1WU5A

Crystal structure of reducing-end-xylose releasing exo-oligoxylanase complexed with xylose
Total Genus 152
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
152
sequence length
376
structure length
376
Chain Sequence
EGAFYTREYRNLFKEFGYSEAEIQERVKDTWEQLFGDNPETKIYYEVGDDLGYLLDTGNLDVRTEGMSYGMMMAVQMDRKDIFDRIWNWTMKNMYMTEGVHAGYFAWSCQPDGTKNSWGPAPDGEEYFALALFFASHRWGDGDEQPFNYSEQARKLLHTCVHNGEGGPGHPMWNRDNKLIKFIPEVEFSDPSYHLPHFYELFSLWANEEDRVFWKEAAEASREYLKIACHPETGLAPEYAYYDGTPNDEKGYGHFFSDSYRVAANIGLDAEWFGGSEWSAEEINKIQAFFADKEPEDYRRYKIDGEPFEEKSLHPVGLIATNAMGSLASVDGPYAKANVDLFWNTPVRTGNRRYYDNCLYLFAMLALSGNFKIWFP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords xylanase Y
publication title Structural Basis for the Specificity of the Reducing End Xylose-releasing Exo-oligoxylanase from Bacillus halodurans C-125
pubmed doi rcsb
source organism Bacillus halodurans
molecule tags Hydrolase
total genus 152
structure length 376
sequence length 376
ec nomenclature ec 3.2.1.156: Oligosaccharide reducing-end xylanase.
pdb deposition date 2004-12-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01270 Glyco_hydro_8 Glycosyl hydrolases family 8
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.50.10.10 Mainly Alpha Alpha/alpha barrel Glycosyltransferase Glycosyltransferase 1wu5A01
2FUZA 1V5DA 1CLCA 1XWQA 3WIRA 1F9OA 3ANIA 4AYOA 3QFZA 1NXCA 5DGRA 3ANJA 1DOGA 1UT9A 2VN4A 3GZKA 4WU0A 3QRYA 3RENA 1CEMA 3RX7A 4TXTA 1KKTA 5KKBA 2ZBLA 1LF6A 1DL2A 2RI8A 3QG0A 2RGKA 3PMMA 3RRSA 3TF4A 2ZZRA 3W7SA 2D5JA 1FMIA 2VN7A 5M7IA 1G6IA 3D3IA 3QXFA 1FO2A 2EAEA 3W5NA 4L0GA 1KSDA 3ON6A 4Z4LA 5CD2A 1GA2A 3S4DA 1KRFA 1F9DA 3WKIA 1FO3A 1GLMA 5GW7A 4J5TA 1WU5A 2DRQA 1IA7A 2XFGA 3ANKA 3S4AA 4ZG8A 2AFAA 4EL8A 1HCUA 3H7LA 2AHFA 4FUSA 1AYXA 3W7UA 4TF4A 4ZH5A 4Z4JA 1WU6A 3QT9A 3WUXA 5CZLA 2FV1A 1KWFA 3QXQA 3W7WA 1V7WA 1X9DA 2JF4A 3EZ8A 4AYPA 1L2AA 3S4CA 3K11A 1KSCA 4KTRA 1JS4A 1V7VA 4AYQA 1XW2A 3WKFA 4CJ0A 1V5CA 3WKHA 2A8ZA 1RQ5A 3RX8A 1FAEA 2P0VA 3H3KA 2CQSA 1L1YA 3WC3A 1KFGA 3QFYA 3S4BA 1G9GA 3P2CA 2YIKA 3WKGA 4DODA 1TF4A 1IS9A 3E73A 3WIWA 3T33A 5MEHA 2B4FA 1GAIA 4JJJA 1IA6A 2NVPA 3RX5A 4CJ1A 2GZ6A 4L6XA 2DROA 2Z07A 3A3VA 1KS8A 1FCEA 2DRRA 5CA3A 1G87A 4DOEA 2JJBA 4WVAA 4WVCA 1H14A 1LF9A 3QWTA 4CE7A 4KTPA 3RSYA 1XWTA 1WZZA 2FBAA 3EQAA 1V7XA 5E2JA 2EABA 3VXDA 3GT5A 1GAHA 3W7TA 2CQTA 1AGMA 3QT3A 3E6UA 2EACA 1WU4A 5DGQA 3ACTA 4XUVA 2OKXA 1UG9A 1VD5A 1FP3A 3QPFA 1NC5A 2FV0A 3W7XA 3QDEA 1H12A 2F6DA 3AFJA 3CIHA 4WVBA 3VW5A 2RI9A 4AYRA 5GY3A 2JG0A 2QNOA 3ACSA 3WIQA 1FBWA 1G9JA 1H54A 4Q88A 1H13A 2AHGA 3H2WA 3W5MA 2DRSA 2GH4A 2WYNA 1ULVA 3GLYA 1KREA 1FBOA 4Q2BA 1K72A 2EADA 2D8LA 3QSPA 3X17A 5M7YA
chains in the Genus database with same CATH superfamily
1TNOB 2FUZA 4OJZA 1RWGA 1F9OA 1F1SA 1RWFA 3ANJA 2BEDB 1TN7B 2ZBLA 1DL2A 2ZZRA 3VSNA 5M7IA 3M7LA 3SDTA 4OK2A 2ONHA 3W5NA 1O1RB 2XQWA 3M7CA 3ON6A 4Z4LA 4LIXA 1GA2A 3KSQB 2BB5A 1O1SB 3PYBA 1IA7A 2BRVX 3H7LA 1AYXA 1HV6A 3KLSA 5DHIA 3W7UA 3P5PA 4ZH5A 3Q7FB 3M76A 3W7WA 1X9DA 1H39A 1L2AA 4EHMB 1KSCA 4GTRB 4GTPB 1RW9A 4AYQA 1XW2A 3WKFA 4MMHA 4CJ0A 1V5CA 1RQ5A 3RX8A 5ILZA 1LD7B 1GSZA 3QFYA 1HN0A 3C72B 3S4BA 3P2CA 3KSLB 1OJPA 2WIIB 1LXMA 1HXGA 3PZ4B 1IS9A 3E73A 1RWCA 3E30B 3T33A 3SDQA 2BRWA 4GL3A 5JMFA 1F9GA 3SQCA 4CJ1A 2GZ6A 4MU9A 2DROA 4V1SA 4F13A 1KS8A 5CA3A 4DOEA 2XWBB 1OJNA 3E80A 4CE7A 3RSYA 3EQAA 3PZ2B 2H6HB 1WU4A 3E33B 5DGQA 3PZ3B 1MZCB 4XUVA 5GZKA 1FP3A 1CB8A 3D5RA 1NC5A 1N94B 3AFJA 1N4RB 2BRPA 2V8IA 4AYRA 5ILYA 4D4CA 1N23A 2E22A 1TNYB 4GTVB 3M02A 2ONGA 3M74A 3H2WA 1ULVA 1QSJA 1N7NA 1K72A 4NEIA 4ZRPA 3X17A 5M7YA 4AYOA 3DRAB 4FJQA 1N7RA 3QFZA 1HX9A 5DGRA 5IK6A 1HXAA 1N1ZA 3NNBA 3QRYA 1HMWA 5DHKA 3RX7A 5KKBA 1LF6A 4KKIA 1S63B 1HZFA 3QG0A 2RGKA 2D5JA 1C3DA 1FMIA 2BB6A 3E34B 1OJOA 1HXCA 3QXFA 1FO2A 3N0GA 2EAEA 2SQCA 3A0OA 1N22A 3WKIA 3SDVA 1FO3A 1N1BA 2H6GB 2I07B 1GHQA 3ANKA 3S4AA 4ZG8A 4FXGB 5FOBB 4TF4A 1D8DB 3OXUA 1WU6A 3QT9A 3WUXA 2GOXA 4GTOB 2FUTA 1NI1B 3S4CA 1GXMA 1H36A 1H3BA 5IKHA 1O79A 4OZWA 4KTRA 1V7VA 3RJ3A 3E7JA 2A8ZA 5IL8A 3WC3A 1KFGA 1LD8B 4D4DA 3WIWA 3E32B 3Q79B 4MBGB 1TNBB 4BOKA 1N95B 3DSXB 1KZOB 4FNVA 1G87A 4WVAA 1H14A 4ZH1A 3DSWB 3SDRA 2WY8A 1LF9A 1FPPB 1H35A 5ILDA 3Q75B 3GT5A 2ZISB 3SDUA 4GTMB 1JCSB 2CQTA 1AGMA 1J0NA 2R2LB 2PN5A 3HXDB 3E37B 1OJMA 2OKXA 1O6QA 1N7OA 3W7XA 5ILJA 1HM3A 5ILKA 3DPYB 5GY3A 2QNOA 5ILIA 3HXBB 3WIQA 1X81B 1S64B 4Q88A 2H6FB 3W5MA 2GH4A 3GLYA 2Q1FA 2D8LA 3RRSA 1X1HA 1D8EB 3WIRA 3AFLA 3LZ9A 1CLCA 1XWQA 3ANIA 1N4PB 1DOGA 2VN4A 4WU0A 1QQFA 3RENA 3M7EA 4TXTA 1KKTA 2V3NA 2RI8A 3W7SA 1GXNA 1EGUA 4FXKB 2J5CA 3D3IA 4LNVA 3G4FA 1N4SB 1N20A 5CD2A 1KRFA 1F9DA 1GLMA 4J5TA 1WU5A 2B39A 3N0FA 2XFGA 5IK0A 4EL8A 4LNBB 4RNQA 1HCUA 1QAZA 4FUSA 4D4BA 1SA4B 1UMPA 4Z4JA 1H3CA 1TN6B 3SFYB 5CZLA 2ZIRB 2NOJA 4D94A 1C82A 2WINB 1SQCA 3EZ8A 4AYPA 3EUVB 1LXKA 1JS4A 1N24A 3OEDA 3M77A 3KQ4A 1HM2A 4V1RA 1QBQB 1RWAA 3WKHA 2F0YB 1FAEA 2P0VA 3H3KA 3PZ1B 4MMIA 2WY7A 1G9GA 1W6JA 2V3PA 3HXEB 1O6RA 2B4FA 2FUQA 4JJJA 3VSMA 3M71A 3DSTB 1X1IA 1W3YA 3NFVA 2DRRA 2JJBA 3G6JB 4WVCA 4QT9A 3M73A 3QWTA 1N4QB 4KTPA 1XWTA 2EABA 2G02A 3VXDA 4OK4A 3Q73B 3DSUB 5IK9A 5ILHA 2EACA 5IL3A 4ONTA 1O6HA 3ACTA 1SA5B 3QDEA 1H12A 2F6DA 3CIHA 3DSSB 2RI9A 4YDOB 3ACSA 5EAUA 1FBWA 1G9JA 1N21A 1H13A 2AHGA 2DRSA 2WYNA 2IEJB 1KREA 1FBOA 2EADA 1H37A 3QSPA 3K7XA 1V5DA 4ZRQA 5C05A 1JCQB 5FO8B 5AGDA 1NXCA 1UT9A 3GZKA 1O5MB 1CEMA 4YDEB 2BBCA 3PMMA 3TF4A 3Q78B 2A73B 2VN7A 1G6IA 1W6KA 2H6IB 4L0GA 2G0DA 1KSDA 1FT1B 4M76A 2XWJB 5FO7B 3S4DA 1KZPB 1LOHA 5GW7A 3M75A 2DRQA 2X03A 1O1TB 2AFAA 3M7BA 3SAEA 1NL4B 5FO9B 2AHFA 3PYAA 3M72A 2FV1A 1KWFA 4E1YA 3QXQA 1TNUB 1V7WA 3SFXB 2JF4A 4GAXA 5JPMB 3K11A 1GXOA 3HXCB 4OZVA 3Q7AB 4DI5A 1DCEB 4D4AA 1N7QA 2V8KA 3P5RA 1FT2B 5IKAA 5JMDA 1H3AA 1L1YA 2CQSA 2V8JA 2PMVA 3HXFB 4LNGB 3WKGA 4DODA 2YIKA 3CU7A 4GTQB 1TF4A 4BOJA 2WDAA 5EATA 5MEHA 1GAIA 1IA6A 2NVPA 1TN8B 1N7PA 3RX5A 5JPNB 4L6XA 2Z07A 3A3VA 3G4DA 1FCEA 4L9PB 3M00A 1JCRB 4KKJA 1J0MA 5IM1A 3M01A 1TNZB 1WZZA 2FBAA 1V7XA 5E2JA 1GAHA 3W7TA 4C1SA 1X1JA 3QT3A 4YCRA 3E6UA 3S9VA 3DSVB 1UG9A 1VD5A 3M78A 3QPFA 1N9AB 3EU5B 4GTTB 2FV0A 1I8QA 2E24A 4WVBA 3VW5A 3D5SA 2WCOA 2JG0A 1HMUA 1LTXB 1R76A 4F10A 4GTSB 1H54A 1RWHA 4Q2BA 5EASA 3EU8A
chains in the Genus database with same CATH topology
1TNOB 2FUZA 1F9OA 3ANJA 2BEDB 1TN7B 2ZBLA 1DL2A 2ZZRA 5M7IA 3M7LA 3SDTA 3W5NA 1O1RB 2XQWA 3M7CA 3ON6A 4Z4LA 4LIXA 1GA2A 3KSQB 2BB5A 1O1SB 3PYBA 1IA7A 3H7LA 1AYXA 3KLSA 3W7UA 3P5PA 4ZH5A 3Q7FB 3M76A 3W7WA 1X9DA 1H39A 1L2AA 4EHMB 1KSCA 4GTRB 4GTPB 4AYQA 1XW2A 3WKFA 4CJ0A 1V5CA 1RQ5A 3RX8A 1LD7B 1GSZA 3QFYA 3C72B 3S4BA 3P2CA 3KSLB 2WIIB 3PZ4B 1IS9A 3E73A 3E30B 3T33A 3SDQA 4GL3A 3SQCA 4CJ1A 2GZ6A 4MU9A 2DROA 4V1SA 1KS8A 5CA3A 4DOEA 2XWBB 4CE7A 3RSYA 3EQAA 3PZ2B 2H6HB 1WU4A 3E33B 5DGQA 3PZ3B 1MZCB 4XUVA 5GZKA 1FP3A 3D5RA 1NC5A 1N94B 3AFJA 1N4RB 2V8IA 4AYRA 4D4CA 1TNYB 4GTVB 3M74A 3H2WA 1ULVA 1QSJA 1K72A 4ZRPA 3X17A 5M7YA 4AYOA 3DRAB 3QFZA 5DGRA 3QRYA 3RX7A 5KKBA 1LF6A 4KKIA 1S63B 1HZFA 3QG0A 2RGKA 2D5JA 1C3DA 1FMIA 2BB6A 3E34B 3QXFA 1FO2A 2EAEA 2SQCA 3WKIA 3SDVA 1FO3A 2H6GB 2I07B 1GHQA 3ANKA 3S4AA 4ZG8A 4FXGB 5FOBB 4TF4A 1D8DB 3OXUA 1WU6A 3QT9A 3WUXA 2GOXA 4GTOB 1NI1B 3S4CA 1GXMA 1H36A 1H3BA 1O79A 4KTRA 1V7VA 3RJ3A 2A8ZA 3WC3A 1KFGA 1LD8B 4D4DA 3WIWA 3E32B 3Q79B 4MBGB 1TNBB 4BOKA 1N95B 3DSXB 1KZOB 1G87A 4WVAA 1H14A 4ZH1A 3DSWB 3SDRA 2WY8A 1LF9A 1FPPB 1H35A 3Q75B 3GT5A 2ZISB 3SDUA 4GTMB 1JCSB 2CQTA 1AGMA 2R2LB 2PN5A 3HXDB 3E37B 2OKXA 1O6QA 3W7XA 3DPYB 5GY3A 2QNOA 3HXBB 3WIQA 1X81B 1S64B 4Q88A 2H6FB 3W5MA 2GH4A 3GLYA 2D8LA 3RRSA 1D8EB 3WIRA 1CLCA 1XWQA 3ANIA 1N4PB 1DOGA 2VN4A 4WU0A 1QQFA 3RENA 3M7EA 4TXTA 1KKTA 2V3NA 2RI8A 3W7SA 1GXNA 4FXKB 3D3IA 4LNVA 1N4SB 5CD2A 1KRFA 1F9DA 1GLMA 4J5TA 1WU5A 2B39A 2XFGA 4EL8A 4LNBB 1HCUA 4FUSA 4D4BA 1SA4B 1UMPA 4Z4JA 1H3CA 1TN6B 3SFYB 5CZLA 2ZIRB 2NOJA 4D94A 2WINB 1SQCA 3EZ8A 4AYPA 3EUVB 1JS4A 3OEDA 3M77A 3KQ4A 4V1RA 1QBQB 3WKHA 2F0YB 1FAEA 2P0VA 3H3KA 3PZ1B 2WY7A 1G9GA 1W6JA 2V3PA 3HXEB 1O6RA 2B4FA 4JJJA 3M71A 3DSTB 2DRRA 2JJBA 3G6JB 4WVCA 4QT9A 3M73A 3QWTA 1N4QB 4KTPA 1XWTA 2EABA 2G02A 3VXDA 3Q73B 3DSUB 2EACA 4ONTA 1O6HA 3ACTA 1SA5B 3QDEA 1H12A 2F6DA 3CIHA 3DSSB 2RI9A 4YDOB 3ACSA 1FBWA 1G9JA 1H13A 2AHGA 2DRSA 2WYNA 2IEJB 1KREA 1FBOA 2EADA 1H37A 3QSPA 3K7XA 1V5DA 4ZRQA 1JCQB 5FO8B 5AGDA 1NXCA 1UT9A 3GZKA 1O5MB 1CEMA 4YDEB 2BBCA 3PMMA 3TF4A 3Q78B 2A73B 2VN7A 1G6IA 1W6KA 2H6IB 4L0GA 2G0DA 1KSDA 1FT1B 4M76A 2XWJB 5FO7B 3S4DA 1KZPB 5GW7A 3M75A 2DRQA 1O1TB 2AFAA 3M7BA 3SAEA 1NL4B 5FO9B 2AHFA 3PYAA 3M72A 2FV1A 1KWFA 3QXQA 1TNUB 1V7WA 3SFXB 2JF4A 5JPMB 3K11A 1GXOA 3HXCB 3Q7AB 1DCEB 4D4AA 2V8KA 3P5RA 1FT2B 1H3AA 1L1YA 2CQSA 2V8JA 2PMVA 3HXFB 4LNGB 3WKGA 4DODA 2YIKA 3CU7A 4GTQB 1TF4A 4BOJA 5MEHA 1GAIA 1IA6A 2NVPA 1TN8B 3RX5A 5JPNB 4L6XA 2Z07A 3A3VA 1FCEA 4L9PB 1JCRB 4KKJA 1TNZB 1WZZA 2FBAA 1V7XA 5E2JA 1GAHA 3W7TA 4C1SA 3QT3A 4YCRA 3E6UA 3S9VA 3DSVB 1UG9A 1VD5A 3M78A 3QPFA 1N9AB 3EU5B 4GTTB 2FV0A 4WVBA 3VW5A 3D5SA 2JG0A 1LTXB 1R76A 4GTSB 1H54A 4Q2BA 3EU8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FUZ A;  1V5D A;  1CLC A;  1XWQ A;  3WIR A;  1F9O A;  3ANI A;  4AYO A;  3QFZ A;  1NXC A;  5DGR A;  3ANJ A;  1DOG A;  1UT9 A;  2VN4 A;  3GZK A;  4WU0 A;  3QRY A;  3REN A;  1CEM A;  3RX7 A;  4TXT A;  1KKT A;  5KKB A;  2ZBL A;  1LF6 A;  1DL2 A;  2RI8 A;  3QG0 A;  2RGK A;  3PMM A;  3RRS A;  3TF4 A;  2ZZR A;  3W7S A;  2D5J A;  1FMI A;  2VN7 A;  5M7I A;  1G6I A;  3D3I A;  3QXF A;  1FO2 A;  2EAE A;  3W5N A;  4L0G A;  1KSD A;  3ON6 A;  4Z4L A;  5CD2 A;  1GA2 A;  3S4D A;  1KRF A;  1F9D A;  3WKI A;  1FO3 A;  1GLM A;  5GW7 A;  4J5T A;  1WU5 A;  2DRQ A;  1IA7 A;  2XFG A;  3ANK A;  3S4A A;  4ZG8 A;  2AFA A;  4EL8 A;  1HCU A;  3H7L A;  2AHF A;  4FUS A;  1AYX A;  3W7U A;  4TF4 A;  4ZH5 A;  4Z4J A;  1WU6 A;  3QT9 A;  3WUX A;  5CZL A;  2FV1 A;  1KWF A;  3QXQ A;  3W7W A;  1V7W A;  1X9D A;  2JF4 A;  3EZ8 A;  4AYP A;  1L2A A;  3S4C A;  3K11 A;  1KSC A;  4KTR A;  1JS4 A;  1V7V A;  4AYQ A;  1XW2 A;  3WKF A;  4CJ0 A;  1V5C A;  3WKH A;  2A8Z A;  1RQ5 A;  3RX8 A;  1FAE A;  2P0V A;  3H3K A;  2CQS A;  1L1Y A;  3WC3 A;  1KFG A;  3QFY A;  3S4B A;  1G9G A;  3P2C A;  2YIK A;  3WKG A;  4DOD A;  1TF4 A;  1IS9 A;  3E73 A;  3WIW A;  3T33 A;  5MEH A;  2B4F A;  1GAI A;  4JJJ A;  1IA6 A;  2NVP A;  3RX5 A;  4CJ1 A;  2GZ6 A;  4L6X A;  2DRO A;  2Z07 A;  3A3V A;  1KS8 A;  1FCE A;  2DRR A;  5CA3 A;  1G87 A;  4DOE A;  2JJB A;  4WVA A;  4WVC A;  1H14 A;  1LF9 A;  3QWT A;  4CE7 A;  4KTP A;  3RSY A;  1XWT A;  1WZZ A;  2FBA A;  3EQA A;  1V7X A;  5E2J A;  2EAB A;  3VXD A;  3GT5 A;  1GAH A;  3W7T A;  2CQT A;  1AGM A;  3QT3 A;  3E6U A;  2EAC A;  1WU4 A;  5DGQ A;  3ACT A;  4XUV A;  2OKX A;  1UG9 A;  1VD5 A;  1FP3 A;  3QPF A;  1NC5 A;  2FV0 A;  3W7X A;  3QDE A;  1H12 A;  2F6D A;  3AFJ A;  3CIH A;  4WVB A;  3VW5 A;  2RI9 A;  4AYR A;  5GY3 A;  2JG0 A;  2QNO A;  3ACS A;  3WIQ A;  1FBW A;  1G9J A;  1H54 A;  4Q88 A;  1H13 A;  2AHG A;  3H2W A;  3W5M A;  2DRS A;  2GH4 A;  2WYN A;  1ULV A;  3GLY A;  1KRE A;  1FBO A;  4Q2B A;  1K72 A;  2EAD A;  2D8L A;  3QSP A;  3X17 A;  5M7Y A; 
#chains in the Genus database with same CATH topology
 1TNO B;  2FUZ A;  4OJZ A;  1RWG A;  1F9O A;  1F1S A;  1RWF A;  3ANJ A;  2BED B;  1TN7 B;  2ZBL A;  1DL2 A;  2ZZR A;  3VSN A;  5M7I A;  3M7L A;  3SDT A;  4OK2 A;  2ONH A;  3W5N A;  1O1R B;  2XQW A;  3M7C A;  3ON6 A;  4Z4L A;  4LIX A;  1GA2 A;  3KSQ B;  2BB5 A;  1O1S B;  3PYB A;  1IA7 A;  2BRV X;  3H7L A;  1AYX A;  1HV6 A;  3KLS A;  5DHI A;  3W7U A;  3P5P A;  4ZH5 A;  3Q7F B;  3M76 A;  3W7W A;  1X9D A;  1H39 A;  1L2A A;  4EHM B;  1KSC A;  4GTR B;  4GTP B;  1RW9 A;  4AYQ A;  1XW2 A;  3WKF A;  4MMH A;  4CJ0 A;  1V5C A;  1RQ5 A;  3RX8 A;  5ILZ A;  1LD7 B;  1GSZ A;  3QFY A;  1HN0 A;  3C72 B;  3S4B A;  3P2C A;  3KSL B;  1OJP A;  2WII B;  1LXM A;  1HXG A;  3PZ4 B;  1IS9 A;  3E73 A;  1RWC A;  3E30 B;  3T33 A;  3SDQ A;  2BRW A;  4GL3 A;  5JMF A;  1F9G A;  3SQC A;  4CJ1 A;  2GZ6 A;  4MU9 A;  2DRO A;  4V1S A;  4F13 A;  1KS8 A;  5CA3 A;  4DOE A;  2XWB B;  1OJN A;  3E80 A;  4CE7 A;  3RSY A;  3EQA A;  3PZ2 B;  2H6H B;  1WU4 A;  3E33 B;  5DGQ A;  3PZ3 B;  1MZC B;  4XUV A;  5GZK A;  1FP3 A;  1CB8 A;  3D5R A;  1NC5 A;  1N94 B;  3AFJ A;  1N4R B;  2BRP A;  2V8I A;  4AYR A;  5ILY A;  4D4C A;  1N23 A;  2E22 A;  1TNY B;  4GTV B;  3M02 A;  2ONG A;  3M74 A;  3H2W A;  1ULV A;  1QSJ A;  1N7N A;  1K72 A;  4NEI A;  4ZRP A;  3X17 A;  5M7Y A;  4AYO A;  3DRA B;  4FJQ A;  1N7R A;  3QFZ A;  1HX9 A;  5DGR A;  5IK6 A;  1HXA A;  1N1Z A;  3NNB A;  3QRY A;  1HMW A;  5DHK A;  3RX7 A;  5KKB A;  1LF6 A;  4KKI A;  1S63 B;  1HZF A;  3QG0 A;  2RGK A;  2D5J A;  1C3D A;  1FMI A;  2BB6 A;  3E34 B;  1OJO A;  1HXC A;  3QXF A;  1FO2 A;  3N0G A;  2EAE A;  2SQC A;  3A0O A;  1N22 A;  3WKI A;  3SDV A;  1FO3 A;  1N1B A;  2H6G B;  2I07 B;  1GHQ A;  3ANK A;  3S4A A;  4ZG8 A;  4FXG B;  5FOB B;  4TF4 A;  1D8D B;  3OXU A;  1WU6 A;  3QT9 A;  3WUX A;  2GOX A;  4GTO B;  2FUT A;  1NI1 B;  3S4C A;  1GXM A;  1H36 A;  1H3B A;  5IKH A;  1O79 A;  4OZW A;  4KTR A;  1V7V A;  3RJ3 A;  3E7J A;  2A8Z A;  5IL8 A;  3WC3 A;  1KFG A;  1LD8 B;  4D4D A;  3WIW A;  3E32 B;  3Q79 B;  4MBG B;  1TNB B;  4BOK A;  1N95 B;  3DSX B;  1KZO B;  4FNV A;  1G87 A;  4WVA A;  1H14 A;  4ZH1 A;  3DSW B;  3SDR A;  2WY8 A;  1LF9 A;  1FPP B;  1H35 A;  5ILD A;  3Q75 B;  3GT5 A;  2ZIS B;  3SDU A;  4GTM B;  1JCS B;  2CQT A;  1AGM A;  1J0N A;  2R2L B;  2PN5 A;  3HXD B;  3E37 B;  1OJM A;  2OKX A;  1O6Q A;  1N7O A;  3W7X A;  5ILJ A;  1HM3 A;  5ILK A;  3DPY B;  5GY3 A;  2QNO A;  5ILI A;  3HXB B;  3WIQ A;  1X81 B;  1S64 B;  4Q88 A;  2H6F B;  3W5M A;  2GH4 A;  3GLY A;  2Q1F A;  2D8L A;  3RRS A;  1X1H A;  1D8E B;  3WIR A;  3AFL A;  3LZ9 A;  1CLC A;  1XWQ A;  3ANI A;  1N4P B;  1DOG A;  2VN4 A;  4WU0 A;  1QQF A;  3REN A;  3M7E A;  4TXT A;  1KKT A;  2V3N A;  2RI8 A;  3W7S A;  1GXN A;  1EGU A;  4FXK B;  2J5C A;  3D3I A;  4LNV A;  3G4F A;  1N4S B;  1N20 A;  5CD2 A;  1KRF A;  1F9D A;  1GLM A;  4J5T A;  1WU5 A;  2B39 A;  3N0F A;  2XFG A;  5IK0 A;  4EL8 A;  4LNB B;  4RNQ A;  1HCU A;  1QAZ A;  4FUS A;  4D4B A;  1SA4 B;  1UMP A;  4Z4J A;  1H3C A;  1TN6 B;  3SFY B;  5CZL A;  2ZIR B;  2NOJ A;  4D94 A;  1C82 A;  2WIN B;  1SQC A;  3EZ8 A;  4AYP A;  3EUV B;  1LXK A;  1JS4 A;  1N24 A;  3OED A;  3M77 A;  3KQ4 A;  1HM2 A;  4V1R A;  1QBQ B;  1RWA A;  3WKH A;  2F0Y B;  1FAE A;  2P0V A;  3H3K A;  3PZ1 B;  4MMI A;  2WY7 A;  1G9G A;  1W6J A;  2V3P A;  3HXE B;  1O6R A;  2B4F A;  2FUQ A;  4JJJ A;  3VSM A;  3M71 A;  3DST B;  1X1I A;  1W3Y A;  3NFV A;  2DRR A;  2JJB A;  3G6J B;  4WVC A;  4QT9 A;  3M73 A;  3QWT A;  1N4Q B;  4KTP A;  1XWT A;  2EAB A;  2G02 A;  3VXD A;  4OK4 A;  3Q73 B;  3DSU B;  5IK9 A;  5ILH A;  2EAC A;  5IL3 A;  4ONT A;  1O6H A;  3ACT A;  1SA5 B;  3QDE A;  1H12 A;  2F6D A;  3CIH A;  3DSS B;  2RI9 A;  4YDO B;  3ACS A;  5EAU A;  1FBW A;  1G9J A;  1N21 A;  1H13 A;  2AHG A;  2DRS A;  2WYN A;  2IEJ B;  1KRE A;  1FBO A;  2EAD A;  1H37 A;  3QSP A;  3K7X A;  1V5D A;  4ZRQ A;  5C05 A;  1JCQ B;  5FO8 B;  5AGD A;  1NXC A;  1UT9 A;  3GZK A;  1O5M B;  1CEM A;  4YDE B;  2BBC A;  3PMM A;  3TF4 A;  3Q78 B;  2A73 B;  2VN7 A;  1G6I A;  1W6K A;  2H6I B;  4L0G A;  2G0D A;  1KSD A;  1FT1 B;  4M76 A;  2XWJ B;  5FO7 B;  3S4D A;  1KZP B;  1LOH A;  5GW7 A;  3M75 A;  2DRQ A;  2X03 A;  1O1T B;  2AFA A;  3M7B A;  3SAE A;  1NL4 B;  5FO9 B;  2AHF A;  3PYA A;  3M72 A;  2FV1 A;  1KWF A;  4E1Y A;  3QXQ A;  1TNU B;  1V7W A;  3SFX B;  2JF4 A;  4GAX A;  5JPM B;  3K11 A;  1GXO A;  3HXC B;  4OZV A;  3Q7A B;  4DI5 A;  1DCE B;  4D4A A;  1N7Q A;  2V8K A;  3P5R A;  1FT2 B;  5IKA A;  5JMD A;  1H3A A;  1L1Y A;  2CQS A;  2V8J A;  2PMV A;  3HXF B;  4LNG B;  3WKG A;  4DOD A;  2YIK A;  3CU7 A;  4GTQ B;  1TF4 A;  4BOJ A;  2WDA A;  5EAT A;  5MEH A;  1GAI A;  1IA6 A;  2NVP A;  1TN8 B;  1N7P A;  3RX5 A;  5JPN B;  4L6X A;  2Z07 A;  3A3V A;  3G4D A;  1FCE A;  4L9P B;  3M00 A;  1JCR B;  4KKJ A;  1J0M A;  5IM1 A;  3M01 A;  1TNZ B;  1WZZ A;  2FBA A;  1V7X A;  5E2J A;  1GAH A;  3W7T A;  4C1S A;  1X1J A;  3QT3 A;  4YCR A;  3E6U A;  3S9V A;  3DSV B;  1UG9 A;  1VD5 A;  3M78 A;  3QPF A;  1N9A B;  3EU5 B;  4GTT B;  2FV0 A;  1I8Q A;  2E24 A;  4WVB A;  3VW5 A;  3D5S A;  2WCO A;  2JG0 A;  1HMU A;  1LTX B;  1R76 A;  4F10 A;  4GTS B;  1H54 A;  1RWH A;  4Q2B A;  5EAS A;  3EU8 A; 
#chains in the Genus database with same CATH homology
 1TNO B;  2FUZ A;  1F9O A;  3ANJ A;  2BED B;  1TN7 B;  2ZBL A;  1DL2 A;  2ZZR A;  5M7I A;  3M7L A;  3SDT A;  3W5N A;  1O1R B;  2XQW A;  3M7C A;  3ON6 A;  4Z4L A;  4LIX A;  1GA2 A;  3KSQ B;  2BB5 A;  1O1S B;  3PYB A;  1IA7 A;  3H7L A;  1AYX A;  3KLS A;  3W7U A;  3P5P A;  4ZH5 A;  3Q7F B;  3M76 A;  3W7W A;  1X9D A;  1H39 A;  1L2A A;  4EHM B;  1KSC A;  4GTR B;  4GTP B;  4AYQ A;  1XW2 A;  3WKF A;  4CJ0 A;  1V5C A;  1RQ5 A;  3RX8 A;  1LD7 B;  1GSZ A;  3QFY A;  3C72 B;  3S4B A;  3P2C A;  3KSL B;  2WII B;  3PZ4 B;  1IS9 A;  3E73 A;  3E30 B;  3T33 A;  3SDQ A;  4GL3 A;  3SQC A;  4CJ1 A;  2GZ6 A;  4MU9 A;  2DRO A;  4V1S A;  1KS8 A;  5CA3 A;  4DOE A;  2XWB B;  4CE7 A;  3RSY A;  3EQA A;  3PZ2 B;  2H6H B;  1WU4 A;  3E33 B;  5DGQ A;  3PZ3 B;  1MZC B;  4XUV A;  5GZK A;  1FP3 A;  3D5R A;  1NC5 A;  1N94 B;  3AFJ A;  1N4R B;  2V8I A;  4AYR A;  4D4C A;  1TNY B;  4GTV B;  3M74 A;  3H2W A;  1ULV A;  1QSJ A;  1K72 A;  4ZRP A;  3X17 A;  5M7Y A;  4AYO A;  3DRA B;  3QFZ A;  5DGR A;  3QRY A;  3RX7 A;  5KKB A;  1LF6 A;  4KKI A;  1S63 B;  1HZF A;  3QG0 A;  2RGK A;  2D5J A;  1C3D A;  1FMI A;  2BB6 A;  3E34 B;  3QXF A;  1FO2 A;  2EAE A;  2SQC A;  3WKI A;  3SDV A;  1FO3 A;  2H6G B;  2I07 B;  1GHQ A;  3ANK A;  3S4A A;  4ZG8 A;  4FXG B;  5FOB B;  4TF4 A;  1D8D B;  3OXU A;  1WU6 A;  3QT9 A;  3WUX A;  2GOX A;  4GTO B;  1NI1 B;  3S4C A;  1GXM A;  1H36 A;  1H3B A;  1O79 A;  4KTR A;  1V7V A;  3RJ3 A;  2A8Z A;  3WC3 A;  1KFG A;  1LD8 B;  4D4D A;  3WIW A;  3E32 B;  3Q79 B;  4MBG B;  1TNB B;  4BOK A;  1N95 B;  3DSX B;  1KZO B;  1G87 A;  4WVA A;  1H14 A;  4ZH1 A;  3DSW B;  3SDR A;  2WY8 A;  1LF9 A;  1FPP B;  1H35 A;  3Q75 B;  3GT5 A;  2ZIS B;  3SDU A;  4GTM B;  1JCS B;  2CQT A;  1AGM A;  2R2L B;  2PN5 A;  3HXD B;  3E37 B;  2OKX A;  1O6Q A;  3W7X A;  3DPY B;  5GY3 A;  2QNO A;  3HXB B;  3WIQ A;  1X81 B;  1S64 B;  4Q88 A;  2H6F B;  3W5M A;  2GH4 A;  3GLY A;  2D8L A;  3RRS A;  1D8E B;  3WIR A;  1CLC A;  1XWQ A;  3ANI A;  1N4P B;  1DOG A;  2VN4 A;  4WU0 A;  1QQF A;  3REN A;  3M7E A;  4TXT A;  1KKT A;  2V3N A;  2RI8 A;  3W7S A;  1GXN A;  4FXK B;  3D3I A;  4LNV A;  1N4S B;  5CD2 A;  1KRF A;  1F9D A;  1GLM A;  4J5T A;  1WU5 A;  2B39 A;  2XFG A;  4EL8 A;  4LNB B;  1HCU A;  4FUS A;  4D4B A;  1SA4 B;  1UMP A;  4Z4J A;  1H3C A;  1TN6 B;  3SFY B;  5CZL A;  2ZIR B;  2NOJ A;  4D94 A;  2WIN B;  1SQC A;  3EZ8 A;  4AYP A;  3EUV B;  1JS4 A;  3OED A;  3M77 A;  3KQ4 A;  4V1R A;  1QBQ B;  3WKH A;  2F0Y B;  1FAE A;  2P0V A;  3H3K A;  3PZ1 B;  2WY7 A;  1G9G A;  1W6J A;  2V3P A;  3HXE B;  1O6R A;  2B4F A;  4JJJ A;  3M71 A;  3DST B;  2DRR A;  2JJB A;  3G6J B;  4WVC A;  4QT9 A;  3M73 A;  3QWT A;  1N4Q B;  4KTP A;  1XWT A;  2EAB A;  2G02 A;  3VXD A;  3Q73 B;  3DSU B;  2EAC A;  4ONT A;  1O6H A;  3ACT A;  1SA5 B;  3QDE A;  1H12 A;  2F6D A;  3CIH A;  3DSS B;  2RI9 A;  4YDO B;  3ACS A;  1FBW A;  1G9J A;  1H13 A;  2AHG A;  2DRS A;  2WYN A;  2IEJ B;  1KRE A;  1FBO A;  2EAD A;  1H37 A;  3QSP A;  3K7X A;  1V5D A;  4ZRQ A;  1JCQ B;  5FO8 B;  5AGD A;  1NXC A;  1UT9 A;  3GZK A;  1O5M B;  1CEM A;  4YDE B;  2BBC A;  3PMM A;  3TF4 A;  3Q78 B;  2A73 B;  2VN7 A;  1G6I A;  1W6K A;  2H6I B;  4L0G A;  2G0D A;  1KSD A;  1FT1 B;  4M76 A;  2XWJ B;  5FO7 B;  3S4D A;  1KZP B;  5GW7 A;  3M75 A;  2DRQ A;  1O1T B;  2AFA A;  3M7B A;  3SAE A;  1NL4 B;  5FO9 B;  2AHF A;  3PYA A;  3M72 A;  2FV1 A;  1KWF A;  3QXQ A;  1TNU B;  1V7W A;  3SFX B;  2JF4 A;  5JPM B;  3K11 A;  1GXO A;  3HXC B;  3Q7A B;  1DCE B;  4D4A A;  2V8K A;  3P5R A;  1FT2 B;  1H3A A;  1L1Y A;  2CQS A;  2V8J A;  2PMV A;  3HXF B;  4LNG B;  3WKG A;  4DOD A;  2YIK A;  3CU7 A;  4GTQ B;  1TF4 A;  4BOJ A;  5MEH A;  1GAI A;  1IA6 A;  2NVP A;  1TN8 B;  3RX5 A;  5JPN B;  4L6X A;  2Z07 A;  3A3V A;  1FCE A;  4L9P B;  1JCR B;  4KKJ A;  1TNZ B;  1WZZ A;  2FBA A;  1V7X A;  5E2J A;  1GAH A;  3W7T A;  4C1S A;  3QT3 A;  4YCR A;  3E6U A;  3S9V A;  3DSV B;  1UG9 A;  1VD5 A;  3M78 A;  3QPF A;  1N9A B;  3EU5 B;  4GTT B;  2FV0 A;  4WVB A;  3VW5 A;  3D5S A;  2JG0 A;  1LTX B;  1R76 A;  4GTS B;  1H54 A;  4Q2B A;  3EU8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...