1WUPA

Crystal structure of metallo-beta-lactamase imp-1 mutant (d81e)
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
217
structure length
217
Chain Sequence
LPDLKIEKLDEGVYVHTSFEEVNGWGVVPKHGLVVLVNAEAYLIDTPFTAKDTEKLVTWFVERGYKIKGSISSHFHSESTGGIEWLNSRSIPTYASELTNELLKKDGKVQATNSFSGVNYWLVKNKIEVFYPGPGHTPDNVVVWLPERKILFGGCFIKPYGLGNLGDANIEAWPKSAKLLKSKYGKAKLVVPSHSEVGDASLLKLTLEQAVKGLNES
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Beta-lactamase IMP-1
publication title Probing the role of Asp-120(81) of metallo-beta-lactamase (IMP-1) by site-directed mutagenesis, kinetic studies, and X-ray crystallography.
pubmed doi rcsb
source organism Serratia marcescens
molecule tags Hydrolase
total genus 58
structure length 217
sequence length 217
chains with identical sequence B, C, D
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2004-12-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.60.15.10 Alpha Beta 4-Layer Sandwich Metallo-beta-lactamase; Chain A Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 1wupA00
1P9EA 5LCFA 5KIKA 4RL0A 5AYAA 4XWTA 1K07A 4GYQA 4AD9A 5EW0A 5ACVA 5AHOA 2HB9A 4H0DA 4TYTA 2BTNA 4AWYB 4DILA 2P97A 4V0HA 2GKLA 3T9MA 3Q6VA 4UWRB 3ZWFA 2BG7A 4HKYA 1VMEA 3RKKA 2BG8B 5AXRA 5ACUA 1BVTA 4Z60A 2BG8A 3JXPA 3H3EA 1Y44A 2WYMA 3T3OA 3AF6A 2I7VA 2M5DA 3DH8A 5B1UA 2GFKA 2NXAA 5K4KA 5LM6A 3KNSA 1JJEA 2YNVB 1ZTCA 5K4MA 2OHHA 5HH6A 5A0TA 4YSLA 2YNVA 3ZNBA 4AX1B 3KL7A 4LE6A 4O98A 3RKJA 3IOFA 4YSKA 5A0VA 1X8IA 4RL2A 3SBLA 2FHXB 4JO0A 2YNUA 3BK2A 5LLDA 1VGNA 2FU6A 1BMCA 1A8TA 1E5DA 2I7TA 2QJSA 4RAMA 5ACQA 1YCFA 2FK6A 5ACWA 4NQ4A 5A5ZA 2DOOA 3IDZA 1DDKA 2FU8A 2YNTB 3PY6A 1XM8A 4WD6A 5EV6A 3DHAA 4Z5YA 4XUKA 4TZFA 3I13A 4D1VA 5KILA 4DIKA 2YNTA 5HIQA 4EXYA 1DXKA 5ACPA 2GCUA 1QH3A 3X30A 4C1GA 4AX0B 3R2UA 1WRAA 4EFZA 2BMIA 4Z6XA 4EY2A 4EYFA 1ZNBA 2YCBA 4ZO3A 3IOGA 3SRXA 2BR6A 3ZR9A 3BV6A 2BFLA 3IEKA 2ZWRA 4ZEJA 5FQAA 5FQCA 2BFZB 4D1UA 3DHBA 2BFKA 1WUPA 2BFZA 4GCWA 4C1EA 2OHJA 2BG6A 4UWPB 4C1CA 3G1PA 1JJTA 2Y87A 5EVKA 1A7TA 3F9OA 4NQ6A 5K0WA 2VW8A 2WRSA 3SD9A 4J5FA 4XWWA 2QDTA 5AXOA 3LVZA 2ZO4A 5HIPA 5EVDA 5ACXA 4UWOB 4F6ZA 5EHTA 3S0ZA 3KNRA 3A4YA 1M2XA 5AHRA 5EH9A 4RM5A 4FSBA 1YCHA 2BC2A 1ZKPA 2Q42A 5LCHA 3P2UA 4FR7A 4EXSA 5B3RA 4Z67A 3I15A 1L9YA 2OHIA 3IE1A 2WYLA 2YNWA 2Q9UA 3PG4A 2GMNA 1DD6A 5EWAA 2QINA 4D02A 5LMCA 1YCGA 4C1DA 2P4ZA 3DHCA 5A87A 5LCAA 3X2XA 4Z7RA 5HH4A 2UYXA 4KEPA 4C09A 2NZEA 4TYFA 3WXCA 5ACTA 2XF4A 2QEDA 4P62A 2H6AA 4UA4A 5LSCA 1BC2A 3SPUA 5IQKA 2QDSA 3FCZA 3AF5A 2Y8AA 3AJ3A 4YSBA 2NZFA 2DKFA 3IE2A 2BGAA 5DPXA 3I14A 4B87A 1KO2A 2FM6A 4BP0A 4UBQA 5ACRA 3ESHA 2WHGA 4TZ9A 2BG2A 4EYBA 2FU7A 3IELA 2NYPA 1WW1A 2I7XA 4ZNBA 2Q0JA 5HH5A 5LE1A 2GFJA 1MQOA 4C1FA 4NQ5A 2FU9A 5AEBA 3IE0A 4EYLA 1XTOA 4BZ3A 2E7YA 3TP9A 3SW3A 4Z5ZA 4FEKA 4TZBA 3VPEA 2YZ3A 3ZQ4A 4GYUA 1QH5A 4U4LA 3I11A 3PY5A 3ADRA 3X2YA 4PVOA 4CHLA 4F6HA 1KO3A 1X8HA 4C1HA 4HL2A 5HIOA 4NQ2A 4TZEA 2P18A 3BC2A 3MD7A 4D1TA 2WYMC 5EV8A 4D1WA 1HLKA 2XR1A 2M5CA 3L6NA 4UWSB 3SFPA 5LS3A 3QH8A 3T3NA 1JT1A 5B15A 1X8GA 3BK1A 3FAIA 3RPCA 2Y8BA 4RBSA 2ZNBA 2AZ4A 1SMLA 2AIOA 4ZO2A 5ACSA 2BIBA 4UAMA 2CBNA 3I0VA 2FHXA 5FQBA 4AWZA 2A7MA 2R2DA 4KEQA 3X2ZA 5EVBA 2ZZIA 4HL1A 4J5HA 2P1EA 5K4NA 3VQZA 1WUOA 1KR3A 2Q0IA 1VJNA 4RAWA 3IEMA 5HISA 4PVTA
chains in the Genus database with same CATH superfamily
1P9EA 5LCFA 5KIKA 4RL0A 5AYAA 4XWTA 1K07A 4GYQA 4AD9A 5EW0A 5ACVA 5AHOA 2HB9A 4H0DA 4NURA 4TYTA 2BTNA 4AWYB 4DILA 2P97A 4V0HA 2GKLA 3T9MA 3Q6VA 4UWRB 3ZWFA 2CFZA 2BG7A 4HKYA 4AV7A 1VMEA 3RKKA 2BG8B 5AXRA 2CG2A 5ACUA 1BVTA 4Z60A 2BG8A 3JXPA 3H3EA 1Y44A 2WYMA 3T3OA 3AF6A 2I7VA 2M5DA 3DH8A 5B1UA 2GFKA 2NXAA 5K4KA 5LM6A 3KNSA 1JJEA 2YNVB 1ZTCA 5K4MA 2OHHA 5HH6A 5A0TA 4YSLA 2YNVA 3ZNBA 4AX1B 3KL7A 4LE6A 4O98A 3RKJA 3IOFA 4YSKA 5A0VA 1X8IA 4RL2A 3SBLA 2FHXB 4JO0A 2YNUA 3BK2A 5LLDA 1VGNA 2FU6A 1BMCA 1A8TA 1E5DA 2YHEA 2I7TA 2QJSA 4RAMA 5ACQA 1YCFA 2FK6A 5ACWA 4NQ4A 5A5ZA 2DOOA 3IDZA 1DDKA 2FU8A 2YNTB 3PY6A 1XM8A 4WD6A 5EV6A 3DHAA 4Z5YA 4XUKA 4TZFA 3I13A 4D1VA 5KILA 4DIKA 2YNTA 4PDXA 5HIQA 1DXKA 4EXYA 5ACPA 2GCUA 1QH3A 3X30A 4C1GA 4AX0B 3R2UA 1WRAA 4EFZA 2CFUA 2BMIA 4Z6XA 4EY2A 4EYFA 1ZNBA 2YCBA 4ZO3A 3IOGA 3SRXA 2BR6A 3ZR9A 3BV6A 2BFLA 3IEKA 2ZWRA 4ZEJA 5FQAA 5FQCA 2BFZB 4D1UA 3DHBA 5AIJA 2BFKA 1WUPA 2BFZA 4GCWA 4C1EA 2OHJA 2BG6A 4UWPB 5A23A 4C1CA 3G1PA 1JJTA 2Y87A 5EVKA 1A7TA 3F9OA 4NQ6A 5K0WA 2VW8A 2WRSA 3SD9A 4J5FA 4XWWA 2QDTA 5AXOA 3LVZA 2ZO4A 5HIPA 5EVDA 5ACXA 4UWOB 4F6ZA 5EHTA 3S0ZA 3KNRA 3A4YA 1M2XA 5AHRA 5EH9A 4RM5A 4FSBA 1YCHA 2BC2A 1ZKPA 2Q42A 5LCHA 3P2UA 4FR7A 4EXSA 5B3RA 4Z67A 3I15A 1L9YA 2OHIA 3IE1A 2WYLA 2YNWA 2Q9UA 3PG4A 1DD6A 2GMNA 5EWAA 2QINA 4D02A 5AJLA 4AXHA 5LMCA 1YCGA 4C1DA 2P4ZA 3DHCA 5A87A 5LCAA 3X2XA 4Z7RA 5HH4A 2UYXA 4KEPA 4C09A 2NZEA 4TYFA 3WXCA 5ACTA 2XF4A 2QEDA 4P62A 2H6AA 4UA4A 5LSCA 1BC2A 3SPUA 5IQKA 2QDSA 3FCZA 3AF5A 2Y8AA 3AJ3A 4YSBA 2NZFA 2DKFA 3IE2A 2BGAA 5DPXA 3I14A 4B87A 1KO2A 2FM6A 4BP0A 4UBQA 5ACRA 3ESHA 2WHGA 4TZ9A 2BG2A 4EYBA 2FU7A 3IELA 2NYPA 1WW1A 2I7XA 4ZNBA 2Q0JA 5HH5A 5LE1A 2GFJA 1MQOA 4C1FA 4NQ5A 2FU9A 5AEBA 3IE0A 4EYLA 1XTOA 4BZ3A 2E7YA 3TP9A 3SW3A 4Z5ZA 4FEKA 4TZBA 3VPEA 2YZ3A 3ZQ4A 4GYUA 1QH5A 4U4LA 3I11A 3PY5A 3ADRA 3X2YA 4PVOA 4CHLA 4F6HA 1KO3A 1X8HA 4C1HA 4HL2A 5HIOA 4NQ2A 4TZEA 2P18A 3BC2A 3MD7A 4D1TA 2WYMC 5EV8A 4D1WA 1HLKA 2XR1A 2M5CA 3L6NA 4UWSB 3SFPA 5LS3A 3QH8A 3T3NA 1JT1A 5B15A 1X8GA 3BK1A 3FAIA 3RPCA 2Y8BA 4RBSA 2ZNBA 2AZ4A 1SMLA 2AIOA 4ZO2A 5ACSA 2BIBA 4UAMA 2CBNA 3I0VA 2FHXA 2CG3A 5FQBA 4AWZA 2A7MA 2R2DA 4KEQA 3X2ZA 5EVBA 2ZZIA 4HL1A 4J5HA 2P1EA 5K4NA 3VQZA 1WUOA 1KR3A 2Q0IA 1VJNA 4RAWA 3IEMA 5HISA 4PVTA
chains in the Genus database with same CATH topology
1P9EA 5LCFA 5KIKA 4RL0A 5AYAA 4XWTA 1K07A 4GYQA 4AD9A 5EW0A 5ACVA 5AHOA 2HB9A 4H0DA 4TYTA 2BTNA 4AWYB 4DILA 2P97A 4V0HA 2GKLA 3T9MA 3Q6VA 4UWRB 3ZWFA 2BG7A 4HKYA 1VMEA 3RKKA 2BG8B 5AXRA 5ACUA 1BVTA 4Z60A 2BG8A 3JXPA 3H3EA 1Y44A 2WYMA 3T3OA 3AF6A 2I7VA 2M5DA 3DH8A 5B1UA 2GFKA 2NXAA 5K4KA 5LM6A 3KNSA 1JJEA 2YNVB 1ZTCA 5K4MA 2OHHA 5HH6A 5A0TA 4YSLA 2YNVA 3ZNBA 4AX1B 3KL7A 4LE6A 4O98A 3RKJA 3IOFA 4YSKA 5A0VA 1X8IA 4RL2A 3SBLA 2FHXB 4JO0A 2YNUA 3BK2A 5LLDA 1VGNA 2FU6A 1BMCA 1A8TA 1E5DA 2I7TA 2QJSA 4RAMA 5ACQA 1YCFA 2FK6A 5ACWA 4NQ4A 5A5ZA 2DOOA 3IDZA 1DDKA 2FU8A 2YNTB 3PY6A 1XM8A 4WD6A 5EV6A 3DHAA 4Z5YA 4XUKA 4TZFA 3I13A 4D1VA 5KILA 4DIKA 2YNTA 5HIQA 4EXYA 1DXKA 5ACPA 2GCUA 1QH3A 3X30A 4C1GA 4AX0B 3R2UA 1WRAA 4EFZA 2BMIA 4Z6XA 4EY2A 4EYFA 1ZNBA 2YCBA 4ZO3A 3IOGA 3SRXA 2BR6A 3ZR9A 3BV6A 2BFLA 3IEKA 2ZWRA 4ZEJA 5FQAA 5FQCA 2BFZB 4D1UA 3DHBA 2BFKA 1WUPA 2BFZA 4GCWA 4C1EA 2OHJA 2BG6A 4UWPB 4C1CA 3G1PA 1JJTA 2Y87A 5EVKA 1A7TA 3F9OA 4NQ6A 5K0WA 2VW8A 2WRSA 3SD9A 4J5FA 4XWWA 2QDTA 5AXOA 3LVZA 2ZO4A 5HIPA 5EVDA 5ACXA 4UWOB 4F6ZA 5EHTA 3S0ZA 3KNRA 3A4YA 1M2XA 5AHRA 5EH9A 4RM5A 4FSBA 1YCHA 2BC2A 1ZKPA 2Q42A 5LCHA 3P2UA 4FR7A 4EXSA 5B3RA 4Z67A 3I15A 1L9YA 2OHIA 3IE1A 2WYLA 2YNWA 2Q9UA 3PG4A 2GMNA 1DD6A 5EWAA 2QINA 4D02A 5LMCA 1YCGA 4C1DA 2P4ZA 3DHCA 5A87A 5LCAA 3X2XA 4Z7RA 5HH4A 2UYXA 4KEPA 4C09A 2NZEA 4TYFA 3WXCA 5ACTA 2XF4A 2QEDA 4P62A 2H6AA 4UA4A 5LSCA 1BC2A 3SPUA 5IQKA 2QDSA 3FCZA 3AF5A 2Y8AA 3AJ3A 4YSBA 2NZFA 2DKFA 3IE2A 2BGAA 5DPXA 3I14A 4B87A 1KO2A 2FM6A 4BP0A 4UBQA 5ACRA 3ESHA 2WHGA 4TZ9A 2BG2A 4EYBA 2FU7A 3IELA 2NYPA 1WW1A 2I7XA 4ZNBA 2Q0JA 5HH5A 5LE1A 2GFJA 1MQOA 4C1FA 4NQ5A 2FU9A 5AEBA 3IE0A 4EYLA 1XTOA 4BZ3A 2E7YA 3TP9A 3SW3A 4Z5ZA 4FEKA 4TZBA 3VPEA 2YZ3A 3ZQ4A 4GYUA 1QH5A 4U4LA 3I11A 3PY5A 3ADRA 3X2YA 4PVOA 4CHLA 4F6HA 1KO3A 1X8HA 4C1HA 4HL2A 5HIOA 4NQ2A 4TZEA 2P18A 3BC2A 3MD7A 4D1TA 2WYMC 5EV8A 4D1WA 1HLKA 2XR1A 2M5CA 3L6NA 4UWSB 3SFPA 5LS3A 3QH8A 3T3NA 1JT1A 5B15A 1X8GA 3BK1A 3FAIA 3RPCA 2Y8BA 4RBSA 2ZNBA 2AZ4A 1SMLA 2AIOA 4ZO2A 5ACSA 2BIBA 4UAMA 2CBNA 3I0VA 2FHXA 5FQBA 4AWZA 2A7MA 2R2DA 4KEQA 3X2ZA 5EVBA 2ZZIA 4HL1A 4J5HA 2P1EA 5K4NA 3VQZA 1WUOA 1KR3A 2Q0IA 1VJNA 4RAWA 3IEMA 5HISA 4PVTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1P9E A;  5LCF A;  5KIK A;  4RL0 A;  5AYA A;  4XWT A;  1K07 A;  4GYQ A;  4AD9 A;  5EW0 A;  5ACV A;  5AHO A;  2HB9 A;  4H0D A;  4TYT A;  2BTN A;  4AWY B;  4DIL A;  2P97 A;  4V0H A;  2GKL A;  3T9M A;  3Q6V A;  4UWR B;  3ZWF A;  2BG7 A;  4HKY A;  1VME A;  3RKK A;  2BG8 B;  5AXR A;  5ACU A;  1BVT A;  4Z60 A;  2BG8 A;  3JXP A;  3H3E A;  1Y44 A;  2WYM A;  3T3O A;  3AF6 A;  2I7V A;  2M5D A;  3DH8 A;  5B1U A;  2GFK A;  2NXA A;  5K4K A;  5LM6 A;  3KNS A;  1JJE A;  2YNV B;  1ZTC A;  5K4M A;  2OHH A;  5HH6 A;  5A0T A;  4YSL A;  2YNV A;  3ZNB A;  4AX1 B;  3KL7 A;  4LE6 A;  4O98 A;  3RKJ A;  3IOF A;  4YSK A;  5A0V A;  1X8I A;  4RL2 A;  3SBL A;  2FHX B;  4JO0 A;  2YNU A;  3BK2 A;  5LLD A;  1VGN A;  2FU6 A;  1BMC A;  1A8T A;  1E5D A;  2I7T A;  2QJS A;  4RAM A;  5ACQ A;  1YCF A;  2FK6 A;  5ACW A;  4NQ4 A;  5A5Z A;  2DOO A;  3IDZ A;  1DDK A;  2FU8 A;  2YNT B;  3PY6 A;  1XM8 A;  4WD6 A;  5EV6 A;  3DHA A;  4Z5Y A;  4XUK A;  4TZF A;  3I13 A;  4D1V A;  5KIL A;  4DIK A;  2YNT A;  5HIQ A;  4EXY A;  1DXK A;  5ACP A;  2GCU A;  1QH3 A;  3X30 A;  4C1G A;  4AX0 B;  3R2U A;  1WRA A;  4EFZ A;  2BMI A;  4Z6X A;  4EY2 A;  4EYF A;  1ZNB A;  2YCB A;  4ZO3 A;  3IOG A;  3SRX A;  2BR6 A;  3ZR9 A;  3BV6 A;  2BFL A;  3IEK A;  2ZWR A;  4ZEJ A;  5FQA A;  5FQC A;  2BFZ B;  4D1U A;  3DHB A;  2BFK A;  1WUP A;  2BFZ A;  4GCW A;  4C1E A;  2OHJ A;  2BG6 A;  4UWP B;  4C1C A;  3G1P A;  1JJT A;  2Y87 A;  5EVK A;  1A7T A;  3F9O A;  4NQ6 A;  5K0W A;  2VW8 A;  2WRS A;  3SD9 A;  4J5F A;  4XWW A;  2QDT A;  5AXO A;  3LVZ A;  2ZO4 A;  5HIP A;  5EVD A;  5ACX A;  4UWO B;  4F6Z A;  5EHT A;  3S0Z A;  3KNR A;  3A4Y A;  1M2X A;  5AHR A;  5EH9 A;  4RM5 A;  4FSB A;  1YCH A;  2BC2 A;  1ZKP A;  2Q42 A;  5LCH A;  3P2U A;  4FR7 A;  4EXS A;  5B3R A;  4Z67 A;  3I15 A;  1L9Y A;  2OHI A;  3IE1 A;  2WYL A;  2YNW A;  2Q9U A;  3PG4 A;  2GMN A;  1DD6 A;  5EWA A;  2QIN A;  4D02 A;  5LMC A;  1YCG A;  4C1D A;  2P4Z A;  3DHC A;  5A87 A;  5LCA A;  3X2X A;  4Z7R A;  5HH4 A;  2UYX A;  4KEP A;  4C09 A;  2NZE A;  4TYF A;  3WXC A;  5ACT A;  2XF4 A;  2QED A;  4P62 A;  2H6A A;  4UA4 A;  5LSC A;  1BC2 A;  3SPU A;  5IQK A;  2QDS A;  3FCZ A;  3AF5 A;  2Y8A A;  3AJ3 A;  4YSB A;  2NZF A;  2DKF A;  3IE2 A;  2BGA A;  5DPX A;  3I14 A;  4B87 A;  1KO2 A;  2FM6 A;  4BP0 A;  4UBQ A;  5ACR A;  3ESH A;  2WHG A;  4TZ9 A;  2BG2 A;  4EYB A;  2FU7 A;  3IEL A;  2NYP A;  1WW1 A;  2I7X A;  4ZNB A;  2Q0J A;  5HH5 A;  5LE1 A;  2GFJ A;  1MQO A;  4C1F A;  4NQ5 A;  2FU9 A;  5AEB A;  3IE0 A;  4EYL A;  1XTO A;  4BZ3 A;  2E7Y A;  3TP9 A;  3SW3 A;  4Z5Z A;  4FEK A;  4TZB A;  3VPE A;  2YZ3 A;  3ZQ4 A;  4GYU A;  1QH5 A;  4U4L A;  3I11 A;  3PY5 A;  3ADR A;  3X2Y A;  4PVO A;  4CHL A;  4F6H A;  1KO3 A;  1X8H A;  4C1H A;  4HL2 A;  5HIO A;  4NQ2 A;  4TZE A;  2P18 A;  3BC2 A;  3MD7 A;  4D1T A;  2WYM C;  5EV8 A;  4D1W A;  1HLK A;  2XR1 A;  2M5C A;  3L6N A;  4UWS B;  3SFP A;  5LS3 A;  3QH8 A;  3T3N A;  1JT1 A;  5B15 A;  1X8G A;  3BK1 A;  3FAI A;  3RPC A;  2Y8B A;  4RBS A;  2ZNB A;  2AZ4 A;  1SML A;  2AIO A;  4ZO2 A;  5ACS A;  2BIB A;  4UAM A;  2CBN A;  3I0V A;  2FHX A;  5FQB A;  4AWZ A;  2A7M A;  2R2D A;  4KEQ A;  3X2Z A;  5EVB A;  2ZZI A;  4HL1 A;  4J5H A;  2P1E A;  5K4N A;  3VQZ A;  1WUO A;  1KR3 A;  2Q0I A;  1VJN A;  4RAW A;  3IEM A;  5HIS A;  4PVT A; 
#chains in the Genus database with same CATH topology
 1P9E A;  5LCF A;  5KIK A;  4RL0 A;  5AYA A;  4XWT A;  1K07 A;  4GYQ A;  4AD9 A;  5EW0 A;  5ACV A;  5AHO A;  2HB9 A;  4H0D A;  4NUR A;  4TYT A;  2BTN A;  4AWY B;  4DIL A;  2P97 A;  4V0H A;  2GKL A;  3T9M A;  3Q6V A;  4UWR B;  3ZWF A;  2CFZ A;  2BG7 A;  4HKY A;  4AV7 A;  1VME A;  3RKK A;  2BG8 B;  5AXR A;  2CG2 A;  5ACU A;  1BVT A;  4Z60 A;  2BG8 A;  3JXP A;  3H3E A;  1Y44 A;  2WYM A;  3T3O A;  3AF6 A;  2I7V A;  2M5D A;  3DH8 A;  5B1U A;  2GFK A;  2NXA A;  5K4K A;  5LM6 A;  3KNS A;  1JJE A;  2YNV B;  1ZTC A;  5K4M A;  2OHH A;  5HH6 A;  5A0T A;  4YSL A;  2YNV A;  3ZNB A;  4AX1 B;  3KL7 A;  4LE6 A;  4O98 A;  3RKJ A;  3IOF A;  4YSK A;  5A0V A;  1X8I A;  4RL2 A;  3SBL A;  2FHX B;  4JO0 A;  2YNU A;  3BK2 A;  5LLD A;  1VGN A;  2FU6 A;  1BMC A;  1A8T A;  1E5D A;  2YHE A;  2I7T A;  2QJS A;  4RAM A;  5ACQ A;  1YCF A;  2FK6 A;  5ACW A;  4NQ4 A;  5A5Z A;  2DOO A;  3IDZ A;  1DDK A;  2FU8 A;  2YNT B;  3PY6 A;  1XM8 A;  4WD6 A;  5EV6 A;  3DHA A;  4Z5Y A;  4XUK A;  4TZF A;  3I13 A;  4D1V A;  5KIL A;  4DIK A;  2YNT A;  4PDX A;  5HIQ A;  1DXK A;  4EXY A;  5ACP A;  2GCU A;  1QH3 A;  3X30 A;  4C1G A;  4AX0 B;  3R2U A;  1WRA A;  4EFZ A;  2CFU A;  2BMI A;  4Z6X A;  4EY2 A;  4EYF A;  1ZNB A;  2YCB A;  4ZO3 A;  3IOG A;  3SRX A;  2BR6 A;  3ZR9 A;  3BV6 A;  2BFL A;  3IEK A;  2ZWR A;  4ZEJ A;  5FQA A;  5FQC A;  2BFZ B;  4D1U A;  3DHB A;  5AIJ A;  2BFK A;  1WUP A;  2BFZ A;  4GCW A;  4C1E A;  2OHJ A;  2BG6 A;  4UWP B;  5A23 A;  4C1C A;  3G1P A;  1JJT A;  2Y87 A;  5EVK A;  1A7T A;  3F9O A;  4NQ6 A;  5K0W A;  2VW8 A;  2WRS A;  3SD9 A;  4J5F A;  4XWW A;  2QDT A;  5AXO A;  3LVZ A;  2ZO4 A;  5HIP A;  5EVD A;  5ACX A;  4UWO B;  4F6Z A;  5EHT A;  3S0Z A;  3KNR A;  3A4Y A;  1M2X A;  5AHR A;  5EH9 A;  4RM5 A;  4FSB A;  1YCH A;  2BC2 A;  1ZKP A;  2Q42 A;  5LCH A;  3P2U A;  4FR7 A;  4EXS A;  5B3R A;  4Z67 A;  3I15 A;  1L9Y A;  2OHI A;  3IE1 A;  2WYL A;  2YNW A;  2Q9U A;  3PG4 A;  1DD6 A;  2GMN A;  5EWA A;  2QIN A;  4D02 A;  5AJL A;  4AXH A;  5LMC A;  1YCG A;  4C1D A;  2P4Z A;  3DHC A;  5A87 A;  5LCA A;  3X2X A;  4Z7R A;  5HH4 A;  2UYX A;  4KEP A;  4C09 A;  2NZE A;  4TYF A;  3WXC A;  5ACT A;  2XF4 A;  2QED A;  4P62 A;  2H6A A;  4UA4 A;  5LSC A;  1BC2 A;  3SPU A;  5IQK A;  2QDS A;  3FCZ A;  3AF5 A;  2Y8A A;  3AJ3 A;  4YSB A;  2NZF A;  2DKF A;  3IE2 A;  2BGA A;  5DPX A;  3I14 A;  4B87 A;  1KO2 A;  2FM6 A;  4BP0 A;  4UBQ A;  5ACR A;  3ESH A;  2WHG A;  4TZ9 A;  2BG2 A;  4EYB A;  2FU7 A;  3IEL A;  2NYP A;  1WW1 A;  2I7X A;  4ZNB A;  2Q0J A;  5HH5 A;  5LE1 A;  2GFJ A;  1MQO A;  4C1F A;  4NQ5 A;  2FU9 A;  5AEB A;  3IE0 A;  4EYL A;  1XTO A;  4BZ3 A;  2E7Y A;  3TP9 A;  3SW3 A;  4Z5Z A;  4FEK A;  4TZB A;  3VPE A;  2YZ3 A;  3ZQ4 A;  4GYU A;  1QH5 A;  4U4L A;  3I11 A;  3PY5 A;  3ADR A;  3X2Y A;  4PVO A;  4CHL A;  4F6H A;  1KO3 A;  1X8H A;  4C1H A;  4HL2 A;  5HIO A;  4NQ2 A;  4TZE A;  2P18 A;  3BC2 A;  3MD7 A;  4D1T A;  2WYM C;  5EV8 A;  4D1W A;  1HLK A;  2XR1 A;  2M5C A;  3L6N A;  4UWS B;  3SFP A;  5LS3 A;  3QH8 A;  3T3N A;  1JT1 A;  5B15 A;  1X8G A;  3BK1 A;  3FAI A;  3RPC A;  2Y8B A;  4RBS A;  2ZNB A;  2AZ4 A;  1SML A;  2AIO A;  4ZO2 A;  5ACS A;  2BIB A;  4UAM A;  2CBN A;  3I0V A;  2FHX A;  2CG3 A;  5FQB A;  4AWZ A;  2A7M A;  2R2D A;  4KEQ A;  3X2Z A;  5EVB A;  2ZZI A;  4HL1 A;  4J5H A;  2P1E A;  5K4N A;  3VQZ A;  1WUO A;  1KR3 A;  2Q0I A;  1VJN A;  4RAW A;  3IEM A;  5HIS A;  4PVT A; 
#chains in the Genus database with same CATH homology
 1P9E A;  5LCF A;  5KIK A;  4RL0 A;  5AYA A;  4XWT A;  1K07 A;  4GYQ A;  4AD9 A;  5EW0 A;  5ACV A;  5AHO A;  2HB9 A;  4H0D A;  4TYT A;  2BTN A;  4AWY B;  4DIL A;  2P97 A;  4V0H A;  2GKL A;  3T9M A;  3Q6V A;  4UWR B;  3ZWF A;  2BG7 A;  4HKY A;  1VME A;  3RKK A;  2BG8 B;  5AXR A;  5ACU A;  1BVT A;  4Z60 A;  2BG8 A;  3JXP A;  3H3E A;  1Y44 A;  2WYM A;  3T3O A;  3AF6 A;  2I7V A;  2M5D A;  3DH8 A;  5B1U A;  2GFK A;  2NXA A;  5K4K A;  5LM6 A;  3KNS A;  1JJE A;  2YNV B;  1ZTC A;  5K4M A;  2OHH A;  5HH6 A;  5A0T A;  4YSL A;  2YNV A;  3ZNB A;  4AX1 B;  3KL7 A;  4LE6 A;  4O98 A;  3RKJ A;  3IOF A;  4YSK A;  5A0V A;  1X8I A;  4RL2 A;  3SBL A;  2FHX B;  4JO0 A;  2YNU A;  3BK2 A;  5LLD A;  1VGN A;  2FU6 A;  1BMC A;  1A8T A;  1E5D A;  2I7T A;  2QJS A;  4RAM A;  5ACQ A;  1YCF A;  2FK6 A;  5ACW A;  4NQ4 A;  5A5Z A;  2DOO A;  3IDZ A;  1DDK A;  2FU8 A;  2YNT B;  3PY6 A;  1XM8 A;  4WD6 A;  5EV6 A;  3DHA A;  4Z5Y A;  4XUK A;  4TZF A;  3I13 A;  4D1V A;  5KIL A;  4DIK A;  2YNT A;  5HIQ A;  4EXY A;  1DXK A;  5ACP A;  2GCU A;  1QH3 A;  3X30 A;  4C1G A;  4AX0 B;  3R2U A;  1WRA A;  4EFZ A;  2BMI A;  4Z6X A;  4EY2 A;  4EYF A;  1ZNB A;  2YCB A;  4ZO3 A;  3IOG A;  3SRX A;  2BR6 A;  3ZR9 A;  3BV6 A;  2BFL A;  3IEK A;  2ZWR A;  4ZEJ A;  5FQA A;  5FQC A;  2BFZ B;  4D1U A;  3DHB A;  2BFK A;  1WUP A;  2BFZ A;  4GCW A;  4C1E A;  2OHJ A;  2BG6 A;  4UWP B;  4C1C A;  3G1P A;  1JJT A;  2Y87 A;  5EVK A;  1A7T A;  3F9O A;  4NQ6 A;  5K0W A;  2VW8 A;  2WRS A;  3SD9 A;  4J5F A;  4XWW A;  2QDT A;  5AXO A;  3LVZ A;  2ZO4 A;  5HIP A;  5EVD A;  5ACX A;  4UWO B;  4F6Z A;  5EHT A;  3S0Z A;  3KNR A;  3A4Y A;  1M2X A;  5AHR A;  5EH9 A;  4RM5 A;  4FSB A;  1YCH A;  2BC2 A;  1ZKP A;  2Q42 A;  5LCH A;  3P2U A;  4FR7 A;  4EXS A;  5B3R A;  4Z67 A;  3I15 A;  1L9Y A;  2OHI A;  3IE1 A;  2WYL A;  2YNW A;  2Q9U A;  3PG4 A;  2GMN A;  1DD6 A;  5EWA A;  2QIN A;  4D02 A;  5LMC A;  1YCG A;  4C1D A;  2P4Z A;  3DHC A;  5A87 A;  5LCA A;  3X2X A;  4Z7R A;  5HH4 A;  2UYX A;  4KEP A;  4C09 A;  2NZE A;  4TYF A;  3WXC A;  5ACT A;  2XF4 A;  2QED A;  4P62 A;  2H6A A;  4UA4 A;  5LSC A;  1BC2 A;  3SPU A;  5IQK A;  2QDS A;  3FCZ A;  3AF5 A;  2Y8A A;  3AJ3 A;  4YSB A;  2NZF A;  2DKF A;  3IE2 A;  2BGA A;  5DPX A;  3I14 A;  4B87 A;  1KO2 A;  2FM6 A;  4BP0 A;  4UBQ A;  5ACR A;  3ESH A;  2WHG A;  4TZ9 A;  2BG2 A;  4EYB A;  2FU7 A;  3IEL A;  2NYP A;  1WW1 A;  2I7X A;  4ZNB A;  2Q0J A;  5HH5 A;  5LE1 A;  2GFJ A;  1MQO A;  4C1F A;  4NQ5 A;  2FU9 A;  5AEB A;  3IE0 A;  4EYL A;  1XTO A;  4BZ3 A;  2E7Y A;  3TP9 A;  3SW3 A;  4Z5Z A;  4FEK A;  4TZB A;  3VPE A;  2YZ3 A;  3ZQ4 A;  4GYU A;  1QH5 A;  4U4L A;  3I11 A;  3PY5 A;  3ADR A;  3X2Y A;  4PVO A;  4CHL A;  4F6H A;  1KO3 A;  1X8H A;  4C1H A;  4HL2 A;  5HIO A;  4NQ2 A;  4TZE A;  2P18 A;  3BC2 A;  3MD7 A;  4D1T A;  2WYM C;  5EV8 A;  4D1W A;  1HLK A;  2XR1 A;  2M5C A;  3L6N A;  4UWS B;  3SFP A;  5LS3 A;  3QH8 A;  3T3N A;  1JT1 A;  5B15 A;  1X8G A;  3BK1 A;  3FAI A;  3RPC A;  2Y8B A;  4RBS A;  2ZNB A;  2AZ4 A;  1SML A;  2AIO A;  4ZO2 A;  5ACS A;  2BIB A;  4UAM A;  2CBN A;  3I0V A;  2FHX A;  5FQB A;  4AWZ A;  2A7M A;  2R2D A;  4KEQ A;  3X2Z A;  5EVB A;  2ZZI A;  4HL1 A;  4J5H A;  2P1E A;  5K4N A;  3VQZ A;  1WUO A;  1KR3 A;  2Q0I A;  1VJN A;  4RAW A;  3IEM A;  5HIS A;  4PVT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...