA 4C3JH 4GNXC 1BKBA 2RSOA 3OPOA 4DR3L 4LAAA 4LJZC 1E7ZA 1FNWA 3EJIA 2PNRC 4R9WA 4LUZA 4JI6L 1NUCA 1STYA 5E7NA 4HIKA 4B3TQ 2NB0A 1W3SA 4A3BH 3L9AX 5HURA 4KK7A 3PF4A 3S17H 4JI6Q 3CCMA 1JOQA 1EQQA 4CJ0B 3S1RH 2MJ8A 2NVYH 1WCMB 5AFWA 5M5XB 3NK9A 3CKIB 2VUMG 3KF8A 1G91A 5ELOA 1GKHA 1TU2B 1IBKQ 1M90C 4CDEC 1KD1C 2ZXRA 4ZRZA 2KHSA 1TS5A 3CRKC 3KK7A 2AQ3B 3NUCA 1D8LA 4JBWA 3BU2A 4QF4A 3DWPA 1CKOA 3PSIA 1EQVA 2VQEL 4DV7L 1PTOC 1IYUA 4C1NK 2HD3A 1S72A 1EEID 2IW3A 1KHIA 4K6DA 3S1NB 3K58A 5M5YB 3J81i 3GD7A 3J81L 2BCOA 1U4LA 2XRSD 1HCZA 3K6OA 3F1ZA 1WTVA 1N33L 3S2HH 3C1FA 4DUZL 2JSOA 3T51B 2NN6I 1HNZQ 3SK5A 4DR4L 3RLFA 1QVCA 3J7YW 1H9SA 4H44C 4IFDI 1C0AA 4KV6A 1PA6A 4UPAA 4O42A 4RGNA 3S2DH 5FLXL 1D1IA 2VNUD 4R4OA 3PCOB 4IUVA 4YWKA 2D2CC 4H7BA 4EQNA 2K1BA 4LF8Q 2F0PA 1N34L 2K50A 1U5KA 4A3EB 2OF1A 3GTKH 1B4OA 4OXPA 4WJWA 3MVVA 2PW5A 1F2LA 1H9RA 4L5QA 1HTPA 4HCEA 3I2ZA 2E2JH 4CJ2C 1WI5A 4JI4L 3WOFA 5EPLA 1HNWL 4LF5Q 4LF9L 4IUTA 2R6GA 3CXCA 4GLAC 3A5ZB 1Q3LA 1EOVA 5BN5A 3PUWA 1EY8A 3PUXA 4X64L 2D62A 3DEPA 2F0WA 3ULLA 1DZ1A 3VR5A 4DR2L 1E1TA 1DXMA 1LTLA 4JI1Q 3KDFA 2A73B 3HGBA 1FGBD 1CZGA 5C0XI 1K73C 4O1NA 4JI7L 1WFQA 4RA8A 3FHWA 5IP7H 4L5TA 3RLOA 2JA7G 1SROA 1GUSA 1XWEA 3SXHA 1FL0A 1QB5D 2QGQA 1G8ZD 1TXYA 1KDBA 5IGGA 4HMJA 1V9PA 3CCUA 1J9OA 4U673 4X3KA 3LNNA 2F0HA 1L0YB 2HHHQ 4X6AH 4HJ9A 1SMYC 1EIFA 1VQ4A 1GJXA 1ET9A 1Y8PB 5LL6X 2VQEQ 3CCJA 1EOTA 1M1KC 1SNOA 2K33A 2I5LX 4YWLA 3CCLA 5EBCA 1J6QA 1N9WA 2A68D 2SNMA 4KHVA 2A74C 4DAPA 1O78A 1HJPA 1EY4A 2RKSA 3K57A 3HS0C 4EVOA 3FP9A 2PI2A 1WCMH 4OX9Q 1JE4A 3F2CA 3GTLB 2F3WA 1YNNC 2BA0A 4IPDA 3I4NH 5JPMC 2O5IC 4K0KL 1SSOA 1XMOL 5IYBG 1PRTF 3OIPA 4YY3Q 2GN5A 1BUVT 3TS2A 2JP1A 1Q1EA 3TP6A 4QMGA 1WD0A 4P74A 2WIIB 1XPRA 2G5DA 1U4PA 2HUGA 3A56A 2WKCA 2E76C 4OONA 1PFMA 4V0BA 3D4DA 4NW2A 4QB4A 4FF2A 1Q90A 3NSWA 3QR8A 1N32Q 1KL9A 2Z6BA 3PF5A 2K05A 3K5MA 1T5XD 3IAYA 4LFCL 4EQOA 3C46A 3H0GB 4N8FA 4DV2Q 4N9TA 4NPSA 3E6ZX 1N36L 2UUAQ 4ZKBB 1QWYA 3TREA 4JYAL 2KCTA 3NWSA 4RWSC 4DV0L 2NN6G 2N3SA 1B9MA 1EZ6A 3U9OA 3OMCA 1NMGA 1KNAA 4DAYB 3NTHA 1CUKA 1I50H 4X62L 5M3FB 1TWFB 1XMQQ 2PW7A 3MXNA 4B9WA 2Q2IA 3OW2A 3AEVA 1N34Q 2EYPA 4R4QA 2RBMA 4GN4B 3SGIA 2OQKA 3GTMH 1Q12A 5EJWA 2R93H 1CZWA 1D5ZC 2XIWA 4G4KA 2EVBA 4DV4L 2JK8A 1FR3A 3KLSA 5FK9C 2R93G 3I73A 2ALYB 4CDDC 2EYFA 4RFBA 2FINB 1XPUA 4IUUA 1WJJA 4L8JA 4CGYB 4DV3Q 3K59A 1QNKA 2QW7A 1EY7A 2E75C 3PMFA 4NXNQ 1Y1WB 4DV5L 3HOZH 2QDBA 2A68C 1RF2D 1PH2A 2V1CC 1L2FA 1B44D 4ZUJA 1YHAA 4RGTA 5CV7A 4DV4Q 3S1MH 1BCPF 4V190 4A75A 4KD3A 2X69A 3ZJYC 3HOVH 5JJKA 4Y7NB 1F2MA 4GOPA 3A74A 1TWAB 1QCBD 1D2BA 1EY6A 3EBEA 3S2DB 3MAQA 1R4PB 1HQRD 3PO3G 4NXML 1EY0A 2LS01 3K81C 2O5JC 1YHBA 1S5CD 1LTAD 2B2TC 4BBSH 5IY0A 1MKHA 4POGA 1YEZA 5CC4A 2MO0A 3BYYB 5FO7B 3I4NB 3I56A 4WORA 2B29A 3PO2H 2F3VA 5C3EB 4OL7A 4A3IB 4A3GH 4E6IA 2Y0SE 1HZAA 3X3NA 1GO3E 1SJED 2RVLA 3A7AB 4K6LA 4C56C 1I6HH 4UAIA 2HCCA 4A3MG 1IBML 1OXVA 2F0UA 3M7NA 1D7QA 4FXDA 4DV6Q 1VQJA 3D4WA 4R4CA 1VQ8A 1IBKL 3I3CA 4JG2A 2A6HD 3VR6A 1HQMC 2JYOA 4K5VA 2CVRA 1II3A 2ZM6Q 3I70A 1KDCA 1TWGB 1Z6HA 1O80A 1JWSD 1SBBB 1VQEA 5GROA 1GOZA 1SMXA 3FPUB 2IT1A 3LX0A 3RZDB 2L12A 1PH5A 5C4HA 1PZJD 2LXJA 1MSHA 1CTMA 1HUNA 4GLXA 4EQPA 2L55A 4DNIA 4C1NI 5IGEA 3MXGA 4IURA 3J80L 4IPCA 4M8AA 3DHQA 4X65L 2B8GA 1A6XA 3R3OA 3RD4A 3AFQA 3A7LA 3RZDH 2LY7A 3HRZC 3GTGH 5IT9E 1HUMA 3Q22A 1XX8A 2Q2TA 1LTSD 5C4JB 5C0XH 4JBKA 4BBSB 4GN3B 4WJ3M 1PMRA 3MHBA 1AW7A 4C3IH 5A2QE 4A3KG 4UP8A 2MP1A 1A0IA 1DONA 1VQ9A 3T1YL 1EQRA 3M4QA 3GV3A 1IXRA 3GTPB 2JE6I 4A93G 2EXDA 1HA5A 1QG7A 2F0VA 4X66Q 2CW0D 1AE2A 4K14A
chains in the Genus database with same CATH topology
1EZ8A 1M8AA 1BQQT 1ICWA 1PTOB 3ONAB 3K7AB 1CM9A 3MTSA 2KCCA 2WINB 4OO1I 2OEOA 5IIFA 3FPPA 4PNYA 5I2XA 1LTBD 2EOTA 5IOCA 4HTHA 1U4MA 1B2TA 4DAYA 1NSNS 2KOLA 2JA5B 3FMCA 4PMCA 4EGVA 2K28A 5FLXE 1JQYD 1AP0A 1I3QB 2A69C 3E0JA 5E4WC 4WFN3 2WB1B 4R8NA 5I4DA 3PO3B 1R4QB 2WAQB 4KY5A 2C5CA 1STEA 3TSSA 2PYKA 3GO5A 2K01A 1TY0A 3IL8A 4RHSA 1CQVA 1S5DD 3OSOA 1HXYD 1LTRD 2IPKD 1KLUD 1TIID 1ILPA 3S1RB 1M4VA 1ZYRD 1CI3M 3BVGA 1OXXK 4DFAA 3RZOB 4ID6A 1EWCA 1ZXTA 3V2TA 3M7GA 1Q1BA 2F0LA 1BCPB 1EU3A 1C8CA 1SXTA 4A3JB 5T1IA 4HSVA 1TKWB 1D5MC 2PPBC 2AQ1B 1ONLA 3R93A 1Z47A 1MSGA 4DXFA 3BG3A 2R7ZB 1FNUA 5EBDA 1CHPD 4OIKA 3BDCA 4X3SA 1I50B 1DYQA 4FXGC 5EGTA 5FO9B 1NCVA 4C3HG 2XNAC 1G291 4J6HA 4XIGS 1VF5C 2QCPX 1WTPA 5K36G 4H0LC 2X6GA 2MUYA 1SEBD 1TS2A 4CHTB 3QIAA 3NPPA 2H4OA 3D8GA 3I4LA 2K5WA 2IWHA 2KEEA 3OIQA 2BE5C 5JVG3 4M1UB 4ABNA 4FVMA 5EPKA 2I07B 1H9MA 2PO4A 5A2QL 5E3FA 3MXUA 1STAA 4ZKCB 3KLRA 3IKJA 4I7ZC 2DN8A 4AYBB 1Y69U 5IT9L 3A55A 4OHJA 4P2CB 1AZPA 2F4IA 1I4QA 3KUPA 1D6EC 2B2WA 3D3RA 2YYZA 2M2LA 2DNEA 1O7YA 5F2DA 2OT2A 3FVQA 2VB3X 4XYOA 4B9XA 2BDOA 3MFGA 3C3LA 1SYCA 3O13A 1XTCD 3QOJA 2KCNA 1SMYD 2G9HD 1O7LA 3NE5B 3BDOA 3X3MA 4DNRB 5C4XB 1F77A 2E2JB 1KLGD 1PTOH 2F0TA 2QF7A 3WDNA 3SDZA 3GTGB 2VB2X 2QEJC 1SYDA 4C2MB 4XT1B 2JA6B 1UEAB 1IW7C 4MN3A 1Y8OB 4OGQC 1SE3A 2F0NA 3QOLA 3KBGA 2O2LD 4XT3B 3LWEA 4KN4C 1I4PA 3M4OB 4ZYSA 3AB9A 1ML0D 3HP3A 4OIJA 4BY1B 5I6WA 4FF4A 1X3QA 1RHPA 4XQJA 3MZ5A 2D9UA 2FJ2A 1PLFA 1ILQA 4IUPA 2EYLA 1TS4A 1SE4A 5C3WA 2EJMA 4H13C 1HTLD 4XQQA 4IUNA 1DCZA 2K7VA 4KJNA 3DWQA 4RCOA 5CV5A 3L3OC 2G9DA 1RODA 4ZUIA 2AUJD 2FMCA 1SFOB 3ITPA 2EYMA 1SDFA 5IGFA 2CW0C 2NTSA 1D5XC 4K2KA 1PRTB 2EYOA 4TRDA 4C3JB 1WTXA 3FDTA 4Q0FA 3HOYB 1UUPA 3I90A 2F0DA 5I2YA 1OXTA 5EKLA 1LACA 1UNSA 4IFDJ 3SK6A 5BN3A 1GHJA 3NTIA 1RTNA 3S17B 2EYHA 5FOBB 1TS3A 2B2TA 3TP5A 1DD2A 1CT1D 1H9KA 4GZYC 1X3PA 2BOSA 2PZUA 4X3UA 1H9SB 1MD2D 1STBA 1BCPC 4FXKC 4NDXA 1CA6A 5JVH3 4RH6A 5M9OA 1LLRD 4DN4M 2KQ3A 1TY2A 1HFGA 2PZWA 3K0YA 1W6JA 1I4GA 4A3BB 5J1ZA 3EFXD 2Z8LA 4DK1A 2ZT9C 3N6RA 3EVQA 3DMUA 2XSCA 1BNZA 2XWJB 3VYUA 2EXZA 2JXMB 1S5ED 2XRQD 1D1KA 1SYFA 1E2WA 3D6WA 3BVZA 3TP7A 5CR3A 2AWNA 2WKDA 3TZUA 4HMIA 3U9SA 2H1EA 2J0TD 3ND8A 3JAME 4S3SA 3MWYW 2EY5A 3VA5A 1STHA 2LFNA 4HR7B 5KNBA 2MPMA 1HA6A 1LV9A 2PQEA 4G57A 4BBRB 3SE0A 5C5MA 2HDLA 3P7JA 1JWMD 3I4MB 1JCKB 2GA4B 3OOCA 3A8KE 2RA4A 3DM1A 4NMZA 5NUCA 5KIXA 2CHBD 4BY7B 1CFMA 4L6TB 3VR3A 3CRLC 2M9VA 3RMHA 4ZQ3A 1A2TA 3K5OA 1WTRA 2ZXOA 4DA2A 1WTWA 5J22A 1Q8IA 2WACA 5TSSA 1GXDC 2PMZB 1O7ZA 5M3MB 1I6HB 3G6JB 5ELEA 1V1PB 4ZK9B 2EJGC 3J81E 2F0QA 4KMUC 4HCSA 1V43A 4MHEA 1G2SA 1RKNA 1MBYA 1EU4A 1B53A 1F2YA 1PZKD 4ILWA 3VR4A 3SK4A 4TSSA 2J7ZA 2V4DA 2R3ZA 1I4XA 5I9OA 2N88A 4PQXA 1B3AA 1X32A 4F7XA 1LO5D 2N55A 3Q6SA 1BDOA 1LT6D 4FF1A 1SJHD 2Q8IB 2B2UA 1Y1VB 3TN2A 3GTQB 5ISRA 1RCVD 1GUTA 5EPJA 1TQOA 1S5BD 1OO9B 2NYZD 4DAVA 5G3LD 1LTTD 1F9PA 1VF7A 2PCFB 2XWBB 3HOUB 4XDXA 3FRPB 3UI2A 4BS9A 1STGA 1S5FD 3NHHA 4KY7A 1FYCA 2RSNA 5E4XA 3GQBA 1HRJA 5C3XA 2NBFA 2KJXA 2DY8A 5KRUA 1XYIA 1G6ZA 4XXEA 1MI2A 5CV6A 1EIGA 5M5WB 3IFDA 4RHRA 5DNFA 2IL8A 2J4XA 4HAEA 3M3YB 3MEHA 1LTGD 5ELFA 3VR2A 2IX0A 2HQEA 2L0CA 1GUNA 5JEAJ 3QO2A 2X6LA 1NR2A 5IODA 3QG1A 1PFBA 2NTTA 1STNA 4C3IG 4IZ8A 5CBEE 3NTKA 4KTAA 1PTOD 2FHTA 1OXUA 1JWUD 3EROA 5D3IB 3SK8A 4IN3A 5C5LA 1ZKOA 3H6MA 5CV4A 2JA7B 1MGSA 4QIWB 1TT2A 2IX3A 3S16B 2XN9C 4A3KB 1SNDA 2KEDA 1JOKA 3CU7A 3TMEA 1QJOA 1AN8A 2HCIA 5I6YA 2SNSA 3AMUA 1I4HA 2K03A 2TSSA 3V96A 4IFDG 2Z1CA 2EY2A 2KA7A 4BA2I 2E2IB 4FO2A 1PDQA 2F0KA 3OWEB 4PV1C 3EQLC 4C3JG 3VYRA 2AQ2B 2SDFA 4QUFA 4UDUC 3GTJB 2Z4IA 2A6HC 4A3GB 3BYTB 1PRTD 2B2UC 1HHVA 2XVSA 4F8MA 5D65A 4Q5VA 1HPCA 5KGUA 3SEBA 4R8IA 2EJFC 1EYDA 3NBIA 2VXWA 1WVLA 3H09A 1AZQA 3GV6A 1B9NA 4DU9A 3TZDA 4KHZA 5JJZA 3F2UA 4JK1C 3NXWA 2CQAA 5EQ0A 1A3VA 1EEFD 1GHKA 3H3VC 1QILA 4CKBA 3A54A 1IKLA 5I9PA 3BS1A 1OXSC 1J8IA 4BA1I 1A15A 1E2ZA 3PO2B 2IX1A 2VUMB 4DGZA 1EIHA 3PIO3 1IKMA 1RJTA 1T5EA 2F0GA 2K5QA 3I72A 3EA6A 3AU7A 4C3HB 4LMQD 4CBVA 3W3AA 3D31A 2F0OA 4Z9CB 4K8IA 5E1FA 2B2WC 4FYDA 1BBXC 4RCNA 5EKIA 3T16A 1ESRA 4L63B 3HZXA 2B8FA 1JORA 1K83B 1WD1A 1SNPA 4HN7A 1AFPA 3KBXA 5CV8A 3J7AF 1B1ZA 2E2HB 3CHBD 1V1PA 2IJ0A 4IFDH 2Q8RE 1F9SA 3GTMB 2PZTA 2EE1A 1SYEA 2KVMA 4KKUA 1JR0D 1SAPA 3R8BA 3MFYA 1Y8NB 1A3TA 4ZLTF 3GTKB 3R2IA 4U68A 1LABA 2MHVA 4IUQA 3FEWX 1RTOA 2K04A 4ODGA 1RD9D 2B2YA 5JOBA 1F9RA 1NR4A 4CKEA 2NUCA 1EWHA 1GUOA 3DWAA 5D3DA 3QJYA 3T13A 3RUZA 2WP8J 1JC7A 5G3LF 2L9HA 1ENCA 4K8JA 5FO8B 2R61A 4FP5D 3GTOB 1DOMA 3BVMA 1VCIA 1GUGA 4LK1C 3NWTA 4IALA 2F03A 2L1BA 3S1QB 3D6CA 1KAAA 1CK1A 1G2TA 2L11A 3OMGA 4ME5A 4MIUA 1KTKA 1A3UA 4ULLA 3PUYA 2D5DA 3J80E 2RQXA 4KKSA 1TR5A 2A69D 2NN6H 3P20A 5HGTA 1BR9A 2I46A 3D4RA 3OWFA 1H9JA 4XQNA 1YNJC 3K5LA 3Q24A 4RAUC 3L7ZC 2QKIC 2ENBA 3C2PA 3ND9A 5C44B 1K8OA 1DJRD 1S4ZA 2Z4HA 3QB3A 1PXUA 3T53B 3ZYYX 2EYJA 3OW7A 1FNVA 4TKOB 3IFTA 4RKLA 4ZAIA 4DK0A 1K8MA 1NAPA 5K5PA 3P1HA 1ZYRC 3HOWB 4FNFA 1BO0A 1PZID 5IGDA 1ENAA 1BXTA 2B2VA 4G7OC 3H94A 1E0BA 2R92B 2B2YC 3BZDB 5ELCA 3BDLA 3KLSX 2JEBI 5CBAE 3HEJA 3S15B 5JEAH 2BA1A 3Q0AA 3T56B 1TWCB 3C1EA 1LTID 2JA8B 2ICEC 5ELDA 2YU9B 5IGBA 1I6VC 2RDHA 5C0XJ 2A5HA 4A93B 5CV9A 2NVYB 1IL8A 2K32A 1CHQD 2SEBD 2SOBA 3I8ZA 3HOZB 3J7AV 3HG9A 2DNCA 5CGKA 4G7ZC 1IYVA 2ID0A 2NZ1D 1BCPD 4QUCA 4K5WA 1JICA 4FF3A 2FFKB 1L0XB 5C6AA 4J1MA 4HEDA 4OO1H 5KNDA 3ERQA 2AUKA 3SVMA 3K5NA 2B39A 1IW7D 3JAML 1ZEQX 4A3FB 3PUVA 1VMPA 4CJ1B 4QCLA 4KKTA 2Y0SB 4A3DB 3W2DA 1QNUA 5CMDA 2M00A 2RDFA 3PV0A 1WTQA 5LL6S 4HSPA 3Q23A 4I65A 3NP8A 2ICIA 3FKIB 1RDPD 4NP5A 5LHY1 5COYA 1BF4A 4KN7C 2EZVA 1PFNA 3P75A 3MXPA 3G7LA 3HKZB 3LWUA 3OHXC 1YNJD 3SHLA 2EY1A 5D14A 1EL0A 1U9RA 4WRDA 1CQFA 1FD7D 5C4ZA 5KYIA 3WOEA 1DM0B 4DXGA 4RGMA 1EQTA 1XXGA 1IHZA 1SE2A 4PMBA 4K2LA 1DOKA 3R2TA 3PUZA 1LT3D 4A3MB 2B63B 1PYWD 1HFNA 2TMPA 5BN4A 3S2HB 5JEAG 4DF7A 1W6KA 1EYCA 4KI0A 3HOXB 2L4NA 1JB3A 3GP7A 3TP8A 1F2ZA 2NVTB 1VMCA 4G7HC 2F0IA 1TWHB 3S1MB 1C48A 2F0JA 3M85A 5C0XG 5DEHA 1BOSA 3S14B 1SNMA 2FMMA 3S9WA 1GUWA 4PMWA 1JOOA 2A6EC 1Z7TA 4N9PA 2E2DC 4F87A 2L5TA 3CQZB 1CA5A 4OO1G 1KNEA 3DXJC 5DM73 1DOLA 1E2VA 1EY5A 2Q8TA 3T4AC 1SNCA 2JEAI 5FKAC 4RGOS 1SYBA 2WV6D 4XTCS 1V1OA 2A6ED 5IGCA 2F0EA 2LMCB 5EKKA 4NKLA 1EY9A 1U4RA 1ENFA 1V8QA 1R9TB 5DAUA 3I91A 5K36H 1B50A 1ESFA 3A8IE 5JAVA 3PIP3 5KYLA 4CKCA 5A35A 5J39A 2BE5D 1PTOF 4KD4A 4KY6A 5KEEA 5ELBA 3NBHA 3DUZA 2QILA 4RKBA 1SYGA 3TDQA 5KNCA 1QE6A 1ET6A 3A8JE 3H91A 2BDNA 2AWOA 3NQTA 4BWGB 3MA2B 4X3TA 2O4XA 3SR1A 4XYQA 2NVQB 2F0MA 3M4YA 2DY7A 3V05A 2B2VC 3DEOA 5T1GA 3VA7A 1YNND 1EFID 2K5DA 4YIJA 2K6AA 3NQIA 2KUMA 4IQZA 2NWGA 1C4QA 1AEXA 2EY6A 2F0FA 2E74C 2MGSA 2KECA 5CORA 3VYSA 1LT5D 4TQUS 1QOHA 5CYUA 3QWNA 3URYA 1EYAA 2RDGA 4F88A 3E5SA 2OXPA 4KJOA 1WTOA 3HOVB 2HDMA 2F1MA 2LKVA 5DM63 1I4RA 4K5XA 3TBIB 4J8QA 2F0SA 1KDAA 4B08A 1LT4D 4C3IB 1KABA 2EDGA 5JPNC 1VDZA 2R93B 4DNTB 1PRTC 1SNQA 1F9QA 2NVXB 3MC0B 1A2UA 3N52A 1UAPA 2C9OA 2EPBA 2ZXPA 1TVXA 3VYTA 3OPOA 2RSOA 4LAAA 4LJZC 1FNWA 3EJIA 2PNRC 4R9WA 1NUCA 1STYA 2NB0A 3L9AX 5HURA 4KK7A 1JOQA 4CJ0B 2MJ8A 1WCMB 5AFWA 5M5XB 3NK9A 3CKIB 3KF8A 1G91A 1TU2B 2ZXRA 4ZRZA 2KHSA 1TS5A 3CRKC 3KK7A 2AQ3B 3NUCA 4JBWA 4QF4A 3DWPA 1EQVA 1PTOC 1IYUA 4C1NK 1EEID 2IW3A 4K6DA 3S1NB 3K58A 5M5YB 3GD7A 3J81L 2BCOA 1U4LA 2XRSD 1HCZA 3K6OA 1WTVA 3C1FA 2JSOA 3T51B 2NN6I 3SK5A 3RLFA 3J7YW 1H9SA 4H44C 4IFDI 4KV6A 4O42A 4RGNA 2VNUD 5FLXL 1D1IA 4IUVA 2D2CC 4H7BA 4EQNA 2K1BA 2F0PA 4A3EB 2OF1A 1B4OA 4WJWA 3MVVA 2PW5A 1F2LA 1H9RA 1HTPA 4HCEA 4CJ2C 3WOFA 5EPLA 4IUTA 2R6GA 1Q3LA 5BN5A 3PUWA 1EY8A 3PUXA 2D62A 3DEPA 2F0WA 1DZ1A 3VR5A 1DXMA 2A73B 3HGBA 1FGBD 1CZGA 5C0XI 4O1NA 4RA8A 1GUSA 1XWEA 3SXHA 1QB5D 1G8ZD 1KDBA 5IGGA 4HMJA 1J9OA 4U673 4X3KA 3LNNA 2F0HA 1L0YB 1SMYC 1GJXA 1ET9A 1Y8PB 5LL6X 1EOTA 1SNOA 2K33A 5EBCA 2A68D 2SNMA 4KHVA 2A74C 4DAPA 1O78A 2RKSA 1EY4A 3K57A 3HS0C 4EVOA 1JE4A 3GTLB 2F3WA 1YNNC 2BA0A 5JPMC 2O5IC 1SSOA 1PRTF 3OIPA 1BUVT 2JP1A 1Q1EA 3TP6A 4QMGA 1WD0A 2WIIB 1U4PA 2HUGA 3A56A 2WKCA 2E76C 1PFMA 4V0BA 3D4DA 4NW2A 4QB4A 4FF2A 1Q90A 3NSWA 2K05A 3K5MA 1T5XD 3IAYA 4EQOA 3C46A 3H0GB 4N9TA 3E6ZX 4ZKBB 1QWYA 3NWSA 4RWSC 2NN6G 1B9MA 1EZ6A 3U9OA 3OMCA 1KNAA 3NTHA 5M3FB 1TWFB 2PW7A 3MXNA 4B9WA 2EYPA 2RBMA 1Q12A 5EJWA 1CZWA 1D5ZC 2XIWA 4G4KA 2EVBA 1FR3A 3KLSA 5FK9C 3I73A 2EYFA 4RFBA 2FINB 4IUUA 4L8JA 4CGYB 3K59A 1QNKA 1EY7A 2E75C 3PMFA 1Y1WB 2QDBA 2A68C 1RF2D 1B44D 4ZUJA 4RGTA 5CV7A 1BCPF 4V190 4KD3A 2X69A 4Y7NB 1F2MA 1TWAB 1QCBD 1D2BA 1EY6A 3S2DB 3MAQA 1R4PB 1HQRD 1EY0A 2LS01 2O5JC 1S5CD 1LTAD 2B2TC 5CC4A 3BYYB 5FO7B 3I4NB 4WORA 2F3VA 5C3EB 4OL7A 4A3IB 4E6IA 3X3NA 3A7AB 1SJED 2RVLA 4K6LA 4C56C 4UAIA 2HCCA 1OXVA 2F0UA 3M7NA 4FXDA 3D4WA 3I3CA 2A6HD 3VR6A 1HQMC 2JYOA 4K5VA 2CVRA 1II3A 3I70A 1KDCA 1TWGB 1Z6HA 1O80A 1JWSD 1SBBB 1GOZA 3FPUB 2IT1A 3LX0A 3RZDB 2L12A 5C4HA 1PZJD 1MSHA 1CTMA 1HUNA 4EQPA 2L55A 4C1NI 5IGEA 3MXGA 4IURA 3J80L 4M8AA 3DHQA 2B8GA 1A6XA 3R3OA 3RD4A 3A7LA 2LY7A 3HRZC 5IT9E 1HUMA 3Q22A 1XX8A 1LTSD 5C4JB 5C0XH 4BBSB 1PMRA 3MHBA 1AW7A 5A2QE 2MP1A 1DONA 3GV3A 3GTPB 2JE6I 1HA5A 1QG7A 2F0VA 2CW0D 4K14A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2B2T C;  4OIK A;  1M8A A;  4IUV A;  1IKM A;  2JP1 A;  1ICW A;  1RTN A;  4X3S A;  3ONA B;  1RJT A;  1WD0 A;  1NCV A;  2B2T A;  1CM9 A;  2K1B A;  1U4P A;  2KED A;  2L9H A;  2HUG A;  3MTS A;  2NYZ D;  5CBA E;  1F9P A;  1G91 A;  5D14 A;  1X3P A;  4X3U A;  1EL0 A;  2HCI A;  1WTP A;  1PFM A;  2RA4 A;  1B4O A;  3DM1 A;  4LMQ D;  1U4R A;  4NW2 A;  1F2L A;  2X6G A;  1DOM A;  3I91 A;  1F9Q A;  2K03 A;  1CA6 A;  4XDX A;  2K05 A;  3N52 A;  1B50 A;  2EOT A;  1B2T A;  3UI2 A;  1U4M A;  2B2W C;  4XT1 B;  4CJ2 C;  2KOL A;  1AZP A;  2L1B A;  1BBX C;  1EQT A;  5EPL A;  1WTR A;  2EPB A;  2RVL A;  5EKI A;  2KEE A;  1TVX A;  4MN3 A;  1PDQ A;  4IUT A;  4DN4 M;  1ESR A;  1IL8 A;  4UAI A;  1G2T A;  2L11 A;  2HCC A;  1DOK A;  1Q3L A;  2RSO A;  4ZKB B;  2K28 A;  1WTW A;  3I8Z A;  1WD1 A;  2RSN A;  4XT3 B;  3LWE A;  3DEP A;  2SDF A;  4R9W A;  4RWS C;  4QUF A;  1AP0 A;  5E4X A;  1HFG A;  1DZ1 A;  5EPK A;  1HRJ A;  3I3C A;  1ML0 D;  5E4W C;  3HP3 A;  1KNA A;  1O7Z A;  2B2U C;  4OIJ A;  3KBX A;  2DY8 A;  2NZ1 D;  1HFN A;  2JYO A;  1QE6 A;  2CVR A;  1X3Q A;  4QUC A;  1XYI A;  1BNZ A;  1G6Z A;  1RHP A;  1HHV A;  4ZKC B;  4CJ0 B;  2MJ8 A;  1MI2 A;  2D9U A;  1JIC A;  2FJ2 A;  1PLF A;  1ILQ A;  2FFK B;  1O80 A;  4IUP A;  4RA8 A;  3H91 A;  5D65 A;  5AFW A;  4ZK9 B;  2BDN A;  1EIG A;  3FPU B;  4HED A;  2L4N A;  3IFD A;  4X3T A;  4R8I A;  3SVM A;  2Q8R E;  2K01 A;  1F9S A;  3D6W A;  4HCS A;  2L12 A;  5DNF A;  3IL8 A;  4RAU C;  5EJW A;  2XIW A;  2IL8 A;  4MHE A;  4HAE A;  2EE1 A;  1MSH A;  1G2S A;  1VMC A;  2DY7 A;  3KUP A;  2B2V C;  1HUN A;  2VXW A;  3DEO A;  5T1G A;  1VMP A;  2FIN B;  2KVM A;  1J9O A;  2B2W A;  4X3K A;  4CJ1 B;  1WVL A;  1B53 A;  1AZQ A;  1SAP A;  4IUU A;  2M2L A;  3GV6 A;  1ILP A;  1S4Z A;  1QNK A;  1ROD A;  4IUR A;  3TZD A;  2KUM A;  1O7Y A;  2J7Z A;  2NWG A;  2X6L A;  3QO2 A;  2FMM A;  2H1E A;  4ZLT F;  1EOT A;  2R3Z A;  5JJZ A;  3F2U A;  5CMD A;  1GUW A;  2N88 A;  3MWY W;  1B3A A;  1NR2 A;  1X32 A;  4U68 A;  1SDF A;  1HUM A;  1ZXT A;  5EQ0 A;  1XX8 A;  1WTQ A;  1U4L A;  2KEC A;  2MGS A;  1PFB A;  5COR A;  4IUQ A;  1RTO A;  2K04 A;  2N55 A;  4ZAI A;  1WTV A;  2MPM A;  1HA6 A;  1IKL A;  1NAP A;  5CBE E;  2B2Y A;  1C8C A;  1CA5 A;  1LV9 A;  3Q6S A;  1KNE A;  2FHT A;  5T1I A;  2X69 A;  1BO0 A;  2B2U A;  4HSV A;  1J8I A;  1WTO A;  5COY A;  1BF4 A;  1DOL A;  1JE4 A;  2MP1 A;  1DON A;  1F9R A;  2HDM A;  2B2V A;  1PFN A;  1NR4 A;  1A15 A;  2HDL A;  1WTX A;  3TN2 A;  3P7J A;  3FDT A;  3R93 A;  3GV3 A;  3I90 A;  1MSG A;  1SSO A;  4O42 A;  1QG7 A;  2Q8T A;  1E0B A;  1EIH A;  1MGS A;  3G7L A;  2B2Y C;  5EPJ A; 
#chains in the Genus database with same CATH topology
 1EZ8 A;  1M8A A;  1BQQ T;  1ICW A;  1PTO B;  3ULJ A;  3ONA B;  3GDE A;  3K7A B;  1CM9 A;  4A3L G;  3MTS A;  2KCC A;  4JYA Q;  1JMC A;  2WIN B;  1BVS A;  4OO1 I;  4DR7 Q;  2OEO A;  4DV1 Q;  5IIF A;  3FPP A;  4PNY A;  5I2X A;  1LTB D;  2EOT A;  5IOC A;  4HTH A;  1U4M A;  1B2T A;  4DAY A;  1NSN S;  2KOL A;  3HOV G;  4GS3 A;  2JA5 B;  2HIV A;  1ICF B;  2MO1 A;  4Y7N H;  3FMC A;  2OQ0 A;  4PMC A;  3NEM A;  4EGV A;  1IBL L;  2K28 A;  1YZ6 A;  5FLX E;  1JQY D;  3NEN A;  1Y14 B;  5M5X H;  4A3C H;  5AJ3 Q;  1AP0 A;  2I5M X;  4TVA B;  2D0P A;  1I3Q B;  2A69 C;  1JJC B;  3E0J A;  5E4W C;  4WFN 3;  2JA9 A;  4JI8 L;  2WB1 B;  2K5H A;  4R8N A;  5I4D A;  3PO3 B;  1R4Q B;  3CCQ A;  2WAQ B;  2PQA A;  2WB1 E;  5IWA Q;  4KY5 A;  2C5C A;  3HFZ B;  1STE A;  3TSS A;  3KYH C;  1AH9 A;  2PYK A;  3GO5 A;  2K01 A;  1TY0 A;  3IL8 A;  1XJV A;  1N32 L;  4RHS A;  3S1N H;  1CQV A;  1S5D D;  3OSO A;  1HXY D;  5IYC H;  1UE6 A;  1CKN B;  1LTR D;  1PVO A;  1JJG A;  2IPK D;  1KLU D;  2AKW B;  1TII D;  3K0X A;  1I94 Q;  4IOA A;  1ILP A;  3BZK A;  3S1R B;  1M4V A;  3ULP A;  3W5O A;  1NJI C;  1ZYR D;  1CI3 M;  1HNX Q;  3BVG A;  1OXX K;  4DFA A;  3RZO B;  4ID6 A;  1EWC A;  4K0K Q;  1ZXT A;  3V2T A;  3M7G A;  3HOW G;  4Y52 H;  1Q1B A;  1CKN A;  1AE3 A;  2NZH A;  2F0L A;  2CCZ A;  1BCP B;  1EU3 A;  5M3F H;  1C8C A;  1KAW A;  1SXT A;  4A3J B;  4NXN L;  5T1I A;  4HSV A;  1TKW B;  1D5M C;  2PPB C;  1VQI A;  2R7Z G;  4OEL B;  4UP7 A;  2AQ1 B;  1ONL A;  2VW9 A;  3R93 A;  2UXD L;  4MTN A;  4ME3 A;  1Z47 A;  1VQM A;  1MSG A;  4DXF A;  3BG3 A;  2R7Z B;  4OEM B;  1FNU A;  5EAY A;  5EBD A;  3HOU H;  1CHP D;  1TWH H;  3BDC A;  4OIK A;  4X3S A;  1I50 B;  1DYQ A;  4FXG C;  2Z6K C;  5EGT A;  1NCV A;  5FO9 B;  4C3H G;  2XNA C;  4A3B G;  3W1G A;  1G29 1;  4A3J H;  4J6H A;  4XIG S;  2PMZ E;  1RIP A;  1VF5 C;  2QCP X;  1WTP A;  5K36 G;  4OX9 L;  4H0L C;  1JT8 A;  2X6G A;  2MUY A;  1SEB D;  1VQD A;  1TS2 A;  3G6E A;  4CHT B;  3QIA A;  3NPP A;  1UE1 A;  3F8T A;  2H4O A;  2HQL A;  3D8G A;  3I4L A;  2ZJQ A;  2JA6 H;  4LUV A;  2K5W A;  2IWH A;  1HZB A;  2KEE A;  3E9I A;  5FLX c;  3OIQ A;  2BE5 C;  4JBJ A;  4QY7 A;  5JVG 3;  1VQ7 A;  5M5W H;  4M1U B;  4ABN A;  2YTY A;  1HZC A;  4FVM A;  2VY3 A;  5EPK A;  2I07 B;  1H9M A;  1L0W A;  2PO4 A;  5A2Q L;  5E3F A;  4A76 A;  3MXU A;  1STA A;  4ZKC B;  3KLR A;  3IKJ A;  4I7Z C;  2DN8 A;  1TWG H;  2BH2 A;  4AYB B;  1RL2 A;  5IT9 L;  3A55 A;  1Y69 U;  4OHJ A;  2WAQ G;  4P2C B;  1K8G A;  1AZP A;  2F4I A;  4GKJ Q;  1I4Q A;  2N78 A;  1I3Q H;  5M5Y H;  2L15 A;  1LM0 A;  3KUP A;  1D6E C;  2B2W A;  3D3R A;  2YYZ A;  2CWP A;  2M2L A;  2JA5 H;  2DNE A;  1O7Y A;  5F2D A;  2OT2 A;  3FVQ A;  2VB3 X;  4XYO A;  4B9X A;  2R92 G;  4HJA A;  2BDO A;  3MFG A;  3C3L A;  2K75 A;  3K80 C;  1Z9F A;  1SR3 A;  1SYC A;  2PI2 E;  4AQY L;  2FXQ A;  4L5S A;  3O13 A;  1XTC D;  3QOJ A;  2KCN A;  1SMY D;  4DR7 L;  4JI2 Q;  1XPO A;  2G9H D;  1O7L A;  3NE5 B;  3BDO A;  3X3M A;  3A0J A;  1VQG A;  4DNR B;  4AYB G;  1YIJ A;  3GTP H;  5C4X B;  1F77 A;  1I94 L;  2E2J B;  1MJC A;  2R92 H;  1KLG D;  1QUQ A;  1PTO H;  2F0T A;  1FVI A;  2QF7 A;  2KCM A;  4BBR G;  1NE3 A;  2E2I H;  3K8A A;  3WDN A;  4X62 Q;  1SE8 A;  3KOJ A;  3SDZ A;  3WWV A;  1KRS A;  4MNO A;  3GTG B;  2VB2 X;  2QEJ C;  1SYD A;  2UU9 Q;  4C2M B;  4XT1 B;  3S16 H;  2JA6 B;  1UEA B;  1IW7 C;  2Z6K A;  3JAM i;  4MN3 A;  1Y8O B;  4OGQ C;  5JJL A;  1SE3 A;  1N36 Q;  1I5F A;  2F0N A;  4BBR H;  4IO9 A;  1B3Q A;  3QOL A;  3KBG A;  4QGU A;  2O2L D;  4XT3 B;  3LWE A;  4KN4 C;  1I4P A;  3M4O B;  4ZYS A;  3AB9 A;  1EIY B;  1ML0 D;  3HP3 A;  4OIJ A;  4BY1 B;  5I6W A;  3T1Y Q;  3F2B A;  4GLV B;  4FF4 A;  1X3Q A;  4PG3 A;  1RHP A;  4XQJ A;  3MZ5 A;  2D9U A;  2FJ2 A;  1PLF A;  1ILQ A;  4IUP A;  2EYL A;  1TS4 A;  1SE4 A;  2UXB L;  5C3W A;  1ASY A;  5JJI A;  2EJM A;  4H13 C;  1Q86 C;  1HR0 Q;  1HTL D;  1Q81 C;  3CD6 A;  4XQQ A;  3U4Z A;  4IUN A;  3JC6 6;  1PHJ A;  1DCZ A;  2K7V A;  3CC2 A;  3J80 i;  4KJN A;  4CDC C;  3DWQ A;  4RCO A;  5CV5 A;  3L3O C;  3OYY A;  2G9D A;  1ROD A;  4ZUI A;  4PZ7 A;  2AUJ D;  2FMC A;  1SFO B;  2XGT A;  3ITP A;  2VUM H;  2EYM A;  1SDF A;  2MNA A;  3I4N G;  4R4T A;  1UE7 A;  2VS1 A;  5IGF A;  2CW0 C;  5C3E G;  2YU9 H;  2NTS A;  1MIU A;  3A5U A;  1EUJ A;  2DGY A;  1D5X C;  4K2K A;  1PRT B;  2EYO A;  1PH4 A;  4TRD A;  4C3J B;  1WTX A;  3FDT A;  4Q0F A;  4JW0 A;  3HOY B;  1UUP A;  3I90 A;  2F0D A;  4R1J A;  4ZCK A;  5I2Y A;  1OXT A;  5EKL A;  2WB1 G;  1LAC A;  3CMA A;  1UNS A;  4IFD J;  3SK6 A;  5BN3 A;  1GHJ A;  3NTI A;  3HOY G;  1RTN A;  3S17 B;  2EYH A;  4B3M L;  5FOB B;  4JI3 Q;  1TS3 A;  2B2T A;  4B3R L;  2AHO B;  3TP5 A;  1DD2 A;  1VQL A;  1CT1 D;  1H9K A;  1CKM A;  3S15 H;  4GZY C;  1X3P A;  2BOS A;  2PZU A;  4X3U A;  1H9S B;  5GAG C;  3L2P A;  3PGZ A;  4YCV A;  1MD2 D;  1STB A;  1BCP C;  3D0F A;  3MXN B;  4FXK C;  1XNR Q;  4GOP C;  4H02 A;  4NDX A;  1CA6 A;  5JVH 3;  3RN5 A;  3HKZ G;  3U50 C;  3UDI A;  4RH6 A;  1G6P A;  5M9O A;  3K7A H;  1LLR D;  4BXX G;  4DN4 M;  2KQ3 A;  4BXX H;  1TY2 A;  1KRT A;  1HFG A;  2PZW A;  3K0Y A;  1W6J A;  1I4G A;  4APV A;  4A3B B;  1XNQ L;  1MHW C;  3E0E A;  3EFX D;  5J1Z A;  2Z8L A;  2NVX H;  4DK1 A;  2ZT9 C;  3RNU A;  3N6R A;  3EVQ A;  3DMU A;  2XSC A;  1BNZ A;  2XWJ B;  4HJ8 A;  3VYU A;  1TWF H;  2EXZ A;  2JXM B;  2YTV A;  1S5E D;  2XRQ D;  5GAD C;  1D1K A;  1SYF A;  1NBW A;  1E2W A;  3D6W A;  3BVZ A;  3TP7 A;  4FDB A;  5CR3 A;  2AWN A;  2WKD A;  1KC8 C;  3TZU A;  3BZC A;  4HMI A;  3K7U C;  4ALP A;  3PIP A;  3U9S A;  3PO3 H;  2H5X A;  5IYD H;  1A62 A;  2H1E A;  5IP9 H;  3G48 A;  2J0T D;  1C9O A;  5IWA L;  3ND8 A;  3JAM E;  4S3S A;  2GVB A;  3MWY W;  2KHI A;  4RMF A;  2EY5 A;  3VA5 A;  1STH A;  2LFN A;  4B3T L;  4HR7 B;  5KNB A;  2JA8 H;  1PFS A;  2MPM A;  5AJ3 L;  1HA6 A;  1LV9 A;  4YWM A;  3HOZ G;  2LSS A;  2PQE A;  4G57 A;  4JI2 L;  4BBR B;  3SE0 A;  5C5M A;  2HDL A;  1HNW Q;  3P7J A;  5IP9 G;  1JWM D;  1XNQ Q;  5IT9 c;  4A3M H;  3I4M B;  3E9H A;  2WAQ E;  1S3O A;  2N8N A;  5HGQ A;  1JCK B;  2AMC B;  2GA4 B;  5DLQ E;  3OOC A;  1VQN A;  2OWO A;  3A8K E;  2RA4 A;  3DM1 A;  4LFC Q;  1IYJ B;  4NMZ A;  5NUC A;  5KIX A;  2CHB D;  4BY7 B;  1CFM A;  5C3E H;  4L6T B;  3VR3 A;  3CRL C;  2M9V A;  3L0O A;  3RMH A;  4JI0 L;  2ES2 A;  1UEB A;  4ZQ3 A;  1A2T A;  3K5O A;  1WTR A;  1B70 B;  2ZXO A;  1YVC A;  3CME A;  2P5Z X;  4DA2 A;  4LFB Q;  2C35 B;  4DK3 C;  1WTW A;  5J22 A;  1Q8I A;  1PH7 A;  4LF4 L;  1K83 H;  4JCV E;  2WAC A;  1FJG L;  3CAM A;  4YY3 L;  4A3G G;  2CKZ B;  5TSS A;  4MTK A;  1V1Q A;  1GXD C;  2KHJ A;  4JI8 Q;  2PMZ B;  1O7Z A;  5M3M B;  2E5L L;  5LMN L;  4HID A;  1I6H B;  3G6J B;  3KF8 B;  5ELE A;  1V1P B;  4X65 Q;  1LYL A;  4DV2 L;  4ZK9 B;  2EJG C;  4P73 A;  4QIW E;  3J81 E;  1TWA H;  4DR5 L;  2F0Q A;  4KMU C;  4B3S L;  4HCS A;  1QVG A;  1V43 A;  4GNX A;  1T9H A;  3ICE A;  5C44 G;  4MHE A;  4N8X 1;  1G2S A;  1RKN A;  4O2D A;  2NVT H;  1MBY A;  1EU4 A;  1B53 A;  4UP9 A;  1BBU A;  1F2Y A;  1PZK D;  4ILW A;  3VR4 A;  3SK4 A;  4TSS A;  1XTD A;  1PH6 A;  2IHE A;  4DK6 C;  2J7Z A;  1QZG A;  2V4D A;  2R3Z A;  1I4X A;  2ZM6 L;  1Y1W H;  3KDF B;  3STB D;  5I9O A;  2N88 A;  3KJP A;  4PQX A;  1B3A A;  1X32 A;  4LF6 L;  1WOC A;  4F7X A;  1Y1W G;  3F2D A;  1LO5 D;  4EQ5 A;  4C2M H;  2N55 A;  4DR6 L;  4KHP Q;  3Q6S A;  1BDO A;  1LT6 D;  4FF1 A;  1SJH D;  2Q8I B;  4A3E G;  2B2U A;  1Y1V B;  1QVF A;  3TN2 A;  3GTQ B;  5ISR A;  3M4P A;  1RCV D;  1HR0 W;  1GUT A;  1YJN A;  4DR1 L;  2HHH L;  5EPJ A;  1TQO A;  3UDX A;  1LUZ A;  1S5B D;  3CCV A;  1OO9 B;  3T1H Q;  1E24 A;  2NYZ D;  4DAV A;  3H0G H;  5G3L D;  1LTT D;  1F9P A;  3S14 H;  5FLM G;  3U4V A;  1VF7 A;  2CH4 A;  4CDF C;  2UXC Q;  2PCF B;  2XWB B;  3TQY A;  3HOU B;  4XDX A;  3FRP B;  2ZTC A;  3UI2 A;  1X6O A;  2R7D A;  2UXC L;  4BS9 A;  1STG A;  1S5F D;  1B8A A;  3GTO H;  3I4O A;  3NHH A;  3RR5 A;  4KY7 A;  1SFO H;  1FYC A;  2RSN A;  2QEX A;  4WJ4 A;  2E5L Q;  5E4X A;  2ATW A;  3GQB A;  2QDL A;  1HRJ A;  5C3X A;  2NBF A;  2KJX A;  2DY8 A;  5KRU A;  1XYI A;  1G6Z A;  4DR4 Q;  4XXE A;  1MI2 A;  4A3C G;  5CV6 A;  3HKZ E;  1EIG A;  3IRB A;  5M5W B;  3IFD A;  4OWX B;  4RHR A;  1R9T H;  5DNF A;  3JAM c;  2IL8 A;  2J4X A;  3GTJ H;  4HAE A;  3M3Y B;  3MEH A;  1LTG D;  5ELF A;  5LMN W;  4LW1 A;  1A8V A;  3VR2 A;  2IX0 A;  2HQE A;  2L0C A;  1XNR L;  4DV1 L;  1GUN A;  1X55 A;  5JEA J;  4JBM A;  4POF A;  3QO2 A;  2X6L A;  3J81 c;  3FKI H;  2LXK A;  4C3H H;  1Y1V G;  4LF5 L;  4LF9 Q;  1NR2 A;  2ASB A;  5IOD A;  3QG1 A;  1PFB A;  2NTT A;  1STN A;  4C3I G;  4IZ8 A;  4A3K H;  5CBE E;  3NTK A;  4KTA A;  1PTO D;  2FHT A;  1J5E L;  4B3S Q;  1OXU A;  1Q46 A;  1JWU D;  2ZTE A;  3ERO A;  5J3B A;  5D3I B;  3SK8 A;  4IN3 A;  1NNX A;  1ZKO A;  5C5L A;  3H6M A;  1E3P A;  3ER0 A;  5CV4 A;  2JA7 B;  1MGS A;  4QIW B;  5M3F G;  1TT2 A;  2OCE A;  2IX3 A;  4X64 Q;  3S16 B;  4NB3 A;  2XN9 C;  4DV7 Q;  3J7Z C;  4A3K B;  1SND A;  2KED A;  1FJG Q;  1JOK A;  3CU7 A;  3TME A;  1QJO A;  1AN8 A;  1SN8 A;  2HCI A;  5I6Y A;  2SNS A;  3AMU A;  5IE8 A;  2JQO A;  1UWV A;  1I4H A;  3UDF A;  4DUZ Q;  4QQB X;  2K03 A;  2R7F A;  2TSS A;  3V96 A;  4IFD G;  2Z1C A;  1YIT A;  3LGJ A;  2EY2 A;  1YJ9 A;  2KA7 A;  1HZ9 A;  4BA2 I;  2E2I B;  4FO2 A;  1PDQ A;  3UE0 A;  4JPB W;  2F0K A;  3OWE B;  1VQ5 A;  4A3L H;  3VDY A;  1GD7 A;  1YHQ A;  1IBL Q;  5GQO A;  4PV1 C;  3EQL C;  4C3J G;  3VYR A;  2AQ2 B;  2SDF A;  4QUF A;  4UDU C;  4AYB E;  3CCE A;  3GTJ B;  1SLJ A;  2Z4I A;  5M3M H;  2A6H C;  4YHH Q;  4A3G B;  3BYT B;  1PRT D;  2B2U C;  2UXD Q;  3CP0 A;  1JE5 A;  3B6Y A;  1HHV A;  2XVS A;  4BY7 G;  2A1A A;  5D65 A;  4F8M A;  3G4S A;  4Q5V A;  3CC4 A;  4HJ5 A;  1HPC A;  1H95 A;  1NMF A;  5KGU A;  3SEB A;  4R8I A;  5IYC G;  2MFI A;  3DLL A;  4PZ6 A;  2EJF C;  1EYD A;  3NBI A;  3I4M H;  3M3Y H;  2VXW A;  1WVL A;  1HNX L;  3H09 A;  1AZQ A;  3GV6 A;  1B9N A;  4DU9 A;  3TZD A;  4KHZ A;  3M9B A;  5JJZ A;  3F2U A;  1K9M C;  4JK1 C;  1GVP A;  4P72 A;  3NXW A;  2CQA A;  5EQ0 A;  1A3V A;  1EEF D;  1GHK A;  3H3V C;  1QIL A;  4CKB A;  1KIX A;  3A54 A;  1IKL A;  3CF5 A;  3TEH B;  5I9P A;  3BS1 A;  1OXS C;  3MEF A;  1J8I A;  4DKA C;  4BA1 I;  1A15 A;  1E2Z A;  3PO2 B;  2IX1 A;  2JJQ A;  1EFW A;  3HOU G;  2VUM B;  2YV5 A;  4DGZ A;  1EIH A;  2DJG C;  3W1B A;  3PIO 3;  1VQ6 A;  1IKM A;  1IZ6 A;  1RJT A;  1T5E A;  3FKI G;  4DR5 Q;  2F0G A;  2K5Q A;  3I72 A;  1O7I A;  1U0L A;  4A4I A;  1K0S A;  1PH9 A;  3EA6 A;  3AU7 A;  1X3E A;  1S40 A;  4C3H B;  4LMQ D;  4CBV A;  3W3A A;  5FJ8 H;  3D31 A;  1YNX A;  2F0O A;  2NZO A;  4Z9C B;  4K8I A;  5E1F A;  4RG1 A;  1DGS A;  4JI5 Q;  2B2W C;  2QA4 A;  4FYD A;  1BBX C;  1N8R C;  4RCN A;  3CPF A;  5EKI A;  4LF4 Q;  5IP7 G;  3T16 A;  1ESR A;  4L63 B;  3HZX A;  2B8F A;  1JOR A;  1K3B C;  1K83 B;  4A3J G;  1WD1 A;  1SNP A;  4HN7 A;  2UUB L;  1AFP A;  3KBX A;  1YJW A;  2KEN A;  5CV8 A;  1VQO A;  2JA6 G;  3G71 A;  3J7A F;  1B1Z A;  2E2H B;  4OWT B;  2BH8 A;  4LNQ A;  2Q2H A;  3CHB D;  1V1P A;  2IJ0 A;  4IFD H;  2Q8R E;  1F9S A;  3GTM B;  1P8L A;  2PZT A;  1EYG A;  3CC7 A;  2EE1 A;  3CCS A;  1L1O B;  1SYE A;  2Z0S A;  2KVM A;  4KKU A;  4YHH L;  3CPW A;  4DV5 Q;  1JR0 D;  2Q2U A;  4AH6 A;  1SAP A;  3R8B A;  3MFY A;  1Y8N B;  1A3T A;  5H1S E;  4HJ7 A;  4ZLT F;  3GTK B;  2VQF L;  5M3M G;  5GAH C;  3R2I A;  1Q82 C;  2NVQ H;  2Z9H A;  4U68 A;  1LAB A;  2MHV A;  4LFA L;  2ZJR A;  4IUQ A;  3FEW X;  1RTO A;  4JV5 L;  1QUQ B;  2K04 A;  4ODG A;  1RD9 D;  1C7Y A;  2B2Y A;  2E8G A;  1XMQ L;  4UY8 C;  5JOB A;  1F9R A;  1NR4 A;  5LMU Q;  4CKE A;  2NUC A;  1WCM G;  3KLW A;  1EWH A;  1VQK A;  1GUO A;  3DWA A;  5D3D A;  4QJF A;  3QJY A;  4IPG A;  3T13 A;  3RUZ A;  2WP8 J;  1JC7 A;  5G3L F;  2L9H A;  1ENC A;  4K8J A;  5FO8 B;  2R61 A;  2DUD A;  1JB7 A;  2RCN A;  5LMN Q;  4FP5 D;  5BR8 Q;  4LF7 L;  3GTO B;  1DOM A;  3BVM A;  3RN2 A;  1VCI A;  1GUG A;  5L37 A;  2UUC L;  4LK1 C;  3NWT A;  4IAL A;  2F03 A;  1GM5 A;  1KXL A;  2L1B A;  3S1Q B;  4JOI A;  3D6C A;  1KAA A;  1CK1 A;  1G2T A;  2L11 A;  3OMG A;  4ME5 A;  1VQF A;  4JI7 Q;  4YCW A;  3J80 c;  4MIU A;  1KTK A;  5ELN A;  3M4O H;  1A3U A;  4ULL A;  3PUY A;  2D5D A;  2JA7 H;  3J80 E;  4BY1 H;  2RQX A;  4KKS A;  1VQP A;  1TR5 A;  2A69 D;  1BBW A;  2NN6 H;  3P20 A;  5HGT A;  1BR9 A;  3KJO A;  2I46 A;  1PH1 A;  3D4R A;  3OWF A;  1H9J A;  4XQN A;  1YNJ C;  2PQA B;  3TRZ A;  4QL5 A;  4B3M Q;  3K5L A;  3Q24 A;  4RAU C;  3L7Z C;  4IJL A;  3RZO H;  2QKI C;  4JVZ A;  1VQC A;  2ENB A;  4JOI C;  3C2P A;  3ND9 A;  5C44 B;  4P75 A;  1K8O A;  1DJR D;  2DJF C;  1S4Z A;  2JA8 G;  2Z4H A;  3QB3 A;  1PXU A;  2K5N A;  3T53 B;  2PNH A;  3PIO A;  3ZYY X;  2EYJ A;  1X65 A;  2D0O A;  3OW7 A;  4A3I H;  1FNV A;  3KFU A;  4LFA Q;  4TKO B;  3IFT A;  5C4X H;  4RKL A;  4ZAI A;  4DK0 A;  1K8M A;  1NAP A;  5K5P A;  1NY4 A;  4KLK A;  3P1H A;  4GKJ L;  1ZYR C;  3HOW B;  4FNF A;  4DPG A;  1BO0 A;  4O0A A;  4B3R Q;  1PZI D;  5IGD A;  1ENA A;  4DUY L;  1BXT A;  2B2V A;  1P16 A;  4G7O C;  4UHV A;  3H94 A;  3HOY H;  1E0B A;  3HOX G;  4JI5 L;  2R92 B;  1K28 A;  2B2Y C;  3BZD B;  3H15 A;  3T1H L;  4A3I G;  1B7Y B;  5ELC A;  3BDL A;  3KLS X;  2IHF A;  3S1Q H;  2JEB I;  5CBA E;  3HEJ A;  3I55 A;  3S15 B;  1VQH A;  3EIV A;  2CQO A;  5JEA H;  2BA1 A;  2I5H A;  3Q0A A;  3H3V I;  3T56 B;  1TWC B;  3C1E A;  1LTI D;  2JA8 B;  2ICE C;  4IJH A;  5ELD A;  2YU9 B;  3EN2 A;  5IGB A;  1I6V C;  2RDH A;  1K3R A;  5C0X J;  2A5H A;  4A93 B;  5CV9 A;  2NVY B;  1IL8 A;  2K32 A;  1CHQ D;  2SEB D;  5IYB H;  2SOB A;  3I8Z A;  3HOZ B;  3J7A V;  3HG9 A;  2DNC A;  5CGK A;  1L1O A;  4G7Z C;  1IYV A;  2ID0 A;  5C44 H;  2NZ1 D;  1BCP D;  4QUC A;  4K5W A;  4GOP B;  1JIC A;  4FF3 A;  2FFK B;  1L0X B;  5C6A A;  4J1M A;  4HED A;  1ASZ A;  4OO1 H;  5KND A;  3ERQ A;  2AUK A;  3SVM A;  3CCR A;  3K5N A;  1A63 A;  2B39 A;  1IW7 D;  3JAM L;  1ZEQ X;  1MJE A;  4DR6 Q;  4KHP L;  1SRU A;  4LF8 L;  4DV0 Q;  4A3F B;  3PUV A;  1VMP A;  4CJ1 B;  1K8A C;  4QCL A;  4KKT A;  2Y0S B;  2A19 A;  4A3D B;  4PZ8 A;  3W2D A;  4HIO A;  1QNU A;  1VQB A;  4BY1 G;  5GAE C;  5CMD A;  4DR1 Q;  4LFB L;  2M00 A;  2RDF A;  4A3F G;  4AIM A;  3PV0 A;  3BJU A;  3U58 A;  1WTQ A;  1N33 Q;  1Q8K A;  2Y0S G;  4DUY Q;  4A3F H;  3CQZ H;  4HSP A;  5LL6 S;  3Q23 A;  2UUC Q;  4GKK L;  4I65 A;  4BBS G;  3NP8 A;  2ICI A;  3FKI B;  1RDP D;  4NP5 A;  5LHY 1;  1L1O C;  5COY A;  5BR8 L;  1BF4 A;  4LF7 Q;  2JN4 A;  4KN7 C;  2EZV A;  1PFN A;  5IYD G;  4JI1 L;  3P75 A;  3H0G G;  1G51 A;  1E1O A;  3MXP A;  1CSP A;  1TWC H;  2A8V A;  3G7L A;  1X56 A;  3HKZ B;  4GNX B;  1HR0 L;  3PO2 G;  3LWU A;  2K4K A;  3OHX C;  2UXB Q;  1YNJ D;  3SHL A;  1K0R A;  2EY1 A;  5D14 A;  1EL0 A;  4HIM A;  4JC0 A;  1U9R A;  4WRD A;  1CQF A;  5C4X G;  1FD7 D;  5C4Z A;  5KYI A;  2IY5 B;  3WOE A;  1DM0 B;  4JI0 Q;  4DXG A;  3AYH B;  4L5R C;  4RGM A;  1EQT A;  5FLM H;  1XXG A;  1IHZ A;  4LF6 Q;  3CW2 C;  4LUO A;  1SE2 A;  4PMB A;  4K2L A;  2OTJ A;  1DOK A;  3HOX H;  2HIX A;  2K52 A;  2ZTD A;  1X3G A;  3R2T A;  3PUZ A;  3KF6 A;  1LT3 D;  3DM3 A;  4A3M B;  2UU9 L;  2B63 B;  1PYW D;  3I7F A;  2N49 A;  1HFN A;  2TMP A;  5BN4 A;  3S2H B;  1X9N A;  2E2H H;  5JEA G;  1IL2 A;  1Q7Y C;  1X3F A;  4DF7 A;  1PH3 A;  1W6K A;  2RHQ B;  1EYC A;  4KI0 A;  3HOX B;  2L4N A;  2ZJP A;  3GTQ H;  4JV5 Q;  1JB3 A;  3GP7 A;  3TP8 A;  1F2Z A;  2NVT B;  1VMC A;  3RLN A;  4G7H C;  2F0I A;  1TWH B;  2KBN A;  3S1M B;  1C48 A;  2F0J A;  3NBH B;  3M85 A;  4DR3 Q;  5C0X G;  5DEH A;  1BOS A;  1OTC A;  3S14 B;  1J5E Q;  2F4V Q;  1SNM A;  2FMM A;  2F52 A;  2MQH A;  2CWA A;  3S9W A;  4JI4 Q;  1GUW A;  5HY6 A;  3AQQ A;  4PMW A;  4A3D G;  1JOO A;  2A6E C;  1Z7T A;  5C4J H;  4N9P A;  1X54 A;  2E2D C;  4F87 A;  2L5T A;  2GVA A;  4I7A A;  3STB C;  1VQA A;  3CQZ B;  1CA5 A;  3HOW H;  2XTI A;  4OO1 G;  1KNE A;  3DXJ C;  3J81 j;  4IPH A;  5DM7 3;  1Y1V H;  1PH8 A;  1DOL A;  1EWI A;  2K14 A;  3UDG A;  1E2V A;  2RF4 A;  1EY5 A;  3ERS X;  3NEL A;  2R7Z H;  2Q8T A;  3T4A C;  1SNC A;  3PQI A;  1YI2 A;  2OTL A;  2JEA I;  5FKA C;  4RGO S;  3E3X A;  1SYB A;  4J15 A;  2VL6 A;  2WV6 D;  4XTC S;  1V1O A;  2A6E D;  5IGC A;  2EIF A;  1NTG A;  3J7A 5;  1IBM Q;  1YBY A;  2F0E A;  2LMC B;  5EKK A;  3S24 A;  5LMU L;  2YTX A;  4NKL A;  1HNZ L;  3UE1 A;  1EY9 A;  1U4R A;  1ENF A;  4A3E H;  1V8Q A;  1QZH A;  4BY7 H;  1R9T B;  5DAU A;  1WYD A;  1FGU A;  3I91 A;  5K36 H;  1UE5 A;  1B50 A;  1ESF A;  3A8I E;  5JAV A;  3PIP 3;  5KYL A;  4CKC A;  5A35 A;  5J39 A;  2BE5 D;  1PTO F;  4KD4 A;  4EX5 A;  4A93 H;  1CSQ A;  4KY6 A;  5KEE A;  2VQF Q;  2RCF A;  5ELB A;  3NBH A;  3DUZ A;  2QIL A;  4RKB A;  1SYG A;  2EQS A;  2WFW A;  2UUB Q;  3TDQ A;  5KNC A;  1JJ2 A;  2I0Q A;  4DR2 Q;  2JA5 G;  1QE6 A;  1ET6 A;  2F3I A;  3A8J E;  4OWW B;  3I4M G;  1WTH A;  1XMO Q;  4R4I A;  4P71 A;  1PYB A;  3H91 A;  2BDN A;  3NQT A;  2AWO A;  4BWG B;  3MA2 B;  3GTL H;  4X3T A;  4LWC A;  2O4X A;  2B63 G;  3HKS A;  3SR1 A;  4XYQ A;  2NVQ B;  2F0M A;  3M4Y A;  4AQY Q;  2K5V A;  2DY7 A;  4IOC A;  3V05 A;  2B2V C;  3DEO A;  5T1G A;  1KQS A;  3VA7 A;  3OTO L;  3KF6 B;  1YNN D;  1PYS B;  1EFI D;  2K5D A;  2RHS B;  4YIJ A;  1E22 A;  2K6A A;  2CFM A;  3NQI A;  2KUM A;  4IQZ A;  2NWG A;  3OTO Q;  1C4Q A;  4YCU A;  1AEX A;  2EY6 A;  4DV3 L;  2F0F A;  2E74 C;  1HH2 P;  2B63 H;  2MGS A;  2KEC A;  5COR A;  3VYS A;  1LT5 D;  4TQU S;  1QOH A;  5CYU A;  3QWN A;  3URY A;  1EYA A;  2RDG A;  4F88 A;  3AFP A;  3E5S A;  2OXP A;  4KJO A;  1WTO A;  4GN5 A;  3HOV B;  2HDM A;  2CH4 W;  2F1M A;  3Q8D A;  2LKV A;  5DM6 3;  1I4R A;  4K5X A;  2F4V L;  4GKK Q;  1VS0 A;  4DAM A;  3TBI B;  4JI3 L;  4NXM Q;  4J8Q A;  4X66 L;  2F0S A;  5FJ8 G;  1KDA A;  4B08 A;  1LT4 D;  4C3I B;  1KAB A;  1PV4 A;  4A3D H;  2EDG A;  4MZ9 A;  5JPN C;  2B3G A;  3H3V H;  1VDZ A;  2UUA L;  2R93 B;  4DNT B;  1PRT C;  1SNQ A;  2VZA A;  1F9Q A;  2NVX B;  3MC0 B;  1A2U A;  3N52 A;  4DV6 L;  1UAP A;  2HT1 A;  2C9O A;  2EPB A;  2ZXP A;  3TS0 A;  1TVX A;  3VYT A;  1W2B A;  4C3J H;  4GNX C;  1BKB A;  2RSO A;  3OPO A;  4DR3 L;  4LAA A;  4LJZ C;  1E7Z A;  1FNW A;  3EJI A;  2PNR C;  4R9W A;  4LUZ A;  4JI6 L;  1NUC A;  1STY A;  5E7N A;  4HIK A;  4B3T Q;  2NB0 A;  1W3S A;  4A3B H;  3L9A X;  5HUR A;  4KK7 A;  3PF4 A;  3S17 H;  4JI6 Q;  3CCM A;  1JOQ A;  1EQQ A;  4CJ0 B;  3S1R H;  2MJ8 A;  2NVY H;  1WCM B;  5AFW A;  5M5X B;  3NK9 A;  3CKI B;  2VUM G;  3KF8 A;  1G91 A;  5ELO A;  1GKH A;  1TU2 B;  1IBK Q;  1M90 C;  4CDE C;  1KD1 C;  2ZXR A;  4ZRZ A;  2KHS A;  1TS5 A;  3CRK C;  3KK7 A;  2AQ3 B;  3NUC A;  1D8L A;  4JBW A;  3BU2 A;  4QF4 A;  3DWP A;  1CKO A;  3PSI A;  1EQV A;  2VQE L;  4DV7 L;  1PTO C;  1IYU A;  4C1N K;  2HD3 A;  1S72 A;  1EEI D;  2IW3 A;  1KHI A;  4K6D A;  3S1N B;  3K58 A;  5M5Y B;  3J81 i;  3GD7 A;  3J81 L;  2BCO A;  1U4L A;  2XRS D;  1HCZ A;  3K6O A;  3F1Z A;  1WTV A;  1N33 L;  3S2H H;  3C1F A;  4DUZ L;  2JSO A;  3T51 B;  2NN6 I;  1HNZ Q;  3SK5 A;  4DR4 L;  3RLF A;  1QVC A;  3J7Y W;  1H9S A;  4H44 C;  4IFD I;  1C0A A;  4KV6 A;  1PA6 A;  4UPA A;  4O42 A;  4RGN A;  3S2D H;  5FLX L;  1D1I A;  2VNU D;  4R4O A;  3PCO B;  4IUV A;  4YWK A;  2D2C C;  4H7B A;  4EQN A;  2K1B A;  4LF8 Q;  2F0P A;  1N34 L;  2K50 A;  1U5K A;  4A3E B;  2OF1 A;  3GTK H;  1B4O A;  4OXP A;  4WJW A;  3MVV A;  2PW5 A;  1F2L A;  1H9R A;  4L5Q A;  1HTP A;  4HCE A;  3I2Z A;  2E2J H;  4CJ2 C;  1WI5 A;  4JI4 L;  3WOF A;  5EPL A;  1HNW L;  4LF5 Q;  4LF9 L;  4IUT A;  2R6G A;  3CXC A;  4GLA C;  3A5Z B;  1Q3L A;  1EOV A;  5BN5 A;  3PUW A;  1EY8 A;  3PUX A;  4X64 L;  2D62 A;  3DEP A;  2F0W A;  3ULL A;  1DZ1 A;  3VR5 A;  4DR2 L;  1E1T A;  1DXM A;  1LTL A;  4JI1 Q;  3KDF A;  2A73 B;  3HGB A;  1FGB D;  1CZG A;  5C0X I;  1K73 C;  4O1N A;  4JI7 L;  1WFQ A;  4RA8 A;  3FHW A;  5IP7 H;  4L5T A;  3RLO A;  2JA7 G;  1SRO A;  1GUS A;  1XWE A;  3SXH A;  1FL0 A;  1QB5 D;  2QGQ A;  1G8Z D;  1TXY A;  1KDB A;  5IGG A;  4HMJ A;  1V9P A;  3CCU A;  1J9O A;  4U67 3;  4X3K A;  3LNN A;  2F0H A;  1L0Y B;  2HHH Q;  4X6A H;  4HJ9 A;  1SMY C;  1EIF A;  1VQ4 A;  1GJX A;  1ET9 A;  1Y8P B;  5LL6 X;  2VQE Q;  3CCJ A;  1EOT A;  1M1K C;  1SNO A;  2K33 A;  2I5L X;  4YWL A;  3CCL A;  5EBC A;  1J6Q A;  1N9W A;  2A68 D;  2SNM A;  4KHV A;  2A74 C;  4DAP A;  1O78 A;  1HJP A;  1EY4 A;  2RKS A;  3K57 A;  3HS0 C;  4EVO A;  3FP9 A;  2PI2 A;  1WCM H;  4OX9 Q;  1JE4 A;  3F2C A;  3GTL B;  2F3W A;  1YNN C;  2BA0 A;  4IPD A;  3I4N H;  5JPM C;  2O5I C;  4K0K L;  1SSO A;  1XMO L;  5IYB G;  1PRT F;  3OIP A;  4YY3 Q;  2GN5 A;  1BUV T;  3TS2 A;  2JP1 A;  1Q1E A;  3TP6 A;  4QMG A;  1WD0 A;  4P74 A;  2WII B;  1XPR A;  2G5D A;  1U4P A;  2HUG A;  3A56 A;  2WKC A;  2E76 C;  4OON A;  1PFM A;  4V0B A;  3D4D A;  4NW2 A;  4QB4 A;  4FF2 A;  1Q90 A;  3NSW A;  3QR8 A;  1N32 Q;  1KL9 A;  2Z6B A;  3PF5 A;  2K05 A;  3K5M A;  1T5X D;  3IAY A;  4LFC L;  4EQO A;  3C46 A;  3H0G B;  4N8F A;  4DV2 Q;  4N9T A;  4NPS A;  3E6Z X;  1N36 L;  2UUA Q;  4ZKB B;  1QWY A;  3TRE A;  4JYA L;  2KCT A;  3NWS A;  4RWS C;  4DV0 L;  2NN6 G;  2N3S A;  1B9M A;  1EZ6 A;  3U9O A;  3OMC A;  1NMG A;  1KNA A;  4DAY B;  3NTH A;  1CUK A;  1I50 H;  4X62 L;  5M3F B;  1TWF B;  1XMQ Q;  2PW7 A;  3MXN A;  4B9W A;  2Q2I A;  3OW2 A;  3AEV A;  1N34 Q;  2EYP A;  4R4Q A;  2RBM A;  4GN4 B;  3SGI A;  2OQK A;  3GTM H;  1Q12 A;  5EJW A;  2R93 H;  1CZW A;  1D5Z C;  2XIW A;  4G4K A;  2EVB A;  4DV4 L;  2JK8 A;  1FR3 A;  3KLS A;  5FK9 C;  2R93 G;  3I73 A;  2ALY B;  4CDD C;  2EYF A;  4RFB A;  2FIN B;  1XPU A;  4IUU A;  1WJJ A;  4L8J A;  4CGY B;  4DV3 Q;  3K59 A;  1QNK A;  2QW7 A;  1EY7 A;  2E75 C;  3PMF A;  4NXN Q;  1Y1W B;  4DV5 L;  3HOZ H;  2QDB A;  2A68 C;  1RF2 D;  1PH2 A;  2V1C C;  1L2F A;  1B44 D;  4ZUJ A;  1YHA A;  4RGT A;  5CV7 A;  4DV4 Q;  3S1M H;  1BCP F;  4V19 0;  4A75 A;  4KD3 A;  2X69 A;  3ZJY C;  3HOV H;  5JJK A;  4Y7N B;  1F2M A;  4GOP A;  3A74 A;  1TWA B;  1QCB D;  1D2B A;  1EY6 A;  3EBE A;  3S2D B;  3MAQ A;  1R4P B;  1HQR D;  3PO3 G;  4NXM L;  1EY0 A;  2LS0 1;  3K81 C;  2O5J C;  1YHB A;  1S5C D;  1LTA D;  2B2T C;  4BBS H;  5IY0 A;  1MKH A;  4POG A;  1YEZ A;  5CC4 A;  2MO0 A;  3BYY B;  5FO7 B;  3I4N B;  3I56 A;  4WOR A;  2B29 A;  3PO2 H;  2F3V A;  5C3E B;  4OL7 A;  4A3I B;  4A3G H;  4E6I A;  2Y0S E;  1HZA A;  3X3N A;  1GO3 E;  1SJE D;  2RVL A;  3A7A B;  4K6L A;  4C56 C;  1I6H H;  4UAI A;  2HCC A;  4A3M G;  1IBM L;  1OXV A;  2F0U A;  3M7N A;  1D7Q A;  4FXD A;  4DV6 Q;  1VQJ A;  3D4W A;  4R4C A;  1VQ8 A;  1IBK L;  3I3C A;  4JG2 A;  2A6H D;  3VR6 A;  1HQM C;  2JYO A;  4K5V A;  2CVR A;  1II3 A;  2ZM6 Q;  3I70 A;  1KDC A;  1TWG B;  1Z6H A;  1O80 A;  1JWS D;  1SBB B;  1VQE A;  5GRO A;  1GOZ A;  1SMX A;  3FPU B;  2IT1 A;  3LX0 A;  3RZD B;  2L12 A;  1PH5 A;  5C4H A;  1PZJ D;  2LXJ A;  1MSH A;  1CTM A;  1HUN A;  4GLX A;  4EQP A;  2L55 A;  4DNI A;  4C1N I;  5IGE A;  3MXG A;  4IUR A;  3J80 L;  4IPC A;  4M8A A;  3DHQ A;  4X65 L;  2B8G A;  1A6X A;  3R3O A;  3RD4 A;  3AFQ A;  3A7L A;  3RZD H;  2LY7 A;  3HRZ C;  3GTG H;  5IT9 E;  1HUM A;  3Q22 A;  1XX8 A;  2Q2T A;  1LTS D;  5C4J B;  5C0X H;  4JBK A;  4BBS B;  4GN3 B;  4WJ3 M;  1PMR A;  3MHB A;  1AW7 A;  4C3I H;  5A2Q E;  4A3K G;  4UP8 A;  2MP1 A;  1A0I A;  1DON A;  1VQ9 A;  3T1Y L;  1EQR A;  3M4Q A;  3GV3 A;  1IXR A;  3GTP B;  2JE6 I;  4A93 G;  2EXD A;  1HA5 A;  1QG7 A;  2F0V A;  4X66 Q;  2CW0 D;  1AE2 A;  4K14 A; 
#chains in the Genus database with same CATH homology
 1EZ8 A;  1M8A A;  1BQQ T;  1ICW A;  1PTO B;  3ONA B;  3K7A B;  1CM9 A;  3MTS A;  2KCC A;  2WIN B;  4OO1 I;  2OEO A;  5IIF A;  3FPP A;  4PNY A;  5I2X A;  1LTB D;  2EOT A;  5IOC A;  4HTH A;  1U4M A;  1B2T A;  4DAY A;  1NSN S;  2KOL A;  2JA5 B;  3FMC A;  4PMC A;  4EGV A;  2K28 A;  5FLX E;  1JQY D;  1AP0 A;  1I3Q B;  2A69 C;  3E0J A;  5E4W C;  4WFN 3;  2WB1 B;  4R8N A;  5I4D A;  3PO3 B;  1R4Q B;  2WAQ B;  4KY5 A;  2C5C A;  1STE A;  3TSS A;  2PYK A;  3GO5 A;  2K01 A;  1TY0 A;  3IL8 A;  4RHS A;  1CQV A;  1S5D D;  3OSO A;  1HXY D;  1LTR D;  2IPK D;  1KLU D;  1TII D;  1ILP A;  3S1R B;  1M4V A;  1ZYR D;  1CI3 M;  3BVG A;  1OXX K;  4DFA A;  3RZO B;  4ID6 A;  1EWC A;  1ZXT A;  3V2T A;  3M7G A;  1Q1B A;  2F0L A;  1BCP B;  1EU3 A;  1C8C A;  1SXT A;  4A3J B;  5T1I A;  4HSV A;  1TKW B;  1D5M C;  2PPB C;  2AQ1 B;  1ONL A;  3R93 A;  1Z47 A;  1MSG A;  4DXF A;  3BG3 A;  2R7Z B;  1FNU A;  5EBD A;  1CHP D;  4OIK A;  3BDC A;  4X3S A;  1I50 B;  1DYQ A;  4FXG C;  5EGT A;  5FO9 B;  1NCV A;  4C3H G;  2XNA C;  1G29 1;  4J6H A;  4XIG S;  1VF5 C;  2QCP X;  1WTP A;  5K36 G;  4H0L C;  2X6G A;  2MUY A;  1SEB D;  1TS2 A;  4CHT B;  3QIA A;  3NPP A;  2H4O A;  3D8G A;  3I4L A;  2K5W A;  2IWH A;  2KEE A;  3OIQ A;  2BE5 C;  5JVG 3;  4M1U B;  4ABN A;  4FVM A;  5EPK A;  2I07 B;  1H9M A;  2PO4 A;  5A2Q L;  5E3F A;  3MXU A;  1STA A;  4ZKC B;  3KLR A;  3IKJ A;  4I7Z C;  2DN8 A;  4AYB B;  1Y69 U;  5IT9 L;  3A55 A;  4OHJ A;  4P2C B;  1AZP A;  2F4I A;  1I4Q A;  3KUP A;  1D6E C;  2B2W A;  3D3R A;  2YYZ A;  2M2L A;  2DNE A;  1O7Y A;  5F2D A;  2OT2 A;  3FVQ A;  2VB3 X;  4XYO A;  4B9X A;  2BDO A;  3MFG A;  3C3L A;  1SYC A;  3O13 A;  1XTC D;  3QOJ A;  2KCN A;  1SMY D;  2G9H D;  1O7L A;  3NE5 B;  3BDO A;  3X3M A;  4DNR B;  5C4X B;  1F77 A;  2E2J B;  1KLG D;  1PTO H;  2F0T A;  2QF7 A;  3WDN A;  3SDZ A;  3GTG B;  2VB2 X;  2QEJ C;  1SYD A;  4C2M B;  4XT1 B;  2JA6 B;  1UEA B;  1IW7 C;  4MN3 A;  1Y8O B;  4OGQ C;  1SE3 A;  2F0N A;  3QOL A;  3KBG A;  2O2L D;  4XT3 B;  3LWE A;  4KN4 C;  1I4P A;  3M4O B;  4ZYS A;  3AB9 A;  1ML0 D;  3HP3 A;  4OIJ A;  4BY1 B;  5I6W A;  4FF4 A;  1X3Q A;  1RHP A;  4XQJ A;  3MZ5 A;  2D9U A;  2FJ2 A;  1PLF A;  1ILQ A;  4IUP A;  2EYL A;  1TS4 A;  1SE4 A;  5C3W A;  2EJM A;  4H13 C;  1HTL D;  4XQQ A;  4IUN A;  1DCZ A;  2K7V A;  4KJN A;  3DWQ A;  4RCO A;  5CV5 A;  3L3O C;  2G9D A;  1ROD A;  4ZUI A;  2AUJ D;  2FMC A;  1SFO B;  3ITP A;  2EYM A;  1SDF A;  5IGF A;  2CW0 C;  2NTS A;  1D5X C;  4K2K A;  1PRT B;  2EYO A;  4TRD A;  4C3J B;  1WTX A;  3FDT A;  4Q0F A;  3HOY B;  1UUP A;  3I90 A;  2F0D A;  5I2Y A;  1OXT A;  5EKL A;  1LAC A;  1UNS A;  4IFD J;  3SK6 A;  5BN3 A;  1GHJ A;  3NTI A;  1RTN A;  3S17 B;  2EYH A;  5FOB B;  1TS3 A;  2B2T A;  3TP5 A;  1DD2 A;  1CT1 D;  1H9K A;  4GZY C;  1X3P A;  2BOS A;  2PZU A;  4X3U A;  1H9S B;  1MD2 D;  1STB A;  1BCP C;  4FXK C;  4NDX A;  1CA6 A;  5JVH 3;  4RH6 A;  5M9O A;  1LLR D;  4DN4 M;  2KQ3 A;  1TY2 A;  1HFG A;  2PZW A;  3K0Y A;  1W6J A;  1I4G A;  4A3B B;  5J1Z A;  3EFX D;  2Z8L A;  4DK1 A;  2ZT9 C;  3N6R A;  3EVQ A;  3DMU A;  2XSC A;  1BNZ A;  2XWJ B;  3VYU A;  2EXZ A;  2JXM B;  1S5E D;  2XRQ D;  1D1K A;  1SYF A;  1E2W A;  3D6W A;  3BVZ A;  3TP7 A;  5CR3 A;  2AWN A;  2WKD A;  3TZU A;  4HMI A;  3U9S A;  2H1E A;  2J0T D;  3ND8 A;  3JAM E;  4S3S A;  3MWY W;  2EY5 A;  3VA5 A;  1STH A;  2LFN A;  4HR7 B;  5KNB A;  2MPM A;  1HA6 A;  1LV9 A;  2PQE A;  4G57 A;  4BBR B;  3SE0 A;  5C5M A;  2HDL A;  3P7J A;  1JWM D;  3I4M B;  1JCK B;  2GA4 B;  3OOC A;  3A8K E;  2RA4 A;  3DM1 A;  4NMZ A;  5NUC A;  5KIX A;  2CHB D;  4BY7 B;  1CFM A;  4L6T B;  3VR3 A;  3CRL C;  2M9V A;  3RMH A;  4ZQ3 A;  1A2T A;  3K5O A;  1WTR A;  2ZXO A;  4DA2 A;  1WTW A;  5J22 A;  1Q8I A;  2WAC A;  5TSS A;  1GXD C;  2PMZ B;  1O7Z A;  5M3M B;  1I6H B;  3G6J B;  5ELE A;  1V1P B;  4ZK9 B;  2EJG C;  3J81 E;  2F0Q A;  4KMU C;  4HCS A;  1V43 A;  4MHE A;  1G2S A;  1RKN A;  1MBY A;  1EU4 A;  1B53 A;  1F2Y A;  1PZK D;  4ILW A;  3VR4 A;  3SK4 A;  4TSS A;  2J7Z A;  2V4D A;  2R3Z A;  1I4X A;  5I9O A;  2N88 A;  4PQX A;  1B3A A;  1X32 A;  4F7X A;  1LO5 D;  2N55 A;  3Q6S A;  1BDO A;  1LT6 D;  4FF1 A;  1SJH D;  2Q8I B;  2B2U A;  1Y1V B;  3TN2 A;  3GTQ B;  5ISR A;  1RCV D;  1GUT A;  5EPJ A;  1TQO A;  1S5B D;  1OO9 B;  2NYZ D;  4DAV A;  5G3L D;  1LTT D;  1F9P A;  1VF7 A;  2PCF B;  2XWB B;  3HOU B;  4XDX A;  3FRP B;  3UI2 A;  4BS9 A;  1STG A;  1S5F D;  3NHH A;  4KY7 A;  1FYC A;  2RSN A;  5E4X A;  3GQB A;  1HRJ A;  5C3X A;  2NBF A;  2KJX A;  2DY8 A;  5KRU A;  1XYI A;  1G6Z A;  4XXE A;  1MI2 A;  5CV6 A;  1EIG A;  5M5W B;  3IFD A;  4RHR A;  5DNF A;  2IL8 A;  2J4X A;  4HAE A;  3M3Y B;  3MEH A;  1LTG D;  5ELF A;  3VR2 A;  2IX0 A;  2HQE A;  2L0C A;  1GUN A;  5JEA J;  3QO2 A;  2X6L A;  1NR2 A;  5IOD A;  3QG1 A;  1PFB A;  2NTT A;  1STN A;  4C3I G;  4IZ8 A;  5CBE E;  3NTK A;  4KTA A;  1PTO D;  2FHT A;  1OXU A;  1JWU D;  3ERO A;  5D3I B;  3SK8 A;  4IN3 A;  5C5L A;  1ZKO A;  3H6M A;  5CV4 A;  2JA7 B;  1MGS A;  4QIW B;  1TT2 A;  2IX3 A;  3S16 B;  2XN9 C;  4A3K B;  1SND A;  2KED A;  1JOK A;  3CU7 A;  3TME A;  1QJO A;  1AN8 A;  2HCI A;  5I6Y A;  2SNS A;  3AMU A;  1I4H A;  2K03 A;  2TSS A;  3V96 A;  4IFD G;  2Z1C A;  2EY2 A;  2KA7 A;  4BA2 I;  2E2I B;  4FO2 A;  1PDQ A;  2F0K A;  3OWE B;  4PV1 C;  3EQL C;  4C3J G;  3VYR A;  2AQ2 B;  2SDF A;  4QUF A;  4UDU C;  3GTJ B;  2Z4I A;  2A6H C;  4A3G B;  3BYT B;  1PRT D;  2B2U C;  1HHV A;  2XVS A;  4F8M A;  5D65 A;  4Q5V A;  1HPC A;  5KGU A;  3SEB A;  4R8I A;  2EJF C;  1EYD A;  3NBI A;  2VXW A;  1WVL A;  3H09 A;  1AZQ A;  3GV6 A;  1B9N A;  4DU9 A;  3TZD A;  4KHZ A;  5JJZ A;  3F2U A;  4JK1 C;  3NXW A;  2CQA A;  5EQ0 A;  1A3V A;  1EEF D;  1GHK A;  3H3V C;  1QIL A;  4CKB A;  3A54 A;  1IKL A;  5I9P A;  3BS1 A;  1OXS C;  1J8I A;  4BA1 I;  1A15 A;  1E2Z A;  3PO2 B;  2IX1 A;  2VUM B;  4DGZ A;  1EIH A;  3PIO 3;  1IKM A;  1RJT A;  1T5E A;  2F0G A;  2K5Q A;  3I72 A;  3EA6 A;  3AU7 A;  4C3H B;  4LMQ D;  4CBV A;  3W3A A;  3D31 A;  2F0O A;  4Z9C B;  4K8I A;  5E1F A;  2B2W C;  4FYD A;  1BBX C;  4RCN A;  5EKI A;  3T16 A;  1ESR A;  4L63 B;  3HZX A;  2B8F A;  1JOR A;  1K83 B;  1WD1 A;  1SNP A;  4HN7 A;  1AFP A;  3KBX A;  5CV8 A;  3J7A F;  1B1Z A;  2E2H B;  3CHB D;  1V1P A;  2IJ0 A;  4IFD H;  2Q8R E;  1F9S A;  3GTM B;  2PZT A;  2EE1 A;  1SYE A;  2KVM A;  4KKU A;  1JR0 D;  1SAP A;  3R8B A;  3MFY A;  1Y8N B;  1A3T A;  4ZLT F;  3GTK B;  3R2I A;  4U68 A;  1LAB A;  2MHV A;  4IUQ A;  3FEW X;  1RTO A;  2K04 A;  4ODG A;  1RD9 D;  2B2Y A;  5JOB A;  1F9R A;  1NR4 A;  4CKE A;  2NUC A;  1EWH A;  1GUO A;  3DWA A;  5D3D A;  3QJY A;  3T13 A;  3RUZ A;  2WP8 J;  1JC7 A;  5G3L F;  2L9H A;  1ENC A;  4K8J A;  5FO8 B;  2R61 A;  4FP5 D;  3GTO B;  1DOM A;  3BVM A;  1VCI A;  1GUG A;  4LK1 C;  3NWT A;  4IAL A;  2F03 A;  2L1B A;  3S1Q B;  3D6C A;  1KAA A;  1CK1 A;  1G2T A;  2L11 A;  3OMG A;  4ME5 A;  4MIU A;  1KTK A;  1A3U A;  4ULL A;  3PUY A;  2D5D A;  3J80 E;  2RQX A;  4KKS A;  1TR5 A;  2A69 D;  2NN6 H;  3P20 A;  5HGT A;  1BR9 A;  2I46 A;  3D4R A;  3OWF A;  1H9J A;  4XQN A;  1YNJ C;  3K5L A;  3Q24 A;  4RAU C;  3L7Z C;  2QKI C;  2ENB A;  3C2P A;  3ND9 A;  5C44 B;  1K8O A;  1DJR D;  1S4Z A;  2Z4H A;  3QB3 A;  1PXU A;  3T53 B;  3ZYY X;  2EYJ A;  3OW7 A;  1FNV A;  4TKO B;  3IFT A;  4RKL A;  4ZAI A;  4DK0 A;  1K8M A;  1NAP A;  5K5P A;  3P1H A;  1ZYR C;  3HOW B;  4FNF A;  1BO0 A;  1PZI D;  5IGD A;  1ENA A;  1BXT A;  2B2V A;  4G7O C;  3H94 A;  1E0B A;  2R92 B;  2B2Y C;  3BZD B;  5ELC A;  3BDL A;  3KLS X;  2JEB I;  5CBA E;  3HEJ A;  3S15 B;  5JEA H;  2BA1 A;  3Q0A A;  3T56 B;  1TWC B;  3C1E A;  1LTI D;  2JA8 B;  2ICE C;  5ELD A;  2YU9 B;  5IGB A;  1I6V C;  2RDH A;  5C0X J;  2A5H A;  4A93 B;  5CV9 A;  2NVY B;  1IL8 A;  2K32 A;  1CHQ D;  2SEB D;  2SOB A;  3I8Z A;  3HOZ B;  3J7A V;  3HG9 A;  2DNC A;  5CGK A;  4G7Z C;  1IYV A;  2ID0 A;  2NZ1 D;  1BCP D;  4QUC A;  4K5W A;  1JIC A;  4FF3 A;  2FFK B;  1L0X B;  5C6A A;  4J1M A;  4HED A;  4OO1 H;  5KND A;  3ERQ A;  2AUK A;  3SVM A;  3K5N A;  2B39 A;  1IW7 D;  3JAM L;  1ZEQ X;  4A3F B;  3PUV A;  1VMP A;  4CJ1 B;  4QCL A;  4KKT A;  2Y0S B;  4A3D B;  3W2D A;  1QNU A;  5CMD A;  2M00 A;  2RDF A;  3PV0 A;  1WTQ A;  5LL6 S;  4HSP A;  3Q23 A;  4I65 A;  3NP8 A;  2ICI A;  3FKI B;  1RDP D;  4NP5 A;  5LHY 1;  5COY A;  1BF4 A;  4KN7 C;  2EZV A;  1PFN A;  3P75 A;  3MXP A;  3G7L A;  3HKZ B;  3LWU A;  3OHX C;  1YNJ D;  3SHL A;  2EY1 A;  5D14 A;  1EL0 A;  1U9R A;  4WRD A;  1CQF A;  1FD7 D;  5C4Z A;  5KYI A;  3WOE A;  1DM0 B;  4DXG A;  4RGM A;  1EQT A;  1XXG A;  1IHZ A;  1SE2 A;  4PMB A;  4K2L A;  1DOK A;  3R2T A;  3PUZ A;  1LT3 D;  4A3M B;  2B63 B;  1PYW D;  1HFN A;  2TMP A;  5BN4 A;  3S2H B;  5JEA G;  4DF7 A;  1W6K A;  1EYC A;  4KI0 A;  3HOX B;  2L4N A;  1JB3 A;  3GP7 A;  3TP8 A;  1F2Z A;  2NVT B;  1VMC A;  4G7H C;  2F0I A;  1TWH B;  3S1M B;  1C48 A;  2F0J A;  3M85 A;  5C0X G;  5DEH A;  1BOS A;  3S14 B;  1SNM A;  2FMM A;  3S9W A;  1GUW A;  4PMW A;  1JOO A;  2A6E C;  1Z7T A;  4N9P A;  2E2D C;  4F87 A;  2L5T A;  3CQZ B;  1CA5 A;  4OO1 G;  1KNE A;  3DXJ C;  5DM7 3;  1DOL A;  1E2V A;  1EY5 A;  2Q8T A;  3T4A C;  1SNC A;  2JEA I;  5FKA C;  4RGO S;  1SYB A;  2WV6 D;  4XTC S;  1V1O A;  2A6E D;  5IGC A;  2F0E A;  2LMC B;  5EKK A;  4NKL A;  1EY9 A;  1U4R A;  1ENF A;  1V8Q A;  1R9T B;  5DAU A;  3I91 A;  5K36 H;  1B50 A;  1ESF A;  3A8I E;  5JAV A;  3PIP 3;  5KYL A;  4CKC A;  5A35 A;  5J39 A;  2BE5 D;  1PTO F;  4KD4 A;  4KY6 A;  5KEE A;  5ELB A;  3NBH A;  3DUZ A;  2QIL A;  4RKB A;  1SYG A;  3TDQ A;  5KNC A;  1QE6 A;  1ET6 A;  3A8J E;  3H91 A;  2BDN A;  2AWO A;  3NQT A;  4BWG B;  3MA2 B;  4X3T A;  2O4X A;  3SR1 A;  4XYQ A;  2NVQ B;  2F0M A;  3M4Y A;  2DY7 A;  3V05 A;  2B2V C;  3DEO A;  5T1G A;  3VA7 A;  1YNN D;  1EFI D;  2K5D A;  4YIJ A;  2K6A A;  3NQI A;  2KUM A;  4IQZ A;  2NWG A;  1C4Q A;  1AEX A;  2EY6 A;  2F0F A;  2E74 C;  2MGS A;  2KEC A;  5COR A;  3VYS A;  1LT5 D;  4TQU S;  1QOH A;  5CYU A;  3QWN A;  3URY A;  1EYA A;  2RDG A;  4F88 A;  3E5S A;  2OXP A;  4KJO A;  1WTO A;  3HOV B;  2HDM A;  2F1M A;  2LKV A;  5DM6 3;  1I4R A;  4K5X A;  3TBI B;  4J8Q A;  2F0S A;  1KDA A;  4B08 A;  1LT4 D;  4C3I B;  1KAB A;  2EDG A;  5JPN C;  1VDZ A;  2R93 B;  4DNT B;  1PRT C;  1SNQ A;  1F9Q A;  2NVX B;  3MC0 B;  1A2U A;  3N52 A;  1UAP A;  2C9O A;  2EPB A;  2ZXP A;  1TVX A;  3VYT A;  3OPO A;  2RSO A;  4LAA A;  4LJZ C;  1FNW A;  3EJI A;  2PNR C;  4R9W A;  1NUC A;  1STY A;  2NB0 A;  3L9A X;  5HUR A;  4KK7 A;  1JOQ A;  4CJ0 B;  2MJ8 A;  1WCM B;  5AFW A;  5M5X B;  3NK9 A;  3CKI B;  3KF8 A;  1G91 A;  1TU2 B;  2ZXR A;  4ZRZ A;  2KHS A;  1TS5 A;  3CRK C;  3KK7 A;  2AQ3 B;  3NUC A;  4JBW A;  4QF4 A;  3DWP A;  1EQV A;  1PTO C;  1IYU A;  4C1N K;  1EEI D;  2IW3 A;  4K6D A;  3S1N B;  3K58 A;  5M5Y B;  3GD7 A;  3J81 L;  2BCO A;  1U4L A;  2XRS D;  1HCZ A;  3K6O A;  1WTV A;  3C1F A;  2JSO A;  3T51 B;  2NN6 I;  3SK5 A;  3RLF A;  3J7Y W;  1H9S A;  4H44 C;  4IFD I;  4KV6 A;  4O42 A;  4RGN A;  2VNU D;  5FLX L;  1D1I A;  4IUV A;  2D2C C;  4H7B A;  4EQN A;  2K1B A;  2F0P A;  4A3E B;  2OF1 A;  1B4O A;  4WJW A;  3MVV A;  2PW5 A;  1F2L A;  1H9R A;  1HTP A;  4HCE A;  4CJ2 C;  3WOF A;  5EPL A;  4IUT A;  2R6G A;  1Q3L A;  5BN5 A;  3PUW A;  1EY8 A;  3PUX A;  2D62 A;  3DEP A;  2F0W A;  1DZ1 A;  3VR5 A;  1DXM A;  2A73 B;  3HGB A;  1FGB D;  1CZG A;  5C0X I;  4O1N A;  4RA8 A;  1GUS A;  1XWE A;  3SXH A;  1QB5 D;  1G8Z D;  1KDB A;  5IGG A;  4HMJ A;  1J9O A;  4U67 3;  4X3K A;  3LNN A;  2F0H A;  1L0Y B;  1SMY C;  1GJX A;  1ET9 A;  1Y8P B;  5LL6 X;  1EOT A;  1SNO A;  2K33 A;  5EBC A;  2A68 D;  2SNM A;  4KHV A;  2A74 C;  4DAP A;  1O78 A;  2RKS A;  1EY4 A;  3K57 A;  3HS0 C;  4EVO A;  1JE4 A;  3GTL B;  2F3W A;  1YNN C;  2BA0 A;  5JPM C;  2O5I C;  1SSO A;  1PRT F;  3OIP A;  1BUV T;  2JP1 A;  1Q1E A;  3TP6 A;  4QMG A;  1WD0 A;  2WII B;  1U4P A;  2HUG A;  3A56 A;  2WKC A;  2E76 C;  1PFM A;  4V0B A;  3D4D A;  4NW2 A;  4QB4 A;  4FF2 A;  1Q90 A;  3NSW A;  2K05 A;  3K5M A;  1T5X D;  3IAY A;  4EQO A;  3C46 A;  3H0G B;  4N9T A;  3E6Z X;  4ZKB B;  1QWY A;  3NWS A;  4RWS C;  2NN6 G;  1B9M A;  1EZ6 A;  3U9O A;  3OMC A;  1KNA A;  3NTH A;  5M3F B;  1TWF B;  2PW7 A;  3MXN A;  4B9W A;  2EYP A;  2RBM A;  1Q12 A;  5EJW A;  1CZW A;  1D5Z C;  2XIW A;  4G4K A;  2EVB A;  1FR3 A;  3KLS A;  5FK9 C;  3I73 A;  2EYF A;  4RFB A;  2FIN B;  4IUU A;  4L8J A;  4CGY B;  3K59 A;  1QNK A;  1EY7 A;  2E75 C;  3PMF A;  1Y1W B;  2QDB A;  2A68 C;  1RF2 D;  1B44 D;  4ZUJ A;  4RGT A;  5CV7 A;  1BCP F;  4V19 0;  4KD3 A;  2X69 A;  4Y7N B;  1F2M A;  1TWA B;  1QCB D;  1D2B A;  1EY6 A;  3S2D B;  3MAQ A;  1R4P B;  1HQR D;  1EY0 A;  2LS0 1;  2O5J C;  1S5C D;  1LTA D;  2B2T C;  5CC4 A;  3BYY B;  5FO7 B;  3I4N B;  4WOR A;  2F3V A;  5C3E B;  4OL7 A;  4A3I B;  4E6I A;  3X3N A;  3A7A B;  1SJE D;  2RVL A;  4K6L A;  4C56 C;  4UAI A;  2HCC A;  1OXV A;  2F0U A;  3M7N A;  4FXD A;  3D4W A;  3I3C A;  2A6H D;  3VR6 A;  1HQM C;  2JYO A;  4K5V A;  2CVR A;  1II3 A;  3I70 A;  1KDC A;  1TWG B;  1Z6H A;  1O80 A;  1JWS D;  1SBB B;  1GOZ A;  3FPU B;  2IT1 A;  3LX0 A;  3RZD B;  2L12 A;  5C4H A;  1PZJ D;  1MSH A;  1CTM A;  1HUN A;  4EQP A;  2L55 A;  4C1N I;  5IGE A;  3MXG A;  4IUR A;  3J80 L;  4M8A A;  3DHQ A;  2B8G A;  1A6X A;  3R3O A;  3RD4 A;  3A7L A;  2LY7 A;  3HRZ C;  5IT9 E;  1HUM A;  3Q22 A;  1XX8 A;  1LTS D;  5C4J B;  5C0X H;  4BBS B;  1PMR A;  3MHB A;  1AW7 A;  5A2Q E;  2MP1 A;  1DON A;  3GV3 A;  3GTP B;  2JE6 I;  1HA5 A;  1QG7 A;  2F0V A;  2CW0 D;  4K14 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...