1WU3I

Crystal structure of recombinant murine interferon beta
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
161
structure length
161
Chain Sequence
INYKQLQLQERTNIRKCQELLEQLNGKINLTYRADFKIPMEMTEKMQKSYTAFAIQEMLQNVFLVFRNNFSSTGWNETIVVRLLDELHQQTVFLKTVLEEKQEERLTWEMSSTALHLKSYYWRVQRYLKLMKYNSYAWMVVRAEIFRNFLIIRRLTRNFQN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Refined crystal structure of recombinant murine interferon-beta at 2.15 A resolution
pubmed doi rcsb
molecule keywords Interferon beta
molecule tags Cytokine
source organism Mus musculus
total genus 66
structure length 161
sequence length 161
ec nomenclature
pdb deposition date 2004-12-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00143 Interferon Interferon alpha/beta domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1250.10 Mainly Alpha Up-down Bundle Growth Hormone; Chain: A; Growth Hormone; Chain: A; 1wu3I00
3SE4B 1RHGA 1M48A 3SE3B 1BBNA 1EMRA 2H24A 1IJZA 3Q1SI 4I77Z 1M49A 1J7VL 3N06A 4FA8E 4NEJA 3DGCL 3DUHC 3NCCA 1Y6NL 2CYKA 4YPGC 4ZF7A 5D22A 3HMXB 3VA2A 4ZS7A 5FHXA 2LMSA 2B91A 1EVSA 1ALUA 1BGEA 1RFBA 5KNHI 1WU3I 2O26A 3MZGA 2IL6A 2E9WC 1FYHA 4NI7A 5D70A 1Y6ML 3OQ3A 2Q7NB 1VLKA 1IARA 3BPLA 4CNIC 2INTA 4O6KA 1HUWA 1HZIA 1FG9A 1I1RB 1M47A 1CNT1 1AXIA 1IRLA 2L3OA 1HWGA 1RCBA 1M4AA 1LK3A 2B90A 1LQSL 4DOHA 3EJJA 5L6YC 3BPOA 1SCFA 1Z7CA 2L3YA 3INKC 4O9HA 1N1FA 1HGUA 2B8XA 4PS4A 5C7XA 1IL6A 1RW5A 3UX9A 1M4RA 1PGRA 3PIWA 3L5WI 3HHRA 1CD9A 1EKUA 3D48P 3L5XA 2ERJD 1JLIA 4RS1A 4YDYI 3G6DA 1ITFA 1ITMA 3LB6A 4J4LC 1F6FA 1BCNA 3NCFA 1Y6KL 1ITLA 1BP3A 4NEMA 1V7NV 3N0PA 3NPZA 1ILKA 2GMFA 1P9MB 3D87A 4GRWA 5D72A 5FUCA 1ITIA 1M4CA 3LB6B 3BPNA 1GA3A 1D9CA 1HWHA 4YUEC 1A7MA 4WRLB 3B5KA 3PIVA 1AX8A 1ETEA 1LKIA 1INRA 1BGCA 1Z92A 1GNCA 1V7MV 1EXZA 1CSGA 2KZ1A 2ILKA 3NCBA 2B8UA 2B8YA 4NKQC 4YQXA 3UF2A 4NI9A 1NBPA 1PW6A 1EERA 2LAGA 1HIJA 1AU1A 3S9DA 2B5IA 1KF9A 3UF5A 2O27A 1A22A 2D9QA 4Z5RD 1CYLA 3QAZA 2Q98A 3D85C 3DLQI 1BGDA 2B8ZA 3QB7A 1PVHB 1QVNA 3QB1A 4MHLA 5E4EA 2D48A 5LQBA 1CN4C 3EW3A 3BESL 3QWRB 1BUYA 3QT2C 3G9VB 1D9GA 1M4BA 5D71A 3UEZE 5D28B 3WCYI 1IK0A 4X51A 1F45B 1B5LA 3NCEA 1HIKA 1HULA 1YKBA 2HYMB 1PY2A
chains in the Genus database with same CATH superfamily
3SE4B 4DKCA 5D59A 5IP7D 4IKXA 3N06A 5IP9D 1Y6NL 4ZF7A 4D2BA 1ALUA 1RFBA 2O26A 2E9WC 4OAAA 3OQ3A 2Q7NB 4ZWBA 4D2CA 1IARA 2INTA 1HUWA 1Y14A 4LEPA 1LK3A 4DOHA 5L6YC 3BPOA 1HGUA 4PS4A 4GS7A 3I4MD 4BY7D 1M4RA 4A3FD 4RS1A 1ITFA 5EQHA 1Y6KL 3N0PA 3NPZA 2JA6D 1P9MB 3D87A 1ITIA 1AX8A 1Z92A 1V7MV 1CSGA 3O7QA 1PW6A 4YB9D 1EERA 4UVMA 4GC0A 4A3JD 5IYBD 1KF9A 1A22A 2VUMD 3HHCA 3QAZA 4U4WA 2PSMA 4A3BD 2XQBA 5C44D 5LQBA 3QWRB 1BUYA 4BY1D 3FKID 3PO3D 4IKYA 2HYMB 1M48A 5EQIA 5A2NA 1WCMD 3Q1SI 4I77Z 3DGCL 4A3LD 4YPGC 5FHXA 4TPJA 1EVSA 3MZGA 3PO2D 4A3DD 1Y6ML 3BPLA 3HOWD 1HZIA 1FG9A 1M47A 1CNT1 4QIQA 4U4VA 1HWGA 3HOVD 1RCBA 1M4AA 2Z3QA 2B90A 4ZWCA 2L3YA 4XNJA 4O9HA 1IL6A 1RW5A 1EKUA 3D48P 4BXXD 1ITMA 1F6FA 1ITLA 1BP3A 1V7NV 1ILKA 4APSA 1D9CA 1A7MA 4WRLB 1PV6A 1LKIA 1INRA 1BGCA 4A3ID 3NCBA 5TS9A 4BBRD 2LAGA 4A3MD 1HIJA 2R7ZD 4A3KD 3UF5A 4Z5RD 3OG4A 2Q98A 1Y1VD 3HOZD 1PVHB 3QB1A 4MHLA 5E4EA 3EW3A 3BESL 3QT2C 3H3VE 4W6VA 5D28B 1HIKA 4GBZA 4BBSD 1RHGA 4TPHA 1BBNA 1EMRA 5EQGA 1J7VL 2R93D 4FA8E 4NEJA 2JA5D 3NCCA 2CYKA 4IKWA 5D22A 3HMXB 2LMSA 3TGXB 2B91A 5KNHI 1WU3I 5A2OA 3HOUD 4EXNA 4IKVA 4JA3A 1I1RB 1AXIA 1IRLA 2XUTA 2L3OA 1SCFA 3INKC 1N1FA 2B8XA 3IRHA 2JA7D 2V8NA 4DKEA 3UX9A 2Z3RA 4J05A 2R92D 3PIWA 3AYHA 3L5XA 4YDYI 3G6DA 4DKFA 3LB6A 4J4LC 4D2DA 1BCNA 3NCFA 2O6IA 4NEMA 4DKDA 4TPGA 2GMFA 4PYPA 4GRWA 4Q65A 4IU8A 3BPNA 1GA3A 1HWHA 4YUEC 3OG6A 3HOXD 3B5KA 3PIVA 1ETEA 3DI2A 4LRLA 4A3CD 1GNCA 2KZ1A 4NN6A 2B8UA 2B8YA 4NN7A 3UF2A 4NI9A 1NBPA 5IYDD 3H0GD 1AU1A 2D9QA 4IKZA 1BGDA 2B8ZA 3QB7A 1QVNA 2D48A 1CN4C 4U4TA 5D58A 3WCYI 1IK0A 4OH3A 3NCEA 3SE3B 2H24A 1IJZA 1M49A 4JR9A 4NN5A 5C4XD 3O7PA 3DUHC 4ZW9A 3VA2A 4ZS7A 1PW4A 1BGEA 2IL6A 1FYHA 4YBQA 4NI7A 3I4ND 4A93D 5D70A 4ZYRA 4A3ED 5GXBA 1VLKA 5FLMD 4CNIC 4O6KA 1LQSL 3EJJA 4GBYA 4XNIA 1Z7CA 5C7XA 1PGRA 4LDSA 3L5WI 3HHRA 1CD9A 2ERJD 1JLIA 2CFQA 2Y5YA 2C35A 3WDOA 2OQPA 3DI3A 2CFPA 1PV7A 2Q14A 4IU9A 5D72A 5FUCA 1M4CA 3LB6B 1EXZA 2ILKA 4NKQC 4YQXA 4JREA 5IYCD 3S9DA 4A3GD 2B5IA 2B63D 2O27A 5C3ED 1CYLA 3D85C 3DLQI 2JA8D 3G9VB 4EXPA 1D9GA 1M4BA 5D71A 5C65A 3UEZE 5D6KA 4X51A 3HOYD 1F45B 1Y1WD 1B5LA 1HULA 1YKBA 1PY2A
chains in the Genus database with same CATH topology
4BBSD 3SE4B 1RHGA 1M48A 4DKCA 3SE3B 1BBNA 1WCMD 1EMRA 2H24A 1IJZA 3Q1SI 4I77Z 1M49A 5IP7D 1J7VL 4NN5A 2R93D 3N06A 4FA8E 4NEJA 3DGCL 5C4XD 2JA5D 5IP9D 3DUHC 3NCCA 4A3LD 1Y6NL 2CYKA 4YPGC 4ZF7A 5D22A 3HMXB 3VA2A 4ZS7A 5FHXA 2LMSA 3TGXB 2B91A 1EVSA 1ALUA 1BGEA 1RFBA 5KNHI 1WU3I 2O26A 3MZGA 2IL6A 2E9WC 1FYHA 4NI7A 3I4ND 4A93D 5D70A 3PO2D 4A3DD 1Y6ML 3OQ3A 2Q7NB 3HOUD 4EXNA 4A3ED 1VLKA 1IARA 3BPLA 4CNIC 2INTA 4O6KA 1HUWA 1HZIA 1FG9A 1I1RB 1M47A 5FLMD 3HOWD 1CNT1 1Y14A 1AXIA 1IRLA 2L3OA 1HWGA 3HOVD 1RCBA 1M4AA 1LK3A 2B90A 1LQSL 2Z3QA 3EJJA 4DOHA 5L6YC 3BPOA 1SCFA 1Z7CA 2L3YA 3INKC 4O9HA 1N1FA 1HGUA 2B8XA 3IRHA 4PS4A 5C7XA 4GS7A 2JA7D 3I4MD 1IL6A 1RW5A 4DKEA 3UX9A 2Z3RA 2R92D 4BY7D 1M4RA 1PGRA 3PIWA 3L5WI 3HHRA 1CD9A 1EKUA 3D48P 3AYHA 3L5XA 4BXXD 2ERJD 1JLIA 4RS1A 4YDYI 3G6DA 2C35A 4A3FD 4DKFA 2OQPA 1ITMA 3DI3A 3LB6A 1F6FA 4J4LC 1ITFA 1BCNA 3NCFA 1Y6KL 2O6IA 1ITLA 1BP3A 4NEMA 4DKDA 2Q14A 1V7NV 3N0PA 3NPZA 1ILKA 2GMFA 2JA6D 1P9MB 3D87A 4GRWA 5D72A 5FUCA 1ITIA 1M4CA 3LB6B 3BPNA 1GA3A 1D9CA 1HWHA 4YUEC 3OG6A 1A7MA 3HOXD 4WRLB 3B5KA 3PIVA 1AX8A 1ETEA 3DI2A 4LRLA 1LKIA 4A3CD 1INRA 1BGCA 1Z92A 4A3ID 1GNCA 1V7MV 1EXZA 1CSGA 2KZ1A 2ILKA 3NCBA 4NN6A 2B8UA 2B8YA 4NN7A 5TS9A 4NKQC 4YQXA 3UF2A 4NI9A 1NBPA 4BBRD 1PW6A 5IYDD 1EERA 2LAGA 4A3MD 3H0GD 1HIJA 5IYCD 2R7ZD 1AU1A 3S9DA 4A3JD 4A3GD 2B5IA 5IYBD 1KF9A 4A3KD 3UF5A 2B63D 2O27A 1A22A 2D9QA 4Z5RD 5C3ED 2VUMD 1CYLA 3OG4A 3HHCA 3QAZA 2Q98A 3D85C 1Y1VD 3DLQI 2PSMA 1BGDA 2B8ZA 3QB7A 3HOZD 4A3BD 1PVHB 1QVNA 2XQBA 3QB1A 4MHLA 5C44D 5E4EA 2D48A 5LQBA 1CN4C 3EW3A 2JA8D 3BESL 3QWRB 1BUYA 3QT2C 3G9VB 4EXPA 3FKID 4BY1D 1D9GA 3H3VE 1M4BA 5D71A 3PO3D 3UEZE 5D28B 3WCYI 1IK0A 4X51A 3HOYD 1F45B 1Y1WD 1B5LA 3NCEA 1HIKA 1HULA 1YKBA 2HYMB 1PY2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3SE4 B;  1RHG A;  1M48 A;  3SE3 B;  1BBN A;  1EMR A;  2H24 A;  1IJZ A;  3Q1S I;  4I77 Z;  1M49 A;  1J7V L;  3N06 A;  4FA8 E;  4NEJ A;  3DGC L;  3DUH C;  3NCC A;  1Y6N L;  2CYK A;  4YPG C;  4ZF7 A;  5D22 A;  3HMX B;  3VA2 A;  4ZS7 A;  5FHX A;  2LMS A;  2B91 A;  1EVS A;  1ALU A;  1BGE A;  1RFB A;  5KNH I;  1WU3 I;  2O26 A;  3MZG A;  2IL6 A;  2E9W C;  1FYH A;  4NI7 A;  5D70 A;  1Y6M L;  3OQ3 A;  2Q7N B;  1VLK A;  1IAR A;  3BPL A;  4CNI C;  2INT A;  4O6K A;  1HUW A;  1HZI A;  1FG9 A;  1I1R B;  1M47 A;  1CNT 1;  1AXI A;  1IRL A;  2L3O A;  1HWG A;  1RCB A;  1M4A A;  1LK3 A;  2B90 A;  1LQS L;  4DOH A;  3EJJ A;  5L6Y C;  3BPO A;  1SCF A;  1Z7C A;  2L3Y A;  3INK C;  4O9H A;  1N1F A;  1HGU A;  2B8X A;  4PS4 A;  5C7X A;  1IL6 A;  1RW5 A;  3UX9 A;  1M4R A;  1PGR A;  3PIW A;  3L5W I;  3HHR A;  1CD9 A;  1EKU A;  3D48 P;  3L5X A;  2ERJ D;  1JLI A;  4RS1 A;  4YDY I;  3G6D A;  1ITF A;  1ITM A;  3LB6 A;  4J4L C;  1F6F A;  1BCN A;  3NCF A;  1Y6K L;  1ITL A;  1BP3 A;  4NEM A;  1V7N V;  3N0P A;  3NPZ A;  1ILK A;  2GMF A;  1P9M B;  3D87 A;  4GRW A;  5D72 A;  5FUC A;  1ITI A;  1M4C A;  3LB6 B;  3BPN A;  1GA3 A;  1D9C A;  1HWH A;  4YUE C;  1A7M A;  4WRL B;  3B5K A;  3PIV A;  1AX8 A;  1ETE A;  1LKI A;  1INR A;  1BGC A;  1Z92 A;  1GNC A;  1V7M V;  1EXZ A;  1CSG A;  2KZ1 A;  2ILK A;  3NCB A;  2B8U A;  2B8Y A;  4NKQ C;  4YQX A;  3UF2 A;  4NI9 A;  1NBP A;  1PW6 A;  1EER A;  2LAG A;  1HIJ A;  1AU1 A;  3S9D A;  2B5I A;  1KF9 A;  3UF5 A;  2O27 A;  1A22 A;  2D9Q A;  4Z5R D;  1CYL A;  3QAZ A;  2Q98 A;  3D85 C;  3DLQ I;  1BGD A;  2B8Z A;  3QB7 A;  1PVH B;  1QVN A;  3QB1 A;  4MHL A;  5E4E A;  2D48 A;  5LQB A;  1CN4 C;  3EW3 A;  3BES L;  3QWR B;  1BUY A;  3QT2 C;  3G9V B;  1D9G A;  1M4B A;  5D71 A;  3UEZ E;  5D28 B;  3WCY I;  1IK0 A;  4X51 A;  1F45 B;  1B5L A;  3NCE A;  1HIK A;  1HUL A;  1YKB A;  2HYM B;  1PY2 A; 
#chains in the Genus database with same CATH topology
 3SE4 B;  4DKC A;  5D59 A;  5IP7 D;  4IKX A;  3N06 A;  5IP9 D;  1Y6N L;  4ZF7 A;  4D2B A;  1ALU A;  1RFB A;  2O26 A;  2E9W C;  4OAA A;  3OQ3 A;  2Q7N B;  4ZWB A;  4D2C A;  1IAR A;  2INT A;  1HUW A;  1Y14 A;  4LEP A;  1LK3 A;  4DOH A;  5L6Y C;  3BPO A;  1HGU A;  4PS4 A;  4GS7 A;  3I4M D;  4BY7 D;  1M4R A;  4A3F D;  4RS1 A;  1ITF A;  5EQH A;  1Y6K L;  3N0P A;  3NPZ A;  2JA6 D;  1P9M B;  3D87 A;  1ITI A;  1AX8 A;  1Z92 A;  1V7M V;  1CSG A;  3O7Q A;  1PW6 A;  4YB9 D;  1EER A;  4UVM A;  4GC0 A;  4A3J D;  5IYB D;  1KF9 A;  1A22 A;  2VUM D;  3HHC A;  3QAZ A;  4U4W A;  2PSM A;  4A3B D;  2XQB A;  5C44 D;  5LQB A;  3QWR B;  1BUY A;  4BY1 D;  3FKI D;  3PO3 D;  4IKY A;  2HYM B;  1M48 A;  5EQI A;  5A2N A;  1WCM D;  3Q1S I;  4I77 Z;  3DGC L;  4A3L D;  4YPG C;  5FHX A;  4TPJ A;  1EVS A;  3MZG A;  3PO2 D;  4A3D D;  1Y6M L;  3BPL A;  3HOW D;  1HZI A;  1FG9 A;  1M47 A;  1CNT 1;  4QIQ A;  4U4V A;  1HWG A;  3HOV D;  1RCB A;  1M4A A;  2Z3Q A;  2B90 A;  4ZWC A;  2L3Y A;  4XNJ A;  4O9H A;  1IL6 A;  1RW5 A;  1EKU A;  3D48 P;  4BXX D;  1ITM A;  1F6F A;  1ITL A;  1BP3 A;  1V7N V;  1ILK A;  4APS A;  1D9C A;  1A7M A;  4WRL B;  1PV6 A;  1LKI A;  1INR A;  1BGC A;  4A3I D;  3NCB A;  5TS9 A;  4BBR D;  2LAG A;  4A3M D;  1HIJ A;  2R7Z D;  4A3K D;  3UF5 A;  4Z5R D;  3OG4 A;  2Q98 A;  1Y1V D;  3HOZ D;  1PVH B;  3QB1 A;  4MHL A;  5E4E A;  3EW3 A;  3BES L;  3QT2 C;  3H3V E;  4W6V A;  5D28 B;  1HIK A;  4GBZ A;  4BBS D;  1RHG A;  4TPH A;  1BBN A;  1EMR A;  5EQG A;  1J7V L;  2R93 D;  4FA8 E;  4NEJ A;  2JA5 D;  3NCC A;  2CYK A;  4IKW A;  5D22 A;  3HMX B;  2LMS A;  3TGX B;  2B91 A;  5KNH I;  1WU3 I;  5A2O A;  3HOU D;  4EXN A;  4IKV A;  4JA3 A;  1I1R B;  1AXI A;  1IRL A;  2XUT A;  2L3O A;  1SCF A;  3INK C;  1N1F A;  2B8X A;  3IRH A;  2JA7 D;  2V8N A;  4DKE A;  3UX9 A;  2Z3R A;  4J05 A;  2R92 D;  3PIW A;  3AYH A;  3L5X A;  4YDY I;  3G6D A;  4DKF A;  3LB6 A;  4J4L C;  4D2D A;  1BCN A;  3NCF A;  2O6I A;  4NEM A;  4DKD A;  4TPG A;  2GMF A;  4PYP A;  4GRW A;  4Q65 A;  4IU8 A;  3BPN A;  1GA3 A;  1HWH A;  4YUE C;  3OG6 A;  3HOX D;  3B5K A;  3PIV A;  1ETE A;  3DI2 A;  4LRL A;  4A3C D;  1GNC A;  2KZ1 A;  4NN6 A;  2B8U A;  2B8Y A;  4NN7 A;  3UF2 A;  4NI9 A;  1NBP A;  5IYD D;  3H0G D;  1AU1 A;  2D9Q A;  4IKZ A;  1BGD A;  2B8Z A;  3QB7 A;  1QVN A;  2D48 A;  1CN4 C;  4U4T A;  5D58 A;  3WCY I;  1IK0 A;  4OH3 A;  3NCE A;  3SE3 B;  2H24 A;  1IJZ A;  1M49 A;  4JR9 A;  4NN5 A;  5C4X D;  3O7P A;  3DUH C;  4ZW9 A;  3VA2 A;  4ZS7 A;  1PW4 A;  1BGE A;  2IL6 A;  1FYH A;  4YBQ A;  4NI7 A;  3I4N D;  4A93 D;  5D70 A;  4ZYR A;  4A3E D;  5GXB A;  1VLK A;  5FLM D;  4CNI C;  4O6K A;  1LQS L;  3EJJ A;  4GBY A;  4XNI A;  1Z7C A;  5C7X A;  1PGR A;  4LDS A;  3L5W I;  3HHR A;  1CD9 A;  2ERJ D;  1JLI A;  2CFQ A;  2Y5Y A;  2C35 A;  3WDO A;  2OQP A;  3DI3 A;  2CFP A;  1PV7 A;  2Q14 A;  4IU9 A;  5D72 A;  5FUC A;  1M4C A;  3LB6 B;  1EXZ A;  2ILK A;  4NKQ C;  4YQX A;  4JRE A;  5IYC D;  3S9D A;  4A3G D;  2B5I A;  2B63 D;  2O27 A;  5C3E D;  1CYL A;  3D85 C;  3DLQ I;  2JA8 D;  3G9V B;  4EXP A;  1D9G A;  1M4B A;  5D71 A;  5C65 A;  3UEZ E;  5D6K A;  4X51 A;  3HOY D;  1F45 B;  1Y1W D;  1B5L A;  1HUL A;  1YKB A;  1PY2 A; 
#chains in the Genus database with same CATH homology
 4BBS D;  3SE4 B;  1RHG A;  1M48 A;  4DKC A;  3SE3 B;  1BBN A;  1WCM D;  1EMR A;  2H24 A;  1IJZ A;  3Q1S I;  4I77 Z;  1M49 A;  5IP7 D;  1J7V L;  4NN5 A;  2R93 D;  3N06 A;  4FA8 E;  4NEJ A;  3DGC L;  5C4X D;  2JA5 D;  5IP9 D;  3DUH C;  3NCC A;  4A3L D;  1Y6N L;  2CYK A;  4YPG C;  4ZF7 A;  5D22 A;  3HMX B;  3VA2 A;  4ZS7 A;  5FHX A;  2LMS A;  3TGX B;  2B91 A;  1EVS A;  1ALU A;  1BGE A;  1RFB A;  5KNH I;  1WU3 I;  2O26 A;  3MZG A;  2IL6 A;  2E9W C;  1FYH A;  4NI7 A;  3I4N D;  4A93 D;  5D70 A;  3PO2 D;  4A3D D;  1Y6M L;  3OQ3 A;  2Q7N B;  3HOU D;  4EXN A;  4A3E D;  1VLK A;  1IAR A;  3BPL A;  4CNI C;  2INT A;  4O6K A;  1HUW A;  1HZI A;  1FG9 A;  1I1R B;  1M47 A;  5FLM D;  3HOW D;  1CNT 1;  1Y14 A;  1AXI A;  1IRL A;  2L3O A;  1HWG A;  3HOV D;  1RCB A;  1M4A A;  1LK3 A;  2B90 A;  1LQS L;  2Z3Q A;  3EJJ A;  4DOH A;  5L6Y C;  3BPO A;  1SCF A;  1Z7C A;  2L3Y A;  3INK C;  4O9H A;  1N1F A;  1HGU A;  2B8X A;  3IRH A;  4PS4 A;  5C7X A;  4GS7 A;  2JA7 D;  3I4M D;  1IL6 A;  1RW5 A;  4DKE A;  3UX9 A;  2Z3R A;  2R92 D;  4BY7 D;  1M4R A;  1PGR A;  3PIW A;  3L5W I;  3HHR A;  1CD9 A;  1EKU A;  3D48 P;  3AYH A;  3L5X A;  4BXX D;  2ERJ D;  1JLI A;  4RS1 A;  4YDY I;  3G6D A;  2C35 A;  4A3F D;  4DKF A;  2OQP A;  1ITM A;  3DI3 A;  3LB6 A;  1F6F A;  4J4L C;  1ITF A;  1BCN A;  3NCF A;  1Y6K L;  2O6I A;  1ITL A;  1BP3 A;  4NEM A;  4DKD A;  2Q14 A;  1V7N V;  3N0P A;  3NPZ A;  1ILK A;  2GMF A;  2JA6 D;  1P9M B;  3D87 A;  4GRW A;  5D72 A;  5FUC A;  1ITI A;  1M4C A;  3LB6 B;  3BPN A;  1GA3 A;  1D9C A;  1HWH A;  4YUE C;  3OG6 A;  1A7M A;  3HOX D;  4WRL B;  3B5K A;  3PIV A;  1AX8 A;  1ETE A;  3DI2 A;  4LRL A;  1LKI A;  4A3C D;  1INR A;  1BGC A;  1Z92 A;  4A3I D;  1GNC A;  1V7M V;  1EXZ A;  1CSG A;  2KZ1 A;  2ILK A;  3NCB A;  4NN6 A;  2B8U A;  2B8Y A;  4NN7 A;  5TS9 A;  4NKQ C;  4YQX A;  3UF2 A;  4NI9 A;  1NBP A;  4BBR D;  1PW6 A;  5IYD D;  1EER A;  2LAG A;  4A3M D;  3H0G D;  1HIJ A;  5IYC D;  2R7Z D;  1AU1 A;  3S9D A;  4A3J D;  4A3G D;  2B5I A;  5IYB D;  1KF9 A;  4A3K D;  3UF5 A;  2B63 D;  2O27 A;  1A22 A;  2D9Q A;  4Z5R D;  5C3E D;  2VUM D;  1CYL A;  3OG4 A;  3HHC A;  3QAZ A;  2Q98 A;  3D85 C;  1Y1V D;  3DLQ I;  2PSM A;  1BGD A;  2B8Z A;  3QB7 A;  3HOZ D;  4A3B D;  1PVH B;  1QVN A;  2XQB A;  3QB1 A;  4MHL A;  5C44 D;  5E4E A;  2D48 A;  5LQB A;  1CN4 C;  3EW3 A;  2JA8 D;  3BES L;  3QWR B;  1BUY A;  3QT2 C;  3G9V B;  4EXP A;  3FKI D;  4BY1 D;  1D9G A;  3H3V E;  1M4B A;  5D71 A;  3PO3 D;  3UEZ E;  5D28 B;  3WCY I;  1IK0 A;  4X51 A;  3HOY D;  1F45 B;  1Y1W D;  1B5L A;  3NCE A;  1HIK A;  1HUL A;  1YKB A;  2HYM B;  1PY2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...