1WTPA

Hyperthermophile chromosomal protein sac7d single mutant m29f in complex with dna gcga(ubr)cgc
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
63
structure length
63
Chain Sequence
VKVKFKYKGEEKEVDTSKIKKVWRVGKFVSFTYDDNGKTGRGAVSEKDAPKELLDMLARAERE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5'-D(*GP*CP*GP*AP*(BRU)P*CP*GP*C)-3'
publication title Probing the DNA kink structure induced by the hyperthermophilic chromosomal protein Sac7d
pubmed doi rcsb
source organism Sulfolobus acidocaldarius
molecule tags Dna binding protein/dna
total genus 13
structure length 63
sequence length 63
chains with identical sequence B
ec nomenclature
pdb deposition date 2004-11-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02294 7kD_DNA_binding 7kD DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1wtpA00
1NAPA 5T1GA 3R93A 3TN2A 1G2SA 2JP1A 1BO0A 4R9WA 5E4WC 1CA5A 5EPKA 1PFMA 1AZPA 2HUGA 1WTVA 1HUMA 4ZKBB 2FJ2A 1HRJA 2FINB 1DOKA 2DY7A 3DM1A 4U68A 2X69A 4IUPA 1WVLA 1ILPA 1J9OA 1ICWA 4CJ2C 1SDFA 1LV9A 4CJ0B 1DOMA 4ZLTF 1WD0A 3KBXA 1B3AA 2B2VC 5AFWA 4OIKA 3P7JA 2N88A 1ESRA 1XX8A 2RVLA 1O80A 2X6LA 4IURA 4UAIA 5EKIA 2L1BA 2HDMA 1B2TA 3F2UA 1U4PA 4DN4M 2N55A 5CORA 1WTQA 1WTXA 2K03A 1CM9A 1G91A 1F2LA 2KVMA 2FHTA 1J8IA 2KEEA 1U4MA 3H91A 5COYA 2L9HA 2EOTA 4IUTA 1WTRA 1MSHA 1SSOA 1PFNA 4X3SA 5EPLA 1B50A 1JICA 1WD1A 1EQTA 3MWYW 1ILQA 1EL0A 1X32A 3D6WA 1PLFA 2K01A 2MJ8A 2HCIA 3I3CA 1QG7A 2NZ1D 2FMMA 2KEDA 2B2TA 3FPUB 2RSOA 5CBEE 1MGSA 3HP3A 1WTOA 2B2TC 1AP0A 4HAEA 2K1BA 1DONA 3IFDA 2H1EA 2VXWA 3GV3A 2RSNA 1KNEA 2K04A 1NCVA 3IL8A 1A15A 5EPJA 5T1IA 1X3PA 3KUPA 4HSVA 4QUFA 2Q8RE 1PDQA 2XIWA 1IKMA 1U4RA 2HCCA 2L12A 5E4XA 2MGSA 2D9UA 5D14A 5DNFA 4CJ1B 4QUCA 1BBXC 1AZQA 3N52A 1G6ZA 3DEOA 1GUWA 1CA6A 1EOTA 2CVRA 1E0BA 2EE1A 1PFBA 2HDLA 3Q6SA 5EJWA 1DZ1A 2B2WA 1KNAA 4X3UA 4X3TA 2B2WC 2KECA 2Q8TA 3TZDA 3SVMA 1QNKA 1MSGA 2SDFA 3ONAB 1QE6A 1JE4A 5CBAE 2EPBA 4RA8A 5JJZA 3G7LA 2NWGA 4OIJA 4IUQA 4HCSA 1HA6A 4LMQD 1EIGA 4X3KA 1C8CA 2M2LA 4XT1B 1O7YA 1SAPA 2JYOA 2K05A 4RAUC 4MN3A 1X3QA 4O42A 1F9RA 1Q3LA 2FFKB 1BF4A 3QO2A 3UI2A 1RTNA 2MP1A 1ZXTA 3I90A 3LWEA 1XYIA 4R8IA 1G2TA 1VMPA 2MPMA 1BNZA 2IL8A 4XT3B 1RTOA 3GV6A 4RWSC 5D65A 3MTSA 3FDTA 1MI2A 1RODA 4MHEA 1U4LA 1NR2A 3I8ZA 2BDNA 5CMDA 1F9QA 1M8AA 1ML0D 1NR4A 2KUMA 2L4NA 4HEDA 2B2VA 2DY8A 2J7ZA 1RHPA 1B53A 1RJTA 1F9SA 1IKLA 2X6GA 3DEPA 5EQ0A 2B2UA 1IL8A 1S4ZA 1B4OA 2B2UC 3I91A 4NW2A 1HFGA 1O7ZA 1VMCA 2RA4A 4XDXA 1WTPA 1EIHA 1HUNA 4ZK9B 1DOLA 4IUUA 2L11A 4ZKCB 1HFNA 1WTWA 2K28A 2KOLA 1F9PA 1TVXA 2R3ZA 2B2YA 1HHVA 2NYZD 4IUVA 4ZAIA 2B2YC
chains in the Genus database with same CATH superfamily
1STEA 2UUCQ 1LTTD 1X54A 1KRTA 3DWAA 1N32Q 3H94A 1BO0A 1SN8A 4IOCA 4QMGA 1PFMA 1SLJA 2WFWA 4DAYB 1GXDC 1JB7A 2AQ3B 3S9WA 1LM0A 1ICWA 1HR0W 1VF7A 4A3MG 2F0PA 2R7ZG 1XX8A 1U5KA 2X6LA 5EKIA 2HD3A 2XVSA 2JJQA 2K33A 4A4IA 3I4MH 3D4DA 5C4XH 2ES2A 2VUMG 1G6PA 4FF3A 3A8JE 2L9HA 3OMGA 3EROA 4OGQC 1I4RA 1YBYA 3U9OA 3V05A 1V43A 3OSOA 3ITPA 3HP3A 3GQBA 5M5WH 2RBMA 1PFSA 4GNXC 2K5DA 4KTAA 3SK5A 4HSVA 4A3JH 5JJLA 1IBLQ 4A3MB 1GUWA 3N52A 1VQ6A 2R7ZB 4G7HC 3ERSX 4L6TB 4YIJA 2VUMB 2Z6KA 5ELEA 2B2WC 4NXNQ 4RKLA 3SVMA 5IT9c 1H9SA 1JWMD 1YJNA 4OIJA 2K5QA 3CD6A 3HOYG 1SAPA 4BY1H 1DGSA 2BA0A 1U9RA 3A7AB 1WTHA 1SYFA 3CCJA 2E2HB 2OWOA 3R3OA 3KJPA 2MP1A 4OWWB 2F4IA 4NDXA 5JPMC 2BH8A 2YV5A 3RN5A 4IPCA 3X3MA 2R92G 3D4RA 2Q2TA 2JA6G 2BA1A 2EYMA 1LTGD 1MI2A 1HZCA 4C2MH 4DR2Q 1NR4A 4LFBQ 1FVIA 1RHPA 2EJFC 4X62L 3CAMA 3VA7A 4N9TA 1YI2A 3TZUA 1JJGA 4IUUA 4A3FH 1HFNA 5BN3A 1CT1D 2K28A 1F9PA 1S5ED 3I72A 3Q24A 3HKZG 1EYDA 4OX9L 4R4IA 2JA8G 3DEOA 3S16H 2A5HA 3CPFA 3R93A 3A0JA 1G2SA 4CDEC 3HOYB 1RD9D 4JI4L 4KJOA 2KCTA 3WOFA 2B29A 3I4NH 2FJ2A 3CW2C 1V9PA 1VQAA 1ILPA 1EWHA 2R92B 1W2BA 5AFWA 3J81i 2F03A 1WJJA 1XXGA 2JA6B 4HR7B 1ESRA 1W6JA 4IOAA 3GD7A 2NUCA 1D8LA 2CWAA 1SR3A 4DN4M 3L2PA 1F2LA 4AYBG 1RL2A 4UDUC 3IRBA 4M8AA 4TSSA 4DAVA 1WTRA 3CC7A 1WD1A 3MWYW 1N33L 2F1MA 3HKZB 5IYDH 2JA8B 5CYUA 5CBEE 4B3TQ 2RDGA 4P71A 4JV5L 2PW7A 3RLFA 3IL8A 4A3EH 3MXPA 1H9SB 4DKAC 1QZGA 2PQAB 1XMOL 3FEWX 4LFAL 3M3YH 3NSWA 3OIPA 1HTPA 1KDAA 1K0RA 5D14A 1WFQA 1DXMA 5FK9C 2LKVA 3BYYB 3S24A 4DU9A 3RZDH 4AYBB 4IPDA 4V190 2HIVA 3E3XA 3R2IA 3MFYA 1A2UA 2PNRC 5EAYA 5C5MA 1Z7TA 3A8KE 2P5ZX 1K9MC 4RCOA 4RGNA 1O7YA 1S5DD 1TS3A 5FLXL 4UP7A 3WDNA 3C46A 3VR5A 5AJ3L 2EY6A 3P20A 1KTKA 3U9SA 4BA2I 2VQFQ 2E2JB 2F0QA 3NUCA 2E5LL 4DV3L 3Q23A 2A8VA 2YTVA 3I4OA 4DK1A 1BBUA 2ID0A 3TS2A 3V2TA 1KAWA 3GTOH 1K3RA 5BN5A 2KJXA 2F0TA 3CCQA 1HR0L 5EQ0A 3QJYA 1IL8A 2NBFA 4YHHL 1PH7A 4EQPA 3Q0AA 2RA4A 3HKZE 3H15A 4ZKCB 2LMCB 5IGGA 3MHBA 1N36L 1IW7D 1T5EA 4R1JA 5C3WA 2HHHQ 3STBC 2NVYH 5CR3A 4A3DH 4KK7A 2PI2A 4IUPA 4DR5Q 4GNXA 2NVQB 1I4QA 1B9NA 4JI3L 3D6CA 1PZID 4KN4C 5BN4A 2B2VC 4DV5L 3F8TA 5IYBH 4IURA 2HDMA 2D2CC 4AYBE 2O5JC 1X3GA 2K6AA 4J15A 4UP8A 1XTCD 3NTHA 2KEEA 4KY5A 1H9MA 1KC8C 4JI0Q 1EQTA 1Q12A 2K32A 2GN5A 2K50A 1JQYD 1EYGA 4LUOA 5GADC 1SYDA 4N9PA 1EZ8A 4QCLA 1MGSA 4PZ8A 2B2TC 1GUGA 2EYLA 2Z4HA 2KCCA 1HNZQ 1G291 2VXWA 1HNXQ 1T9HA 1E1TA 3GV3A 2F0MA 1GJXA 4IFDH 2EJMA 4RHSA 3HOXH 4AQYL 2JA7H 4A93H 3NPPA 1J6QA 2Q8RE 3DXJC 2Q8IB 2KBNA 4JI1L 4CDCC 4CGYB 4MTKA 1B9MA 3J80L 3DWPA 3CQZH 1YJ9A 5KYIA 4LF4L 1X56A 1FJGQ 1EWIA 3FPPA 1AE2A 1I6HB 2BE5D 1Q90A 3MVVA 4A3KH 3S1MB 4DGZA 3D31A 3L9AX 1SRUA 2ZM6L 3M4OB 2R93G 3BZDB 3G7LA 4JBJA 1J5EL 2ATWA 4GN5A 1C9OA 2JEBI 3HOUG 2K05A 1BKBA 4MN3A 4JYAL 1IBML 1F2ZA 3S15B 1F9RA 1KDCA 2UUBQ 3GTJB 1V1QA 1DD2A 2IW3A 4KY6A 4BY7H 1EY0A 1OXVA 4R4QA 3HOZG 4H02A 4CKEA 4R4TA 1NTGA 3AU7A 2WINB 2RF4A 4JW0A 1ML0D 3T1YL 3GTPH 4JI8Q 4IPGA 3DEPA 1HNWQ 3T1HQ 1S4ZA 2NN6G 2VS1A 4GKJL 4DR4L 1HUNA 4GNXB 1SROA 4QIWB 2R93B 5LL6X 2E2IB 1NAPA 2OTJA 2F0SA 3MZ5A 1F2YA 3HOUB 2XNAC 4OEMB 3NK9A 4NB3A 2L5TA 2K5VA 5J1ZA 4OXPA 4F8MA 4K0KL 1I50B 2LXKA 3GTLB 4KN7C 3PIO3 1HTLD 2I0QA 3HOZB 2R7FA 3J81j 2FMCA 4OO1H 3PUYA 3BDCA 1VQBA 2NVXH 1PMRA 4AIMA 3NENA 3GDEA 1CK1A 3NTIA 5CORA 3VYUA 1J8IA 3Q8DA 1VQ9A 4KY7A 1MSHA 2MNAA 3ER0A 1FNUA 4HSPA 1DM0B 2K01A 1KHIA 1ENAA 1W6KA 1K8AC 5C44H 4H7BA 3HG9A 5IGEA 4Y52H 3K7UC 2G9HD 1QNUA 4YCUA 2L0CA 3AMUA 1SE3A 3E6ZX 3HOVG 4KHVA 1U4RA 2JQOA 5E4XA 1UEBA 5GAHC 3CPWA 4DK3C 4CJ1B 3S1QH 3HS0C 1I4HA 2PI2E 1FGBD 4QIWE 2PZWA 3FMCA 2Q8TA 5CV9A 1L0XB 2VL6A 5FJ8H 4DV0L 1G51A 5I6YA 2A6EC 1VQEA 1QZHA 3D0FA 1Y1VH 2N49A 3S2HB 3QIAA 3ND8A 3GTKB 1JT8A 2KENA 1CFMA 1SXTA 1FR3A 5IP9G 4PZ7A 3UI2A 3PUVA 3KF6A 3U4ZA 4ZQ3A 4MIUA 1YNJD 4JG2A 1UE7A 4EQNA 4Y7NB 4XT3B 3PSIA 3HOVB 4X65L 5IGDA 4K2LA 1ENCA 3TRZA 2MHVA 1EIHA 2I5HA 2B2VA 3WWVA 4JI6L 1JC7A 1XPUA 1F9SA 2NVTB 1A0IA 3G4SA 1ICFB 2KCMA 1H9RA 3TP5A 1Z47A 3TREA 1E22A 4L5QA 3L7ZC 3E9IA 1K28A 2DJFC 1IBKL 5EBCA 1TQOA 1YNXA 1PXUA 3LWUA 3IFTA 4CKCA 5HY6A 5C4JB 1AZPA 4XQNA 1CHQD 4GOPC 4LF7Q 3TBIB 1WVLA 2E76C 3CRKC 4H13C 5H1SE 1JJCB 1ZYRD 2JE6I 2F4VL 1SMXA 4HIDA 1VQLA 1STGA 4K2KA 4DV4Q 1LO5D 4JI7Q 1BDOA 1ASYA 4HN7A 4X3SA 3KDFA 2QKIC 1SYCA 4JCVE 1RCVD 1H9JA 5C0XH 1Y8PB 4HIOA 1P16A 1PTOD 5M5YB 3G71A 2AMCB 3NQIA 3HZXA 1N9WA 3OHXC 2RSNA 1LLRD 5EPJA 5CV7A 2ZTDA 5T1IA 5C3EH 3TP7A 1QUQB 4LF6L 1X3EA 1TWCH 2SOBA 3RLNA 5DNFA 1AZQA 4YWLA 4ME3A 5A2QL 2CVRA 1Z6HA 5KNCA 1KLUD 3PUWA 2V4DA 5BR8Q 3HOWG 1KNAA 1EIYB 1RKNA 2Y0SE 1JB3A 4K5VA 4TVAB 5CV8A 1QNKA 1Q86C 3M4YA 1VQGA 2EYJA 2PO4A 5FLMG 2M00A 1D5XC 4XT1B 1LUZA 5LMNQ 4LF5L 5JEAH 1D1IA 1Q3LA 2WP8J 1XTDA 4UY8C 4F88A 1EEFD 5C0XJ 1C0AA 4X66L 1EYCA 5G3LF 2UXCL 1BXTA 4A3LG 3C2PA 1U4LA 5LMUQ 1Y8OB 1F9QA 4A3CH 3U50C 2DNCA 4JI5Q 1A3UA 5HGTA 1OXSC 1YNND 1B7YB 3HOWB 2UXDQ 4J6HA 1B4OA 1BOSA 3OWEB 2D0PA 4A75A 3NE5B 4GS3A 4KMUC 4EGVA 3KF8A 3TEHB 3F2BA 1R9TB 1VQ4A 1TVXA 1AW7A 4KLKA 2VY3A 4ZAIA 3FKIG 1K8GA 3CCUA 2JA5G 5IWAL 3CMAA 1V8QA 1CA5A 1SYGA 3S1RH 3K0XA 2MFIA 1HRJA 4PQXA 2XN9C 5KGUA 3F2DA 5M5XB 4LFCL 1SFOB 3KDFB 4OO1I 2NZHA 3I4LA 1I4XA 5JEAJ 1GD7A 5L37A 4XQJA 2EXDA 1QWYA 3EFXD 2IX3A 1PTOH 4QGUA 2A74C 2IX1A 3TP8A 4RCNA 4GLXA 5M3FH 4DV1L 1TY0A 3FKIB 5K36H 3ZJYC 2PW5A 3O13A 4IJHA 4LWCA 2JA5B 1I94Q 5IIFA 3I4MG 1NCVA 3KLRA 4DV7Q 1CUKA 1BQQT 4B3RL 1I3QH 3NQTA 1GUTA 3ICEA 1KABA 5ELOA 4DAMA 5LL6S 1CSPA 2DN8A 2E75C 1JOKA 3TS0A 2HDLA 3JAME 2EDGA 3J81E 5JVG3 4JI2L 4B3ML 2F0LA 4LMQD 4F87A 4B3SL 1VQNA 3PO2G 3JC66 2MO0A 2R7ZH 4YY3Q 1SE4A 4YCVA 3I56A 1BF4A 2VUMH 1NJIC 1ZXTA 3I4MB 3LWEA 4XTCS 2I5LX 2F0HA 2CW0D 1XMQQ 1TT2A 2JK8A 3KF8B 3FRPB 2IL8A 2JXMB 4RWSC 3RLOA 1I6VC 4LF9Q 2ZTCA 4JK1C 2DY8A 2PQAA 2ZXOA 4CDFC 2E2HH 1IW7C 1HFGA 1VMCA 3BVGA 5JPNC 5M5WB 3V96A 4BBSG 3S1NB 1WTWA 2KOLA 3DHQA 2OTLA 2WIIB 1C7YA 4L63B 2UUAL 1SJHD 2C35B 1HZBA 1GHKA 4DUZL 1XNQQ 2NB0A 3PO2B 4PMCA 4OHJA 4BA1I 4P75A 1Y1WG 3H3VI 2HUGA 1SE2A 1VQFA 3ERQA 2R6GA 4DV6L 4S3SA 1DOMA 1VF5C 3QOJA 4H0LC 5M3MG 3PO3G 4G7OC 3U4VA 2RCNA 4HIMA 4OELB 3BDLA 3F2UA 3HOYH 3HKSA 3K57A 1G91A 3R8BA 4I7AA 3D3RA 4IUTA 3CC2A 3BJUA 2ZXPA 4CKBA 2Q2UA 4BBSB 4K6DA 1EL0A 5GQOA 3KJOA 3E9HA 2UUCL 5C0XI 2HQEA 3UE1A 3CCMA 3ULPA 4DUYQ 2JA6H 1N32L 4R4CA 3PIPA 2RSOA 1ESFA 1TKWB 4HAEA 4K5WA 3JAMi 1Y1WB 2E2DC 4DFAA 5CGKA 3JAMc 4DR1Q 4C3HH 3OIQA 2YTYA 4K8IA 1PH1A 3G48A 3J81c 2F0JA 2CFMA 5ELCA 3C1EA 1RF2D 2L12A 5M3MB 1JE5A 3PO3B 2JA8H 5IY0A 2DUDA 4UHVA 2J0TD 1AFPA 2HT1A 1PYSB 1PH6A 3S2DB 4H44C 3S17H 3RD4A 1VQJA 4EX5A 3I4NB 4JC0A 4GOPB 4A3EG 1LT5D 4HCSA 4X3KA 1GOZA 1KXLA 2PCFB 2KQ3A 1VQPA 3SK8A 2VQEQ 4RMFA 1TWHH 4KJNA 2K5NA 4EVOA 1BBWA 1PRTD 4G4KA 3GV6A 1IBLL 1STAA 1B3QA 3PV0A 2CH4A 4MHEA 1A2TA 1F77A 3I7FA 3AFPA 1IKLA 3E5SA 3LX0A 4NXNL 2QILA 1E7ZA 1STHA 1UAPA 2B2UC 2E2JH 5JJKA 1VQ7A 3OW7A 1F2MA 4FNFA 3VR6A 2B2YA 2NYZD 2AQ1B 4RHRA 1BCPF 4A3EB 3NXWA 1ASZA 3M3YB 4JPBW 1EU4A 4CBVA 3SK4A 3MFGA 3I73A 4KKSA 4U68A 2DY7A 3EA6A 3KK7A 1JR0D 3K5NA 2AUKA 4WJ3M 1LV9A 2BOSA 3RZDB 1S40A 4DR2L 2RHSB 2QF7A 4LFBL 4FXKC 1R4QB 4PG3A 1EFWA 1VCIA 3AYHB 4DR3Q 3M9BA 1IHZA 2IHEA 3UE0A 2QGQA 3UDFA 1JICA 2RHQB 4A3BH 1YEZA 1D7QA 4A3DG 2YU9H 1V1OA 1EQQA 3EIVA 3FPUB 1B70B 2ICEC 2ZJRA 1YHAA 3RUZA 1DONA 1B44D 2LSSA 3GTOB 2K04A 1VS0A 3MAQA 3KFUA 3RZOB 3IKJA 5A35A 1WI5A 3TSSA 1K8OA 5D3IB 1CI3M 1GUNA 1WYDA 2A1AA 2A19A 1PHJA 5ELNA 2KHIA 3CMEA 2WKCA 3BZCA 1NBWA 4TKOB 3GP7A 5IP7G 4DA2A 4IPHA 4UP9A 2B2WA 4DR7Q 2KECA 2EXZA 1YHQA 1WCMG 2SDFA 1CTMA 4MNOA 3A5ZB 3EN2A 3HEJA 4IFDG 1TWAH 4A3DB 3EQLC 1SYBA 4B3TL 2LXJA 2A68C 3K7AH 2F0IA 4C1NK 4FVMA 1LTRD 3QO2A 2B8FA 3T51B 3RNUA 1I6HH 1NNXA 3S1MH 4RGOS 1VMPA 2Z4IA 3GTQB 4RH6A 3I55A 3TZDA 3W3AA 3CCVA 4TQUS 1ET6A 3PUXA 3S15H 2Z6BA 2PQEA 3RR5A 1O7ZA 3GTJH 1WCMB 1JCKB 2L11A 5EKKA 4A3IH 1PH8A 1HXYD 2FXQA 1VQDA 5FO8B 2DGYA 1LT3D 4BY7G 2LY7A 4HJ7A 1SNPA 3L3OC 1JWUD 1K83B 2NTSA 2XWBB 3OTOQ 2VQFL 4HMIA 3X3NA 1J9OA 5IYCG 4JBWA 3CQZB 4CJ0B 5KNDA 2ZJQA 2UU9Q 4BXXG 4LF8Q 1PH2A 1T5XD 2E2IH 3GTGB 3J7ZC 4DV2Q 2F0NA 2I46A 1PTOC 3K5MA 2VNUD 1U4MA 5FOBB 3GTLH 1GKHA 3CF5A 1QOHA 4G7ZC 1K73C 4QL5A 1EFID 3HOZH 2BCOA 2EYFA 1MIUA 3NWSA 2HCIA 1PH4A 2H5XA 5KRUA 1XPRA 4BY7B 5IT9L 1MJEA 2HHHL 4KHPQ 1PV4A 2KHJA 3IFDA 2F0DA 2PNHA 1M90C 5KIXA 4ZCKA 4DR5L 2NN6H 3UDGA 1S5BD 1HZAA 2TMPA 3NBHB 3S14H 1PZJD 3CCLA 1AEXA 1IKMA 2UXBQ 3NWTA 5C4ZA 2OF1A 5EBDA 3QWNA 1DZ1A 5I4DA 4GN4B 2HQLA 2F0EA 2TSSA 3K80C 3CU7A 4JI0L 2JEAI 1TXYA 4NP5A 1IZ6A 2D0OA 4DR6Q 3AB9A 2RDHA 4C56C 2XWJB 1C8CA 1HNZL 4RAUC 1NUCA 4X64Q 4GZYC 2VB2X 1TR5A 4DNIA 1YNNC 4LK1C 2Z0SA 3QR8A 1KIXA 2MPMA 4Q5VA 5FO9B 4OL7A 1LT6D 4MZ9A 3F2CA 3FDTA 4F7XA 2JN4A 5FJ8G 3AEVA 3J7A5 3S2HH 2ALYB 1M8AA 3KOJA 3GTKH 5ELBA 4P74A 1QUQA 2F0GA 2RKSA 4C3IG 1H95A 5JAVA 4NW2A 3J81L 2RCFA 5DM63 4Y7NH 1PA6A 1Q8KA 3CP0A 1OXXK 3OW2A 2UUBL 2NVTH 1BCPC 4LAAA 4JVZA 5FLXE 5JJIA 3KBXA 1IXRA 4OIKA 3VR3A 2N88A 5E7NA 1D5MC 3AQQA 1MHWC 4JI8L 1HNWL 3L0OA 3T1HL 1AN8A 1UE5A 1OTCA 2N55A 1Q82C 4BBRG 2K03A 5IP9H 3C1FA 4C3IB 4POGA 1E3PA 5LMNW 1SEBD 3QOLA 1SNDA 4DK6C 2F0KA 1X32A 3M4QA 3I2ZA 4NXMQ 1QG7A 2NZ1D 1TWGB 2FMMA 3H3VH 2B2TA 4GKKQ 3PUZA 4L5RC 3G6JB 1L1OC 2Q2IA 1KNEA 1P8LA 1EY8A 4QUFA 1XNRQ 1SNMA 3KLSA 1G6ZA 4EQOA 4Z9CB 5EJWA 4C1NI 5M5YH 1IYUA 1HPCA 2L55A 3MXGA 4BBRB 2Z6KC 1D6EC 2F3VA 3PIOA 2PPBC 3ONAB 1N34Q 1PYBA 1CZWA 3LGJA 1U0LA 4ME5A 3P1HA 3B6YA 5C3EG 1SNQA 3GTMB 3BVMA 4L8JA 4BS9A 3VA5A 1QJOA 3TDQA 3EVQA 5C5LA 1G8ZD 3CRLC 2EVBA 1UWVA 1Y14B 2SNMA 4R8NA 3J7YW 5D65A 1RDPD 2NTTA 4A3GH 2VZAA 3DM3A 4IN3A 5E1FA 3T13A 1KRSA 5CV6A 2ZJPA 3GO5A 1QILA 2IX0A 1STNA 2F3IA 3ZYYX 4FO2A 1Q46A 1RIPA 1W3SA 2E74C 1Y8NB 4GLAC 5DM73 1FYCA 5FLXc 1KL9A 3J80E 3VR2A 3T4AC 2ZT9C 2A69D 3TP6A 5C4HA 2IWHA 3TN2A 4XIGS 4AH6A 5C3EB 2B63H 1SNOA 4XYOA 4HJ8A 3HOWH 5TSSA 4A3CG 3R2TA 1DOKA 3MA2B 4HJAA 2X69A 2YTXA 1YVCA 1MKHA 1R9TH 3DWQA 4RGTA 4ZUJA 3H0GH 2EQSA 5FLMH 2RVLA 1O80A 2XSCA 3UDXA 3VDYA 1Y69U 4QQBX 4B9XA 1YHBA 3BS1A 1N8RC 2MO1A 1PFNA 2EIFA 4C3JG 1JOOA 2M9VA 1A3VA 3U58A 2Z8LA 1SFOH 2MJ8A 3I3CA 2KEDA 3CKIB 3SEBA 4A3LH 4E6IA 1E2VA 2NN6I 5GAGC 4LF7L 4KHZA 5JOBA 1TWFB 1WOCA 1YITA 5K5PA 3M4PA 1KAAA 1S5FD 3WOEA 3BG3A 2A6ED 3FKIH 1GO3E 5M3FG 1EOTA 2JA5H 2EE1A 3Q22A 4JI7L 4X62Q 1X55A 1KDBA 3A8IE 1EUJA 3OWFA 4C3JB 1QE6A 2EPBA 4RA8A 1STBA 4ILWA 1SYEA 4OX9Q 1EIGA 1PRTC 1SBBB 5C4XG 3FHWA 2GVBA 4O42A 3OMCA 4ODGA 4JI4Q 4R4OA 4RGMA 1EOVA 3BDOA 3MC0B 4ZRZA 3QB3A 4TRDA 2RDFA 3J80i 1H9KA 1UE1A 1PTOB 3J80c 1RTOA 1S5CD 1QB5D 2QDBA 1HQMC 4LJZC 5BR8L 5M3FB 1E2WA 2J7ZA 1Q1BA 4Q0FA 1LT4D 3OPOA 2A6HD 4A3MH 4A3JG 3KLWA 5CC4A 4O1NA 4GLVB 1NMFA 3BVZA 4LUZA 1BUVT 4U673 4KV6A 2IHFA 1SE8A 1N33Q 5LMNL 3CCRA 1I3QB 3NEMA 4K8JA 3VYSA 5C4XB 2RQXA 5E4WC 5I9OA 5EPKA 3K5OA 4GOPA 1HQRD 1HUMA 1L1OA 4JV5Q 2O4XA 3DM1A 3NP8A 1TIID 1NSNS 4JOIC 3W5OA 3DMUA 4LFAQ 1XMOQ 3S1NH 2MQHA 1XPOA 1B3AA 2K75A 1HZ9A 5LMUL 3P7JA 1Q7YC 1B2TA 4BY1G 1O78A 3VR4A 4DXFA 4JI5L 2OEOA 3PO2H 1B1ZA 2UXDL 1V1PB 5IGFA 2O5IC 1NMGA 1FD7D 4HCEA 4A3JB 1O7LA 3HGBA 5J3BA 2L15A 2B8GA 4HTHA 4DPGA 2BH2A 3OOCA 1AP0A 2QCPX 4PV1C 4N8FA 2EJGC 1S72A 1HH2P 1UNSA 3PF5A 5AJ3Q 1PTOF 4A3FG 3K6OA 2WV6D 2E5LQ 4BBSH 3T16A 2KHSA 4DV3Q 2B3GA 5HGQA 5I6WA 4FF4A 1GHJA 1BBXC 4HJ5A 1ZKOA 4BY1B 1VQ8A 3CCEA 4HMJA 2N78A 1EU3A 3I4NG 4P72A 2CQAA 1Y1WH 4QF4A 1MBYA 5DLQE 1HR0Q 2R92H 1R4PB 2IJ0A 4YHHQ 1BCPB 3KBGA 5CBAE 2D5DA 2LFNA 4C3HG 5JJZA 1B8AA 4CHTB 5M3MH 3PO3H 4C2MB 1I94L 4DNTB 4KKTA 1N36Q 2IPKD 1Q1EA 3KLSX 2BE5C 2CKZB 4DV7L 1RTNA 2F0OA 2VW9A 1II3A 3S2DH 2K5WA 4A3FB 4R8IA 1XYIA 1G2TA 2QEXA 1ET9A 5IYDG 3LNNA 4JI3Q 3S16B 3NBIA 1LTBD 1NR2A 3E0EA 3K59A 4DV5Q 1SMYD 2KA7A 2D62A 4N8X1 4OWTB 1A63A 3VYTA 1OXUA 1EY7A 1L1OB 2EY1A 1BR9A 2K52A 1JMCA 4FF2A 5A2QE 1PH9A 2EYOA 1STYA 4C3HB 1X9NA 3QG1A 4WORA 2EYHA 1XWEA 4YY3L 2G9DA 3HRZC 4FDBA 4ZKBB 1XMQL 1TS2A 5DAUA 4UPAA 1EQRA 4XQQA 4HJ9A 1SDFA 3M85A 4AQYQ 4LF9L 1VQMA 3S17B 4UAIA 4XXEA 4JI1Q 1A3TA 1EY6A 2C5CA 1Z9FA 1VQCA 5DEHA 1CM9A 3K58A 1ZEQX 3F1ZA 5FKAC 1QCBD 3H6MA 4LF4Q 4PZ6A 1UE6A 2NZOA 5EPLA 1GM5A 1D1KA 3T53B 1ILQA 4WJWA 4IQZA 2VB3X 3D6WA 2N3SA 1FL0A 1TWHB 1PZKD 2ZM6Q 2IT1A 2OT2A 3EBEA 1J5EQ 1XNQL 4IZ8A 4KD4A 3TMEA 3H3VC 1VDZA 1EYAA 4YCWA 1NY4A 2BDOA 2ICIA 4JYAQ 1IBMQ 4LNQA 1K3BC 2XRSD 2AUJD 4WFN3 4RKBA 3N6RA 4ID6A 2HCCA 2MGSA 1HJPA 4A3BG 1CA6A 3SXHA 4PMBA 1KQSA 4P2CB 1KLGD 3Q6SA 2AHOB 3W1GA 3T1YQ 2NVQH 3K5LA 4X3TA 4V0BA 4GKJQ 1JWSD 3M7NA 3RZOH 1Q8IA 3A5UA 2CHBD 4ZUIA 4DR4Q 5IOCA 4DUYL 2OQ0A 3AFQA 5CV4A 5IYBG 3HFZB 3NTKA 4DXGA 1JOQA 4B08A 3TQYA 1M4VA 4X6AH 2JYOA 4K14A 3RN2A 1BVSA 2OXPA 3MXNA 1X3QA 2XGTA 4DR1L 2I07B 2FFKB 4RG1A 4RFBA 1EWCA 4K0KQ 3ND9A 1CKOA 2F52A 3SE0A 4HIKA 2OQKA 4JOIA 4L5TA 5CMDA 5JVH3 2R61A 1LTLA 4O2DA 4WJ4A 1LABA 4A3BB 3D4WA 3NBHA 3J7AV 2YU9B 5GAEC 1EQVA 1YNJC 2NVYB 3HOXG 4XDXA 1WTPA 2JA7G 4A93G 3MEFA 4K6LA 1HHVA 5CV5A 3GTQH 2JA9A 4KKUA 3SHLA 2K7VA 2VQEL 5IP7H 1E24A 5HURA 3M4OH 4K5XA 4A3KG 2PZTA 4I65A 1WCMH 3SR1A 5D3DA 1WD0A 1E1OA 2WKDA 1D5ZC 2Z9HA 1VQOA 4A3IG 2QW7A 1C4QA 1ONLA 1TWAB 1PH5A 2AWOA 1K83H 1PRTB 4APVA 3G6EA 2EZVA 1MD2D 2KVMA 2FHTA 3H91A 3K7AB 1CKNA 1GVPA 1ZYRC 3CHBD 3HOXB 2JA7B 4A93B 2LS01 1AH9A 2G5DA 4DV0Q 3GTGH 4CDDC 1TS5A 1JORA 1WTOA 1CSQA 3PQIA 2QA4A 1Q81C 2H1EA 2R93H 1A15A 2OCEA 4A3KB 5F2DA 1X3PA 4NPSA 4BWGB 3HOUH 2XIWA 1A8VA 2PYKA 4X65Q 4A3IB 1I50H 4DR3L 1PFBA 3MXNB 4JI6Q 2F0WA 2K5HA 1EIFA 1VQ5A 4QJFA 3K81C 3SGIA 1PVOA 1ENFA 4GN3B 4YWMA 1PH3A 4IFDJ 4POFA 2JSOA 4DK0A 2K4KA 5IYCH 3SDZA 4OO1G 2NWGA 4BXXH 3SK6A 4KD3A 2M2LA 2SEBD 1IBKQ 1SJED 3GTPB 2B39A 3MXUA 3H09A 1QVFA 3ULJA 5G3LD 2R7DA 2WACA 4DNRB 2AWNA 2ZXRA 3MEHA 1SNCA 4FP5D 1CQVA 2WB1G 5EKLA 2EY5A 3E0JA 2QEJC 1RODA 5ISRA 2F4VQ 3I8ZA 2J4XA 2BDNA 4IJLA 4LUVA 5C44G 4JBKA 2F3WA 2L4NA 2A69C 4HEDA 1PRTF 4DR7L 4I7ZC 2B2UA 5LHY1 1C48A 1CZGA 1E2ZA 4ZK9B 2YYZA 2DNEA 3J7AF 3A56A 1HNXL 3NELA 3RMHA 2SNSA 2NVXB 3S14B 5C3XA 2JP1A 1VQKA 5J22A 4R9WA 2K14A 5GROA 1WTVA 1YZ6A 2N8NA 1CKNB 3BU2A 3P75A 3I70A 5I2YA 4EQ5A 1A6XA 4IUNA 3CC4A 2EY2A 1Y1VG 2Z1CA 1FJGL 4LF6Q 3OYYA 1PYWD 2WB1B 3JAML 1JJ2A 4WRDA 5FO7B 4QY7A 3STBD 5C44B 1U4PA 1VQIA 1KD1C 1LTID 1WTXA 5E3FA 1TS4A 3HOVH 3FVQA 3K8AA 5COYA 1SSOA 1B50A 2O2LD 2CCZA 4XYQA 2F0VA 3PF4A 3T56B 2Y0SG 3S1QB 3OTOL 4LF5Q 2K1BA 4FXDA 3DUZA 5I9PA 1LTSD 1OXTA 2XRQD 4C3IH 3KUPA 2C9OA 2UU9L 1PDQA 4LF8L 4X66Q 1L2FA 5IGCA 1Y1VB 2MUYA 4DV2L 2D9UA 2UXCQ 5C4JH 1TWGH 4QUCA 1DCZA 5ELDA 1IYVA 5KYLA 2A68D 2ENBA 4X3UA 1S3OA 5IGBA 1YIJA 2WAQG 3W2DA 4YWKA 1JE4A 1K8MA 3VYRA 4ABNA 4IUQA 4IO9A 1HA6A 1OO9B 1X6OA 2I5MX 3A74A 4FF1A 4KHPL 5ELFA 2Y0SB 3A7LA 5IWAQ 3K0YA 1EEID 4P73A 4QB4A 4BBRH 3I90A 4A76A 4JBMA 2WB1E 1DYQA 2GA4B 1BNZA 4OWXB 2UXBL 2A6HC 3MTSA 4G57A 5C0XG 4LFCQ 2KCNA 1I4GA 3GTMH 2KUMA 1UEAB 1GUOA 1VQHA 2X6GA 1B53A 2PMZB 1K0SA 1I4PA 4FXGC 3DLLA 2CW0C 3I91A 4DR6L 2H4OA 2Q2HA 2WAQB 1DOLA 2EYPA 3FP9A 2E8GA 4NKLA 2ASBA 2R3ZA 3M7GA 5J39A 5KNBA 4IUVA 4DF7A 4DV1Q 5T1GA 1QVGA 4OONA 1X3FA 4FYDA 4LW1A 4A3GG 1YJWA 1EZ6A 4X64L 3CXCA 2FINB 1IL2A 1M1KC 3BYTB 5NUCA 4CJ2C 4M1UB 2CH4W 4ZLTF 4IFDI 4B3RQ 1L0YB 3D8GA 3A54A 1AE3A 1XJVA 5JEAG 2L1BA 3BZKA 4DAPA 4ALPA 4PNYA 4DAYA 1WTQA 1MJCA 4MTNA 4B9WA 2B63G 4J8QA 2EOTA 1TY2A 2GVAA 2CQOA 3IAYA 1PLFA 1TWCB 4ZYSA 4JI2Q 3PCOB 3KF6B 4B3MQ 3CCSA 1EY4A 3A55A 1DJRD 1LTAD 3NHHA 4B3SQ 3H0GG 4A3GB 1TU2B 2AQ2B 2PZUA 1A62A 3ULLA 1NE3A 2QDLA 1EY9A 2PMZE 4KI0A 5IODA 1LYLA 1E0BA 2IY5B 2WAQE 1CHPD 5M5XH 3URYA 5KEEA 5EGTA 2B63B 2CWPA 1TWFH 4L5SA 2ZTEA 4NXML 1MSGA 1LACA 2F0FA 1UUPA 3KYHC 2V1CC 1V1PA 4NMZA 4GKKL 5IE8A 2UUAQ 1I5FA 1FGUA 4J1MA 2DJGC 4DUZQ 3C3LA 4IALA 3H0GB 5I2XA 1HA5A 2HIXA 3PMFA 1SMYC 2AKWB 5IT9E 3PGZA 1FNWA 4DV4L 1CKMA 1XNRL 1FNVA 1GUSA 3EJIA 4C3JH 1X65A 4DV6Q 4PMWA 5K36G 3PIP3 1EY5A 5C6AA 4O0AA 3UDIA 1O7IA 1D2BA 1HCZA 1RJTA 3S1RB 3W1BA 1BCPD 5M9OA 1L0WA 2XTIA 2F0UA 1N34L 1CQFA 4ULLA 1IYJB 2A73B 1QVCA 2B2YC
chains in the Genus database with same CATH topology
1STEA 1LTTD 3DWAA 3H94A 1BO0A 4QMGA 1PFMA 1GXDC 2AQ3B 3S9WA 1ICWA 1VF7A 2F0PA 1XX8A 2X6LA 5EKIA 2XVSA 2K33A 3D4DA 4FF3A 3A8JE 2L9HA 3OMGA 3EROA 4OGQC 1I4RA 3U9OA 3V05A 1V43A 3OSOA 3ITPA 3HP3A 3GQBA 2RBMA 2K5DA 4KTAA 3SK5A 4HSVA 4A3MB 1GUWA 3N52A 2R7ZB 4G7HC 4L6TB 4YIJA 2VUMB 5ELEA 2B2WC 4RKLA 3SVMA 1H9SA 1JWMD 4OIJA 2K5QA 1SAPA 2BA0A 1U9RA 3A7AB 1SYFA 2E2HB 3R3OA 2MP1A 2F4IA 4NDXA 5JPMC 3X3MA 3D4RA 2BA1A 2EYMA 1LTGD 1MI2A 1NR4A 1RHPA 2EJFC 3VA7A 4N9TA 3TZUA 4IUUA 1HFNA 5BN3A 1CT1D 2K28A 1F9PA 1S5ED 3I72A 3Q24A 1EYDA 3DEOA 2A5HA 3R93A 1G2SA 3HOYB 1RD9D 4KJOA 3WOFA 2FJ2A 1ILPA 1EWHA 2R92B 5AFWA 2JA6B 2F03A 1XXGA 4HR7B 1ESRA 1W6JA 3GD7A 2NUCA 4DN4M 1F2LA 4UDUC 4M8AA 4TSSA 4DAVA 1WTRA 1WD1A 3MWYW 2F1MA 3HKZB 2JA8B 5CYUA 5CBEE 2RDGA 2PW7A 3RLFA 3IL8A 3MXPA 1H9SB 3FEWX 3NSWA 3OIPA 1HTPA 1KDAA 5D14A 1DXMA 5FK9C 2LKVA 3BYYB 4DU9A 4AYBB 4V190 3R2IA 3MFYA 1A2UA 2PNRC 5C5MA 1Z7TA 3A8KE 4RCOA 4RGNA 1O7YA 1S5DD 1TS3A 5FLXL 3WDNA 3C46A 3VR5A 2EY6A 3P20A 1KTKA 3U9SA 4BA2I 2E2JB 2F0QA 3NUCA 3Q23A 4DK1A 2ID0A 3V2TA 5BN5A 2KJXA 2F0TA 5EQ0A 3QJYA 1IL8A 2NBFA 4EQPA 3Q0AA 2RA4A 4ZKCB 2LMCB 5IGGA 3MHBA 1IW7D 1T5EA 5C3WA 5CR3A 4KK7A 4IUPA 2NVQB 1I4QA 1B9NA 3D6CA 1PZID 4KN4C 5BN4A 2B2VC 4IURA 2HDMA 2D2CC 2O5JC 2K6AA 1XTCD 3NTHA 2KEEA 4KY5A 1H9MA 1EQTA 1Q12A 2K32A 1JQYD 1SYDA 4N9PA 1EZ8A 4QCLA 1MGSA 2B2TC 1GUGA 2EYLA 2Z4HA 2KCCA 1G291 2VXWA 1GJXA 3GV3A 2F0MA 4IFDH 2EJMA 4RHSA 3NPPA 2Q8RE 2Q8IB 3DXJC 4CGYB 1B9MA 3J80L 3DWPA 5KYIA 1I6HB 3FPPA 2BE5D 1Q90A 3MVVA 3S1MB 4DGZA 3D31A 3L9AX 3M4OB 3BZDB 3G7LA 2JEBI 2K05A 4MN3A 1F2ZA 3S15B 1F9RA 1KDCA 3GTJB 1DD2A 2IW3A 4KY6A 1EY0A 1OXVA 4CKEA 3AU7A 2WINB 1ML0D 3DEPA 1S4ZA 2NN6G 1HUNA 4QIWB 2R93B 5LL6X 2E2IB 1NAPA 2F0SA 3MZ5A 1F2YA 3HOUB 2XNAC 3NK9A 2L5TA 5J1ZA 4F8MA 1I50B 3GTLB 4KN7C 3PIO3 1HTLD 3HOZB 2FMCA 4OO1H 3PUYA 3BDCA 1PMRA 1CK1A 3NTIA 5CORA 3VYUA 1J8IA 4KY7A 1MSHA 1FNUA 4HSPA 1DM0B 2K01A 1ENAA 1W6KA 4H7BA 3HG9A 5IGEA 2G9HD 1QNUA 2L0CA 3AMUA 1SE3A 3E6ZX 4KHVA 1U4RA 5E4XA 4CJ1B 3HS0C 1I4HA 1FGBD 2PZWA 3FMCA 2Q8TA 5CV9A 1L0XB 5I6YA 2A6EC 3S2HB 3QIAA 3ND8A 3GTKB 1CFMA 1SXTA 1FR3A 3UI2A 3PUVA 4ZQ3A 4MIUA 1YNJD 4EQNA 4Y7NB 4XT3B 3HOVB 5IGDA 4K2LA 1ENCA 2MHVA 1EIHA 2B2VA 1JC7A 1F9SA 2NVTB 1H9RA 3TP5A 1Z47A 3L7ZC 5EBCA 1TQOA 1PXUA 3LWUA 3IFTA 4CKCA 5C4JB 1AZPA 4XQNA 1CHQD 3TBIB 1WVLA 2E76C 3CRKC 4H13C 1ZYRD 2JE6I 1STGA 4K2KA 1LO5D 1BDOA 4HN7A 4X3SA 2QKIC 1SYCA 1RCVD 1H9JA 5C0XH 1Y8PB 1PTOD 5M5YB 3NQIA 3HZXA 3OHXC 2RSNA 1LLRD 5EPJA 5CV7A 5T1IA 3TP7A 2SOBA 5DNFA 1AZQA 5A2QL 2CVRA 1Z6HA 5KNCA 1KLUD 3PUWA 2V4DA 1KNAA 1RKNA 1JB3A 4K5VA 5CV8A 1QNKA 3M4YA 2EYJA 2PO4A 2M00A 1D5XC 4XT1B 5JEAH 1D1IA 1Q3LA 2WP8J 4F88A 1EEFD 5C0XJ 1EYCA 5G3LF 1BXTA 3C2PA 1U4LA 1Y8OB 1F9QA 2DNCA 1A3UA 5HGTA 1OXSC 1YNND 3HOWB 4J6HA 1B4OA 1BOSA 3OWEB 3NE5B 4KMUC 4EGVA 3KF8A 1R9TB 1TVXA 1AW7A 4ZAIA 1V8QA 1CA5A 1SYGA 1HRJA 4PQXA 2XN9C 5KGUA 5M5XB 1SFOB 4OO1I 3I4LA 1I4XA 5JEAJ 4XQJA 1QWYA 3EFXD 2IX3A 1PTOH 2A74C 2IX1A 3TP8A 4RCNA 1TY0A 3FKIB 5K36H 2PW5A 3O13A 2JA5B 5IIFA 1NCVA 3KLRA 1BQQT 3NQTA 1GUTA 1KABA 5LL6S 2DN8A 2E75C 1JOKA 2HDLA 3JAME 2EDGA 3J81E 5JVG3 2F0LA 4LMQD 4F87A 1SE4A 1BF4A 1ZXTA 3I4MB 4XTCS 3LWEA 2F0HA 2CW0D 1TT2A 3FRPB 2IL8A 2JXMB 4RWSC 1I6VC 4JK1C 2DY8A 2ZXOA 1IW7C 1HFGA 1VMCA 3BVGA 5JPNC 5M5WB 3V96A 3S1NB 1WTWA 2KOLA 3DHQA 2WIIB 4L63B 1SJHD 1GHKA 2NB0A 3PO2B 4PMCA 4OHJA 4BA1I 2HUGA 1SE2A 3ERQA 2R6GA 4S3SA 1DOMA 1VF5C 3QOJA 4H0LC 4G7OC 3BDLA 3F2UA 3K57A 1G91A 3R8BA 3D3RA 4IUTA 2ZXPA 4CKBA 4BBSB 4K6DA 1EL0A 5C0XI 2HQEA 2RSOA 1ESFA 1TKWB 4HAEA 4K5WA 1Y1WB 2E2DC 4DFAA 5CGKA 3OIQA 4K8IA 2F0JA 5ELCA 3C1EA 1RF2D 2L12A 5M3MB 3PO3B 2J0TD 1AFPA 3S2DB 4H44C 3RD4A 3I4NB 1LT5D 4HCSA 4X3KA 1GOZA 2PCFB 2KQ3A 3SK8A 4KJNA 4EVOA 1PRTD 4G4KA 3GV6A 1STAA 3PV0A 4MHEA 1A2TA 1F77A 1IKLA 3E5SA 3LX0A 2QILA 1STHA 1UAPA 2B2UC 3OW7A 1F2MA 4FNFA 3VR6A 2B2YA 2NYZD 2AQ1B 4RHRA 1BCPF 4A3EB 3NXWA 3M3YB 1EU4A 4CBVA 3SK4A 3MFGA 3I73A 4KKSA 4U68A 2DY7A 3EA6A 3KK7A 1JR0D 3K5NA 2AUKA 1LV9A 2BOSA 3RZDB 2QF7A 4FXKC 1R4QB 1VCIA 1IHZA 1JICA 1V1OA 3FPUB 2ICEC 1DONA 3RUZA 1B44D 3GTOB 2K04A 3MAQA 3RZOB 3IKJA 5A35A 3TSSA 1K8OA 5D3IB 1CI3M 1GUNA 2WKCA 4TKOB 3GP7A 4DA2A 2B2WA 2KECA 2EXZA 2SDFA 1CTMA 3HEJA 4IFDG 4A3DB 3EQLC 1SYBA 2A68C 2F0IA 4C1NK 4FVMA 1LTRD 3QO2A 2B8FA 3T51B 4RGOS 1VMPA 2Z4IA 3GTQB 4RH6A 3TZDA 3W3AA 4TQUS 1ET6A 3PUXA 2PQEA 1O7ZA 1WCMB 1JCKB 2L11A 5EKKA 1HXYD 5FO8B 1LT3D 2LY7A 1SNPA 3L3OC 1JWUD 1K83B 2NTSA 2XWBB 4HMIA 3X3NA 1J9OA 4JBWA 3CQZB 4CJ0B 5KNDA 3GTGB 1T5XD 2F0NA 2I46A 1PTOC 3K5MA 2VNUD 1U4MA 5FOBB 4G7ZC 1QOHA 1EFID 2BCOA 2EYFA 3NWSA 2HCIA 5KRUA 4BY7B 5IT9L 3IFDA 2F0DA 5KIXA 2NN6H 1S5BD 2TMPA 1PZJD 1AEXA 1IKMA 3NWTA 5C4ZA 2OF1A 5EBDA 3QWNA 1DZ1A 5I4DA 2F0EA 2TSSA 3CU7A 2JEAI 4NP5A 3AB9A 2RDHA 4C56C 2XWJB 1C8CA 4RAUC 1NUCA 4GZYC 2VB2X 1TR5A 1YNNC 4LK1C 2MPMA 4Q5VA 5FO9B 4OL7A 1LT6D 3FDTA 4F7XA 1M8AA 5ELBA 2F0GA 2RKSA 4C3IG 5JAVA 4NW2A 3J81L 5DM63 1OXXK 1BCPC 4LAAA 5FLXE 3KBXA 4OIKA 3VR3A 2N88A 1D5MC 1AN8A 2N55A 2K03A 3C1FA 4C3IB 1SEBD 3QOLA 1SNDA 2F0KA 1X32A 1QG7A 2NZ1D 1TWGB 2FMMA 2B2TA 3PUZA 3G6JB 1KNEA 1EY8A 4QUFA 1SNMA 3KLSA 1G6ZA 4EQOA 4Z9CB 5EJWA 4C1NI 1IYUA 1HPCA 2L55A 3MXGA 4BBRB 1D6EC 2F3VA 2PPBC 3ONAB 1CZWA 4ME5A 3P1HA 1SNQA 3GTMB 3BVMA 4L8JA 4BS9A 3VA5A 1QJOA 3TDQA 3EVQA 5C5LA 1G8ZD 3CRLC 2EVBA 3J7YW 2SNMA 4R8NA 5D65A 1RDPD 2NTTA 3T13A 4IN3A 5E1FA 5CV6A 3GO5A 1QILA 2IX0A 1STNA 3ZYYX 4FO2A 2E74C 1Y8NB 5DM73 1FYCA 3J80E 3VR2A 3T4AC 2ZT9C 2A69D 3TP6A 5C4HA 2IWHA 3TN2A 4XIGS 5C3EB 1SNOA 4XYOA 5TSSA 3R2TA 1DOKA 3MA2B 2X69A 3DWQA 4RGTA 4ZUJA 2RVLA 1O80A 2XSCA 1Y69U 4B9XA 3BS1A 1PFNA 4C3JG 1JOOA 2M9VA 1A3VA 2Z8LA 2MJ8A 3I3CA 2KEDA 3CKIB 3SEBA 4E6IA 1E2VA 2NN6I 4KHZA 5JOBA 1TWFB 5K5PA 1KAAA 1S5FD 3WOEA 3BG3A 2A6ED 1EOTA 2EE1A 3Q22A 1KDBA 3A8IE 3OWFA 4C3JB 1QE6A 2EPBA 4RA8A 1STBA 4ILWA 1SYEA 1EIGA 1PRTC 1SBBB 4O42A 3OMCA 4ODGA 4RGMA 3BDOA 4ZRZA 3MC0B 3QB3A 4TRDA 2RDFA 1H9KA 1PTOB 1RTOA 1S5CD 1QB5D 2QDBA 1HQMC 4LJZC 5M3FB 1E2WA 2J7ZA 1Q1BA 4Q0FA 1LT4D 3OPOA 2A6HD 5CC4A 4O1NA 3BVZA 1BUVT 4U673 4KV6A 1I3QB 4K8JA 3VYSA 5C4XB 2RQXA 5E4WC 5I9OA 5EPKA 3K5OA 1HQRD 1HUMA 2O4XA 3DM1A 3NP8A 1TIID 1NSNS 3DMUA 1B3AA 3P7JA 1B2TA 1O78A 3VR4A 4DXFA 2OEOA 1B1ZA 1V1PB 5IGFA 2O5IC 1FD7D 4HCEA 4A3JB 1O7LA 3HGBA 2B8GA 4HTHA 3OOCA 1AP0A 2QCPX 4PV1C 2EJGC 1UNSA 1PTOF 3K6OA 2WV6D 3T16A 2KHSA 5I6WA 4FF4A 1GHJA 1BBXC 1ZKOA 4BY1B 4HMJA 1EU3A 2CQAA 4QF4A 1MBYA 1R4PB 2IJ0A 1BCPB 3KBGA 5CBAE 2D5DA 2LFNA 4C3HG 5JJZA 4CHTB 4C2MB 4DNTB 4KKTA 2IPKD 1Q1EA 3KLSX 2BE5C 1RTNA 2F0OA 1II3A 2K5WA 4A3FB 4R8IA 1XYIA 1G2TA 1ET9A 3LNNA 3S16B 3NBIA 1LTBD 1NR2A 3K59A 1SMYD 2KA7A 2D62A 3VYTA 1OXUA 1EY7A 2EY1A 1BR9A 4FF2A 5A2QE 2EYOA 1STYA 4C3HB 3QG1A 4WORA 2EYHA 1XWEA 2G9DA 3HRZC 4ZKBB 1TS2A 5DAUA 4XQQA 1SDFA 3M85A 3S17B 4UAIA 4XXEA 1A3TA 1EY6A 2C5CA 5DEHA 1CM9A 3K58A 1ZEQX 5FKAC 1QCBD 3H6MA 5EPLA 1D1KA 3T53B 1ILQA 4WJWA 4IQZA 2VB3X 3D6WA 1TWHB 1PZKD 2IT1A 2OT2A 4IZ8A 4KD4A 3TMEA 3H3VC 1VDZA 1EYAA 2BDOA 2ICIA 2XRSD 2AUJD 4WFN3 4RKBA 3N6RA 4ID6A 2HCCA 2MGSA 1CA6A 3SXHA 4PMBA 4P2CB 1KLGD 3Q6SA 3K5LA 4X3TA 4V0BA 1JWSD 3M7NA 1Q8IA 2CHBD 4ZUIA 5IOCA 5CV4A 3NTKA 4DXGA 1JOQA 4B08A 1M4VA 2JYOA 4K14A 2OXPA 3MXNA 1X3QA 2I07B 2FFKB 4RFBA 1EWCA 3ND9A 3SE0A 5CMDA 5JVH3 2R61A 1LABA 4A3BB 3D4WA 3NBHA 3J7AV 2YU9B 1EQVA 1YNJC 2NVYB 1WTPA 4XDXA 4K6LA 1HHVA 5CV5A 4KKUA 3SHLA 2K7VA 5HURA 4K5XA 2PZTA 4I65A 3SR1A 5D3DA 1WD0A 2WKDA 1D5ZC 1C4QA 1ONLA 1TWAB 2AWOA 1PRTB 2EZVA 1MD2D 2KVMA 2FHTA 3H91A 3K7AB 3CHBD 1ZYRC 3HOXB 2JA7B 4A93B 2LS01 1TS5A 1JORA 1WTOA 2H1EA 1A15A 4A3KB 5F2DA 1X3PA 4BWGB 2XIWA 2PYKA 4A3IB 1PFBA 2F0WA 1ENFA 4IFDJ 2JSOA 4DK0A 3SDZA 4OO1G 2NWGA 3SK6A 4KD3A 2M2LA 2SEBD 1SJED 3GTPB 2B39A 3MXUA 3H09A 5G3LD 2WACA 4DNRB 2AWNA 2ZXRA 3MEHA 1SNCA 4FP5D 1CQVA 5EKLA 2EY5A 3E0JA 2QEJC 1RODA 5ISRA 3I8ZA 2J4XA 2BDNA 2F3WA 2L4NA 2A69C 4HEDA 1PRTF 4I7ZC 2B2UA 5LHY1 1C48A 1CZGA 1E2ZA 4ZK9B 2YYZA 2DNEA 3J7AF 3A56A 3RMHA 2SNSA 2NVXB 3S14B 5C3XA 2JP1A 5J22A 4R9WA 1WTVA 3P75A 3I70A 5I2YA 1A6XA 4IUNA 2EY2A 2Z1CA 1PYWD 2WB1B 3JAML 4WRDA 5FO7B 5C44B 1U4PA 1LTID 1WTXA 5E3FA 1TS4A 3FVQA 5COYA 1SSOA 1B50A 2O2LD 4XYQA 2F0VA 3T56B 3S1QB 2K1BA 4FXDA 3DUZA 5I9PA 1LTSD 1OXTA 2XRQD 3KUPA 2C9OA 1PDQA 5IGCA 1Y1VB 2MUYA 2D9UA 4QUCA 1DCZA 5ELDA 1IYVA 5KYLA 2A68D 2ENBA 4X3UA 5IGBA 3W2DA 1JE4A 1K8MA 3VYRA 4ABNA 4IUQA 1HA6A 1OO9B 4FF1A 5ELFA 2Y0SB 3A7LA 3K0YA 1EEID 4QB4A 3I90A 1DYQA 2GA4B 1BNZA 2A6HC 3MTSA 4G57A 5C0XG 2KCNA 1I4GA 2KUMA 1UEAB 1GUOA 2X6GA 1B53A 2PMZB 1I4PA 4FXGC 2CW0C 3I91A 2H4OA 2WAQB 1DOLA 2EYPA 4NKLA 2R3ZA 3M7GA 5J39A 5KNBA 4IUVA 4DF7A 5T1GA 4FYDA 1EZ6A 2FINB 3BYTB 5NUCA 4CJ2C 4M1UB 4ZLTF 4IFDI 1L0YB 3D8GA 3A54A 5JEAG 2L1BA 4DAPA 4PNYA 4DAYA 1WTQA 4B9WA 4J8QA 2EOTA 1TY2A 3IAYA 1PLFA 1TWCB 4ZYSA 1EY4A 3A55A 1DJRD 1LTAD 3NHHA 4A3GB 1TU2B 2AQ2B 2PZUA 1EY9A 4KI0A 5IODA 1E0BA 1CHPD 3URYA 5KEEA 5EGTA 2B63B 1MSGA 1LACA 2F0FA 1UUPA 1V1PA 4NMZA 4J1MA 3C3LA 4IALA 3H0GB 5I2XA 1HA5A 3PMFA 1SMYC 5IT9E 1FNWA 1FNVA 1GUSA 3EJIA 4PMWA 5K36G 3PIP3 1EY5A 5C6AA 1D2BA 1HCZA 1RJTA 3S1RB 1BCPD 5M9OA 2F0UA 1CQFA 4ULLA 2A73B 2B2YC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NAP A;  5T1G A;  3R93 A;  3TN2 A;  1G2S A;  2JP1 A;  1BO0 A;  4R9W A;  5E4W C;  1CA5 A;  5EPK A;  1PFM A;  1AZP A;  2HUG A;  1WTV A;  1HUM A;  4ZKB B;  2FJ2 A;  1HRJ A;  2FIN B;  1DOK A;  2DY7 A;  3DM1 A;  4U68 A;  2X69 A;  4IUP A;  1WVL A;  1ILP A;  1J9O A;  1ICW A;  4CJ2 C;  1SDF A;  1LV9 A;  4CJ0 B;  1DOM A;  4ZLT F;  1WD0 A;  3KBX A;  1B3A A;  2B2V C;  5AFW A;  4OIK A;  3P7J A;  2N88 A;  1ESR A;  1XX8 A;  2RVL A;  1O80 A;  2X6L A;  4IUR A;  4UAI A;  5EKI A;  2L1B A;  2HDM A;  1B2T A;  3F2U A;  1U4P A;  4DN4 M;  2N55 A;  5COR A;  1WTQ A;  1WTX A;  2K03 A;  1CM9 A;  1G91 A;  1F2L A;  2KVM A;  2FHT A;  1J8I A;  2KEE A;  1U4M A;  3H91 A;  5COY A;  2L9H A;  2EOT A;  4IUT A;  1WTR A;  1MSH A;  1SSO A;  1PFN A;  4X3S A;  5EPL A;  1B50 A;  1JIC A;  1WD1 A;  1EQT A;  3MWY W;  1ILQ A;  1EL0 A;  1X32 A;  3D6W A;  1PLF A;  2K01 A;  2MJ8 A;  2HCI A;  3I3C A;  1QG7 A;  2NZ1 D;  2FMM A;  2KED A;  2B2T A;  3FPU B;  2RSO A;  5CBE E;  1MGS A;  3HP3 A;  1WTO A;  2B2T C;  1AP0 A;  4HAE A;  2K1B A;  1DON A;  3IFD A;  2H1E A;  2VXW A;  3GV3 A;  2RSN A;  1KNE A;  2K04 A;  1NCV A;  3IL8 A;  1A15 A;  5EPJ A;  5T1I A;  1X3P A;  3KUP A;  4HSV A;  4QUF A;  2Q8R E;  1PDQ A;  2XIW A;  1IKM A;  1U4R A;  2HCC A;  2L12 A;  5E4X A;  2MGS A;  2D9U A;  5D14 A;  5DNF A;  4CJ1 B;  4QUC A;  1BBX C;  1AZQ A;  3N52 A;  1G6Z A;  3DEO A;  1GUW A;  1CA6 A;  1EOT A;  2CVR A;  1E0B A;  2EE1 A;  1PFB A;  2HDL A;  3Q6S A;  5EJW A;  1DZ1 A;  2B2W A;  1KNA A;  4X3U A;  4X3T A;  2B2W C;  2KEC A;  2Q8T A;  3TZD A;  3SVM A;  1QNK A;  1MSG A;  2SDF A;  3ONA B;  1QE6 A;  1JE4 A;  5CBA E;  2EPB A;  4RA8 A;  5JJZ A;  3G7L A;  2NWG A;  4OIJ A;  4IUQ A;  4HCS A;  1HA6 A;  4LMQ D;  1EIG A;  4X3K A;  1C8C A;  2M2L A;  4XT1 B;  1O7Y A;  1SAP A;  2JYO A;  2K05 A;  4RAU C;  4MN3 A;  1X3Q A;  4O42 A;  1F9R A;  1Q3L A;  2FFK B;  1BF4 A;  3QO2 A;  3UI2 A;  1RTN A;  2MP1 A;  1ZXT A;  3I90 A;  3LWE A;  1XYI A;  4R8I A;  1G2T A;  1VMP A;  2MPM A;  1BNZ A;  2IL8 A;  4XT3 B;  1RTO A;  3GV6 A;  4RWS C;  5D65 A;  3MTS A;  3FDT A;  1MI2 A;  1ROD A;  4MHE A;  1U4L A;  1NR2 A;  3I8Z A;  2BDN A;  5CMD A;  1F9Q A;  1M8A A;  1ML0 D;  1NR4 A;  2KUM A;  2L4N A;  4HED A;  2B2V A;  2DY8 A;  2J7Z A;  1RHP A;  1B53 A;  1RJT A;  1F9S A;  1IKL A;  2X6G A;  3DEP A;  5EQ0 A;  2B2U A;  1IL8 A;  1S4Z A;  1B4O A;  2B2U C;  3I91 A;  4NW2 A;  1HFG A;  1O7Z A;  1VMC A;  2RA4 A;  4XDX A;  1WTP A;  1EIH A;  1HUN A;  4ZK9 B;  1DOL A;  4IUU A;  2L11 A;  4ZKC B;  1HFN A;  1WTW A;  2K28 A;  2KOL A;  1F9P A;  1TVX A;  2R3Z A;  2B2Y A;  1HHV A;  2NYZ D;  4IUV A;  4ZAI A;  2B2Y C; 
#chains in the Genus database with same CATH topology
 1STE A;  2UUC Q;  1LTT D;  1X54 A;  1KRT A;  3DWA A;  1N32 Q;  3H94 A;  1BO0 A;  1SN8 A;  4IOC A;  4QMG A;  1PFM A;  1SLJ A;  2WFW A;  4DAY B;  1GXD C;  1JB7 A;  2AQ3 B;  3S9W A;  1LM0 A;  1ICW A;  1HR0 W;  1VF7 A;  4A3M G;  2F0P A;  2R7Z G;  1XX8 A;  1U5K A;  2X6L A;  5EKI A;  2HD3 A;  2XVS A;  2JJQ A;  2K33 A;  4A4I A;  3I4M H;  3D4D A;  5C4X H;  2ES2 A;  2VUM G;  1G6P A;  4FF3 A;  3A8J E;  2L9H A;  3OMG A;  3ERO A;  4OGQ C;  1I4R A;  1YBY A;  3U9O A;  3V05 A;  1V43 A;  3OSO A;  3ITP A;  3HP3 A;  3GQB A;  5M5W H;  2RBM A;  1PFS A;  4GNX C;  2K5D A;  4KTA A;  3SK5 A;  4HSV A;  4A3J H;  5JJL A;  1IBL Q;  4A3M B;  1GUW A;  3N52 A;  1VQ6 A;  2R7Z B;  4G7H C;  3ERS X;  4L6T B;  4YIJ A;  2VUM B;  2Z6K A;  5ELE A;  2B2W C;  4NXN Q;  4RKL A;  3SVM A;  5IT9 c;  1H9S A;  1JWM D;  1YJN A;  4OIJ A;  2K5Q A;  3CD6 A;  3HOY G;  1SAP A;  4BY1 H;  1DGS A;  2BA0 A;  1U9R A;  3A7A B;  1WTH A;  1SYF A;  3CCJ A;  2E2H B;  2OWO A;  3R3O A;  3KJP A;  2MP1 A;  4OWW B;  2F4I A;  4NDX A;  5JPM C;  2BH8 A;  2YV5 A;  3RN5 A;  4IPC A;  3X3M A;  2R92 G;  3D4R A;  2Q2T A;  2JA6 G;  2BA1 A;  2EYM A;  1LTG D;  1MI2 A;  1HZC A;  4C2M H;  4DR2 Q;  1NR4 A;  4LFB Q;  1FVI A;  1RHP A;  2EJF C;  4X62 L;  3CAM A;  3VA7 A;  4N9T A;  1YI2 A;  3TZU A;  1JJG A;  4IUU A;  4A3F H;  1HFN A;  5BN3 A;  1CT1 D;  2K28 A;  1F9P A;  1S5E D;  3I72 A;  3Q24 A;  3HKZ G;  1EYD A;  4OX9 L;  4R4I A;  2JA8 G;  3DEO A;  3S16 H;  2A5H A;  3CPF A;  3R93 A;  3A0J A;  1G2S A;  4CDE C;  3HOY B;  1RD9 D;  4JI4 L;  4KJO A;  2KCT A;  3WOF A;  2B29 A;  3I4N H;  2FJ2 A;  3CW2 C;  1V9P A;  1VQA A;  1ILP A;  1EWH A;  2R92 B;  1W2B A;  5AFW A;  3J81 i;  2F03 A;  1WJJ A;  1XXG A;  2JA6 B;  4HR7 B;  1ESR A;  1W6J A;  4IOA A;  3GD7 A;  2NUC A;  1D8L A;  2CWA A;  1SR3 A;  4DN4 M;  3L2P A;  1F2L A;  4AYB G;  1RL2 A;  4UDU C;  3IRB A;  4M8A A;  4TSS A;  4DAV A;  1WTR A;  3CC7 A;  1WD1 A;  3MWY W;  1N33 L;  2F1M A;  3HKZ B;  5IYD H;  2JA8 B;  5CYU A;  5CBE E;  4B3T Q;  2RDG A;  4P71 A;  4JV5 L;  2PW7 A;  3RLF A;  3IL8 A;  4A3E H;  3MXP A;  1H9S B;  4DKA C;  1QZG A;  2PQA B;  1XMO L;  3FEW X;  4LFA L;  3M3Y H;  3NSW A;  3OIP A;  1HTP A;  1KDA A;  1K0R A;  5D14 A;  1WFQ A;  1DXM A;  5FK9 C;  2LKV A;  3BYY B;  3S24 A;  4DU9 A;  3RZD H;  4AYB B;  4IPD A;  4V19 0;  2HIV A;  3E3X A;  3R2I A;  3MFY A;  1A2U A;  2PNR C;  5EAY A;  5C5M A;  1Z7T A;  3A8K E;  2P5Z X;  1K9M C;  4RCO A;  4RGN A;  1O7Y A;  1S5D D;  1TS3 A;  5FLX L;  4UP7 A;  3WDN A;  3C46 A;  3VR5 A;  5AJ3 L;  2EY6 A;  3P20 A;  1KTK A;  3U9S A;  4BA2 I;  2VQF Q;  2E2J B;  2F0Q A;  3NUC A;  2E5L L;  4DV3 L;  3Q23 A;  2A8V A;  2YTV A;  3I4O A;  4DK1 A;  1BBU A;  2ID0 A;  3TS2 A;  3V2T A;  1KAW A;  3GTO H;  1K3R A;  5BN5 A;  2KJX A;  2F0T A;  3CCQ A;  1HR0 L;  5EQ0 A;  3QJY A;  1IL8 A;  2NBF A;  4YHH L;  1PH7 A;  4EQP A;  3Q0A A;  2RA4 A;  3HKZ E;  3H15 A;  4ZKC B;  2LMC B;  5IGG A;  3MHB A;  1N36 L;  1IW7 D;  1T5E A;  4R1J A;  5C3W A;  2HHH Q;  3STB C;  2NVY H;  5CR3 A;  4A3D H;  4KK7 A;  2PI2 A;  4IUP A;  4DR5 Q;  4GNX A;  2NVQ B;  1I4Q A;  1B9N A;  4JI3 L;  3D6C A;  1PZI D;  4KN4 C;  5BN4 A;  2B2V C;  4DV5 L;  3F8T A;  5IYB H;  4IUR A;  2HDM A;  2D2C C;  4AYB E;  2O5J C;  1X3G A;  2K6A A;  4J15 A;  4UP8 A;  1XTC D;  3NTH A;  2KEE A;  4KY5 A;  1H9M A;  1KC8 C;  4JI0 Q;  1EQT A;  1Q12 A;  2K32 A;  2GN5 A;  2K50 A;  1JQY D;  1EYG A;  4LUO A;  5GAD C;  1SYD A;  4N9P A;  1EZ8 A;  4QCL A;  1MGS A;  4PZ8 A;  2B2T C;  1GUG A;  2EYL A;  2Z4H A;  2KCC A;  1HNZ Q;  1G29 1;  2VXW A;  1HNX Q;  1T9H A;  1E1T A;  3GV3 A;  2F0M A;  1GJX A;  4IFD H;  2EJM A;  4RHS A;  3HOX H;  4AQY L;  2JA7 H;  4A93 H;  3NPP A;  1J6Q A;  2Q8R E;  3DXJ C;  2Q8I B;  2KBN A;  4JI1 L;  4CDC C;  4CGY B;  4MTK A;  1B9M A;  3J80 L;  3DWP A;  3CQZ H;  1YJ9 A;  5KYI A;  4LF4 L;  1X56 A;  1FJG Q;  1EWI A;  3FPP A;  1AE2 A;  1I6H B;  2BE5 D;  1Q90 A;  3MVV A;  4A3K H;  3S1M B;  4DGZ A;  3D31 A;  3L9A X;  1SRU A;  2ZM6 L;  3M4O B;  2R93 G;  3BZD B;  3G7L A;  4JBJ A;  1J5E L;  2ATW A;  4GN5 A;  1C9O A;  2JEB I;  3HOU G;  2K05 A;  1BKB A;  4MN3 A;  4JYA L;  1IBM L;  1F2Z A;  3S15 B;  1F9R A;  1KDC A;  2UUB Q;  3GTJ B;  1V1Q A;  1DD2 A;  2IW3 A;  4KY6 A;  4BY7 H;  1EY0 A;  1OXV A;  4R4Q A;  3HOZ G;  4H02 A;  4CKE A;  4R4T A;  1NTG A;  3AU7 A;  2WIN B;  2RF4 A;  4JW0 A;  1ML0 D;  3T1Y L;  3GTP H;  4JI8 Q;  4IPG A;  3DEP A;  1HNW Q;  3T1H Q;  1S4Z A;  2NN6 G;  2VS1 A;  4GKJ L;  4DR4 L;  1HUN A;  4GNX B;  1SRO A;  4QIW B;  2R93 B;  5LL6 X;  2E2I B;  1NAP A;  2OTJ A;  2F0S A;  3MZ5 A;  1F2Y A;  3HOU B;  2XNA C;  4OEM B;  3NK9 A;  4NB3 A;  2L5T A;  2K5V A;  5J1Z A;  4OXP A;  4F8M A;  4K0K L;  1I50 B;  2LXK A;  3GTL B;  4KN7 C;  3PIO 3;  1HTL D;  2I0Q A;  3HOZ B;  2R7F A;  3J81 j;  2FMC A;  4OO1 H;  3PUY A;  3BDC A;  1VQB A;  2NVX H;  1PMR A;  4AIM A;  3NEN A;  3GDE A;  1CK1 A;  3NTI A;  5COR A;  3VYU A;  1J8I A;  3Q8D A;  1VQ9 A;  4KY7 A;  1MSH A;  2MNA A;  3ER0 A;  1FNU A;  4HSP A;  1DM0 B;  2K01 A;  1KHI A;  1ENA A;  1W6K A;  1K8A C;  5C44 H;  4H7B A;  3HG9 A;  5IGE A;  4Y52 H;  3K7U C;  2G9H D;  1QNU A;  4YCU A;  2L0C A;  3AMU A;  1SE3 A;  3E6Z X;  3HOV G;  4KHV A;  1U4R A;  2JQO A;  5E4X A;  1UEB A;  5GAH C;  3CPW A;  4DK3 C;  4CJ1 B;  3S1Q H;  3HS0 C;  1I4H A;  2PI2 E;  1FGB D;  4QIW E;  2PZW A;  3FMC A;  2Q8T A;  5CV9 A;  1L0X B;  2VL6 A;  5FJ8 H;  4DV0 L;  1G51 A;  5I6Y A;  2A6E C;  1VQE A;  1QZH A;  3D0F A;  1Y1V H;  2N49 A;  3S2H B;  3QIA A;  3ND8 A;  3GTK B;  1JT8 A;  2KEN A;  1CFM A;  1SXT A;  1FR3 A;  5IP9 G;  4PZ7 A;  3UI2 A;  3PUV A;  3KF6 A;  3U4Z A;  4ZQ3 A;  4MIU A;  1YNJ D;  4JG2 A;  1UE7 A;  4EQN A;  4Y7N B;  4XT3 B;  3PSI A;  3HOV B;  4X65 L;  5IGD A;  4K2L A;  1ENC A;  3TRZ A;  2MHV A;  1EIH A;  2I5H A;  2B2V A;  3WWV A;  4JI6 L;  1JC7 A;  1XPU A;  1F9S A;  2NVT B;  1A0I A;  3G4S A;  1ICF B;  2KCM A;  1H9R A;  3TP5 A;  1Z47 A;  3TRE A;  1E22 A;  4L5Q A;  3L7Z C;  3E9I A;  1K28 A;  2DJF C;  1IBK L;  5EBC A;  1TQO A;  1YNX A;  1PXU A;  3LWU A;  3IFT A;  4CKC A;  5HY6 A;  5C4J B;  1AZP A;  4XQN A;  1CHQ D;  4GOP C;  4LF7 Q;  3TBI B;  1WVL A;  2E76 C;  3CRK C;  4H13 C;  5H1S E;  1JJC B;  1ZYR D;  2JE6 I;  2F4V L;  1SMX A;  4HID A;  1VQL A;  1STG A;  4K2K A;  4DV4 Q;  1LO5 D;  4JI7 Q;  1BDO A;  1ASY A;  4HN7 A;  4X3S A;  3KDF A;  2QKI C;  1SYC A;  4JCV E;  1RCV D;  1H9J A;  5C0X H;  1Y8P B;  4HIO A;  1P16 A;  1PTO D;  5M5Y B;  3G71 A;  2AMC B;  3NQI A;  3HZX A;  1N9W A;  3OHX C;  2RSN A;  1LLR D;  5EPJ A;  5CV7 A;  2ZTD A;  5T1I A;  5C3E H;  3TP7 A;  1QUQ B;  4LF6 L;  1X3E A;  1TWC H;  2SOB A;  3RLN A;  5DNF A;  1AZQ A;  4YWL A;  4ME3 A;  5A2Q L;  2CVR A;  1Z6H A;  5KNC A;  1KLU D;  3PUW A;  2V4D A;  5BR8 Q;  3HOW G;  1KNA A;  1EIY B;  1RKN A;  2Y0S E;  1JB3 A;  4K5V A;  4TVA B;  5CV8 A;  1QNK A;  1Q86 C;  3M4Y A;  1VQG A;  2EYJ A;  2PO4 A;  5FLM G;  2M00 A;  1D5X C;  4XT1 B;  1LUZ A;  5LMN Q;  4LF5 L;  5JEA H;  1D1I A;  1Q3L A;  2WP8 J;  1XTD A;  4UY8 C;  4F88 A;  1EEF D;  5C0X J;  1C0A A;  4X66 L;  1EYC A;  5G3L F;  2UXC L;  1BXT A;  4A3L G;  3C2P A;  1U4L A;  5LMU Q;  1Y8O B;  1F9Q A;  4A3C H;  3U50 C;  2DNC A;  4JI5 Q;  1A3U A;  5HGT A;  1OXS C;  1YNN D;  1B7Y B;  3HOW B;  2UXD Q;  4J6H A;  1B4O A;  1BOS A;  3OWE B;  2D0P A;  4A75 A;  3NE5 B;  4GS3 A;  4KMU C;  4EGV A;  3KF8 A;  3TEH B;  3F2B A;  1R9T B;  1VQ4 A;  1TVX A;  1AW7 A;  4KLK A;  2VY3 A;  4ZAI A;  3FKI G;  1K8G A;  3CCU A;  2JA5 G;  5IWA L;  3CMA A;  1V8Q A;  1CA5 A;  1SYG A;  3S1R H;  3K0X A;  2MFI A;  1HRJ A;  4PQX A;  2XN9 C;  5KGU A;  3F2D A;  5M5X B;  4LFC L;  1SFO B;  3KDF B;  4OO1 I;  2NZH A;  3I4L A;  1I4X A;  5JEA J;  1GD7 A;  5L37 A;  4XQJ A;  2EXD A;  1QWY A;  3EFX D;  2IX3 A;  1PTO H;  4QGU A;  2A74 C;  2IX1 A;  3TP8 A;  4RCN A;  4GLX A;  5M3F H;  4DV1 L;  1TY0 A;  3FKI B;  5K36 H;  3ZJY C;  2PW5 A;  3O13 A;  4IJH A;  4LWC A;  2JA5 B;  1I94 Q;  5IIF A;  3I4M G;  1NCV A;  3KLR A;  4DV7 Q;  1CUK A;  1BQQ T;  4B3R L;  1I3Q H;  3NQT A;  1GUT A;  3ICE A;  1KAB A;  5ELO A;  4DAM A;  5LL6 S;  1CSP A;  2DN8 A;  2E75 C;  1JOK A;  3TS0 A;  2HDL A;  3JAM E;  2EDG A;  3J81 E;  5JVG 3;  4JI2 L;  4B3M L;  2F0L A;  4LMQ D;  4F87 A;  4B3S L;  1VQN A;  3PO2 G;  3JC6 6;  2MO0 A;  2R7Z H;  4YY3 Q;  1SE4 A;  4YCV A;  3I56 A;  1BF4 A;  2VUM H;  1NJI C;  1ZXT A;  3I4M B;  3LWE A;  4XTC S;  2I5L X;  2F0H A;  2CW0 D;  1XMQ Q;  1TT2 A;  2JK8 A;  3KF8 B;  3FRP B;  2IL8 A;  2JXM B;  4RWS C;  3RLO A;  1I6V C;  4LF9 Q;  2ZTC A;  4JK1 C;  2DY8 A;  2PQA A;  2ZXO A;  4CDF C;  2E2H H;  1IW7 C;  1HFG A;  1VMC A;  3BVG A;  5JPN C;  5M5W B;  3V96 A;  4BBS G;  3S1N B;  1WTW A;  2KOL A;  3DHQ A;  2OTL A;  2WII B;  1C7Y A;  4L63 B;  2UUA L;  1SJH D;  2C35 B;  1HZB A;  1GHK A;  4DUZ L;  1XNQ Q;  2NB0 A;  3PO2 B;  4PMC A;  4OHJ A;  4BA1 I;  4P75 A;  1Y1W G;  3H3V I;  2HUG A;  1SE2 A;  1VQF A;  3ERQ A;  2R6G A;  4DV6 L;  4S3S A;  1DOM A;  1VF5 C;  3QOJ A;  4H0L C;  5M3M G;  3PO3 G;  4G7O C;  3U4V A;  2RCN A;  4HIM A;  4OEL B;  3BDL A;  3F2U A;  3HOY H;  3HKS A;  3K57 A;  1G91 A;  3R8B A;  4I7A A;  3D3R A;  4IUT A;  3CC2 A;  3BJU A;  2ZXP A;  4CKB A;  2Q2U A;  4BBS B;  4K6D A;  1EL0 A;  5GQO A;  3KJO A;  3E9H A;  2UUC L;  5C0X I;  2HQE A;  3UE1 A;  3CCM A;  3ULP A;  4DUY Q;  2JA6 H;  1N32 L;  4R4C A;  3PIP A;  2RSO A;  1ESF A;  1TKW B;  4HAE A;  4K5W A;  3JAM i;  1Y1W B;  2E2D C;  4DFA A;  5CGK A;  3JAM c;  4DR1 Q;  4C3H H;  3OIQ A;  2YTY A;  4K8I A;  1PH1 A;  3G48 A;  3J81 c;  2F0J A;  2CFM A;  5ELC A;  3C1E A;  1RF2 D;  2L12 A;  5M3M B;  1JE5 A;  3PO3 B;  2JA8 H;  5IY0 A;  2DUD A;  4UHV A;  2J0T D;  1AFP A;  2HT1 A;  1PYS B;  1PH6 A;  3S2D B;  4H44 C;  3S17 H;  3RD4 A;  1VQJ A;  4EX5 A;  3I4N B;  4JC0 A;  4GOP B;  4A3E G;  1LT5 D;  4HCS A;  4X3K A;  1GOZ A;  1KXL A;  2PCF B;  2KQ3 A;  1VQP A;  3SK8 A;  2VQE Q;  4RMF A;  1TWH H;  4KJN A;  2K5N A;  4EVO A;  1BBW A;  1PRT D;  4G4K A;  3GV6 A;  1IBL L;  1STA A;  1B3Q A;  3PV0 A;  2CH4 A;  4MHE A;  1A2T A;  1F77 A;  3I7F A;  3AFP A;  1IKL A;  3E5S A;  3LX0 A;  4NXN L;  2QIL A;  1E7Z A;  1STH A;  1UAP A;  2B2U C;  2E2J H;  5JJK A;  1VQ7 A;  3OW7 A;  1F2M A;  4FNF A;  3VR6 A;  2B2Y A;  2NYZ D;  2AQ1 B;  4RHR A;  1BCP F;  4A3E B;  3NXW A;  1ASZ A;  3M3Y B;  4JPB W;  1EU4 A;  4CBV A;  3SK4 A;  3MFG A;  3I73 A;  4KKS A;  4U68 A;  2DY7 A;  3EA6 A;  3KK7 A;  1JR0 D;  3K5N A;  2AUK A;  4WJ3 M;  1LV9 A;  2BOS A;  3RZD B;  1S40 A;  4DR2 L;  2RHS B;  2QF7 A;  4LFB L;  4FXK C;  1R4Q B;  4PG3 A;  1EFW A;  1VCI A;  3AYH B;  4DR3 Q;  3M9B A;  1IHZ A;  2IHE A;  3UE0 A;  2QGQ A;  3UDF A;  1JIC A;  2RHQ B;  4A3B H;  1YEZ A;  1D7Q A;  4A3D G;  2YU9 H;  1V1O A;  1EQQ A;  3EIV A;  3FPU B;  1B70 B;  2ICE C;  2ZJR A;  1YHA A;  3RUZ A;  1DON A;  1B44 D;  2LSS A;  3GTO B;  2K04 A;  1VS0 A;  3MAQ A;  3KFU A;  3RZO B;  3IKJ A;  5A35 A;  1WI5 A;  3TSS A;  1K8O A;  5D3I B;  1CI3 M;  1GUN A;  1WYD A;  2A1A A;  2A19 A;  1PHJ A;  5ELN A;  2KHI A;  3CME A;  2WKC A;  3BZC A;  1NBW A;  4TKO B;  3GP7 A;  5IP7 G;  4DA2 A;  4IPH A;  4UP9 A;  2B2W A;  4DR7 Q;  2KEC A;  2EXZ A;  1YHQ A;  1WCM G;  2SDF A;  1CTM A;  4MNO A;  3A5Z B;  3EN2 A;  3HEJ A;  4IFD G;  1TWA H;  4A3D B;  3EQL C;  1SYB A;  4B3T L;  2LXJ A;  2A68 C;  3K7A H;  2F0I A;  4C1N K;  4FVM A;  1LTR D;  3QO2 A;  2B8F A;  3T51 B;  3RNU A;  1I6H H;  1NNX A;  3S1M H;  4RGO S;  1VMP A;  2Z4I A;  3GTQ B;  4RH6 A;  3I55 A;  3TZD A;  3W3A A;  3CCV A;  4TQU S;  1ET6 A;  3PUX A;  3S15 H;  2Z6B A;  2PQE A;  3RR5 A;  1O7Z A;  3GTJ H;  1WCM B;  1JCK B;  2L11 A;  5EKK A;  4A3I H;  1PH8 A;  1HXY D;  2FXQ A;  1VQD A;  5FO8 B;  2DGY A;  1LT3 D;  4BY7 G;  2LY7 A;  4HJ7 A;  1SNP A;  3L3O C;  1JWU D;  1K83 B;  2NTS A;  2XWB B;  3OTO Q;  2VQF L;  4HMI A;  3X3N A;  1J9O A;  5IYC G;  4JBW A;  3CQZ B;  4CJ0 B;  5KND A;  2ZJQ A;  2UU9 Q;  4BXX G;  4LF8 Q;  1PH2 A;  1T5X D;  2E2I H;  3GTG B;  3J7Z C;  4DV2 Q;  2F0N A;  2I46 A;  1PTO C;  3K5M A;  2VNU D;  1U4M A;  5FOB B;  3GTL H;  1GKH A;  3CF5 A;  1QOH A;  4G7Z C;  1K73 C;  4QL5 A;  1EFI D;  3HOZ H;  2BCO A;  2EYF A;  1MIU A;  3NWS A;  2HCI A;  1PH4 A;  2H5X A;  5KRU A;  1XPR A;  4BY7 B;  5IT9 L;  1MJE A;  2HHH L;  4KHP Q;  1PV4 A;  2KHJ A;  3IFD A;  2F0D A;  2PNH A;  1M90 C;  5KIX A;  4ZCK A;  4DR5 L;  2NN6 H;  3UDG A;  1S5B D;  1HZA A;  2TMP A;  3NBH B;  3S14 H;  1PZJ D;  3CCL A;  1AEX A;  1IKM A;  2UXB Q;  3NWT A;  5C4Z A;  2OF1 A;  5EBD A;  3QWN A;  1DZ1 A;  5I4D A;  4GN4 B;  2HQL A;  2F0E A;  2TSS A;  3K80 C;  3CU7 A;  4JI0 L;  2JEA I;  1TXY A;  4NP5 A;  1IZ6 A;  2D0O A;  4DR6 Q;  3AB9 A;  2RDH A;  4C56 C;  2XWJ B;  1C8C A;  1HNZ L;  4RAU C;  1NUC A;  4X64 Q;  4GZY C;  2VB2 X;  1TR5 A;  4DNI A;  1YNN C;  4LK1 C;  2Z0S A;  3QR8 A;  1KIX A;  2MPM A;  4Q5V A;  5FO9 B;  4OL7 A;  1LT6 D;  4MZ9 A;  3F2C A;  3FDT A;  4F7X A;  2JN4 A;  5FJ8 G;  3AEV A;  3J7A 5;  3S2H H;  2ALY B;  1M8A A;  3KOJ A;  3GTK H;  5ELB A;  4P74 A;  1QUQ A;  2F0G A;  2RKS A;  4C3I G;  1H95 A;  5JAV A;  4NW2 A;  3J81 L;  2RCF A;  5DM6 3;  4Y7N H;  1PA6 A;  1Q8K A;  3CP0 A;  1OXX K;  3OW2 A;  2UUB L;  2NVT H;  1BCP C;  4LAA A;  4JVZ A;  5FLX E;  5JJI A;  3KBX A;  1IXR A;  4OIK A;  3VR3 A;  2N88 A;  5E7N A;  1D5M C;  3AQQ A;  1MHW C;  4JI8 L;  1HNW L;  3L0O A;  3T1H L;  1AN8 A;  1UE5 A;  1OTC A;  2N55 A;  1Q82 C;  4BBR G;  2K03 A;  5IP9 H;  3C1F A;  4C3I B;  4POG A;  1E3P A;  5LMN W;  1SEB D;  3QOL A;  1SND A;  4DK6 C;  2F0K A;  1X32 A;  3M4Q A;  3I2Z A;  4NXM Q;  1QG7 A;  2NZ1 D;  1TWG B;  2FMM A;  3H3V H;  2B2T A;  4GKK Q;  3PUZ A;  4L5R C;  3G6J B;  1L1O C;  2Q2I A;  1KNE A;  1P8L A;  1EY8 A;  4QUF A;  1XNR Q;  1SNM A;  3KLS A;  1G6Z A;  4EQO A;  4Z9C B;  5EJW A;  4C1N I;  5M5Y H;  1IYU A;  1HPC A;  2L55 A;  3MXG A;  4BBR B;  2Z6K C;  1D6E C;  2F3V A;  3PIO A;  2PPB C;  3ONA B;  1N34 Q;  1PYB A;  1CZW A;  3LGJ A;  1U0L A;  4ME5 A;  3P1H A;  3B6Y A;  5C3E G;  1SNQ A;  3GTM B;  3BVM A;  4L8J A;  4BS9 A;  3VA5 A;  1QJO A;  3TDQ A;  3EVQ A;  5C5L A;  1G8Z D;  3CRL C;  2EVB A;  1UWV A;  1Y14 B;  2SNM A;  4R8N A;  3J7Y W;  5D65 A;  1RDP D;  2NTT A;  4A3G H;  2VZA A;  3DM3 A;  4IN3 A;  5E1F A;  3T13 A;  1KRS A;  5CV6 A;  2ZJP A;  3GO5 A;  1QIL A;  2IX0 A;  1STN A;  2F3I A;  3ZYY X;  4FO2 A;  1Q46 A;  1RIP A;  1W3S A;  2E74 C;  1Y8N B;  4GLA C;  5DM7 3;  1FYC A;  5FLX c;  1KL9 A;  3J80 E;  3VR2 A;  3T4A C;  2ZT9 C;  2A69 D;  3TP6 A;  5C4H A;  2IWH A;  3TN2 A;  4XIG S;  4AH6 A;  5C3E B;  2B63 H;  1SNO A;  4XYO A;  4HJ8 A;  3HOW H;  5TSS A;  4A3C G;  3R2T A;  1DOK A;  3MA2 B;  4HJA A;  2X69 A;  2YTX A;  1YVC A;  1MKH A;  1R9T H;  3DWQ A;  4RGT A;  4ZUJ A;  3H0G H;  2EQS A;  5FLM H;  2RVL A;  1O80 A;  2XSC A;  3UDX A;  3VDY A;  1Y69 U;  4QQB X;  4B9X A;  1YHB A;  3BS1 A;  1N8R C;  2MO1 A;  1PFN A;  2EIF A;  4C3J G;  1JOO A;  2M9V A;  1A3V A;  3U58 A;  2Z8L A;  1SFO H;  2MJ8 A;  3I3C A;  2KED A;  3CKI B;  3SEB A;  4A3L H;  4E6I A;  1E2V A;  2NN6 I;  5GAG C;  4LF7 L;  4KHZ A;  5JOB A;  1TWF B;  1WOC A;  1YIT A;  5K5P A;  3M4P A;  1KAA A;  1S5F D;  3WOE A;  3BG3 A;  2A6E D;  3FKI H;  1GO3 E;  5M3F G;  1EOT A;  2JA5 H;  2EE1 A;  3Q22 A;  4JI7 L;  4X62 Q;  1X55 A;  1KDB A;  3A8I E;  1EUJ A;  3OWF A;  4C3J B;  1QE6 A;  2EPB A;  4RA8 A;  1STB A;  4ILW A;  1SYE A;  4OX9 Q;  1EIG A;  1PRT C;  1SBB B;  5C4X G;  3FHW A;  2GVB A;  4O42 A;  3OMC A;  4ODG A;  4JI4 Q;  4R4O A;  4RGM A;  1EOV A;  3BDO A;  3MC0 B;  4ZRZ A;  3QB3 A;  4TRD A;  2RDF A;  3J80 i;  1H9K A;  1UE1 A;  1PTO B;  3J80 c;  1RTO A;  1S5C D;  1QB5 D;  2QDB A;  1HQM C;  4LJZ C;  5BR8 L;  5M3F B;  1E2W A;  2J7Z A;  1Q1B A;  4Q0F A;  1LT4 D;  3OPO A;  2A6H D;  4A3M H;  4A3J G;  3KLW A;  5CC4 A;  4O1N A;  4GLV B;  1NMF A;  3BVZ A;  4LUZ A;  1BUV T;  4U67 3;  4KV6 A;  2IHF A;  1SE8 A;  1N33 Q;  5LMN L;  3CCR A;  1I3Q B;  3NEM A;  4K8J A;  3VYS A;  5C4X B;  2RQX A;  5E4W C;  5I9O A;  5EPK A;  3K5O A;  4GOP A;  1HQR D;  1HUM A;  1L1O A;  4JV5 Q;  2O4X A;  3DM1 A;  3NP8 A;  1TII D;  1NSN S;  4JOI C;  3W5O A;  3DMU A;  4LFA Q;  1XMO Q;  3S1N H;  2MQH A;  1XPO A;  1B3A A;  2K75 A;  1HZ9 A;  5LMU L;  3P7J A;  1Q7Y C;  1B2T A;  4BY1 G;  1O78 A;  3VR4 A;  4DXF A;  4JI5 L;  2OEO A;  3PO2 H;  1B1Z A;  2UXD L;  1V1P B;  5IGF A;  2O5I C;  1NMG A;  1FD7 D;  4HCE A;  4A3J B;  1O7L A;  3HGB A;  5J3B A;  2L15 A;  2B8G A;  4HTH A;  4DPG A;  2BH2 A;  3OOC A;  1AP0 A;  2QCP X;  4PV1 C;  4N8F A;  2EJG C;  1S72 A;  1HH2 P;  1UNS A;  3PF5 A;  5AJ3 Q;  1PTO F;  4A3F G;  3K6O A;  2WV6 D;  2E5L Q;  4BBS H;  3T16 A;  2KHS A;  4DV3 Q;  2B3G A;  5HGQ A;  5I6W A;  4FF4 A;  1GHJ A;  1BBX C;  4HJ5 A;  1ZKO A;  4BY1 B;  1VQ8 A;  3CCE A;  4HMJ A;  2N78 A;  1EU3 A;  3I4N G;  4P72 A;  2CQA A;  1Y1W H;  4QF4 A;  1MBY A;  5DLQ E;  1HR0 Q;  2R92 H;  1R4P B;  2IJ0 A;  4YHH Q;  1BCP B;  3KBG A;  5CBA E;  2D5D A;  2LFN A;  4C3H G;  5JJZ A;  1B8A A;  4CHT B;  5M3M H;  3PO3 H;  4C2M B;  1I94 L;  4DNT B;  4KKT A;  1N36 Q;  2IPK D;  1Q1E A;  3KLS X;  2BE5 C;  2CKZ B;  4DV7 L;  1RTN A;  2F0O A;  2VW9 A;  1II3 A;  3S2D H;  2K5W A;  4A3F B;  4R8I A;  1XYI A;  1G2T A;  2QEX A;  1ET9 A;  5IYD G;  3LNN A;  4JI3 Q;  3S16 B;  3NBI A;  1LTB D;  1NR2 A;  3E0E A;  3K59 A;  4DV5 Q;  1SMY D;  2KA7 A;  2D62 A;  4N8X 1;  4OWT B;  1A63 A;  3VYT A;  1OXU A;  1EY7 A;  1L1O B;  2EY1 A;  1BR9 A;  2K52 A;  1JMC A;  4FF2 A;  5A2Q E;  1PH9 A;  2EYO A;  1STY A;  4C3H B;  1X9N A;  3QG1 A;  4WOR A;  2EYH A;  1XWE A;  4YY3 L;  2G9D A;  3HRZ C;  4FDB A;  4ZKB B;  1XMQ L;  1TS2 A;  5DAU A;  4UPA A;  1EQR A;  4XQQ A;  4HJ9 A;  1SDF A;  3M85 A;  4AQY Q;  4LF9 L;  1VQM A;  3S17 B;  4UAI A;  4XXE A;  4JI1 Q;  1A3T A;  1EY6 A;  2C5C A;  1Z9F A;  1VQC A;  5DEH A;  1CM9 A;  3K58 A;  1ZEQ X;  3F1Z A;  5FKA C;  1QCB D;  3H6M A;  4LF4 Q;  4PZ6 A;  1UE6 A;  2NZO A;  5EPL A;  1GM5 A;  1D1K A;  3T53 B;  1ILQ A;  4WJW A;  4IQZ A;  2VB3 X;  3D6W A;  2N3S A;  1FL0 A;  1TWH B;  1PZK D;  2ZM6 Q;  2IT1 A;  2OT2 A;  3EBE A;  1J5E Q;  1XNQ L;  4IZ8 A;  4KD4 A;  3TME A;  3H3V C;  1VDZ A;  1EYA A;  4YCW A;  1NY4 A;  2BDO A;  2ICI A;  4JYA Q;  1IBM Q;  4LNQ A;  1K3B C;  2XRS D;  2AUJ D;  4WFN 3;  4RKB A;  3N6R A;  4ID6 A;  2HCC A;  2MGS A;  1HJP A;  4A3B G;  1CA6 A;  3SXH A;  4PMB A;  1KQS A;  4P2C B;  1KLG D;  3Q6S A;  2AHO B;  3W1G A;  3T1Y Q;  2NVQ H;  3K5L A;  4X3T A;  4V0B A;  4GKJ Q;  1JWS D;  3M7N A;  3RZO H;  1Q8I A;  3A5U A;  2CHB D;  4ZUI A;  4DR4 Q;  5IOC A;  4DUY L;  2OQ0 A;  3AFQ A;  5CV4 A;  5IYB G;  3HFZ B;  3NTK A;  4DXG A;  1JOQ A;  4B08 A;  3TQY A;  1M4V A;  4X6A H;  2JYO A;  4K14 A;  3RN2 A;  1BVS A;  2OXP A;  3MXN A;  1X3Q A;  2XGT A;  4DR1 L;  2I07 B;  2FFK B;  4RG1 A;  4RFB A;  1EWC A;  4K0K Q;  3ND9 A;  1CKO A;  2F52 A;  3SE0 A;  4HIK A;  2OQK A;  4JOI A;  4L5T A;  5CMD A;  5JVH 3;  2R61 A;  1LTL A;  4O2D A;  4WJ4 A;  1LAB A;  4A3B B;  3D4W A;  3NBH A;  3J7A V;  2YU9 B;  5GAE C;  1EQV A;  1YNJ C;  2NVY B;  3HOX G;  4XDX A;  1WTP A;  2JA7 G;  4A93 G;  3MEF A;  4K6L A;  1HHV A;  5CV5 A;  3GTQ H;  2JA9 A;  4KKU A;  3SHL A;  2K7V A;  2VQE L;  5IP7 H;  1E24 A;  5HUR A;  3M4O H;  4K5X A;  4A3K G;  2PZT A;  4I65 A;  1WCM H;  3SR1 A;  5D3D A;  1WD0 A;  1E1O A;  2WKD A;  1D5Z C;  2Z9H A;  1VQO A;  4A3I G;  2QW7 A;  1C4Q A;  1ONL A;  1TWA B;  1PH5 A;  2AWO A;  1K83 H;  1PRT B;  4APV A;  3G6E A;  2EZV A;  1MD2 D;  2KVM A;  2FHT A;  3H91 A;  3K7A B;  1CKN A;  1GVP A;  1ZYR C;  3CHB D;  3HOX B;  2JA7 B;  4A93 B;  2LS0 1;  1AH9 A;  2G5D A;  4DV0 Q;  3GTG H;  4CDD C;  1TS5 A;  1JOR A;  1WTO A;  1CSQ A;  3PQI A;  2QA4 A;  1Q81 C;  2H1E A;  2R93 H;  1A15 A;  2OCE A;  4A3K B;  5F2D A;  1X3P A;  4NPS A;  4BWG B;  3HOU H;  2XIW A;  1A8V A;  2PYK A;  4X65 Q;  4A3I B;  1I50 H;  4DR3 L;  1PFB A;  3MXN B;  4JI6 Q;  2F0W A;  2K5H A;  1EIF A;  1VQ5 A;  4QJF A;  3K81 C;  3SGI A;  1PVO A;  1ENF A;  4GN3 B;  4YWM A;  1PH3 A;  4IFD J;  4POF A;  2JSO A;  4DK0 A;  2K4K A;  5IYC H;  3SDZ A;  4OO1 G;  2NWG A;  4BXX H;  3SK6 A;  4KD3 A;  2M2L A;  2SEB D;  1IBK Q;  1SJE D;  3GTP B;  2B39 A;  3MXU A;  3H09 A;  1QVF A;  3ULJ A;  5G3L D;  2R7D A;  2WAC A;  4DNR B;  2AWN A;  2ZXR A;  3MEH A;  1SNC A;  4FP5 D;  1CQV A;  2WB1 G;  5EKL A;  2EY5 A;  3E0J A;  2QEJ C;  1ROD A;  5ISR A;  2F4V Q;  3I8Z A;  2J4X A;  2BDN A;  4IJL A;  4LUV A;  5C44 G;  4JBK A;  2F3W A;  2L4N A;  2A69 C;  4HED A;  1PRT F;  4DR7 L;  4I7Z C;  2B2U A;  5LHY 1;  1C48 A;  1CZG A;  1E2Z A;  4ZK9 B;  2YYZ A;  2DNE A;  3J7A F;  3A56 A;  1HNX L;  3NEL A;  3RMH A;  2SNS A;  2NVX B;  3S14 B;  5C3X A;  2JP1 A;  1VQK A;  5J22 A;  4R9W A;  2K14 A;  5GRO A;  1WTV A;  1YZ6 A;  2N8N A;  1CKN B;  3BU2 A;  3P75 A;  3I70 A;  5I2Y A;  4EQ5 A;  1A6X A;  4IUN A;  3CC4 A;  2EY2 A;  1Y1V G;  2Z1C A;  1FJG L;  4LF6 Q;  3OYY A;  1PYW D;  2WB1 B;  3JAM L;  1JJ2 A;  4WRD A;  5FO7 B;  4QY7 A;  3STB D;  5C44 B;  1U4P A;  1VQI A;  1KD1 C;  1LTI D;  1WTX A;  5E3F A;  1TS4 A;  3HOV H;  3FVQ A;  3K8A A;  5COY A;  1SSO A;  1B50 A;  2O2L D;  2CCZ A;  4XYQ A;  2F0V A;  3PF4 A;  3T56 B;  2Y0S G;  3S1Q B;  3OTO L;  4LF5 Q;  2K1B A;  4FXD A;  3DUZ A;  5I9P A;  1LTS D;  1OXT A;  2XRQ D;  4C3I H;  3KUP A;  2C9O A;  2UU9 L;  1PDQ A;  4LF8 L;  4X66 Q;  1L2F A;  5IGC A;  1Y1V B;  2MUY A;  4DV2 L;  2D9U A;  2UXC Q;  5C4J H;  1TWG H;  4QUC A;  1DCZ A;  5ELD A;  1IYV A;  5KYL A;  2A68 D;  2ENB A;  4X3U A;  1S3O A;  5IGB A;  1YIJ A;  2WAQ G;  3W2D A;  4YWK A;  1JE4 A;  1K8M A;  3VYR A;  4ABN A;  4IUQ A;  4IO9 A;  1HA6 A;  1OO9 B;  1X6O A;  2I5M X;  3A74 A;  4FF1 A;  4KHP L;  5ELF A;  2Y0S B;  3A7L A;  5IWA Q;  3K0Y A;  1EEI D;  4P73 A;  4QB4 A;  4BBR H;  3I90 A;  4A76 A;  4JBM A;  2WB1 E;  1DYQ A;  2GA4 B;  1BNZ A;  4OWX B;  2UXB L;  2A6H C;  3MTS A;  4G57 A;  5C0X G;  4LFC Q;  2KCN A;  1I4G A;  3GTM H;  2KUM A;  1UEA B;  1GUO A;  1VQH A;  2X6G A;  1B53 A;  2PMZ B;  1K0S A;  1I4P A;  4FXG C;  3DLL A;  2CW0 C;  3I91 A;  4DR6 L;  2H4O A;  2Q2H A;  2WAQ B;  1DOL A;  2EYP A;  3FP9 A;  2E8G A;  4NKL A;  2ASB A;  2R3Z A;  3M7G A;  5J39 A;  5KNB A;  4IUV A;  4DF7 A;  4DV1 Q;  5T1G A;  1QVG A;  4OON A;  1X3F A;  4FYD A;  4LW1 A;  4A3G G;  1YJW A;  1EZ6 A;  4X64 L;  3CXC A;  2FIN B;  1IL2 A;  1M1K C;  3BYT B;  5NUC A;  4CJ2 C;  4M1U B;  2CH4 W;  4ZLT F;  4IFD I;  4B3R Q;  1L0Y B;  3D8G A;  3A54 A;  1AE3 A;  1XJV A;  5JEA G;  2L1B A;  3BZK A;  4DAP A;  4ALP A;  4PNY A;  4DAY A;  1WTQ A;  1MJC A;  4MTN A;  4B9W A;  2B63 G;  4J8Q A;  2EOT A;  1TY2 A;  2GVA A;  2CQO A;  3IAY A;  1PLF A;  1TWC B;  4ZYS A;  4JI2 Q;  3PCO B;  3KF6 B;  4B3M Q;  3CCS A;  1EY4 A;  3A55 A;  1DJR D;  1LTA D;  3NHH A;  4B3S Q;  3H0G G;  4A3G B;  1TU2 B;  2AQ2 B;  2PZU A;  1A62 A;  3ULL A;  1NE3 A;  2QDL A;  1EY9 A;  2PMZ E;  4KI0 A;  5IOD A;  1LYL A;  1E0B A;  2IY5 B;  2WAQ E;  1CHP D;  5M5X H;  3URY A;  5KEE A;  5EGT A;  2B63 B;  2CWP A;  1TWF H;  4L5S A;  2ZTE A;  4NXM L;  1MSG A;  1LAC A;  2F0F A;  1UUP A;  3KYH C;  2V1C C;  1V1P A;  4NMZ A;  4GKK L;  5IE8 A;  2UUA Q;  1I5F A;  1FGU A;  4J1M A;  2DJG C;  4DUZ Q;  3C3L A;  4IAL A;  3H0G B;  5I2X A;  1HA5 A;  2HIX A;  3PMF A;  1SMY C;  2AKW B;  5IT9 E;  3PGZ A;  1FNW A;  4DV4 L;  1CKM A;  1XNR L;  1FNV A;  1GUS A;  3EJI A;  4C3J H;  1X65 A;  4DV6 Q;  4PMW A;  5K36 G;  3PIP 3;  1EY5 A;  5C6A A;  4O0A A;  3UDI A;  1O7I A;  1D2B A;  1HCZ A;  1RJT A;  3S1R B;  3W1B A;  1BCP D;  5M9O A;  1L0W A;  2XTI A;  2F0U A;  1N34 L;  1CQF A;  4ULL A;  1IYJ B;  2A73 B;  1QVC A;  2B2Y C; 
#chains in the Genus database with same CATH homology
 1STE A;  1LTT D;  3DWA A;  3H94 A;  1BO0 A;  4QMG A;  1PFM A;  1GXD C;  2AQ3 B;  3S9W A;  1ICW A;  1VF7 A;  2F0P A;  1XX8 A;  2X6L A;  5EKI A;  2XVS A;  2K33 A;  3D4D A;  4FF3 A;  3A8J E;  2L9H A;  3OMG A;  3ERO A;  4OGQ C;  1I4R A;  3U9O A;  3V05 A;  1V43 A;  3OSO A;  3ITP A;  3HP3 A;  3GQB A;  2RBM A;  2K5D A;  4KTA A;  3SK5 A;  4HSV A;  4A3M B;  1GUW A;  3N52 A;  2R7Z B;  4G7H C;  4L6T B;  4YIJ A;  2VUM B;  5ELE A;  2B2W C;  4RKL A;  3SVM A;  1H9S A;  1JWM D;  4OIJ A;  2K5Q A;  1SAP A;  2BA0 A;  1U9R A;  3A7A B;  1SYF A;  2E2H B;  3R3O A;  2MP1 A;  2F4I A;  4NDX A;  5JPM C;  3X3M A;  3D4R A;  2BA1 A;  2EYM A;  1LTG D;  1MI2 A;  1NR4 A;  1RHP A;  2EJF C;  3VA7 A;  4N9T A;  3TZU A;  4IUU A;  1HFN A;  5BN3 A;  1CT1 D;  2K28 A;  1F9P A;  1S5E D;  3I72 A;  3Q24 A;  1EYD A;  3DEO A;  2A5H A;  3R93 A;  1G2S A;  3HOY B;  1RD9 D;  4KJO A;  3WOF A;  2FJ2 A;  1ILP A;  1EWH A;  2R92 B;  5AFW A;  2JA6 B;  2F03 A;  1XXG A;  4HR7 B;  1ESR A;  1W6J A;  3GD7 A;  2NUC A;  4DN4 M;  1F2L A;  4UDU C;  4M8A A;  4TSS A;  4DAV A;  1WTR A;  1WD1 A;  3MWY W;  2F1M A;  3HKZ B;  2JA8 B;  5CYU A;  5CBE E;  2RDG A;  2PW7 A;  3RLF A;  3IL8 A;  3MXP A;  1H9S B;  3FEW X;  3NSW A;  3OIP A;  1HTP A;  1KDA A;  5D14 A;  1DXM A;  5FK9 C;  2LKV A;  3BYY B;  4DU9 A;  4AYB B;  4V19 0;  3R2I A;  3MFY A;  1A2U A;  2PNR C;  5C5M A;  1Z7T A;  3A8K E;  4RCO A;  4RGN A;  1O7Y A;  1S5D D;  1TS3 A;  5FLX L;  3WDN A;  3C46 A;  3VR5 A;  2EY6 A;  3P20 A;  1KTK A;  3U9S A;  4BA2 I;  2E2J B;  2F0Q A;  3NUC A;  3Q23 A;  4DK1 A;  2ID0 A;  3V2T A;  5BN5 A;  2KJX A;  2F0T A;  5EQ0 A;  3QJY A;  1IL8 A;  2NBF A;  4EQP A;  3Q0A A;  2RA4 A;  4ZKC B;  2LMC B;  5IGG A;  3MHB A;  1IW7 D;  1T5E A;  5C3W A;  5CR3 A;  4KK7 A;  4IUP A;  2NVQ B;  1I4Q A;  1B9N A;  3D6C A;  1PZI D;  4KN4 C;  5BN4 A;  2B2V C;  4IUR A;  2HDM A;  2D2C C;  2O5J C;  2K6A A;  1XTC D;  3NTH A;  2KEE A;  4KY5 A;  1H9M A;  1EQT A;  1Q12 A;  2K32 A;  1JQY D;  1SYD A;  4N9P A;  1EZ8 A;  4QCL A;  1MGS A;  2B2T C;  1GUG A;  2EYL A;  2Z4H A;  2KCC A;  1G29 1;  2VXW A;  1GJX A;  3GV3 A;  2F0M A;  4IFD H;  2EJM A;  4RHS A;  3NPP A;  2Q8R E;  2Q8I B;  3DXJ C;  4CGY B;  1B9M A;  3J80 L;  3DWP A;  5KYI A;  1I6H B;  3FPP A;  2BE5 D;  1Q90 A;  3MVV A;  3S1M B;  4DGZ A;  3D31 A;  3L9A X;  3M4O B;  3BZD B;  3G7L A;  2JEB I;  2K05 A;  4MN3 A;  1F2Z A;  3S15 B;  1F9R A;  1KDC A;  3GTJ B;  1DD2 A;  2IW3 A;  4KY6 A;  1EY0 A;  1OXV A;  4CKE A;  3AU7 A;  2WIN B;  1ML0 D;  3DEP A;  1S4Z A;  2NN6 G;  1HUN A;  4QIW B;  2R93 B;  5LL6 X;  2E2I B;  1NAP A;  2F0S A;  3MZ5 A;  1F2Y A;  3HOU B;  2XNA C;  3NK9 A;  2L5T A;  5J1Z A;  4F8M A;  1I50 B;  3GTL B;  4KN7 C;  3PIO 3;  1HTL D;  3HOZ B;  2FMC A;  4OO1 H;  3PUY A;  3BDC A;  1PMR A;  1CK1 A;  3NTI A;  5COR A;  3VYU A;  1J8I A;  4KY7 A;  1MSH A;  1FNU A;  4HSP A;  1DM0 B;  2K01 A;  1ENA A;  1W6K A;  4H7B A;  3HG9 A;  5IGE A;  2G9H D;  1QNU A;  2L0C A;  3AMU A;  1SE3 A;  3E6Z X;  4KHV A;  1U4R A;  5E4X A;  4CJ1 B;  3HS0 C;  1I4H A;  1FGB D;  2PZW A;  3FMC A;  2Q8T A;  5CV9 A;  1L0X B;  5I6Y A;  2A6E C;  3S2H B;  3QIA A;  3ND8 A;  3GTK B;  1CFM A;  1SXT A;  1FR3 A;  3UI2 A;  3PUV A;  4ZQ3 A;  4MIU A;  1YNJ D;  4EQN A;  4Y7N B;  4XT3 B;  3HOV B;  5IGD A;  4K2L A;  1ENC A;  2MHV A;  1EIH A;  2B2V A;  1JC7 A;  1F9S A;  2NVT B;  1H9R A;  3TP5 A;  1Z47 A;  3L7Z C;  5EBC A;  1TQO A;  1PXU A;  3LWU A;  3IFT A;  4CKC A;  5C4J B;  1AZP A;  4XQN A;  1CHQ D;  3TBI B;  1WVL A;  2E76 C;  3CRK C;  4H13 C;  1ZYR D;  2JE6 I;  1STG A;  4K2K A;  1LO5 D;  1BDO A;  4HN7 A;  4X3S A;  2QKI C;  1SYC A;  1RCV D;  1H9J A;  5C0X H;  1Y8P B;  1PTO D;  5M5Y B;  3NQI A;  3HZX A;  3OHX C;  2RSN A;  1LLR D;  5EPJ A;  5CV7 A;  5T1I A;  3TP7 A;  2SOB A;  5DNF A;  1AZQ A;  5A2Q L;  2CVR A;  1Z6H A;  5KNC A;  1KLU D;  3PUW A;  2V4D A;  1KNA A;  1RKN A;  1JB3 A;  4K5V A;  5CV8 A;  1QNK A;  3M4Y A;  2EYJ A;  2PO4 A;  2M00 A;  1D5X C;  4XT1 B;  5JEA H;  1D1I A;  1Q3L A;  2WP8 J;  4F88 A;  1EEF D;  5C0X J;  1EYC A;  5G3L F;  1BXT A;  3C2P A;  1U4L A;  1Y8O B;  1F9Q A;  2DNC A;  1A3U A;  5HGT A;  1OXS C;  1YNN D;  3HOW B;  4J6H A;  1B4O A;  1BOS A;  3OWE B;  3NE5 B;  4KMU C;  4EGV A;  3KF8 A;  1R9T B;  1TVX A;  1AW7 A;  4ZAI A;  1V8Q A;  1CA5 A;  1SYG A;  1HRJ A;  4PQX A;  2XN9 C;  5KGU A;  5M5X B;  1SFO B;  4OO1 I;  3I4L A;  1I4X A;  5JEA J;  4XQJ A;  1QWY A;  3EFX D;  2IX3 A;  1PTO H;  2A74 C;  2IX1 A;  3TP8 A;  4RCN A;  1TY0 A;  3FKI B;  5K36 H;  2PW5 A;  3O13 A;  2JA5 B;  5IIF A;  1NCV A;  3KLR A;  1BQQ T;  3NQT A;  1GUT A;  1KAB A;  5LL6 S;  2DN8 A;  2E75 C;  1JOK A;  2HDL A;  3JAM E;  2EDG A;  3J81 E;  5JVG 3;  2F0L A;  4LMQ D;  4F87 A;  1SE4 A;  1BF4 A;  1ZXT A;  3I4M B;  4XTC S;  3LWE A;  2F0H A;  2CW0 D;  1TT2 A;  3FRP B;  2IL8 A;  2JXM B;  4RWS C;  1I6V C;  4JK1 C;  2DY8 A;  2ZXO A;  1IW7 C;  1HFG A;  1VMC A;  3BVG A;  5JPN C;  5M5W B;  3V96 A;  3S1N B;  1WTW A;  2KOL A;  3DHQ A;  2WII B;  4L63 B;  1SJH D;  1GHK A;  2NB0 A;  3PO2 B;  4PMC A;  4OHJ A;  4BA1 I;  2HUG A;  1SE2 A;  3ERQ A;  2R6G A;  4S3S A;  1DOM A;  1VF5 C;  3QOJ A;  4H0L C;  4G7O C;  3BDL A;  3F2U A;  3K57 A;  1G91 A;  3R8B A;  3D3R A;  4IUT A;  2ZXP A;  4CKB A;  4BBS B;  4K6D A;  1EL0 A;  5C0X I;  2HQE A;  2RSO A;  1ESF A;  1TKW B;  4HAE A;  4K5W A;  1Y1W B;  2E2D C;  4DFA A;  5CGK A;  3OIQ A;  4K8I A;  2F0J A;  5ELC A;  3C1E A;  1RF2 D;  2L12 A;  5M3M B;  3PO3 B;  2J0T D;  1AFP A;  3S2D B;  4H44 C;  3RD4 A;  3I4N B;  1LT5 D;  4HCS A;  4X3K A;  1GOZ A;  2PCF B;  2KQ3 A;  3SK8 A;  4KJN A;  4EVO A;  1PRT D;  4G4K A;  3GV6 A;  1STA A;  3PV0 A;  4MHE A;  1A2T A;  1F77 A;  1IKL A;  3E5S A;  3LX0 A;  2QIL A;  1STH A;  1UAP A;  2B2U C;  3OW7 A;  1F2M A;  4FNF A;  3VR6 A;  2B2Y A;  2NYZ D;  2AQ1 B;  4RHR A;  1BCP F;  4A3E B;  3NXW A;  3M3Y B;  1EU4 A;  4CBV A;  3SK4 A;  3MFG A;  3I73 A;  4KKS A;  4U68 A;  2DY7 A;  3EA6 A;  3KK7 A;  1JR0 D;  3K5N A;  2AUK A;  1LV9 A;  2BOS A;  3RZD B;  2QF7 A;  4FXK C;  1R4Q B;  1VCI A;  1IHZ A;  1JIC A;  1V1O A;  3FPU B;  2ICE C;  1DON A;  3RUZ A;  1B44 D;  3GTO B;  2K04 A;  3MAQ A;  3RZO B;  3IKJ A;  5A35 A;  3TSS A;  1K8O A;  5D3I B;  1CI3 M;  1GUN A;  2WKC A;  4TKO B;  3GP7 A;  4DA2 A;  2B2W A;  2KEC A;  2EXZ A;  2SDF A;  1CTM A;  3HEJ A;  4IFD G;  4A3D B;  3EQL C;  1SYB A;  2A68 C;  2F0I A;  4C1N K;  4FVM A;  1LTR D;  3QO2 A;  2B8F A;  3T51 B;  4RGO S;  1VMP A;  2Z4I A;  3GTQ B;  4RH6 A;  3TZD A;  3W3A A;  4TQU S;  1ET6 A;  3PUX A;  2PQE A;  1O7Z A;  1WCM B;  1JCK B;  2L11 A;  5EKK A;  1HXY D;  5FO8 B;  1LT3 D;  2LY7 A;  1SNP A;  3L3O C;  1JWU D;  1K83 B;  2NTS A;  2XWB B;  4HMI A;  3X3N A;  1J9O A;  4JBW A;  3CQZ B;  4CJ0 B;  5KND A;  3GTG B;  1T5X D;  2F0N A;  2I46 A;  1PTO C;  3K5M A;  2VNU D;  1U4M A;  5FOB B;  4G7Z C;  1QOH A;  1EFI D;  2BCO A;  2EYF A;  3NWS A;  2HCI A;  5KRU A;  4BY7 B;  5IT9 L;  3IFD A;  2F0D A;  5KIX A;  2NN6 H;  1S5B D;  2TMP A;  1PZJ D;  1AEX A;  1IKM A;  3NWT A;  5C4Z A;  2OF1 A;  5EBD A;  3QWN A;  1DZ1 A;  5I4D A;  2F0E A;  2TSS A;  3CU7 A;  2JEA I;  4NP5 A;  3AB9 A;  2RDH A;  4C56 C;  2XWJ B;  1C8C A;  4RAU C;  1NUC A;  4GZY C;  2VB2 X;  1TR5 A;  1YNN C;  4LK1 C;  2MPM A;  4Q5V A;  5FO9 B;  4OL7 A;  1LT6 D;  3FDT A;  4F7X A;  1M8A A;  5ELB A;  2F0G A;  2RKS A;  4C3I G;  5JAV A;  4NW2 A;  3J81 L;  5DM6 3;  1OXX K;  1BCP C;  4LAA A;  5FLX E;  3KBX A;  4OIK A;  3VR3 A;  2N88 A;  1D5M C;  1AN8 A;  2N55 A;  2K03 A;  3C1F A;  4C3I B;  1SEB D;  3QOL A;  1SND A;  2F0K A;  1X32 A;  1QG7 A;  2NZ1 D;  1TWG B;  2FMM A;  2B2T A;  3PUZ A;  3G6J B;  1KNE A;  1EY8 A;  4QUF A;  1SNM A;  3KLS A;  1G6Z A;  4EQO A;  4Z9C B;  5EJW A;  4C1N I;  1IYU A;  1HPC A;  2L55 A;  3MXG A;  4BBR B;  1D6E C;  2F3V A;  2PPB C;  3ONA B;  1CZW A;  4ME5 A;  3P1H A;  1SNQ A;  3GTM B;  3BVM A;  4L8J A;  4BS9 A;  3VA5 A;  1QJO A;  3TDQ A;  3EVQ A;  5C5L A;  1G8Z D;  3CRL C;  2EVB A;  3J7Y W;  2SNM A;  4R8N A;  5D65 A;  1RDP D;  2NTT A;  3T13 A;  4IN3 A;  5E1F A;  5CV6 A;  3GO5 A;  1QIL A;  2IX0 A;  1STN A;  3ZYY X;  4FO2 A;  2E74 C;  1Y8N B;  5DM7 3;  1FYC A;  3J80 E;  3VR2 A;  3T4A C;  2ZT9 C;  2A69 D;  3TP6 A;  5C4H A;  2IWH A;  3TN2 A;  4XIG S;  5C3E B;  1SNO A;  4XYO A;  5TSS A;  3R2T A;  1DOK A;  3MA2 B;  2X69 A;  3DWQ A;  4RGT A;  4ZUJ A;  2RVL A;  1O80 A;  2XSC A;  1Y69 U;  4B9X A;  3BS1 A;  1PFN A;  4C3J G;  1JOO A;  2M9V A;  1A3V A;  2Z8L A;  2MJ8 A;  3I3C A;  2KED A;  3CKI B;  3SEB A;  4E6I A;  1E2V A;  2NN6 I;  4KHZ A;  5JOB A;  1TWF B;  5K5P A;  1KAA A;  1S5F D;  3WOE A;  3BG3 A;  2A6E D;  1EOT A;  2EE1 A;  3Q22 A;  1KDB A;  3A8I E;  3OWF A;  4C3J B;  1QE6 A;  2EPB A;  4RA8 A;  1STB A;  4ILW A;  1SYE A;  1EIG A;  1PRT C;  1SBB B;  4O42 A;  3OMC A;  4ODG A;  4RGM A;  3BDO A;  4ZRZ A;  3MC0 B;  3QB3 A;  4TRD A;  2RDF A;  1H9K A;  1PTO B;  1RTO A;  1S5C D;  1QB5 D;  2QDB A;  1HQM C;  4LJZ C;  5M3F B;  1E2W A;  2J7Z A;  1Q1B A;  4Q0F A;  1LT4 D;  3OPO A;  2A6H D;  5CC4 A;  4O1N A;  3BVZ A;  1BUV T;  4U67 3;  4KV6 A;  1I3Q B;  4K8J A;  3VYS A;  5C4X B;  2RQX A;  5E4W C;  5I9O A;  5EPK A;  3K5O A;  1HQR D;  1HUM A;  2O4X A;  3DM1 A;  3NP8 A;  1TII D;  1NSN S;  3DMU A;  1B3A A;  3P7J A;  1B2T A;  1O78 A;  3VR4 A;  4DXF A;  2OEO A;  1B1Z A;  1V1P B;  5IGF A;  2O5I C;  1FD7 D;  4HCE A;  4A3J B;  1O7L A;  3HGB A;  2B8G A;  4HTH A;  3OOC A;  1AP0 A;  2QCP X;  4PV1 C;  2EJG C;  1UNS A;  1PTO F;  3K6O A;  2WV6 D;  3T16 A;  2KHS A;  5I6W A;  4FF4 A;  1GHJ A;  1BBX C;  1ZKO A;  4BY1 B;  4HMJ A;  1EU3 A;  2CQA A;  4QF4 A;  1MBY A;  1R4P B;  2IJ0 A;  1BCP B;  3KBG A;  5CBA E;  2D5D A;  2LFN A;  4C3H G;  5JJZ A;  4CHT B;  4C2M B;  4DNT B;  4KKT A;  2IPK D;  1Q1E A;  3KLS X;  2BE5 C;  1RTN A;  2F0O A;  1II3 A;  2K5W A;  4A3F B;  4R8I A;  1XYI A;  1G2T A;  1ET9 A;  3LNN A;  3S16 B;  3NBI A;  1LTB D;  1NR2 A;  3K59 A;  1SMY D;  2KA7 A;  2D62 A;  3VYT A;  1OXU A;  1EY7 A;  2EY1 A;  1BR9 A;  4FF2 A;  5A2Q E;  2EYO A;  1STY A;  4C3H B;  3QG1 A;  4WOR A;  2EYH A;  1XWE A;  2G9D A;  3HRZ C;  4ZKB B;  1TS2 A;  5DAU A;  4XQQ A;  1SDF A;  3M85 A;  3S17 B;  4UAI A;  4XXE A;  1A3T A;  1EY6 A;  2C5C A;  5DEH A;  1CM9 A;  3K58 A;  1ZEQ X;  5FKA C;  1QCB D;  3H6M A;  5EPL A;  1D1K A;  3T53 B;  1ILQ A;  4WJW A;  4IQZ A;  2VB3 X;  3D6W A;  1TWH B;  1PZK D;  2IT1 A;  2OT2 A;  4IZ8 A;  4KD4 A;  3TME A;  3H3V C;  1VDZ A;  1EYA A;  2BDO A;  2ICI A;  2XRS D;  2AUJ D;  4WFN 3;  4RKB A;  3N6R A;  4ID6 A;  2HCC A;  2MGS A;  1CA6 A;  3SXH A;  4PMB A;  4P2C B;  1KLG D;  3Q6S A;  3K5L A;  4X3T A;  4V0B A;  1JWS D;  3M7N A;  1Q8I A;  2CHB D;  4ZUI A;  5IOC A;  5CV4 A;  3NTK A;  4DXG A;  1JOQ A;  4B08 A;  1M4V A;  2JYO A;  4K14 A;  2OXP A;  3MXN A;  1X3Q A;  2I07 B;  2FFK B;  4RFB A;  1EWC A;  3ND9 A;  3SE0 A;  5CMD A;  5JVH 3;  2R61 A;  1LAB A;  4A3B B;  3D4W A;  3NBH A;  3J7A V;  2YU9 B;  1EQV A;  1YNJ C;  2NVY B;  1WTP A;  4XDX A;  4K6L A;  1HHV A;  5CV5 A;  4KKU A;  3SHL A;  2K7V A;  5HUR A;  4K5X A;  2PZT A;  4I65 A;  3SR1 A;  5D3D A;  1WD0 A;  2WKD A;  1D5Z C;  1C4Q A;  1ONL A;  1TWA B;  2AWO A;  1PRT B;  2EZV A;  1MD2 D;  2KVM A;  2FHT A;  3H91 A;  3K7A B;  3CHB D;  1ZYR C;  3HOX B;  2JA7 B;  4A93 B;  2LS0 1;  1TS5 A;  1JOR A;  1WTO A;  2H1E A;  1A15 A;  4A3K B;  5F2D A;  1X3P A;  4BWG B;  2XIW A;  2PYK A;  4A3I B;  1PFB A;  2F0W A;  1ENF A;  4IFD J;  2JSO A;  4DK0 A;  3SDZ A;  4OO1 G;  2NWG A;  3SK6 A;  4KD3 A;  2M2L A;  2SEB D;  1SJE D;  3GTP B;  2B39 A;  3MXU A;  3H09 A;  5G3L D;  2WAC A;  4DNR B;  2AWN A;  2ZXR A;  3MEH A;  1SNC A;  4FP5 D;  1CQV A;  5EKL A;  2EY5 A;  3E0J A;  2QEJ C;  1ROD A;  5ISR A;  3I8Z A;  2J4X A;  2BDN A;  2F3W A;  2L4N A;  2A69 C;  4HED A;  1PRT F;  4I7Z C;  2B2U A;  5LHY 1;  1C48 A;  1CZG A;  1E2Z A;  4ZK9 B;  2YYZ A;  2DNE A;  3J7A F;  3A56 A;  3RMH A;  2SNS A;  2NVX B;  3S14 B;  5C3X A;  2JP1 A;  5J22 A;  4R9W A;  1WTV A;  3P75 A;  3I70 A;  5I2Y A;  1A6X A;  4IUN A;  2EY2 A;  2Z1C A;  1PYW D;  2WB1 B;  3JAM L;  4WRD A;  5FO7 B;  5C44 B;  1U4P A;  1LTI D;  1WTX A;  5E3F A;  1TS4 A;  3FVQ A;  5COY A;  1SSO A;  1B50 A;  2O2L D;  4XYQ A;  2F0V A;  3T56 B;  3S1Q B;  2K1B A;  4FXD A;  3DUZ A;  5I9P A;  1LTS D;  1OXT A;  2XRQ D;  3KUP A;  2C9O A;  1PDQ A;  5IGC A;  1Y1V B;  2MUY A;  2D9U A;  4QUC A;  1DCZ A;  5ELD A;  1IYV A;  5KYL A;  2A68 D;  2ENB A;  4X3U A;  5IGB A;  3W2D A;  1JE4 A;  1K8M A;  3VYR A;  4ABN A;  4IUQ A;  1HA6 A;  1OO9 B;  4FF1 A;  5ELF A;  2Y0S B;  3A7L A;  3K0Y A;  1EEI D;  4QB4 A;  3I90 A;  1DYQ A;  2GA4 B;  1BNZ A;  2A6H C;  3MTS A;  4G57 A;  5C0X G;  2KCN A;  1I4G A;  2KUM A;  1UEA B;  1GUO A;  2X6G A;  1B53 A;  2PMZ B;  1I4P A;  4FXG C;  2CW0 C;  3I91 A;  2H4O A;  2WAQ B;  1DOL A;  2EYP A;  4NKL A;  2R3Z A;  3M7G A;  5J39 A;  5KNB A;  4IUV A;  4DF7 A;  5T1G A;  4FYD A;  1EZ6 A;  2FIN B;  3BYT B;  5NUC A;  4CJ2 C;  4M1U B;  4ZLT F;  4IFD I;  1L0Y B;  3D8G A;  3A54 A;  5JEA G;  2L1B A;  4DAP A;  4PNY A;  4DAY A;  1WTQ A;  4B9W A;  4J8Q A;  2EOT A;  1TY2 A;  3IAY A;  1PLF A;  1TWC B;  4ZYS A;  1EY4 A;  3A55 A;  1DJR D;  1LTA D;  3NHH A;  4A3G B;  1TU2 B;  2AQ2 B;  2PZU A;  1EY9 A;  4KI0 A;  5IOD A;  1E0B A;  1CHP D;  3URY A;  5KEE A;  5EGT A;  2B63 B;  1MSG A;  1LAC A;  2F0F A;  1UUP A;  1V1P A;  4NMZ A;  4J1M A;  3C3L A;  4IAL A;  3H0G B;  5I2X A;  1HA5 A;  3PMF A;  1SMY C;  5IT9 E;  1FNW A;  1FNV A;  1GUS A;  3EJI A;  4PMW A;  5K36 G;  3PIP 3;  1EY5 A;  5C6A A;  1D2B A;  1HCZ A;  1RJT A;  3S1R B;  1BCP D;  5M9O A;  2F0U A;  1CQF A;  4ULL A;  2A73 B;  2B2Y C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...