1WU6A

Crystal structure of reducing-end-xylose releasing exo-oligoxylanase e70a mutant complexed with xylobiose
Total Genus 155
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
155
sequence length
376
structure length
376
Chain Sequence
EGAFYTREYRNLFKEFGYSEAEIQERVKDTWEQLFGDNPETKIYYEVGDDLGYLLDTGNLDVRTAGMSYGMMMAVQMDRKDIFDRIWNWTMKNMYMTEGVHAGYFAWSCQPDGTKNSWGPAPDGEEYFALALFFASHRWGDGDEQPFNYSEQARKLLHTCVHNGEGGPGHPMWNRDNKLIKFIPEVEFSDPSYHLPHFYELFSLWANEEDRVFWKEAAEASREYLKIACHPETGLAPEYAYYDGTPNDEKGYGHFFSDSYRVAANIGLDAEWFGGSEWSAEEINKIQAFFADKEPEDYRRYKIDGEPFEEKSLHPVGLIATNAMGSLASVDGPYAKANVDLFWNTPVRTGNRRYYDNCLYLFAMLALSGNFKIWFP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords xylanase Y
publication title Structural Basis for the Specificity of the Reducing End Xylose-releasing Exo-oligoxylanase from Bacillus halodurans C-125
pubmed doi rcsb
source organism Bacillus halodurans
molecule tags Hydrolase
total genus 155
structure length 376
sequence length 376
ec nomenclature ec 3.2.1.156: Oligosaccharide reducing-end xylanase.
pdb deposition date 2004-12-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01270 Glyco_hydro_8 Glycosyl hydrolases family 8
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.50.10.10 Mainly Alpha Alpha/alpha barrel Glycosyltransferase Glycosyltransferase 1wu6A01
1RQ5A 2CQSA 1FBWA 3ACTA 1K72A 4Q88A 5DGRA 5CD2A 4DODA 1WU6A 4AYRA 4DOEA 3E73A 2ZZRA 1LF6A 2AHFA 2EAEA 2F6DA 3RX8A 3VW5A 2D8LA 4AYQA 3H2WA 3RSYA 1KSDA 1H54A 2DRSA 3H7LA 3D3IA 3GZKA 1V7XA 2FUZA 3K11A 4AYPA 1F9DA 2A8ZA 2EACA 1DOGA 1FP3A 2RI8A 1UT9A 2ZBLA 3QXQA 3QFYA 3QDEA 1FO2A 3H3KA 3PMMA 1IS9A 2FBAA 2WYNA 1CEMA 4TF4A 1VD5A 5MEHA 1L2AA 4TXTA 3WC3A 3S4BA 1FCEA 1IA7A 3WKHA 4FUSA 5E2JA 1KKTA 1HCUA 4WU0A 3ANIA 2DRRA 3AFJA 4WVCA 3W7SA 1G9JA 3EQAA 4ZG8A 4Z4LA 1H14A 1H12A 4XUVA 3W7WA 1H13A 2YIKA 3S4DA 5M7IA 1GLMA 3S4AA 1V7WA 5GW7A 2NVPA 5CA3A 1UG9A 3ON6A 4AYOA 4L0GA 1L1YA 3RX5A 3QWTA 1KS8A 3ANKA 3CIHA 2JF4A 2FV0A 3A3VA 3ACSA 3QPFA 4Q2BA 4CJ1A 3W7TA 1FAEA 3S4CA 1TF4A 1WZZA 2B4FA 1KWFA 3WUXA 3GLYA 1NXCA 1KRFA 4EL8A 1KFGA 3P2CA 1X9DA 5DGQA 1FBOA 2FV1A 1ULVA 2GZ6A 1F9OA 4KTPA 3TF4A 1V5DA 4KTRA 3WIQA 2VN7A 3QT3A 3QFZA 4CE7A 5CZLA 1GAIA 1AGMA 5M7YA 1KSCA 4WVBA 1G87A 1DL2A 1FMIA 1WU5A 2D5JA 3WIRA 3ANJA 5GY3A 1XWTA 3QG0A 1G6IA 4WVAA 2QNOA 2VN4A 1NC5A 1AYXA 3WKFA 1IA6A 2CQTA 3T33A 3QRYA 1G9GA 4L6XA 4ZH5A 2DRQA 3VXDA 3X17A 5KKBA 4J5TA 3RX7A 2GH4A 2JG0A 2RI9A 3GT5A 3WKGA 1CLCA 3RRSA 2JJBA 2DROA 2XFGA 1GAHA 2P0VA 3W5NA 3RENA 1WU4A 3EZ8A 3QXFA 3WKIA 2Z07A 4CJ0A 3W7XA 2RGKA 2EABA 2AHGA 1V5CA 3E6UA 3QT9A 1GA2A 1XW2A 4JJJA 2EADA 3WIWA 1JS4A 1LF9A 2AFAA 3W5MA 1KREA 1XWQA 1FO3A 3QSPA 2OKXA 4Z4JA 3W7UA 1V7VA
chains in the Genus database with same CATH superfamily
1HV6A 1K72A 5FO7B 1F1SA 4DOEA 3HXFB 2ZZRA 4MMHA 3SFXB 4GTSB 4C1SA 4GTQB 1LD8B 1H54A 2IEJB 2FUZA 4EHMB 1TN7B 5JPMB 2A8ZA 1N4PB 1DOGA 1TNUB 1TNYB 5IKHA 1FP3A 1D8DB 1UT9A 2FUQA 2ZBLA 1N20A 1X1HA 1HMUA 4BOKA 2FBAA 1CEMA 1I8QA 1N7RA 2R2LB 1F9GA 1IA7A 3DSXB 5E2JA 1KKTA 5DHIA 3SDVA 4ZG8A 5JMDA 2B39A 5IM1A 2YIKA 1N24A 3S4AA 1OJMA 3Q78B 3E33B 1N7QA 1EGUA 2NVPA 3EU8A 4L0GA 3M73A 1QQFA 3M7CA 3CIHA 2JF4A 1GXOA 3SAEA 1KFGA 3M02A 3SDQA 1GXMA 1O1RB 1V5DA 3SDUA 1HM3A 1RWCA 3PYBA 3QFZA 2NOJA 1GAIA 5ILJA 1AGMA 4OK2A 4WVBA 1HN0A 1DL2A 3A0OA 1QSJA 3DSVB 1S63B 4OK4A 3Q73B 1LTXB 1TNBB 1AYXA 2XQWA 4F10A 3QRYA 1G9GA 5AGDA 4ZH5A 5C05A 5KKBA 4ZRPA 3WKGA 2RI9A 1O6HA 2DROA 3RENA 1WU4A 3EZ8A 5ILDA 1HMWA 1X81B 3KQ4A 2RGKA 1V5CA 4ZH1A 1JS4A 2AFAA 1DCEB 1FO3A 1TNOB 1RWFA 2E24A 3OEDA 3W7UA 1RQ5A 4MU9A 1H37A 4F13A 5DGRA 3DRAB 3N0GA 5CD2A 4AYRA 2X03A 4KKJA 1FPPB 3M75A 4LIXA 3VW5A 2XWBB 4YCRA 3H7LA 4AYPA 1V7XA 1NI1B 2V3NA 3K11A 1F9DA 4D94A 1C82A 2BRPA 1H3AA 1HM2A 3Q7AB 5IK0A 3PMMA 1R76A 1SA4B 4E1YA 2ONGA 3HXCB 3WC3A 1FCEA 1O79A 3WKHA 4FUSA 1HCUA 2DRRA 5EASA 4WVCA 3W7SA 1G9JA 1H14A 1HXGA 1SQCA 2BB5A 3W7WA 1N21A 1J0MA 1H13A 1TNZB 4YDEB 5M7IA 4GTVB 1N4SB 3DSTB 2ZISB 3M00A 1O6QA 1RWHA 3DPYB 3E37B 3QWTA 2BRWA 3ANKA 2FV0A 1N4QB 3A3VA 3ACSA 3QPFA 4CJ1A 1X1JA 1FAEA 1N23A 1KWFA 2XWJB 3M76A 3Q75B 5IL3A 1NXCA 3K7XA 1N1BA 1RW9A 3G6JB 1X9DA 2WY7A 3DSUB 2GZ6A 4KTPA 4KTRA 3WIQA 2VN7A 3QT3A 4MBGB 3LZ9A 5M7YA 1KSCA 4D4DA 1GHQA 2I07B 2PMVA 1WU5A 5IKAA 1KZOB 1XWTA 2WY8A 3QG0A 4DI5A 4WVAA 2QNOA 3M7LA 4OZVA 3WKFA 1OJPA 3KLSA 1IA6A 1H36A 4J5TA 1H3CA 2JJBA 1O1TB 1O5MB 1GAHA 3NFVA 3W5NA 1H3BA 2Z07A 1H39A 4CJ0A 2V3PA 4OJZA 1QAZA 3QT9A 2PN5A 1CB8A 2BB6A 3W5MA 1XWQA 2OKXA 1V7VA 1S64B 3ACTA 3Q79B 1TN6B 2FUTA 4Q88A 3M01A 3D5SA 4DODA 1WU6A 5FO9B 4M76A 3SQCA 3E73A 1QBQB 1OJNA 1LF6A 3E30B 2F6DA 3EUVB 2D8LA 3H2WA 2H6HB 2DRSA 1GXNA 2BEDB 3D3IA 2EACA 1HX9A 1N9AB 3E34B 2G0DA 3QDEA 1FO2A 4GTPB 2WYNA 4TF4A 4RNQA 1RWAA 1VD5A 5MEHA 1L2AA 3M74A 3S4BA 3M7EA 1W6JA 1H35A 4WU0A 1HZFA 2H6GB 1LD7B 4KKIA 4Z4LA 1H12A 4D4AA 3S4DA 1GLMA 2H6FB 3EU5B 5GW7A 5ILKA 1UG9A 2WIIB 3ON6A 1L1YA 1GSZA 4Q2BA 2BRVX 3W7TA 3S4CA 1TF4A 2B4FA 1N94B 2ZIRB 2WINB 4EL8A 3P2CA 2WDAA 1FBOA 2FV1A 3TF4A 4V1SA 4CE7A 3G4FA 5CZLA 3HXEB 1LXMA 1G87A 3PZ3B 2D5JA 3ANJA 3DSWB 1D8EB 1JCRB 3KSLB 1G6IA 5IK6A 1N7NA 3Q7FB 4FNVA 2CQTA 3VSNA 2H6IB 3PZ1B 2DRQA 3X17A 1HXCA 4FXKB 3RX7A 2GH4A 1N95B 2JG0A 4NEIA 3RRSA 3RJ3A 2BBCA 3M71A 2P0VA 3D5RA 4FJQA 1SA5B 5IL8A 3WKIA 3W7XA 2EABA 4LNGB 1N22A 3WIWA 1LF9A 1KREA 3QSPA 2E22A 4Z4JA 3N0FA 2CQSA 1FBWA 3HXBB 3PZ4B 4L9PB 5JPNB 3M77A 5FOBB 2V8KA 2ONHA 2G02A 2AHFA 2EAEA 1X1IA 3RX8A 4AYQA 1MZCB 3RSYA 1KSDA 3GZKA 4QT9A 3M7BA 1W3YA 1W6KA 3NNBA 3PYAA 2RI8A 3QXQA 3C72B 3QFYA 3H3KA 1O6RA 3M78A 1IS9A 3OXUA 5JMFA 3VSMA 4YDOB 2Q1FA 4TXTA 1FT1B 5ILYA 2V8IA 3ANIA 4GAXA 3AFJA 4D4CA 3M72A 5ILZA 4GTOB 4ONTA 3EQAA 2V8JA 2F0YB 4XUVA 3P5RA 4GL3A 3E32B 1V7WA 5CA3A 3E7JA 4OZWA 4GTRB 4AYOA 3RX5A 3AFLA 1OJOA 1O1SB 3P5PA 1KS8A 5IK9A 5ILHA 2A73B 3KSQB 4BOJA 1C3DA 4GTTB 5EAUA 1WZZA 3WUXA 3GLYA 1NL4B 1KRFA 1KZPB 5GZKA 5DGQA 4GTMB 1N7OA 4LNBB 1ULVA 1F9OA 4LNVA 1TN8B 3SFYB 3PZ2B 3G4DA 1FMIA 3WIRA 5GY3A 1N1ZA 1N7PA 3S9VA 1LOHA 3HXDB 2VN4A 1N4RB 3CU7A 1NC5A 2GOXA 3SDTA 5ILIA 3T33A 4L6XA 5EATA 3VXDA 5FO8B 4ZRQA 1RWGA 2SQCA 3GT5A 1CLCA 3DSSB 3SDRA 5DHKA 1UMPA 4FXGB 2XFGA 3E80A 1LXKA 2WCOA 3QXFA 1J0NA 1JCSB 4D4BA 2AHGA 3E6UA 1GA2A 1XW2A 4JJJA 1JCQB 2EADA 4MMIA 4V1RA 2J5CA 1FT2B 1HXAA
chains in the Genus database with same CATH topology
1K72A 5FO7B 4DOEA 3HXFB 2ZZRA 3SFXB 4GTSB 4C1SA 4GTQB 1LD8B 1H54A 2IEJB 2FUZA 4EHMB 1TN7B 5JPMB 2A8ZA 1N4PB 1DOGA 1TNUB 1TNYB 1FP3A 1D8DB 1UT9A 2ZBLA 4BOKA 2FBAA 1CEMA 2R2LB 1IA7A 3DSXB 5E2JA 1KKTA 3SDVA 4ZG8A 2B39A 2YIKA 3S4AA 3Q78B 3E33B 2NVPA 3EU8A 4L0GA 3M73A 1QQFA 3M7CA 3CIHA 2JF4A 1GXOA 3SAEA 1KFGA 3SDQA 1GXMA 1O1RB 1V5DA 3SDUA 3PYBA 3QFZA 2NOJA 1GAIA 1AGMA 4WVBA 1DL2A 3DSVB 1QSJA 1S63B 3Q73B 1LTXB 1TNBB 1AYXA 2XQWA 3QRYA 1G9GA 5AGDA 4ZH5A 5KKBA 4ZRPA 3WKGA 2RI9A 1O6HA 2DROA 3RENA 1WU4A 3EZ8A 1X81B 3KQ4A 2RGKA 1V5CA 4ZH1A 1JS4A 2AFAA 1DCEB 1FO3A 1TNOB 3W7UA 3OEDA 1RQ5A 4MU9A 1H37A 5DGRA 3DRAB 5CD2A 4AYRA 4KKJA 1FPPB 3M75A 4LIXA 3VW5A 2XWBB 4YCRA 3H7LA 4AYPA 1V7XA 1NI1B 2V3NA 3K11A 1F9DA 4D94A 1H3AA 3Q7AB 3PMMA 1R76A 1SA4B 3HXCB 3WC3A 1FCEA 1O79A 3WKHA 4FUSA 1HCUA 2DRRA 4WVCA 3W7SA 1G9JA 1H14A 1SQCA 2BB5A 3W7WA 1H13A 1TNZB 4YDEB 5M7IA 4GTVB 1N4SB 3DSTB 2ZISB 1O6QA 3DPYB 3E37B 3QWTA 3ANKA 2FV0A 1N4QB 3A3VA 3ACSA 3QPFA 4CJ1A 3Q75B 1FAEA 1KWFA 2XWJB 3M76A 1NXCA 3K7XA 3G6JB 1X9DA 2WY7A 3DSUB 2GZ6A 4KTPA 4KTRA 3WIQA 2VN7A 3QT3A 4MBGB 5M7YA 1KSCA 4D4DA 1GHQA 2I07B 2PMVA 1WU5A 1KZOB 1XWTA 2WY8A 3QG0A 4WVAA 2QNOA 3M7LA 3WKFA 3KLSA 1IA6A 1H36A 4J5TA 1H3CA 2JJBA 1O1TB 1O5MB 1GAHA 3W5NA 1H3BA 2Z07A 1H39A 4CJ0A 2V3PA 3QT9A 2PN5A 2BB6A 3W5MA 1XWQA 2OKXA 1V7VA 1S64B 3ACTA 3Q79B 1TN6B 4Q88A 4DODA 3D5SA 5FO9B 1WU6A 4M76A 3SQCA 3E73A 1QBQB 1LF6A 3E30B 2F6DA 3EUVB 2D8LA 3H2WA 2H6HB 2DRSA 1GXNA 2BEDB 3D3IA 2EACA 1N9AB 3E34B 2G0DA 3QDEA 1FO2A 4GTPB 2WYNA 4TF4A 1VD5A 5MEHA 1L2AA 3M74A 3S4BA 3M7EA 1W6JA 1H35A 4WU0A 1HZFA 2H6GB 1LD7B 4KKIA 4Z4LA 1H12A 4D4AA 3S4DA 1GLMA 2H6FB 3EU5B 5GW7A 1UG9A 2WIIB 3ON6A 1L1YA 1GSZA 4Q2BA 3W7TA 3S4CA 1TF4A 2B4FA 1N94B 2ZIRB 2WINB 4EL8A 3P2CA 1FBOA 2FV1A 3TF4A 4V1SA 4CE7A 5CZLA 3HXEB 1G87A 3PZ3B 2D5JA 3ANJA 3DSWB 1D8EB 1JCRB 3KSLB 1G6IA 3Q7FB 2CQTA 2H6IB 3PZ1B 2DRQA 3X17A 4FXKB 3RX7A 2GH4A 1N95B 2JG0A 3RRSA 3RJ3A 2BBCA 3M71A 2P0VA 3D5RA 1SA5B 3WKIA 3W7XA 2EABA 4LNGB 3WIWA 1LF9A 1KREA 3QSPA 4Z4JA 2CQSA 1FBWA 3HXBB 3PZ4B 4L9PB 5JPNB 3M77A 5FOBB 2V8KA 2G02A 2AHFA 2EAEA 3RX8A 4AYQA 1MZCB 3RSYA 1KSDA 3GZKA 4QT9A 3M7BA 1W6KA 3PYAA 2RI8A 3QXQA 3C72B 3QFYA 3H3KA 1O6RA 3M78A 1IS9A 3OXUA 4YDOB 4TXTA 1FT1B 2V8IA 3ANIA 3AFJA 4D4CA 3M72A 4GTOB 4ONTA 3EQAA 2V8JA 2F0YB 4XUVA 3P5RA 4GL3A 3E32B 1V7WA 5CA3A 4GTRB 4AYOA 3RX5A 3P5PA 1O1SB 1KS8A 2A73B 3KSQB 4BOJA 4GTTB 1C3DA 1WZZA 3WUXA 3GLYA 1NL4B 1KRFA 1KZPB 5GZKA 5DGQA 4GTMB 4LNBB 1ULVA 1F9OA 4LNVA 1TN8B 3SFYB 3PZ2B 1FMIA 3WIRA 5GY3A 3S9VA 3HXDB 2VN4A 1N4RB 3CU7A 1NC5A 2GOXA 3SDTA 3T33A 4L6XA 3VXDA 5FO8B 4ZRQA 2SQCA 3GT5A 1CLCA 3DSSB 3SDRA 1UMPA 4FXGB 2XFGA 3QXFA 1JCSB 4D4BA 2AHGA 3E6UA 1GA2A 1XW2A 4JJJA 1JCQB 2EADA 4V1RA 1FT2B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1RQ5 A;  2CQS A;  1FBW A;  3ACT A;  1K72 A;  4Q88 A;  5DGR A;  5CD2 A;  4DOD A;  1WU6 A;  4AYR A;  4DOE A;  3E73 A;  2ZZR A;  1LF6 A;  2AHF A;  2EAE A;  2F6D A;  3RX8 A;  3VW5 A;  2D8L A;  4AYQ A;  3H2W A;  3RSY A;  1KSD A;  1H54 A;  2DRS A;  3H7L A;  3D3I A;  3GZK A;  1V7X A;  2FUZ A;  3K11 A;  4AYP A;  1F9D A;  2A8Z A;  2EAC A;  1DOG A;  1FP3 A;  2RI8 A;  1UT9 A;  2ZBL A;  3QXQ A;  3QFY A;  3QDE A;  1FO2 A;  3H3K A;  3PMM A;  1IS9 A;  2FBA A;  2WYN A;  1CEM A;  4TF4 A;  1VD5 A;  5MEH A;  1L2A A;  4TXT A;  3WC3 A;  3S4B A;  1FCE A;  1IA7 A;  3WKH A;  4FUS A;  5E2J A;  1KKT A;  1HCU A;  4WU0 A;  3ANI A;  2DRR A;  3AFJ A;  4WVC A;  3W7S A;  1G9J A;  3EQA A;  4ZG8 A;  4Z4L A;  1H14 A;  1H12 A;  4XUV A;  3W7W A;  1H13 A;  2YIK A;  3S4D A;  5M7I A;  1GLM A;  3S4A A;  1V7W A;  5GW7 A;  2NVP A;  5CA3 A;  1UG9 A;  3ON6 A;  4AYO A;  4L0G A;  1L1Y A;  3RX5 A;  3QWT A;  1KS8 A;  3ANK A;  3CIH A;  2JF4 A;  2FV0 A;  3A3V A;  3ACS A;  3QPF A;  4Q2B A;  4CJ1 A;  3W7T A;  1FAE A;  3S4C A;  1TF4 A;  1WZZ A;  2B4F A;  1KWF A;  3WUX A;  3GLY A;  1NXC A;  1KRF A;  4EL8 A;  1KFG A;  3P2C A;  1X9D A;  5DGQ A;  1FBO A;  2FV1 A;  1ULV A;  2GZ6 A;  1F9O A;  4KTP A;  3TF4 A;  1V5D A;  4KTR A;  3WIQ A;  2VN7 A;  3QT3 A;  3QFZ A;  4CE7 A;  5CZL A;  1GAI A;  1AGM A;  5M7Y A;  1KSC A;  4WVB A;  1G87 A;  1DL2 A;  1FMI A;  1WU5 A;  2D5J A;  3WIR A;  3ANJ A;  5GY3 A;  1XWT A;  3QG0 A;  1G6I A;  4WVA A;  2QNO A;  2VN4 A;  1NC5 A;  1AYX A;  3WKF A;  1IA6 A;  2CQT A;  3T33 A;  3QRY A;  1G9G A;  4L6X A;  4ZH5 A;  2DRQ A;  3VXD A;  3X17 A;  5KKB A;  4J5T A;  3RX7 A;  2GH4 A;  2JG0 A;  2RI9 A;  3GT5 A;  3WKG A;  1CLC A;  3RRS A;  2JJB A;  2DRO A;  2XFG A;  1GAH A;  2P0V A;  3W5N A;  3REN A;  1WU4 A;  3EZ8 A;  3QXF A;  3WKI A;  2Z07 A;  4CJ0 A;  3W7X A;  2RGK A;  2EAB A;  2AHG A;  1V5C A;  3E6U A;  3QT9 A;  1GA2 A;  1XW2 A;  4JJJ A;  2EAD A;  3WIW A;  1JS4 A;  1LF9 A;  2AFA A;  3W5M A;  1KRE A;  1XWQ A;  1FO3 A;  3QSP A;  2OKX A;  4Z4J A;  3W7U A;  1V7V A; 
#chains in the Genus database with same CATH topology
 1HV6 A;  1K72 A;  5FO7 B;  1F1S A;  4DOE A;  3HXF B;  2ZZR A;  4MMH A;  3SFX B;  4GTS B;  4C1S A;  4GTQ B;  1LD8 B;  1H54 A;  2IEJ B;  2FUZ A;  4EHM B;  1TN7 B;  5JPM B;  2A8Z A;  1N4P B;  1DOG A;  1TNU B;  1TNY B;  5IKH A;  1FP3 A;  1D8D B;  1UT9 A;  2FUQ A;  2ZBL A;  1N20 A;  1X1H A;  1HMU A;  4BOK A;  2FBA A;  1CEM A;  1I8Q A;  1N7R A;  2R2L B;  1F9G A;  1IA7 A;  3DSX B;  5E2J A;  1KKT A;  5DHI A;  3SDV A;  4ZG8 A;  5JMD A;  2B39 A;  5IM1 A;  2YIK A;  1N24 A;  3S4A A;  1OJM A;  3Q78 B;  3E33 B;  1N7Q A;  1EGU A;  2NVP A;  3EU8 A;  4L0G A;  3M73 A;  1QQF A;  3M7C A;  3CIH A;  2JF4 A;  1GXO A;  3SAE A;  1KFG A;  3M02 A;  3SDQ A;  1GXM A;  1O1R B;  1V5D A;  3SDU A;  1HM3 A;  1RWC A;  3PYB A;  3QFZ A;  2NOJ A;  1GAI A;  5ILJ A;  1AGM A;  4OK2 A;  4WVB A;  1HN0 A;  1DL2 A;  3A0O A;  1QSJ A;  3DSV B;  1S63 B;  4OK4 A;  3Q73 B;  1LTX B;  1TNB B;  1AYX A;  2XQW A;  4F10 A;  3QRY A;  1G9G A;  5AGD A;  4ZH5 A;  5C05 A;  5KKB A;  4ZRP A;  3WKG A;  2RI9 A;  1O6H A;  2DRO A;  3REN A;  1WU4 A;  3EZ8 A;  5ILD A;  1HMW A;  1X81 B;  3KQ4 A;  2RGK A;  1V5C A;  4ZH1 A;  1JS4 A;  2AFA A;  1DCE B;  1FO3 A;  1TNO B;  1RWF A;  2E24 A;  3OED A;  3W7U A;  1RQ5 A;  4MU9 A;  1H37 A;  4F13 A;  5DGR A;  3DRA B;  3N0G A;  5CD2 A;  4AYR A;  2X03 A;  4KKJ A;  1FPP B;  3M75 A;  4LIX A;  3VW5 A;  2XWB B;  4YCR A;  3H7L A;  4AYP A;  1V7X A;  1NI1 B;  2V3N A;  3K11 A;  1F9D A;  4D94 A;  1C82 A;  2BRP A;  1H3A A;  1HM2 A;  3Q7A B;  5IK0 A;  3PMM A;  1R76 A;  1SA4 B;  4E1Y A;  2ONG A;  3HXC B;  3WC3 A;  1FCE A;  1O79 A;  3WKH A;  4FUS A;  1HCU A;  2DRR A;  5EAS A;  4WVC A;  3W7S A;  1G9J A;  1H14 A;  1HXG A;  1SQC A;  2BB5 A;  3W7W A;  1N21 A;  1J0M A;  1H13 A;  1TNZ B;  4YDE B;  5M7I A;  4GTV B;  1N4S B;  3DST B;  2ZIS B;  3M00 A;  1O6Q A;  1RWH A;  3DPY B;  3E37 B;  3QWT A;  2BRW A;  3ANK A;  2FV0 A;  1N4Q B;  3A3V A;  3ACS A;  3QPF A;  4CJ1 A;  1X1J A;  1FAE A;  1N23 A;  1KWF A;  2XWJ B;  3M76 A;  3Q75 B;  5IL3 A;  1NXC A;  3K7X A;  1N1B A;  1RW9 A;  3G6J B;  1X9D A;  2WY7 A;  3DSU B;  2GZ6 A;  4KTP A;  4KTR A;  3WIQ A;  2VN7 A;  3QT3 A;  4MBG B;  3LZ9 A;  5M7Y A;  1KSC A;  4D4D A;  1GHQ A;  2I07 B;  2PMV A;  1WU5 A;  5IKA A;  1KZO B;  1XWT A;  2WY8 A;  3QG0 A;  4DI5 A;  4WVA A;  2QNO A;  3M7L A;  4OZV A;  3WKF A;  1OJP A;  3KLS A;  1IA6 A;  1H36 A;  4J5T A;  1H3C A;  2JJB A;  1O1T B;  1O5M B;  1GAH A;  3NFV A;  3W5N A;  1H3B A;  2Z07 A;  1H39 A;  4CJ0 A;  2V3P A;  4OJZ A;  1QAZ A;  3QT9 A;  2PN5 A;  1CB8 A;  2BB6 A;  3W5M A;  1XWQ A;  2OKX A;  1V7V A;  1S64 B;  3ACT A;  3Q79 B;  1TN6 B;  2FUT A;  4Q88 A;  3M01 A;  3D5S A;  4DOD A;  1WU6 A;  5FO9 B;  4M76 A;  3SQC A;  3E73 A;  1QBQ B;  1OJN A;  1LF6 A;  3E30 B;  2F6D A;  3EUV B;  2D8L A;  3H2W A;  2H6H B;  2DRS A;  1GXN A;  2BED B;  3D3I A;  2EAC A;  1HX9 A;  1N9A B;  3E34 B;  2G0D A;  3QDE A;  1FO2 A;  4GTP B;  2WYN A;  4TF4 A;  4RNQ A;  1RWA A;  1VD5 A;  5MEH A;  1L2A A;  3M74 A;  3S4B A;  3M7E A;  1W6J A;  1H35 A;  4WU0 A;  1HZF A;  2H6G B;  1LD7 B;  4KKI A;  4Z4L A;  1H12 A;  4D4A A;  3S4D A;  1GLM A;  2H6F B;  3EU5 B;  5GW7 A;  5ILK A;  1UG9 A;  2WII B;  3ON6 A;  1L1Y A;  1GSZ A;  4Q2B A;  2BRV X;  3W7T A;  3S4C A;  1TF4 A;  2B4F A;  1N94 B;  2ZIR B;  2WIN B;  4EL8 A;  3P2C A;  2WDA A;  1FBO A;  2FV1 A;  3TF4 A;  4V1S A;  4CE7 A;  3G4F A;  5CZL A;  3HXE B;  1LXM A;  1G87 A;  3PZ3 B;  2D5J A;  3ANJ A;  3DSW B;  1D8E B;  1JCR B;  3KSL B;  1G6I A;  5IK6 A;  1N7N A;  3Q7F B;  4FNV A;  2CQT A;  3VSN A;  2H6I B;  3PZ1 B;  2DRQ A;  3X17 A;  1HXC A;  4FXK B;  3RX7 A;  2GH4 A;  1N95 B;  2JG0 A;  4NEI A;  3RRS A;  3RJ3 A;  2BBC A;  3M71 A;  2P0V A;  3D5R A;  4FJQ A;  1SA5 B;  5IL8 A;  3WKI A;  3W7X A;  2EAB A;  4LNG B;  1N22 A;  3WIW A;  1LF9 A;  1KRE A;  3QSP A;  2E22 A;  4Z4J A;  3N0F A;  2CQS A;  1FBW A;  3HXB B;  3PZ4 B;  4L9P B;  5JPN B;  3M77 A;  5FOB B;  2V8K A;  2ONH A;  2G02 A;  2AHF A;  2EAE A;  1X1I A;  3RX8 A;  4AYQ A;  1MZC B;  3RSY A;  1KSD A;  3GZK A;  4QT9 A;  3M7B A;  1W3Y A;  1W6K A;  3NNB A;  3PYA A;  2RI8 A;  3QXQ A;  3C72 B;  3QFY A;  3H3K A;  1O6R A;  3M78 A;  1IS9 A;  3OXU A;  5JMF A;  3VSM A;  4YDO B;  2Q1F A;  4TXT A;  1FT1 B;  5ILY A;  2V8I A;  3ANI A;  4GAX A;  3AFJ A;  4D4C A;  3M72 A;  5ILZ A;  4GTO B;  4ONT A;  3EQA A;  2V8J A;  2F0Y B;  4XUV A;  3P5R A;  4GL3 A;  3E32 B;  1V7W A;  5CA3 A;  3E7J A;  4OZW A;  4GTR B;  4AYO A;  3RX5 A;  3AFL A;  1OJO A;  1O1S B;  3P5P A;  1KS8 A;  5IK9 A;  5ILH A;  2A73 B;  3KSQ B;  4BOJ A;  1C3D A;  4GTT B;  5EAU A;  1WZZ A;  3WUX A;  3GLY A;  1NL4 B;  1KRF A;  1KZP B;  5GZK A;  5DGQ A;  4GTM B;  1N7O A;  4LNB B;  1ULV A;  1F9O A;  4LNV A;  1TN8 B;  3SFY B;  3PZ2 B;  3G4D A;  1FMI A;  3WIR A;  5GY3 A;  1N1Z A;  1N7P A;  3S9V A;  1LOH A;  3HXD B;  2VN4 A;  1N4R B;  3CU7 A;  1NC5 A;  2GOX A;  3SDT A;  5ILI A;  3T33 A;  4L6X A;  5EAT A;  3VXD A;  5FO8 B;  4ZRQ A;  1RWG A;  2SQC A;  3GT5 A;  1CLC A;  3DSS B;  3SDR A;  5DHK A;  1UMP A;  4FXG B;  2XFG A;  3E80 A;  1LXK A;  2WCO A;  3QXF A;  1J0N A;  1JCS B;  4D4B A;  2AHG A;  3E6U A;  1GA2 A;  1XW2 A;  4JJJ A;  1JCQ B;  2EAD A;  4MMI A;  4V1R A;  2J5C A;  1FT2 B;  1HXA A; 
#chains in the Genus database with same CATH homology
 1K72 A;  5FO7 B;  4DOE A;  3HXF B;  2ZZR A;  3SFX B;  4GTS B;  4C1S A;  4GTQ B;  1LD8 B;  1H54 A;  2IEJ B;  2FUZ A;  4EHM B;  1TN7 B;  5JPM B;  2A8Z A;  1N4P B;  1DOG A;  1TNU B;  1TNY B;  1FP3 A;  1D8D B;  1UT9 A;  2ZBL A;  4BOK A;  2FBA A;  1CEM A;  2R2L B;  1IA7 A;  3DSX B;  5E2J A;  1KKT A;  3SDV A;  4ZG8 A;  2B39 A;  2YIK A;  3S4A A;  3Q78 B;  3E33 B;  2NVP A;  3EU8 A;  4L0G A;  3M73 A;  1QQF A;  3M7C A;  3CIH A;  2JF4 A;  1GXO A;  3SAE A;  1KFG A;  3SDQ A;  1GXM A;  1O1R B;  1V5D A;  3SDU A;  3PYB A;  3QFZ A;  2NOJ A;  1GAI A;  1AGM A;  4WVB A;  1DL2 A;  3DSV B;  1QSJ A;  1S63 B;  3Q73 B;  1LTX B;  1TNB B;  1AYX A;  2XQW A;  3QRY A;  1G9G A;  5AGD A;  4ZH5 A;  5KKB A;  4ZRP A;  3WKG A;  2RI9 A;  1O6H A;  2DRO A;  3REN A;  1WU4 A;  3EZ8 A;  1X81 B;  3KQ4 A;  2RGK A;  1V5C A;  4ZH1 A;  1JS4 A;  2AFA A;  1DCE B;  1FO3 A;  1TNO B;  3W7U A;  3OED A;  1RQ5 A;  4MU9 A;  1H37 A;  5DGR A;  3DRA B;  5CD2 A;  4AYR A;  4KKJ A;  1FPP B;  3M75 A;  4LIX A;  3VW5 A;  2XWB B;  4YCR A;  3H7L A;  4AYP A;  1V7X A;  1NI1 B;  2V3N A;  3K11 A;  1F9D A;  4D94 A;  1H3A A;  3Q7A B;  3PMM A;  1R76 A;  1SA4 B;  3HXC B;  3WC3 A;  1FCE A;  1O79 A;  3WKH A;  4FUS A;  1HCU A;  2DRR A;  4WVC A;  3W7S A;  1G9J A;  1H14 A;  1SQC A;  2BB5 A;  3W7W A;  1H13 A;  1TNZ B;  4YDE B;  5M7I A;  4GTV B;  1N4S B;  3DST B;  2ZIS B;  1O6Q A;  3DPY B;  3E37 B;  3QWT A;  3ANK A;  2FV0 A;  1N4Q B;  3A3V A;  3ACS A;  3QPF A;  4CJ1 A;  3Q75 B;  1FAE A;  1KWF A;  2XWJ B;  3M76 A;  1NXC A;  3K7X A;  3G6J B;  1X9D A;  2WY7 A;  3DSU B;  2GZ6 A;  4KTP A;  4KTR A;  3WIQ A;  2VN7 A;  3QT3 A;  4MBG B;  5M7Y A;  1KSC A;  4D4D A;  1GHQ A;  2I07 B;  2PMV A;  1WU5 A;  1KZO B;  1XWT A;  2WY8 A;  3QG0 A;  4WVA A;  2QNO A;  3M7L A;  3WKF A;  3KLS A;  1IA6 A;  1H36 A;  4J5T A;  1H3C A;  2JJB A;  1O1T B;  1O5M B;  1GAH A;  3W5N A;  1H3B A;  2Z07 A;  1H39 A;  4CJ0 A;  2V3P A;  3QT9 A;  2PN5 A;  2BB6 A;  3W5M A;  1XWQ A;  2OKX A;  1V7V A;  1S64 B;  3ACT A;  3Q79 B;  1TN6 B;  4Q88 A;  4DOD A;  3D5S A;  5FO9 B;  1WU6 A;  4M76 A;  3SQC A;  3E73 A;  1QBQ B;  1LF6 A;  3E30 B;  2F6D A;  3EUV B;  2D8L A;  3H2W A;  2H6H B;  2DRS A;  1GXN A;  2BED B;  3D3I A;  2EAC A;  1N9A B;  3E34 B;  2G0D A;  3QDE A;  1FO2 A;  4GTP B;  2WYN A;  4TF4 A;  1VD5 A;  5MEH A;  1L2A A;  3M74 A;  3S4B A;  3M7E A;  1W6J A;  1H35 A;  4WU0 A;  1HZF A;  2H6G B;  1LD7 B;  4KKI A;  4Z4L A;  1H12 A;  4D4A A;  3S4D A;  1GLM A;  2H6F B;  3EU5 B;  5GW7 A;  1UG9 A;  2WII B;  3ON6 A;  1L1Y A;  1GSZ A;  4Q2B A;  3W7T A;  3S4C A;  1TF4 A;  2B4F A;  1N94 B;  2ZIR B;  2WIN B;  4EL8 A;  3P2C A;  1FBO A;  2FV1 A;  3TF4 A;  4V1S A;  4CE7 A;  5CZL A;  3HXE B;  1G87 A;  3PZ3 B;  2D5J A;  3ANJ A;  3DSW B;  1D8E B;  1JCR B;  3KSL B;  1G6I A;  3Q7F B;  2CQT A;  2H6I B;  3PZ1 B;  2DRQ A;  3X17 A;  4FXK B;  3RX7 A;  2GH4 A;  1N95 B;  2JG0 A;  3RRS A;  3RJ3 A;  2BBC A;  3M71 A;  2P0V A;  3D5R A;  1SA5 B;  3WKI A;  3W7X A;  2EAB A;  4LNG B;  3WIW A;  1LF9 A;  1KRE A;  3QSP A;  4Z4J A;  2CQS A;  1FBW A;  3HXB B;  3PZ4 B;  4L9P B;  5JPN B;  3M77 A;  5FOB B;  2V8K A;  2G02 A;  2AHF A;  2EAE A;  3RX8 A;  4AYQ A;  1MZC B;  3RSY A;  1KSD A;  3GZK A;  4QT9 A;  3M7B A;  1W6K A;  3PYA A;  2RI8 A;  3QXQ A;  3C72 B;  3QFY A;  3H3K A;  1O6R A;  3M78 A;  1IS9 A;  3OXU A;  4YDO B;  4TXT A;  1FT1 B;  2V8I A;  3ANI A;  3AFJ A;  4D4C A;  3M72 A;  4GTO B;  4ONT A;  3EQA A;  2V8J A;  2F0Y B;  4XUV A;  3P5R A;  4GL3 A;  3E32 B;  1V7W A;  5CA3 A;  4GTR B;  4AYO A;  3RX5 A;  3P5P A;  1O1S B;  1KS8 A;  2A73 B;  3KSQ B;  4BOJ A;  4GTT B;  1C3D A;  1WZZ A;  3WUX A;  3GLY A;  1NL4 B;  1KRF A;  1KZP B;  5GZK A;  5DGQ A;  4GTM B;  4LNB B;  1ULV A;  1F9O A;  4LNV A;  1TN8 B;  3SFY B;  3PZ2 B;  1FMI A;  3WIR A;  5GY3 A;  3S9V A;  3HXD B;  2VN4 A;  1N4R B;  3CU7 A;  1NC5 A;  2GOX A;  3SDT A;  3T33 A;  4L6X A;  3VXD A;  5FO8 B;  4ZRQ A;  2SQC A;  3GT5 A;  1CLC A;  3DSS B;  3SDR A;  1UMP A;  4FXG B;  2XFG A;  3QXF A;  1JCS B;  4D4B A;  2AHG A;  3E6U A;  1GA2 A;  1XW2 A;  4JJJ A;  1JCQ B;  2EAD A;  4V1R A;  1FT2 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...