1WUZA

Structure of ec1 domain of cnr
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
103
structure length
103
Chain Sequence
GNSQIHYSIPEEAKHGTFVGRIAQDLGLELTELVPRLFRVASKDRGDLLEVNLQNGILFVNSRIDREELCGRSAECSIHLEVIVDRPLQVFHVEVEVRDINDN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Pcdha4 protein
publication title Structural diversity of the first cadherin domains revealed by the structure of CNR/Protocadherin alpha
rcsb
source organism Mus musculus
molecule tags Cell adhesion
total genus 12
structure length 103
sequence length 103
ec nomenclature
pdb deposition date 2004-12-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08266 Cadherin_2 Cadherin-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.60 Mainly Beta Sandwich Immunoglobulin-like Cadherins 1wuzA01
1FF5A 4XXWC 2WD0A 2OMVB 3K5SA 4ZMZA 4AXWB 4ZMOA 2O72A 2WBXA 3Q2LA 1NCGA 1SUHA 3LNEA 3FF8A 2A4CA 4NQQA 1EDHA 3K5RA 4ZTEA 1OP4A 1NCHA 4AQEA 3K6IA 2OMYB 3UBGA 4ZMLA 3FF7A 2OMWB 2YQGA 1NCIA 4AXWA 5DZVA 2WCPA 1ZVNA 3LNHA 2OMXB 3Q2NA 2YSTA 5JYLA 3Q2WA 4AQAB 4NUQA 4ZMVA 3LNFA 2OMTB 4AQ8A 1WUZA 2V37A 4APXB 4NUPA 5KJ4A 1NCJA 1L3WA 3LNIA 3UBHA 4ZMTA 3UBFA 5CO1A 2OMUB 4AQ8C 2A4EA 2QVFB 4ZI8A 2OMZB 3MVSA 2QVIA 3PPEA 1O6SB 1ZXKA 2WHVA 2X2UA 4ZMYA 4AK1A 2EE0A 3QRBA 3Q2VA 4ZMWA 4AQAA 3LNDA 4ZT1A 4ZMPA 1WYJA 4APXA 1Q1PA 3K6DA 4XXWA 4NUMA 4ZMNA 4OY9A 4ZMQA 5CZRA 5JYMA 3K6FA 4ZMXA 4QD2E 4AQEB 3LNGA
chains in the Genus database with same CATH superfamily
2GK0A 4PS3A 4YDIL 1DQTA 4LZKA 3AAZB 2LU7A 4L1DA 4Z0XB 3UX9B 4WUKL 4GAFB 4WJ5B 1BM7A 1RIVL 4GEJA 1F8TL 4ZNEA 1DVFD 4JFFB 2ENYA 3RWGA 4BSJA 4L9LC 4XRCB 3WIIL 5E2TL 5FEBA 4JFVA 4BFIB 3TBWA 1ML0A 2Q86A 3TPUB 3SPGA 3ALPA 1E4XI 3UTZA 3ZO9A 4Z7WF 5D2LB 5ESVB 1MUJA 5LAXB 4ANKA 1NFDB 2P8MB 2AV1B 2ERJC 4IKJA 3ASWA 2J6EL 2CIKA 1BFOB 4F57H 4HG4K 2CKBL 1NC4D 1MFDL 3IU4L 5BQ7A 3AQXA 5C0AE 4DFHA 5T3XE 3A6OA 5JPNB 1BV8A 3QUYD 2AFNA 2XKNB 3QJUB 1KYAA 4CBZA 1A5FL 3IBEA 1E9PB 3BOVA 3OWRA 3KGRA 3FH8A 1MI5A 1U8QB 4Z7WB 5BRZA 1OB1B 4WK2B 3VA2C 5DDHB 1R5WA 3RWIA 2VISA 1E3ZA 2XUWA 3ZE0E 4AGNA 1EEYA 3VGAB 2KL6A 4I9WE 3PWUB 3WDHA 4Y5YC 2NY6D 3O3UN 2DQFA 1TFPA 3IMSA 4RGOL 5C71A 2O5XL 4OLVH 2ZKXA 1B3IA 4DT2A 5DMYA 4ODBD 3WY2A 1HE7A 1K72A 4JO2L 4ODSL 1OCRB 4A1RA 5DFAA 1KWGA 1M7UA 1OGPA 2BIIA 2W0PA 3QIBB 4L3EA 1NMAL 4RAVA 3S3BB 5EOCJ 3MV8E 2OFQA 4JKWA 3D2UB 5HYFA 4DUWA 4N2IA 3E8VA 1X9RA 3MRRA 4JPVH 5AAMA 4EPSA 4FNLH 3M7FB 1CFVH 4NFDA 2WN2A 3FPYA 4CJ0A 5GIRA 1K8DA 5I71B 4JFYA 4BRVA 5IQOA 2G5UA 1I1RA 3X3FH 2V8MA 2Y7MA 3B56A 3ZHNA 4JPWH 1AJ7H 1BMGA 2VABB 3BT2H 3GJFA 3Q5YA 3QJQB 4PJGE 5ABAA 1ZE3H 2H3NB 5CJOL 5GISL 2CDFA 2X42A 2B0SL 4JK0D 3P77A 2BWQA 1IGFL 2R2EA 3ZDYF 4FEMA 3FTSA 4JFUA 1G7LB 4UB0H 5IMLB 1ZLSL 4HT1H 4CSTA 3OAYH 4LF3A 4KK6C 3O6FC 3BWAB 1UADC 3MRMB 4U6YB 5E8OB 5T5FH 3MRQA 5IJVB 4FTDA 1UD2A 3C6SA 1EMTL 4BKSC 1CDIA 5TFSH 4G6ML 3V0AC 1BGXL 3HBZA 3WD5L 2GJZB 4AEHH 1CPUA 4PB9L 5IVXE 1U93B 4WWKD 2N1TE 4P4KC 3ZRSA 2EH8H 3ZTDC 1AOHA 3QHTC 4DO6A 2H0JA 3U7YH 1LO5B 4Y7OC 1LMIA 4Z7UF 3T0AA 2XFGB 1KJ2H 3G5VA 2P7TB 3Q05A 3QEQB 4S10A 3MSPA 3FAXA 2E74C 5C0CE 5I1GH 4G7YL 2E0PA 1CL7H 2CGYA 1TQVA 4XN4A 1UWFA 5DS8A 4WU7A 4KDWA 4N2AA 5B1JC 1IC7H 3TU6A 3ZTJG 3BVUA 3GMQA 3VJ6A 5B39A 1MCWM 4YSDA 2BRRL 1KCSL 2K8QA 1ZT7A 2YK1H 2XSKA 4GBXB 4HXAH 4R4BA 4YBQC 4J3UA 1F41A 2BSBA 5FV1L 2ZOKA 2OYKA 2YAMA 5D4IA 3QIWC 4QRTA 1AKPA 4NQCA 4HKXB 1IQWH 1AKJB 2PLTA 4PRNB 3WO4C 1KPRB 3I9GH 3PIQB 5DGQA 3RGVC 2ZZUT 2BSED 3MA7B 5EORL 1T66D 2VXQA 1ZWIA 2XWBA 3FTZA 4MBRA 3W9DA 4Z7IA 4PJAF 2UUDH 3RTQB 1SRDA 2XLLA 2DEXX 1NBYB 3GSXB 35C8L 3PNRB 1QRNE 2NR6D 5F0PB 4ZXBA 4HUUB 4C83A 4L4TA 3ZE2B 2JCCF 2OP4L 3ARQA 4X8CA 2G75A 4HCRA 3QDJB 4Z23A 3WS3B 1M7IB 2NNAA 4BA8A 3QUKB 1XV8A 4AJWA 3QZMA 4PJAB 5FLVA 5CJQH 5EMYA 3PNWB 5LDSA 5IGXH 2G5RA 4ZMVA 1QSFD 2MWCA 4XMLL 5JOFA 2VC2H 1TPXC 8CGTA 1KGXA 3DJSA 4HGWA 1BLNB 1PLAA 2VUKA 3EYSL 4D8PB 4KOBA 3B9VA 5FX3A 4DPRA 4O2CA 3ARFB 4DO5A 5E8PB 4MQ7B 1QFHA 1U92B 3GBNH 5L9DL 3WFDH 1H19A 4PB0H 5T5NG 2I9TB 4UQBA 1MY5A 5F9JB 1ZS8B 1UASA 4CN6A 3NFNB 1YEKL 1UWXK 4LGRB 4YPGA 1YEFL 3T0BA 3BH9B 3LRLA 4JFFD 3DX9B 3TZVA 2R8SH 2H2SC 3ZDXF 4PJ5A 4XPAL 4YGVA 1DN2A 4A68A 5FM5O 1GTFA 4OIBA 4C47A 4R4NC 4XVUC 1QYGL 4I48A 4F3FA 1W8OA 3HAEG 5IJBC 4J8RA 3P9WB 3HRPA 1B6UA 2ZOUA 1Q90A 2ZCHH 3MJ7A 3VWJC 1BBDL 5ENWB 1ZAGA 5CKGA 4UYQA 4OCRL 5KSAA 3E9UA 3E1F1 3WY1A 5I9QC 3MRBA 4IK7A 2Z8RA 5GS0D 4KK5C 4ILDA 5E00A 3WMPA 4R2GB 4XX1E 2A1WH 3MRIB 3S8GB 4CW1A 1BD2B 4J3OD 3K72A 3WFHA 1RIUL 5L2JB 3X12B 4HEMA 3A67H 4UAOB 1U3YA 4OFKA 3BAEL 3MRCA 3B3BA 3V10A 3ALWA 5C8JB 1KEMH 4K3DH 3TM6A 1S78C 3IMWA 4BFNA 3TBSA 1G7MB 4X7DC 4G8FB 1FNLA 2GJJA 4LK4A 5JUEL 2VDKL 2GSMB 3EZ8A 4WY7H 3UTSA 4CADA 3S48A 3ZKMC 5IHZA 1GTNA 1QRKA 3QIBD 2HH0H 3BKJL 4NKIH 5FAAA 1YRKA 4OD3L 3D2UD 1TKWA 1WIUA 1DUZA 2WV3A 3FC8A 1G9HA 1J9QA 1SYVB 3WENA 4MJIA 1E4HA 4HUKB 3E2HC 3NH7L 3O2DL 3EYFB 1O5PA 1XR9B 3QFJA 3QWRD 4N26A 4XBMA 1OAYH 2FQDA 4WNSA 4WO4B 2OXGA 4P46A 2A9AA 3IN0A 4XP6L 1FN4B 2WQRA 3KD4A 4PV9A 4WQOA 5DGRA 3SBPA 2VLRA 1UA7A 3ARSA 2WXJA 3KWVA 1CU4H 4U1JA 1G5AA 1NBQA 4DZBA 4Y4FC 4JHVA 4P4KD 2VLLA 3SPCA 5KVMC 2YO3A 3L5WB 3O41B 2HFTA 4IKLA 4L8SA 4XTRD 4A66A 4F91B 4YSRA 4RGNC 2DQHH 5I6OA 1GJIA 2X40A 4X98A 3LHPL 4D3CH 3T6VA 1RSFA 4EJ1C 1I9IL 4ZUWA 1BFVH 1UH3A 1UB5B 3K4DA 1J1PL 4MCYB 5C09E 4YHYC 3UTTB 4K9EL 3MNWB 2VXTL 3MCLH 4M6OL 1OP3K 4HBCH 5E56A 3L1FA 4KGJA 3LRSA 4Y2DA 5E8EB 5B7EA 2VXSH 2R69L 3QEQD 4XAKE 4LCVA 4PW4A 4UTAH 2IDFA 3MV7A 2R1XB 5KYXA 3FTWA 1K5NB 1C7SA 1NGPL 3CH1B 5D7JB 1U8JB 5IQ9B 1G4MA 4NRZA 1KBGH 2UWEF 3PU7A 3HZVA 1VFAA 3CX5K 1SVCP 4G9DA 1IFHH 4ZW8A 5D6CA 2CPCA 5LAPA 1ZGLM 4X80H 3PQYE 2CJUH 4GBXD 4MJHA 1ZS2A 4P5SA 3NCYS 4HC1L 5EC1B 4GW5B 1CGWA 5C0EA 2NPLX 4PJHE 2NT0A 3UZEC 4QF1A 5FM4A 2VAJA 4HJ0D 2VL5B 2DQDH 3TWYA 5ANME 1GYWA 1MJ8H 3R19A 4PGBA 4AI7A 3TJHD 3N41B 1GGIH 1UWEL 2HFGL 4G1EB 2OAAA 3B34A 3T1FB 3W2DL 1F0LA 1KBWA 1KDJA 3NA9H 3PGFH 5BJTB 3CVHA 2Y36H 3QDJD 4FF9A 4JQIL 5DHVH 2VAAB 1T22B 5HDBB 4H25B 2WWKT 3FFCE 3E8UH 3LN4A 2WINA 4P9HC 2PWEA 4QKTA 3C5XA 2UX7A 1CXFA 2VL4A 1U6AH 2WMPA 5C0IB 3N42B 1OEZW 1G1YA 3KM2A 2H2SD 2HG0A 2YPKA 5L88L 2Q6WB 1T1ZA 5MERA 1QO3A 2B1HL 2ZQKA 2FX7L 3T1WA 1A3LL 2ODIA 3KPQB 4DESA 3EFDL 1R3IH 5D71L 3MBEA 2AZUA 3PJSA 1FYTE 1KCUH 4BHUI 5IKCB 4AUJA 5L4IA 2QLYA 3FN0H 4FXGB 3OC5A 4PI0A 3SDYH 1ZK9A 2YEZB 3NIFB 2EDBA 4Y2OB 4LCWE 2D0FA 1A3QA 1T0OA 1FQ9C 1G7QB 4ZUVA 4CC4A 3U4AA 1SEQL 1NL0L 4PJFA 5MENB 2CCVA 4OTXL 1N10A 4EIGB 2DAVA 3KPPA 4Z7VF 4ZO8A 4PJEB 4CSZA 3RU8L 4HJ1A 3MREB 4HGMA 5HGAB 1JVOA 2D2OA 4FQPA 3NACL 2XNAB 3D39B 1MHPL 2P5EE 4XXCC 4IBZA 2IBBA 1U8HA 4HIJA 1BVOA 3PAZA 2BSTB 2Y0SA 3NZ8B 5GS2H 1BD2D 2RCSH 2O6FA 4Q89A 5GXBB 4W70A 4XMWA 5AOZA 3RVWC 4F20A 3BQUA 1TQCB 1J05A 4ZD3H 1G9NC 1CDBA 2AMUA 2YUXA 1A1OB 1EXGA 4OZ4A 5EUOE 5SWZE 1HL8A 3OM3B 5IMKB 2NYZA 4KX7A 4GRMA 4XMKH 2IC2A 1SXSA 3GTVA 3VD2A 1LEGA 1LD9A 4ZMWA 2DIEA 4KKRA 1W0WA 1BZ7A 9CGTA 3II1A 1F42A 4NIYE 1QP1A 4PS4H 5GGUA 4PP2B 4ANXA 5LN4A 1AP2B 4O58H 4Y4FD 2MEJB 4P0DA 3KBHE 4JPSA 5HVGB 2D7MA 2E27H 5E5MA 4RGND 2COQA 5CZXC 1R3HA 4L29A 3D1MC 5IVNA 4WO4D 2CDEA 4N0CC 5C7ZA 4ONOA 1P4LA 1X9UA 4JNXA 4W9ZA 3UG5A 3RFZC 2N7AA 3F3HA 1DQML 3HJ0A 3U4KA 4ESKA 1YC8A 5A6LA 1FCGA 4OM1H 1OHQA 1DEEA 1KENL 2O5YL 2AJ3A 3TT3L 3WEMA 1QKZL 5JXEA 3JWNC 2E3VA 3QJTB 1I3UA 1F6AA 3D4GA 3FUFA 4GRLA 1GZQA 4F58L 3T3MF 1YLBB 1OB0A 2R0ZL 3F85A 1J8RA 2J1WA 2UZXB 4OB5L 4FFYH 3UTTD 4IMLA 1SBBA 1QG3A 3MPCA 3NFSH 4JDTH 5I15H 4AOFA 2AJSL 3ZT5A 3KPRA 2HN7A 3LCYA 1D7FA 1GGBH 4L3CA 4GUPB 4YIQA 5F9WB 1HZHL 4NI3A 2GEEA 4JCLA 4XNXL 2Z31C 3T2QA 4TRPH 1B2WL 1ACYH 1K2DA 2VDRB 2WYHA 3MLVH 2F8OA 1P7QA 4H0GA 1RFDL 1P9MA 3NT0A 5D7JD 4DP6X 5D55A 5KVGH 4NYLA 3O4LE 1SFHA 4KZEL 2RJMA 3U30B 4OIFA 1IAIH 3RJOA 1F6FB 4JY6A 3SIKA 5BMFL 4ETQA 3VQMA 4HJSA 2NRDA 5D1QC 5E23A 2CGRH 5DJAA 2DMBA 3CDZB 3W5MA 4GSRA 1DVSA 1IEBB 1PZ5A 2YGNA 4ZS7L 1XF3A 4PBVC 1M4KA 1HWHB 2XV6B 5EZOH 5DD3H 3EUDA 2EYTB 1OSPH 3UTOA 3ZK0A 1O7VA 2NSXA 1IM3A 4PGDA 1MJUL 2FD6L 3S3CB 3K46A 3CXDH 1A6PA 1BBJB 2R4SH 1A4JB 2OMWA 1TXKA 3L3OB 5FYJD 3CPUA 1L5GA 1YPZE 5T1LA 3RVTD 4K23H 4I5BB 2VN4A 4Q6IA 4NT6B 1ZGLB 4AYID 4KQ3H 4KO9A 2X2UA 4PRAA 2ICES 4HGKC 4XB8A 5FO8A 3TYFA 4HPOH 4DKTA 3CNKA 1FVDB 2OL3H 1T80A 2B5IB 2CO3A 1NIAA 1A14H 1HAWA 1JZDC 3HA0A 2HXAA 4N3UA 3QQ9C 5AFAA 4YHML 1FLRH 3H9ZA 1WV7T 2PXYA 3GK8L 5IVZA 4PJ9C 1DLFL 3BUTA 3DV6B 4HLJA 4GQQA 5TK2A 3V5KA 3QCUH 3U4BH 5C86A 3X1BA 2YPLD 1FVEA 4MCMA 3ULUC 5DJCB 2FBJL 1I8LA 3KS0J 3MRNA 4AEEA 1H8NA 3ULVC 4NLHA 1M2VA 1I7RA 3FMGL 4Q0XH 2L7JA 5K59E 3B83A 1SJHA 3MX0B 3S5YA 2IDQA 5MEND 2BOLA 5D7LB 1ZHBB 3MO1A 4UT9L 1UOKA 2IH3B 3B2PA 4PBDA 1DSYA 4O51B 2ENQA 1DBJL 3IDGA 4P3DB 5TK4A 3C2AH 5I8CA 2OK0H 4ZYKA 4E42B 2UXTA 3FB5B 3D39D 5FFLA 5KYWA 1RP9A 1A64A 4JFXA 4QOKA 3UBXB 4LASL 4TSCL 1AZBA 3NUKA 2GKIA 2EH7L 1RI8A 2VNCA 1BQHA 2ICWI 4H5SA 4NO3B 1EVUA 1F4AA 1OW0C 2BY3A 3IEAA 5EUKB 5T5NF 1E3FA 2X4OB 3KCWA 2WZ6A 5DEZA 3EDKA 4ZTPL 1NJ9B 4QJ5B 3CDGA 2XOTA 3O11A 4X5XB 1OAZL 3QQ3B 5FCUL 2CGZA 4X5WA 2VB5A 5HP5A 4K7PX 1KY7A 4JHBA 2D3LA 1FCCA 2HUHA 2ZOWA 3F12B 2GIMA 2BW5A 2JJSA 5IHWA 5CEYB 3A47A 1R3LA 4EOWL 4OCMC 3S5LB 4IBWA 3O45A 1Z9NA 3MTRA 2IV8A 2NTFB 1AR1B 4AYBA 3OKOB 1CD9B 1TETH 1JP5A 1QATA 3CPLA 5DR5H 1M7XA 2ZXEB 4NUQA 2JSFA 4PVBA 5KOVC 4I7ZC 3CSPA 4X6EA 4KTGA 1GKOA 1B4JL 1R1CA 5FGBC 5INCB 2WZPD 1JXKA 3MV11 4F7CA 5CD3B 4NERA 3HLAB 2DQCL 1WAAA 1TU2A 4GO9A 3SJVE 4Z7QF 3AREA 1UOWA 5FGCE 1U42A 4ONHA 2ZCZA 4DGIL 2VSDA 1TTBA 5DMGD 2CBQA 1NEZB 2OA9A 4MRCA 4L8DA 1XH3B 3STZA 4AKPA 3PF2A 2C7FA 4DAGL 5GJSL 3SDCA 1AAJA 3PAUA 4GMTH 4MDJA 4I0PB 4N2FA 4D9LL 3AXLA 3MAWA 3MKKA 1KBPA 3MLRH 5PAZA 4YHKL 5I0ZA 1AHWC 3WS6C 4NENB 1H15B 2IH1B 2E56A 4XMPH 3TIDA 2DLIA 3FBQA 4OZGF 4DHLA 2CRZA 3L4WA 3NCXA 4ALAC 5DRWB 3EKCA 2BY2A 4K71B 4WTQA 2BWDA 1N70A 2N01B 4JGMA 3TVMA 1AI1L 3EOAB 2DWYA 4OIIH 1YMHA 1QBAA 1VACB 2JJTA 5F9OH 2WQUA 3QPXH 5LBSH 1WWWX 4DETA 2HT3D 2G5BA 3MNVA 1T89C 3QNZA 3QWOB 3S35H 2IPUK 3IMVA 2OMNA 3RG1C 4MRBA 5EOTB 1HEHC 1SYSB 2BSRB 4PSPA 3V7AE 1PQZB 3KL5A 3FUJA 1AG6A 2B3IA 3BRFA 5C0AB 5DO2D 1Q38A 3DGDA 4FHBD 3ML9A 5I1IL 1JZHA 5IOKA 2FK9A 5F7DB 2Q2EB 1I7UB 1A2YB 4UQ2B 2HRPL 3CZSA 5DC0A 3DOSB 4U05A 1PZBA 3ZE0B 4GQ9H 3TIEA 2D73A 2YRZA 2JTDA 1BDYA 5IB2A 3OKDA 2HAZA 3VXQB 3B7RL 5DYFA 3IFLL 1JYWA 3L17A 1L6PA 3M17A 1KLFB 4DKDC 4NO5A 3RZCB 3UYRL 2FJGB 2FX9H 5GGSY 2VDRL 2J72A 5ESAA 1X5YA 3MV8B 3DOHA 2E6PA 3BAYA 4XC1L 1DZBA 2C1OB 1ERNA 5BS0A 1OP5H 2Z7YA 2E4TA 4M93C 4MMZA 5AG9A 1IEHA 1AD9B 2HTLC 1ONQB 3EZJB 3Q01A 2BK8A 1DO5A 4QMEA 1WA0X 2CZNA 4PJGB 4XWGL 4AZ8B 2L04A 5CIPB 1FZJB 5E1AA 1KCRL 1N67A 4PRBB 2I9LB 4KZ0A 2X6UA 4POYA 5C0ND 2VITA 1ZA3B 1PNDA 1THCA 5KJRL 3NRQA 4RVBA 2D7NA 1CR9H 3KYKH 2GITA 3BD5A 3QR2A 4JHAH 5D7LD 5F44A 3ESOA 1UWYA 3CH8A 4ONGL 3H42H 3G6AA 1N5AB 2P5WE 2BY0A 1A7QH 1MAML 3T8XB 3S3JA 4H7VA 5IVXB 3K4ZA 2ARJB 3QR1A 4M5TA 4NJ9L 4Z6AT 1FFPB 4IBTA 3QCVH 4FI8A 1HYRC 4JVWA 3WNLA 1T4KB 2ADGB 3MRHA 1KPUB 2Y7SA 3BUPA 2WCSA 4JQXC 5JQ6H 3G6DL 2WBWB 5LQBL 3N5AA 3P4MA 2GYSA 3N85L 5C0CB 5LBVA 3NJIA 1GC1H 4YLBA 5ICXA 4GAGH 5DUBA 3RBSA 2AK4E 1KNOA 2W65B 2NW3A 4MCZB 3SGDH 1OCWL 2BX5A 3I9IA 3AY4A 3MJ9L 5JORA 4X4ZA 5BOZG 1QVOB 3JVGC 3K2KA 3GI8H 4PY7A 1AR1D 1ZD6A 3L6FA 3HR5A 4KHTH 4MXQD 4BZ1L 1ZV5A 3FRPG 5DZNA 2NY1B 1XF2A 2Y24A 3CGTA 1VA9A 1AC0A 1CE1L 3BDYH 2D4DA 4RETB 5DJYA 5BXFB 1BX2A 4G7QB 3SBWC 2P48B 2EYRA 2VLKE 5I6NA 5SWQB 3P0GB 3T08A 3VE0A 2F7RA 1WZMA 1XGTB 1ZTXL 4BFKA 1T03H 1U8NA 1QRNB 4L5FH 3CVCA 1G6VK 4A37A 2Y07H 4LCIH 2Y9RT 2GCYA 4ZFQA 4U0RC 1SDYA 4L8CB 2E6QA 1UM4L 1JCKA 3KWWB 3KG5A 3DX1A 3L4YA 3SE9H 4DGWC 4M7JL 1L9RA 3T2PA 4KNQA 5EZPA 4I0PD 4I18A 1ZA6B 5C3LD 1QR1B 4WUUA 3GXFA 4OGZA 3S36X 3TN0B 4CMMA 3NZHH 2VDPL 1OZTG 4XNYH 3V0JA 1ORQA 1S9WA 2BH0A 1LO3L 4X8JA 3KPOB 1U9KA 3VO0A 4OGAC 2O5ZL 2AJZB 2BMKB 1W0VA 3OKMA 3TGXA 4QUOA 5I2IB 5E2UL 2DRUA 3CZLA 3QXWA 2Y6SD 2YMOA 4ODHL 2R15A 2EDKA 3IFOA 2RQ8A 1AXTL 2GY7B 3AQDA 1XR8B 4CBPA 3UYOD 3H8NA 3RWFA 4CSPA 1DJHA 2AK1L 1INQA 1KF9B 5E70A 2Z0BA 3NABL 5FOJA 2V17L 1VZGA 4GKSA 5DK2B 3ZKXC 4Q56A 5I0WA 3VXMA 3UPAA 25C8L 2D3VA 2YPVA 2GG1A 2XY2A 5EZIH 3UAJA 2JV6A 5CJXC 1PX8A 1I9JH 2FHBA 5DWUH 3RGHA 3KLDA 1N26A 5DCCA 1YEWA 3FOLA 1AQ8A 2PCYA 3HHSB 2MNJB 3W56A 4FTVA 1L7TL 3MRGA 2PMZA 5F71A 2H4EA 5KBPA 4IIQB 5JPMC 2NUTA 1KTDA 4YFLF 3X14A 3OB8A 1B2YA 3B43A 1UCBH 4FQCH 3DK0A 4KRLB 1UYWH 3ELQA 4WZ9A 5F88B 4QRRA 2YGQA 4FXKA 5TF1L 3NDYE 1F13A 3TV3H 2QT6A 2V5RA 4GG6A 1PKOA 2CDGB 3L9RB 1RZIB 3I02A 1SEBA 1VFBA 1NZRA 3F6LA 5AOMA 4FI6A 3GIZH 1CG9A 2ED8A 5GGSB 1RULL 4AQOA 3RZCD 3EBIA 2XBZA 1OXYA 2HFEB 2ZPKL 4OI9A 1KV3A 3MV8D 2ZNWA 4G11A 1S7RA 3X2QB 1NOLA 1YNKL 4I77L 4TNWF 1EFXA 3HS0B 3QDME 2JI1A 5I1EL 3B2DC 1CYXA 1RVFL 4HHAB 2ICEC 4KHXH 1HHJB 2WK2A 3MCKB 4YDJB 5EEVA 4HISA 2EZ0D 2XKSA 3WFEL 4Z3HA 5E24E 3QB7C 2E9IA 1Q72L 4LIQL 4FJ6A 4H1LB 2ZUQC 4OLXL 1YNTB 4M8QB 4MGXA 5FECB 4N28A 4UILL 2CLZB 1QLEL 4UZSA 3GSNB 2WXOA 5IUCA 4GW4A 1LWJA 2Y6TE 2VZ1A 3HN5A 1A6ZA 1WLHA 4R26L 1LO0L 4AVKA 4NM8H 4P2RE 5C09B 3D52A 1JGLH 1UFUA 4ANVA 3ZN6A 4PJ7A 5D7SH 2X6AA 3X13A 4G8GE 2EEFA 3OKEA 1U21A 3CAFA 1NFAA 2EE3A 1K6QH 5KSUA 1L0QA 2WP3T 2F19H 5C0CD 1WBXB 3CSTA 1NANI 5KJ4A 2ZYHA 3B1UA 4XNQB 3UO1L 4R83A 4XN2A 4D0CA 4F7MA 3VRIA 2WBJB 1YSOA 3BN9D 3UBFA 4M7KH 4ZZFA 5DFVC 2R4RL 2V6HA 2W07A 1A6TB 4QCIA 4C55A 1H3GA 4LAQH 2KYIA 5I26A 5T33H 1CFNA 2RGSA 3EYQD 5GRYA 4JKLA 2FDBP 5JIHA 2AEIT 3PQYB 3HI6H 2R0KL 3NJXA 4N6RA 5LBGA 4QYAA 1KY6A 5I0YA 4F24A 3GMRA 3BKCL 4WHCA 1LGVA 4X5QA 4PJHB 3B2XA 4LMQI 1VESA 2NY1D 2Q3XA 4DPAX 5E8DL 1RZJL 2PCXA 3WG7B 1BFSA 3B9EA 3J8F7 3MNZB 4XPFH 5ANMB 3TEWA 5FA4A 5CSZA 4YHIA 4APQC 1ZSDA 4K73A 3QO0B 2XWCA 1NFIA 3MUUA 1CFTB 4WLCA 5D2NC 1OK0A 3V52H 5J13C 3TWCH 2YLKA 1QRND 3OD3A 1H0DB 4WI4A 4Y4KC 1KGCE 3VXNB 2KLRA 3ARZA 4ZG1A 2XZQH 3QHZH 4HS8H 2PABA 4Z0BL 5TQ0L 4WI2A 4XXWC 5IMMB 3QAZC 4TSBH 3W0WE 1JHTB 3FFCB 5DZPA 1H3PL 2GI7A 1CXKA 3CFEA 5I28A 1C5BL 2EIKB 4PRPA 5FYLH 4IIZA 1RAMA 3WJJC 4G8IA 4JPKH 1HK6A 1VB9A 5ACZA 2A9ML 3D25A 3CFDA 4DZ8B 3TN0D 4ZUTA 4OGYH 2XY1A 3KPTA 4RFEB 2GI0A 4FNPA 1HXMA 1PIGA 4HCRH 1JXGA 1MCQA 1Z3GH 4WI9A 1BWWA 3OV6A 1SOKA 4IS6A 4MJ5B 1FYTB 5E9DA 3WGUB 4YAQA 1H5BB 3VI3E 3H3PL 3HI1B 3NVQA 1F56A 3FU7B 3S3PA 4LCWB 1IKFL 3QEHB 5H4YA 4UTBL 1TQBB 4HFWA 5CBAB 1A7PL 2JK5B 1LE5A 4R5VA 1T5WB 1IBGH 1HSAB 3QORA 1HSBA 4WJG3 5DT1L 3VH8G 4MA3B 4Y9BA 1R5IB 4RWYL 4P57B 4NHUA 1K9TA 3S6CA 2YQ3A 1KGYE 5KZCD 4IHOB 4Z7OF 2E9BA 3PWVB 1WSST 1OAKH 1TQSA 2B1AH 5FV2A 1T7ZA 2P5EB 1GH7A 5HHPA 5LGJA 2AXWA 2OI9B 5C0JB 5KSVB 3WXWL 4H4NA 4FQJH 1C5DB 2FX8H 3GXPA 5BOJA 1K4CA 2Z93A 2NY3B 4IMKA 5HYIA 2AQRA 3MACL 4YE0A 5JOPE 3QDGA 2WKOF 3SCMB 4H20L 5FGRA 3LZLA 1RUAH 4XPBH 5SWZB 5EUOB 4AIOA 3PV6B 4QHPA 2R2BB 2W9EH 4K07A 1TZIA 3BWZA 2X4QA 2MPAL 1P7KB 4OLZL 1JVLA 4XP4H 4PLKC 1XBDA 5I19L 5EU5B 1NSNH 1DVFA 4XN7A 3UCQA 1WHPA 2X3CA 2WQVA 3AABA 1Q94B 1OT1A 4G7RB 4EZMA 3ZE1F 2E4FA 1HILA 1LXMA 2LU3A 1MI5E 2GJ6D 2GSGA 1MOEA 2VW4A 1MFVA 4KKNA 4XVTH 4JBSA 2GFBB 1NC4A 3E3QC 2R2CA 1IC4L 3UPRB 3VDBA 2FWOB 3U1SH 1ZHKA 2Y06H 5IBTH 3QUYA 4LKXB 2W91A 2Z4QB 1I1YB 3T77A 1CICC 3MJ8B 4UDTA 3EXJA 2ZUYA 3P0VL 1CGVA 4F57L 3ZX1A 4JKPH 5TDNB 3M1BA 3KWUA 5ECGA 2HYMA 3IDYB 3MV9D 2W94A 3D09A 4QGTA 1S7XA 4HETA 4BWWA 1DVXA 3HNTH 1EAPB 5J8OA 1I4FB 2NY0B 1GGCH 4PTUA 3M46A 2VT0A 4E41D 4PJBE 2IMMA 2ZX9A 5C09D 3NJKA 5DFVD 2BZ7A 1ZLVK 1NCAH 3SQOH 1OD9A 2AXFA 3RNQB 3T2LA 4ZPVB 3PDOA 1SQ2N 2NXYC 4O5LH 3MN8A 4NNPL 4XAKD 2FWUA 1O0VA 3P1VA 2A0LC 1DVZA 4OAWB 1HQRB 4Y8AA 2O6CA 3O3EB 3IVKB 2OMUA 4NWTH 3CLEH 2Z1PA 3D06A 5IHHA 3IFPB 3HPJA 3X11A 3ZU8A 2FB4H 1K4DA 3G7TA 2HT4C 2WBJD 5DLLA 1O7DC 3UJIL 4M6AA 3NCWA 5HGDA 1JPFA 1IILE 1KSRA 2FUTA 4IKNA 1TQTA 3O4LB 3A4DA 5DEGA 1IAKB 5L6YH 3CQFA 3GI9L 1ND0A 4JPVL 3ZHLA 4WSGA 1TQWA 3BLPX 5CR8A 4HIPA 2E76C 5MEQA 2DI7A 2IH8A 5I24A 3X3FL 2X0VA 1YPZF 4W9KC 5DMJB 5JW4M 3FQ2A 4FNSA 3IMRA 4XNDA 3REVA 1NDMB 1S6NA 1E8XA 1OGTB 4H0LC 1AGCB 5HDWA 4N8PA 4AENA 5BV7L 4JFZH 4HJGB 3FSWA 1NMCC 3FDWA 4JZOB 3T6WA 3T2OA 3FULA 1B4LA 2FECI 3IJHB 3MLXH 2H6PB 4HOXA 2P9RA 2BW4A 2YGVA 2VDLL 4XBGA 1M57B 3ZVVA 3VXUE 1WK0A 4KUZH 5T5FL 1YPZB 1OIOA 2GVYA 4LP4A 5GRUH 5CHNA 2J8UE 4MNHA 2DMKA 3TFKC 4IU2A 5JR1L 5TFSL 1IBHA 2V5SA 4F8LA 3FFCD 1SDDB 2JKLA 1MCWW 3TESA 3MGOA 3OB0H 3L45A 1KXTA 2EH8L 4TTDC 1MELA 3EJQA 1PLGL 1U8KA 3UZVB 1DBML 3ES6A 1KJ2L 2IBGA 2O5NA 4FQXC 4CN4A 5HYQB 1T6VN 2X6MA 5K59F 3KZ8A 4NNYA 3FO0H 3CK0L 1CL7L 3L1EA 2ZYSA 5DFTA 4JFPA 1FYTD 1L9MA 1RZ8A 5IEKA 5IIEA 3ABZA 4L4TE 3IDMB 2BSEA 4FG0A 5EBWA 4UBDC 1HIML 1MLCA 4LCWD 2EIZA 3L4UA 4HXAL 3B9KC 2JJWA 4F9PC 1EJ8A 2JXMB 2YMXL 1E4XL 3G5ZA 1IQWL 4XP9L 2NR6A 3I9GL 2EXTA 1E2WA 2DWEA 4HJEA 4QO1A 4C8XA 2P8PA 2YRLA 1Z0NA 2LABA 3IWUA 4HG4J 5E4OA 4HWZB 2F58L 3CSFA 3QXVA 4S1QL 4X7TA 4OSUH 2OR9L 3NCJH 1CDGA 5J9PA 2NDGA 4DW2H 1A3RH 4N0RA 3RY5A 2O72A 3Q1SH 3GSQB 4Y9CA 4LLWA 4PLKD 4K9EC 1QSFA 3UADA 3R7QA 4LCCB 1WHOA 1LL1A 3Q13A 5AOLA 4AEIH 1Q9WA 4HULB 2O61A 3BLBA 2NY3D 4MMXC 4PJXF 3UERA 4O2FA 4UUJB 3QJFA 3FUNA 4PJ5E 3S37L 5KUKA 4XNBA 2WNXA 1TVHA 2R27A 3HPLA 3O8XB 4U1HB 5E4EB 5SWZD 3MKGA 2Y2WA 1DUYB 4R7VA 1PY9A 2VC2L 4Z0XA 4F7PB 4WJ5A 4NQXB 4X7FC 3D4YA 4OFQA 5HYSA 4JFFA 5E95B 1U3NA 2AERT 3IJ9A 4BFIA 4NQDE 3GBNL 3W1ZA 1AY1H 3ERXA 2GAZB 3TPUA 2WVVA 3FSZA 5IFJB 2F53D 5D2LA 1I3RB 5LAXA 1NFDA 3V8CA 3TOPA 2AV1A 4P9HH 1S7SA 2ZWNA 5TDPB 5FYKE 3L9YA 2R8SL 3BSGA 2WXNA 4N2DA 3SJVB 5JPNA 5FGCB 3NRPA 3VACA 3HC2A 2XKNA 4HAFA 3AU1B 4AYMC 1D3CA 5J57B 2J1KA 2CG9X 2Q5BA 1ETB1 1U8QA 2Y23A 1OB1A 1VGKA 4HH9A 3EBHA 1TJIL 5C07D 1J7VR 5DDHA 1WT5A 2DWDB 3PWUA 3FQYA 2A0LD 2NY0D 2ZCLL 3VQ2C 4IOIB 4QXGH 3UROR 2C9RA 4MHHI 4PUBL 2A1WL 4BZ2H 1CLCA 4ZO9A 1IRAY 3O9WC 3QIBA 1NCBH 1AFVH 1KEML 4K3DL 4G3YL 1U3HC 3D2UA 3LB6C 2VLRE 3K6DA 4PVLA 1RK1B 4JFTA 5EOCH 4A63A 1FNAA 3GB7B 4DJMA 1FH5L 3KCPB 3QWRA 4PHXA 1IIKA 2VABA 5HDQL 2CXKA 3O4LD 4L23A 4OQ1A 5FKAB 5ETUB 1LWRA 1JDDA 4L0PB 3L7EB 3RTQC 1P0SE 2CO7B 3STLB 3TJEH 4ELMF 4YO0B 2ODHA 4OV5B 3UAAA 2H3NA 4K7FB 1F1AA 1G9NH 2PTTB 1NPJA 4UWQB 2WQSA 2VIRB 1YZZA 5DVNA 3FSVA 3VSVA 2K0RA 1G7LA 5IMLA 4PAZA 4KQ0A 5KG9B 1PKQE 4LLUB 1FAIH 3BWAA 2OSXA 3MRMA 4U6YA 5E8OA 1RJCA 5IJVA 1ACZA 4PY8I 3CQPA 1CU4L 3OPZH 3TBCA 2FQEA 4LLAA 1YEIH 2GJZA 2WLKA 4WI0B 1U93A 2A3TA 4M7LL 1ZEAL 5DJ8A 4AGQA 2H32H 3PY9A 3EO0B 4HQQH 1LO5A 1QWUA 1I8IB 2P7TA 3BUQA 3QEQA 2EUZA 4AJ0A 3AT8A 4ATTA 1CK0H 4N6QA 4Y5XC 2EINB 4FNRA 3BH4A 2CLRB 1SXCA 3KLQA 1E6JH 1ZVSB 3MRJA 1UATA 4M8UA 2GUOB 4QHKI 3MCLL 1C1EL 1P5UC 3TA3B 4OCSH 2PO6C 4JVPA 1DJIA 1PZSA 4UTAL 1JYXA 4FFTA 3QR0A 4NZRH 2X87A 4GBXA 3OR6B 1AHMA 1FFOB 3FPXA 1PZCA 5EDXA 4PS7A 5ABDE 7PAZA 1XH2A 2BY1A 3RYMA 2CD0A 1T83C 1KBGL 4HKXA 4JG9A 4P48A 4PRNA 1KPRA 3PIQA 2B7DT 3MA7A 2H2PD 4PRDA 3APCA 1KB5A 2CJUL 1EGJL 2ALAA 4TNGA 4AJYV 5JMOC 2JWYA 2GIYA 5JHDE 1XF1A 1YA5A 1NBYA 3GSXA 3F05A 3BP5B 2WB7A 4JFWA 2CNYA 4PR5B 1D2OA 2FSDA 2DQDL 4HUUA 4HUWB 3S34H 2P5WB 3MVSA 1ORSB 1MJ8L 1IGCH 5DRNB 4KITB 2VMJA 1SOSA 3QDJA 3MMEB 2H0FA 3WS3A 2Q7YB 1AZCA 1M7IA 3SE8H 3QUKA 4TPRL 4JW3A 1CD8A 1WGVA 1GGIL 1ZK5A 3PNWA 3IXAA 4GXVL 3IJSA 1EX0A 3NYKA 3NA9L 3DUUB 4ZMPA 3OKKB 2GBVA 3ARVA 4CC0A 1BLNA 3L5JA 4D8PA 2AK4B 3GJFK 3MLWL 4JE4B 3E8UL 4XBEH 3P2BA 4MQ7A 4HD9A 1HI6A 1U92A 5FUOH 5I8EB 2I9TA 4PJFE 5B4MD 4FERA 1XCQB 5CN1A 4B50A 5CP3H 1ZS8A 3RE0A 3NFNA 4GMSH 4NPJA 4UM8B 2HZHA 2FEEI 3DX9A 1U33A 2D0GA 1R3IL 5KJ7E 1QFWI 4ZW3A 3PWNB 1DJXA 2X7LB 2XT1B 3WTVA 3L9EA 5FGSA 1CC3A 2CR3A 3NN8B 4G42B 2DQIH 1SY6A 3FN0L 3IGKA 2VLKB 3SDYL 4J39A 2N3JA 4PJDE 2JLLA 1TMQA 1F58H 3HVDA 4XMXA 5ENWA 4ERSH 3SJVD 5HVHB 2GJPA 2ZUWA 3MLTB 2TRYA 1FC1A 4M5YH 3GSWB 2LHAA 4FP8H 3ARWA 3HNSH 1G7IB 2CBMA 2UZYA 2CA3A 4JM2F 3LZFH 4BKTC 5D8JH 5KW9H 3TEYA 1IC0A 5D4HA 1BD2A 3T0EE 2CBTA 5L2JA 5B3JE 4RMWA 4TVPH 2BVPB 4OZFB 4POUB 3X12A 2A74C 3PYCA 3ULUH 1U3HD 1BQLL 2YJQA 3BPLC 3LQMA 4UDUB 1LNUB 3GXTA 4QRFA 4XHJC 3VGDA 3ULVH 4KDVA 7FABL 1GYUA 2VERN 3BIKB 5F1IB 1MNNA 1G7MA 1XIWB 4G8FA 2XPYA 1YEDA 4KMTH 3U7AA 4LXFA 1QHOA 5D9SA 1RIHH 4CC1A 3ZY7A 1S5IL 1VEPA 4P23D 4ORZC 4PWEA 2OYLA 4WNJA 2PW2B 4Y4FA 3WKYA 2FHCA 1E50A 1Q4NX 3NSJA 4XMKL 3SKOB 2ID5A 1BHGA 1UURA 4S1RH 2K3TA 3EYFA 5E6IB 4KZDH 1FRGL 4KRMB 1N0XL 1DN0B 4YDLB 3GLEA 4LVHC 4WO4A 3S88L 5D6DC 1PS3A 1TVBB 3IAPA 4FLSA 4GY4A 5FF6A 3CX5J 1ZGLP 2XJKA 4YSUA 3PABB 2YAQA 3UYPB 1DJSA 1P4BH 1JK9B 1WFTA 2WAQA 5JNYB 2E27L 4TQEH 3L5WA 3O41A 1ZSHA 1KXQA 3OXSA 1N4XH 2BNQE 1Y1DA 3G9AB 5ES4B 4WSKA 3QRBA 1B88A 1ETJA 1P69B 3IDNB 1MH5B 1D5IH 4N24A 2O26U 4NKDB 1V8HA 4N1CA 1XL6A 4MCYA 1UB5A 2YR3A 4S1SL 2JF1A 1UT1A 1HWWA 1WYJA 4W1TA 3UTTA 2ZWZA 4N2EA 3DJ9A 5B8CB 3T6QC 3MNWA 2KBGA 3WIHA 4NRXA 5C6WH 1S7WA 2DWTA 5E8EA 3QJHB 1EJOH 4U1MB 4QXWA 3RIFK 3M86A 1IL1B 1QEWB 1EHLH 2R1XA 2YD4A 4MVBC 5C0GB 1K5NA 3G6JE 3EDJA 3MBXH 2Q76B 3CH1A 1GGTA 3ECWA 4JDTL 2DQGH 1A6WL 4B95C 5I15L 5D7JA 1M53A 1U8JA 5IQ9A 1A8JH 1YO4A 4XCEB 3TA3D 3QDMB 1SLWA 3QQ4A 2CSPA 3EJJX 1NCDL 3F7YB 3KVDD 3ARXA 2LLLA 1LDPL 2PCFB 3FCSB 5L8JB 2AJXH 4EKXA 4OGXL 5EC1A 4KVCH 5KBKA 4GW5A 1OSYA 3A6CL 1UXSB 1UZ8B 1CLZH 2MFNA 3EW3B 4J3BA 5E94B 2VL5A 5G4OA 1SUHA 1IAIL 4HU8A 5D96C 4ZX3A 5IBLC 2VN7A 3D9AH 3KVQA 4LLVB 4NQQA 2E75C 1OPGH 1DSWA 2OZ4L 5JIQA 1SXAA 4JN1H 4C4KO 3VWKB 1I82A 3B8SA 2GTQA 3HFMH 3MZTA 4JDZB 3ZT6A 2B59B 2B08A 4FYTA 2OTUB 4ZMLA 2ADIB 4G1EA 3C6LC 2W9DL 4ODUB 4LPWA 3N3EA 2P5WD 4M61B 2X6BA 4P2RB 3UJJL 4HKJB 3B2MA 4F8PA 5BJTA 4HLEA 2Q20A 3OZKA 2HRHA 4L9DA 5KS9F 4XP5H 1T22A 1T7VA 4H25A 3R8BB 2DBLL 2WTOA 4G8GB 3OLGA 3QI9B 2X4RB 2CM5A 2H8PB 1RV6X 5HI3C 3SDAB 3AY2A 4DP2X 2L8AA 4PMEA 4K5NA 3FB6B 4W9JC 5C0IA 4JO1H 1GSMA 2Q6WA 1MZYA 1JV2B 2AK4D 2WWMC 3DHUA 4XO4A 5DA4A 5I30H 3LD8C 4IBSA 1ZT1B 3OWEA 4BXVA 1WG3A 2JFCA 4N8CL 4CU7A 2WYIA 5IKCA 4WF7A 1WTGT 3OSVA 1PBYA 3Q1EA 5EBMA 4OLYL 2YPLA 4FXGA 3SDDB 3VFGL 4Y2OA 2Z64C 3V4UH 4YDKH 2BDNL 3S5ZA 1G7QA 4LDEB 3OSKA 4Y16C 1B0IA 2WSPA 5B21A 5ADPH 3DYMA 1WEJH 1AG0A 1O9VA 2J5LB 3U4BL 5MENA 4K3EH 1ADQL 2VLKD 5CILL 3WN5C 5IB3B 5LVEA 3D87B 4PJEA 3HE7C 4TUJB 4RFNC 1JWMB 1CLOH 3GINA 3WXVL 4AMKL 1GZHA 3MREA 2IBZX 5HGAA 3WEXB 4XHQA 4OF3A 4JGUA 4U3XA 2XNAA 3D39A 3SQRA 5JA9A 4LQFH 5DS2A 1MWAB 1Z2KA 4MS6A 4KX9A 5DC4B 2M8XA 3NA4A 2PW1B 4LSUL 3V5HA 3ARDC 3PHQB 4JR9L 3W0WB 4IRSC 2BSTA 5HHOE 3NZ8A 2HTKC 4C58B 3C2AL 1HCZA 3KYMB 1E4JA 1INDL 4F15B 4AGPA 1INEL 3UDWA 1A1OA 4ZW5A 4ENED 4XPTL 2EABA 4LSQH 1XIWD 4NFBA 5T3ZH 5IMKA 1G7PA 2DQTH 3SGJC 3BD4A 4X6FB 3HZKB 1HQ4B 2WYTA 1X5FA 3FNKA 4PP2A 2KZWA 1N64L 3VI3B 3CLFL 3UAFA 1AP2A 2V0AA 3KYOB 2ZSWB 3C5JB 1S9YB 2KH2B 2BHYA 2DQMA 3C08H 2C4XA 3FCGA 5EU3B 4A6YB 5E6ID 1TETL 1JZ2A 4NN6C 5DR5L 1IT9H 1PAMA 3CC5B 3QG7H 4KJQC 3WDJA 1TNNA 3HG4A 3GF8A 1QUPA 4H2CA 3X3GH 1LMKA 3LH2L 2LVEA 5CJBA 3V4VL 4AYFB 1U0QA 3ECUA 4LOVA 3HCVB 4X7SL 2JQAA 2GK0B 1G87A 1PG7X 1T7XA 1KACB 5F0MB 4YHOH 3ILPA 1DFBH 3L2NA 5K1JA 1FORH 1EIBA 4KDTC 1FGNH 1UACH 3ZQWA 5F7AA 1CXIA 1UD6A 3E80A 3M7OA 2UZXA 2YPVH 3KPNB 2EICA 3ARGC 3H7LA 1XAKA 4FG4A 3QDAA 1MEXH 4GMTL 4JL1A 5BO0D 2X4PB 1JRHH 3K1DA 1AMYA 4KO7A 2XN9E 4QNPE 1BJMA 1JGDB 4GUPA 3EH4B 1KBKA 3RKPA 3VFPA 4HAGA 5J06A 4RNRB 1CYWA 2R56L 1LQBC 4YBLB 5A40E 3DVNB 2H6OA 4U1KB 3TT1H 4N2NA 1MI5B 5IHLB 1TO4A 3F8UB 2R7EB 3FCBA 1R5WB 1S3RA 3QUZD 1KCLA 3RWIB 3W57A 2EE0A 4D0DB 2OXHB 3CFKA 5IUSA 2IALB 4NRYA 3TF4A 1FO0L 5LBSL 3HN8A 3V4LA 1E28B 4F7EB 4PJBF 3LEXB 3KR3L 1IEBA 5FO2A 3S35L 5DQDH 2WO3B 4AM0B 4ZMNA 2RTTA 2WZ0A 1XEDA 2EYTA 2LTQC 2FUQA 1GS7A 1SOQA 5FUCE 3VWKD 1OALA 2NXZC 4RAVB 5LGYA 1BBJA 3VD0A 1Y0LB 1A4JA 2EECA 4NHCL 3NZUA 4XC3H 4M48H 2ZJSL 4PJBB 3T6XA 3VFOB 4P2RD 1HNFA 3GS7A 2WWMD 4E9VA 4I5BA 4JE0A 3OBAA 4NT6A 3UC0L 2EE9A 2KZKA 1V7NL 3ABKB 3SZ6A 4G8GD 2DF3A 3PL6B 1JZ4A 3QI9D 3SDAD 3V6OA 5CSBA 2NYYC 4CNIB 1FVDA 4OUUB 3QUMB 3HG3A 4YPJA 2NY5H 1XGPB 1XL4A 3OHXC 1JZEA 3L48A 1BQSA 1Y6NR 4I3RH 1BVLB 1T3FB 2RD0A 3O0RL 2FX9L 4Y16D 2X89D 4U1SB 4MAUL 1PY0A 3DV6A 3MRQB 3HR6A 2M83A 2J1YA 2ZX7A 1PZUB 3BWSA 1RUKL 3R0NA 1NM4A 1XCWA 3SDDD 2WO4A 5DJCA 3WEBA 3ROOB 4RH4A 4O2EB 3KS0H 1CFBA 1WF5A 4B60A 4EE2A 1EWHA 1N5YH 3LKPB 3VG0H 3W37A 1Z9LA 5DFWH 5IJCC 4NC1E 5D7LA 1ZHBA 5DZOA 3WFBH 2IH3A 4IBYA 1EO7A 2ZSVB 4O51A 3Q44A 4OT1H 5ISZE 4HEPG 5DJ6B 1D9KC 1VEOA 2G60L 3VXUB 3WHE0 4E42A 1CR9L 3FB5A 3AG2B 3KYKL 3GMQB 2XA8H 2FAUA 2J8UB 5CUSL 4KJWC 3UBXA 1A1MA 3H42L 3V6FA 4LLYB 4NO3A 3W0WD 4DGVH 2VDNB 3PRZA 1B6DA 2IAMC 1GIGH 5EUKA 5BQDA 5ITBL 4O9HH 1NJ9A 3WU1A 2Z65C 1AD0B 3QQ3A 2EUWA 3DSNB 1ZWIB 2FATH 3F12A 3KGSA 4O02A 3SYPA 3S4SA 2YA0A 5KVGE 1YECH 5CEYA 3HVNA 2W88A 3U9WA 4B27A 3V0IA 5HDOA 3ECBB 4GAGL 3OKOA 2X28A 5GRJL 3REWB 2G3XA 2YN3A 1T7YA 4LHUG 2AXJA 3DIDA 3HG2A 4EN3C 2EDJA 2MH4A 1A7RL 4L4TB 2ADJB 3Q0HA 2AXHA 2C34A 3MNMA 1MW1A 1BQHG 3DMMB 5AZEH 4KPHH 3GI8L 4G1MA 5INCA 4NAJA 3RB5A 4IDJH 2ZXBA 5CD3A 4S0SD 2J6WA 1ED3B 1MFCH 4D94A 3HLAA 1JGUL 1F1GA 2VDOB 3QNXB 1URIA 5LCVL 2E7BA 4X9HA 5DC2A 3EXLA 4PPTA 1QBLL 1AHWA 4Q9QH 4BYHA 3ZHKA 4U0QB 3FHAA 3ARGD 4A7GA 3T4AC 1OSZB 1F8TH 5GZOD 3H54A 1XH3A 1ICTA 3LSOA 2CWRA 4L1SA 5BZXA 3WIIH 4BDVB 3FN3A 5CS7A 2XU9A 3ARYA 4BCYA 3OQ3B 4E5XA 3QW9A 4I0PA 2OQJB 43CAB 3NAAL 2AKRB 5D1ZB 5GSRB 1E65A 3IU4H 4NENA 5JOPD 1H15A 2IH1A 3HS9A 4UIMA 2X4SB 3NSXA 1WC7B 5AW4B 1GPOL 2BPBA 2QL1A 2CHDA 1AQMA 2AS5M 4X4XB 3CUPA 2BCKB 5DRWA 4F3FB 2A9NH 3OKLB 1Q0XH 4J8RB 4LBAA 3DHPA 4X7EC 1GAFL 2HX7A 1X5IA 1B3JA 2JI2A 1PZ2A 3EOAA 2SEBB 3M1CA 3U2IA 2R29A 2XX1A 4A7VA 4A2MA 1VACA 1NDGA 4NQDB 2X9WA 5KSAB 2NY4C 2ZX8A 3K0WA 4YHLH 2JELL 3QWOA 4FNQA 4RGOH 3V9EA 4BH7B 1BOYA 2O5XH 3QHFL 1L4IA 3IGAB 3LKSB 4OCXH 1W8NA 2Q2LA 4DUXA 5EOTA 4HJJL 4RRPA 2BSRA 2NXZD 1PQZA 4ODSH 2CUIA 1RZJC 4BD4A 3MRCB 1NMAH 4B9GA 3FUDA 4NUJB 2XWJB 3MOAL 4IBQA 3QH3B 5F7DA 1URZA 1I7UA 4EXKA 4GG6E 2QGBA 1A2YA 3JTTB 4UQ2A 3MUGB 3DOSA 3GEFA 3ATBA 1UEMA 4P2AA 4MZIA 1IVLA 2D31B 2GIXA 3KLKA 5DWUL 3VTAA 4LGPB 5F96L 4H88L 1NH6A 1TKWB 1DUZB 1Y1UA 4MA8H 3VXQA 1ET7A 2MSPA 1S3KH 4L1HA 3HBGA 4G6AC 2AAAA 1IGFH 2EC9T 2R1WB 1E7UA 1SJVA 5E5LA 2J12B 3RZCA 1FWXA 2FJGA 3PL6D 1WAEA 3K81A 2KHAA 4FQCL 1S46A 4NAQA 3FS9A 1ZLSH 4BQ6A 5EIQA 3MV8A 4TLTA 1FL3B 2VLRB 5CEZE 4I3SH 1FSKC 4U1JB 3Q2VA 3RDTC 1EMTH 3TO4C 4G6MH 3BVNB 1BGXH 2C1OA 4XCNB 1IBBA 1UJ3B 5J12B 1T0MB 4PB9H 3QJSB 4NUGL 3PGDB 1AD9A 4Z3IA 1LHZA 1TDQA 4M7ZB 2EE6A 1HYSD 4RAUB 1ONQA 1OCZB 1FBIL 4M43L 1PEWA 1EAQA 1WFMA 4PJGA 3HPLB 4AZ8A 1OE3A 5CIPA 1FZJA 4D9RE 2F18A 4BFEA 2NZ1A 4PRBA 4G7YH 1MZZA 2I9LA 4L3AA 1I1AC 3ESMA 3H56A 1BREA 4WEUD 5EH1A 1AXSB 1F4HA 1ZA3A 3DX3A 2ATPB 4F8TA 1CF1A 1PKQB 4J4PC 4I3GA 1HJBC 5F8RC 2IXQA 4OFIA 1VPOL 2BRRH 1GKEA 1NAKL 1N5AA 2Y7OA 3T8XA 5IVXA 2ARJA 3MQIA 4J3TA 3VXUD 1FFPA 3Q2LA 1P6WA 2GY5A 3A0OA 3DRTA 4NRZB 5AKSA 5KVEL 3GM0A 2YQBA 5DD0H 5IR1B 1W2KT 1KPUA 2APXA 3GRBA 2I07B 2X1PA 2CU9A 1J8HE 3CCHB 2DMGA 5EORH 2Y1ZA 1OL0A 5C0CA 3R8QA 2OS7A 5J11C 1E9OB 1JGLL 1XD0A 1D2PA 1XVSA 3HLKA 5D7SL 35C8H 4M7LT 4P3CH 2W65A 5FYJU 3O6MH 4MCZA 3ESNA 3HHMA 3LVEA 2V5YA 1EERB 2KI6A 2OP4H 2QPUA 3LQAL 3PAVA 5GSVB 3QZLA 1X4YA 2D9CA 5CFAA 1TZGL 4JCWA 1H9VA 4C4UA 2UVEA 1AANA 3DXAE 1KTRL 4M7KL 4DQAA 4JDVB 4LPCA 3WY4A 1I3VA 4BA0A 2YEQA 3VMOA 3EH2A 4XMLH 3GHPA 4B3EA 2UY6B 2YMTA 3DMMD 3QULB 5L0QC 1SHSA 5A6IA 5JHDB 2VUOA 1XSKA 3LN4B 3UXFA 1NAMB 4FGMA 5ECJE 4OM0H 4OJCA 3ISRA 5A6MA 2VW7A 1XGTA 5JDJA 5L9DH 4H0IA 3VD7A 1KJ3L 1KIUB 1QRNA 3UGXA 2FLMA 2IQAB 3Q8FA 1H6FA 2BO0A 4XPFL 4OIAA 3WN6A 3CZNA 5KAQG 3P4NB 4XNUL 2K1MA 4Y5VB 4L8CA 2ATKB 4Z3EA 3KWWA 1YEFH 1PG7W 1FG9C 4PJFF 1W80A 1SN2A 4WV1C 3V52L 4TQHA 5HHNB 4F1ZA 5JW4Q 1BA9A 4K55A 1G4RA 2GPZA 1Z3RA 4NP9A 1XB6A 1ZXKA 4HS8L 1K3IA 2VXQL 4Z77B 5D1ZD 3TN0A 2AANA 2F08A 4JJHA 4JEGB 2LOEA 1FHNA 5F1SA 1BBDH 4M8RA 4XVJL 4ELKB 6CGTA 4XMUA 1TR7A 3KPOA 3AG3B 2FO1A 3N1QC 2DTML 4PJFB 3C60C 2AJZA 1I1FB 4LSPH 2K7QA 2Z92B 4UQCA 5I2IA 4MMYB 1PF3A 1BXXA 2YXWA 4HCRL 1PDKB 3D2TA 4LLMA 4O4YL 1RIUH 4NQDD 1IFGA 1XR8A 4TVSa 3I84A 3BAEH 2XN0A 2DOCA 4AMXA 1JZ5A 3BKYL 2WLIB 2OCFD 2NY2B 4NXKA 1F02I 2XQYA 5DK2A 5H2BB 5EEZA 2FEDD 4RDQF 4PJDB 5FYKD 5JUEH 2CLVB 2VDKH 4BGDA 3QIUC 3QUHA 4LPUA 5BV7C 2PTVA 1QFOA 4OD3H 1TOXA 1IBGL 3F6IA 1BPVA 2Y7QB 1QTSA 3HHSA 4RISH 2QKIB 2QQNL 1E3XA 2UY7A 3T0EB 1GW0A 5HI4D 3E38A 3O2DH 4IIQA 3S3DB 4NO2B 1MF2H 1SZNA 3TO4D 2V33A 5F88A 2KLTA 1X5JA 3TJPA 5FM5M 4AK2A 2R1YB 3H85A 5GS0H 4JFED 2ICEA 2CDGA 3L9RA 5CF3A 1RZIA 4RBPK 1V3MA 3MLYL 3ORJA 5E5MB 3NIGF 5GGSA 1CVSC 3TBTB 1CTNA 4OLWH 1EZVY 2QV4A 3L1GA 2GK2A 2HFEA 1S7UB 2CDEB 5FKPB 3K2MC 5IK3B 3VD4A 4KKBC 4J12A 2NNFA 4JMNA 2GJ6A 1I9IH 3EUUA 3HS0A 1NSNL 1TYJA 1J1PH 4YC2B 3VB8A 1M1XA 4HHAA 1MCLA 2AJ3B 1HHJA 4J4PD 2VXTH 4M6OH 4WWNA 4YDJA 5I1CH 1E27B 1CGXA 2MTPA 1J10A 4LDLB 3WTTA 3CBJB 4L5FE 4V33A 3QYCA 4XVTL 4PWFA 3DX8A 2J5WA 4H1LA 5JDSB 3PDGA 1NOAA 5I75B 3WNPA 4FQLL 5AB1A 1YNTA 5K9QG 4M8QA 3MV9A 5FECA 4QRSB 4TVUA 1A22B 2BNQB 2NNXA 4HHWA 2CLZA 3QXAB 5IBTL 4BXSV 3LRHA 1R9FA 3GSNA 5GPRA 2Y7LA 3BFWA 2IIJA 4GI9A 4E41A 4H0HB 5D70H 1EAJA 5C09A 2A38A 3HB3B 4HC1H 2W0LA 2FBRA 5ID0B 5F7MC 1LE9B 5HGHB 2JQMA 1RUML 3HNTL 3P54A 2HG5B 4IRJB 2KS0A 2OMYA 1T0PB 4L4VE 2OTWA 1QFWM 1WBXA 1GYAA 3SPVB 3G6JB 1NCAL 2JKSA 4WHDA 5DJAB 2F74B 2J6EA 4B9YA 1A6VL 2WBJA 2AABL 2CKBA 2QADC 3MUY1 5I6XC 2X05A 4EI0A 2XPGA 4O5LL 1A6TA 3C6EA 1J0JA 3N43F 3RI5K 1UZGA 1H8OA 5ACLA 3FZUD 3HI5H 3PQYA 5F21B 4XGZB 3RFRA 3QUXC 3F58H 3QBTB 3GWJA 4PGDB 4JQIH 1Q9LA 4WJKB 4D7BA 3KLSA 4FN0A 5IW1A 4PJHA 3QCTL 2F2HA 4PJCE 3P11L 5CJ8A 2L0DA 3DGCR 4XNZC 4JJ5B 2H47C 3MNZA 4PTTA 5ANMA 1EO8H 3PWJB 2VLMD 1TJGH 5JHDD 4V1DE 2B1HH 3PUCA 1F4WH 1OKEA 2FX7H 2ZYIA 3QO0A 2TAAA 3ABMB 1CFTA 3EFDH 5D71H 4QJ4B 1H0DA 5TDOB 3QZBA 3GTNA 1ZKAA 1ZOXA 4XN8A 1FVCB 1SDAB 2G0KA 1D5BB 3SCMC 1JPGB 3EOBB 3FFCA 5HHVH 5JZ7D 4BINA 5IJKA 1UA6H 1YDPA 3QPQC 1SEQH 2X4NB 1IAOA 1NL0H 2GBAA 4KUZL 1NCNA 4PD4K 1XT5A 2XCMC 1AHKA 4NZUL 5AVVB 4OTXH 4DZ8A 2ROYA 4RFEA 5LG6A 2P49B 3ILEA 5EO9B 4LEEA 2XTJE 2Q9OA 1HKLL 1GZPB 3NACH 1A7BA 4MJ5A 4R90H 4MLIA 1MHPH 2VUYA 1FYTA 1IE4A 3D7PA 2V37A 3D0LB 1JFQH 1H5BA 4UCFA 4PG2C 3CVHL 3HI1A 3W11C 1MAKA 2X70B 3FU7A 5JIPA 1TQUA 5I8CB 4LCWA 3ZQXA 1Z66A 1FP5A 3HBPA 3V6ZB 4JO8A 3QEHA 1AC6A 4WTZG 1E4KC 2JK5A 2Y5TB 3CWGA 1CT8A 2ZG1A 1T5WA 2NY2D 4H5SB 1ADWA 1HSAA 2OMZB 4HCFA 5ERWB 4LRNH 4MA3A 4QTFA 5E1QA 1R5IA 3BT0A 1ID5I 4P57A 5CU9A 3IDIB 3SPJA 1COBA 1M7DB 3BPCA 3ZGHA 4X9GA 2C4FT 3CDGB 4IHOA 5A2JH 5HXMA 3PWVA 4N3TA 4DN3H 3VG9B 5SX4H 1HHIB 4BSWB 3L4CA 3GZOA 3EAKA 5C0JA 5KSVA 1U58B 1A25A 1R3LB 2B20A 2D7QA 3ZZSA 3O4OC 5HHOB 1C5DA 1WAAF 2F5BL 3T0ED 3U1QA 2UXGA 3CXFA 5F89A 4OSUL 2VKXA 1KFGA 3NCJL 4EBQL 1WWBX 3CPLB 1A3RL 3ET9F 3OPUA 5C97A 4KKBD 3Q1SL 5ICUA 3GDBA 4KXDA 5SWZA 5EUOA 4QY8B 2R2BA 3MLUH 4ZO6A 1P7KA 1TEGA 2G3NA 1DQMH 5EU5A 4F7CB 4X4YB 3OTTA 2H5UA 3IJYB 3MGAA 1NGXA 2O5YH 3WNMA 5J56B 1TU2B 1SN0A 3U0WH 1YY9D 3CDYA 4LPVA 2BM3A 2I25N 1S9XB 4OJDH 1G9ML 3R4DA 4AZUA 4M1CC 1UWGL 3GMMB 3INUL 3K1KC 2D7TH 3ZBMA 1R24A 3H9HB 2GFBA 3AWEA 4IKIA 1J12A 3GM8A 3GKWH 4MDJB 2FWOA 4NZFA 4WU5B 1E6OH 1G7JB 1QUNB 3D69B 4YSOA 3GBDA 2AJSH 3E6HB 1KTKE 3IKCA 4LKXA 4H26B 7CGTA 2Z4QA 1I1YA 1PSKH 4Z3JA 3MJ8A 4XNXH 4LU5L 1IVTA 3BVDB 3QEGH 2G2RB 5TDNA 3NGBB 3IRZA 1EEUA 2H1XA 5C07A 4QNPF 3C5SB 1RFDH 4JN2B 5DUPL 2BNQD 4ANWA 3FQXB 5ICZB 4MASA 2CMRL 4WI5A 4ODVL 4FFWC 1A7NL 1I4FA 4KZEH 3TLRA 5FYLE 1K3ZA 1GOGA 3BUDA 3MYZA 4IOFC 1LO2H 1SJEB 1BVZA 2Y1VA 4R7DB 5BMFH 1A9BB 2FECL 2YWYA 3RPKA 4URKA 3HB3D 4W6XB 5HGBA 3LQZB 2ESVE 1PX3A 3RNQA 1WD8A 1FDLL 1OGSA 4FLHA 4ZPVA 3LZOA 3RUGE 4ZS7H 2XN9B 1GY2A 2QELA 4ZS6C 3KH4A 5J7CC 4LLDA 4IRJD 1UUNA 4OAWA 1HQRA 3D50A 3O3EA 4FMKA 3UJTH 3IFPA 3QQNA 4FFZA 5JW5A 3AXHA 2CE6A 4UQ3B 3UZQA 3US1A 1S8DA 3PP3H 3JVFC 3O4LA 3WIHH 5KTEL 1IAKA 3UMTA 3QUGA 5E7BA 5I82A 5C6TL 3DPBB 1HVXA 4KKAD 5AYQA 1GW6A 1WUNT 2Y69B 4ZPTB 4WFGE 3KPLB 1IQDB 3DIFB 2E46A 1BECA 2ICWJ 1FL5B 2VJ8A 1NLDL 5IB2B 1IB5A 1E8YA 1A66A 3VDAA 3F84A 1NDMA 3TJEL 1OGTA 1AGCA 2JB5H 3RVVC 1GR7A 2MPVA 4HJGA 5KBMA 4EXPX 1F4YL 1HX0A 4JZOA 3VA6A 4YHMH 4AQ1C 1WPCA 3GK8H 3IJHA 4WWID 2H6PA 4OD1H 1DLFH 5CGMA 4PREB 4ZMQA 5IWLC 1YPZA 1OOAA 2QQLH 1DCEA 2K6WA 1L7IH 2XVKA 3H6AA 4FL4B 1CBJA 3K8LA 3ZZ1A 3VW3L 2FBJH 3HRZC 4ZOEA 1SDDA 3V0VB 3FMGH 3FU9A 1EXUA 3BMVA 5J6SA 2WLMA 1E90A 5MI0C 4HQQL 3UZVA 1NBVL 2W81C 2GB2A 5AKRA 4UT9H 4X6BB 6TAAA 2HA1A 3KJ6H 5HYQA 3HKFA 1CF8L 2VXUL 1DBJH 2Q8BL 2VITB 3TPKA 4BFOA 1T1XB 1E6JL 2Y1YA 3D85D 4AYGA 4N8VG 2CUAA 4FHKA 3B9DA 2BLFA 2BWIA 1PW3A 4XP1L 4AM0Q 4OW6A 4EI5B 2EH7H 4NNXA 5DJZA 3SE4A 1OOWA 3IDMA 3P9MB 4OD2B 2JKXA 4ZTPH 5CKAA 5KAQF 4MWFB 2JXMA 4QRAA 1OAZH 3ZMNA 4Z18A 2MCMA 2YD1A 1MRFH 4BK4A 4LL1A 5ISZB 2R69A 3WNOA 4Y4HB 1JVKA 3BZ5A 5IB5B 2NW3B 4WCYL 4J1UB 4DPBX 4P5TC 1KIPB 5TF0A 3ASOB 3ZKQD 1B4JH 3DI2B 5HHOD 1IGCL 4LCCA 2J43A 2NDFA 4UUJA 1RPQA 4HX1B 2ZF8A 2DQCH 3BP7B 1MVFA 1DUYA 4G83A 3RWCA 1BG9A 5JW4R 3JZ7A 4FEIA 1LO4L 4LEBA 4F7PA 3ARTA 1MQKH 4NQXA 4NWUL 1DEDA 4DAGH 2P1YA 2O93L 2CUHA 4PJ8C 5FUOL 4D9LH 2GAZA 1MIML 2GCYB 3SKMB 2WUBL 4LVOB 3TEUA 4ZSOE 1SLVA 2VN3A 4G9FE 4YHKH 1VADB 4F5CE 1I3RA 3NPSC 4K0OA 5E99H 1JXFA 2ZIDA 4HJUA 1V7ML 4YDVB 1ROWA 3W5NA 4FFWD 4PVNA 3TTYA 1VKXA 5AAWC 3SJVA 5CGYD 1XDTT 4ZX4A 3WIFB 1C12B 1J87A 2OR7A 3AU1A 2DQIL 3D8MA 1AI1H 3BKML 1ORQB 4M5SA 5E03A 2J55A 3DTXB 3DROB 3WNJA 3FXIC 4P2QE 1JNNH 2XA3A 4N86A 4YBHA 2CO6B 4KK8D 2DWDA 1D5ZB 4ZS6D 4N25A 1LWHA 4M5YL 5GGRY 2HLEB 2WW8A 1CDUA 3RI5F 5C08E 5BOPA 4AIXA 5CXPA 5KVFE 2OL3B 3LZFL 4LB8A 5D8JL 3SODB 3U79A 5KW9L 1UD8A 1UD3A 3N0AA 1MJJB 4EQ2A 1KGWA 3OLEA 1MCCA 5I1IH 4RGNE 1OWWA 2XN9D 4P23A 2FT7A 3LMJL 3HS8A 3HKZA 2HRPH 1URLA 5DJ0B 1RK1A 4IGBB 5HD8D 3ZKNC 4MTMA 3GB7A 2LFEA 4J3OG 3HUJA 3KCPA 2XWZA 4RQQB 2GBTA 2E7MA 3D5OF 4U2YA 5HPMA 4GG6F 1NCHA 4FLOA 5CN3A 1WA1X 5GJTL 2CHXA 4JREB 5ETUA 3STLA 2PPFA 2PNDA 1CFSB 2CO7A 3CHPA 3L7EA 4YO0A 4PFEA 4XR8C 3DSFL 4Z7NF 4K7FA 2PTTA 1CYGA 1OQOA 3ROLB 2VIRA 3UYRH 5IV2B 1IU1A 1E5YA 2WNWA 3QWNA 3VRJA 1IX2A 3AU0A 2VDRH 4Z3TA 5I0VA 5KYUB 3OZ9L 2X2IA 4Y2NA 2FZ3B 4BHUA 2ZWYA 4NZTL 3N2JA 4UQ9A 3S96B 3WCYA 4LLUA 3T4YB 1IGTB 4FQ2L 3HBQA 2YSTA 4NN5C 1SEBB 4HF5H 4Y5XA 3SY0B 4ADGA 2FO8A 4EUPA 2VM3A 5CBEB 5MHSD 4LL9A 5FPIA 2M2DA 2XFXB 2NZ9D 4FLQA 5GS2D 1MG2C 1JDCA 3LNFA 4HS3B 4WI0A 1MG3C 4XWOD 2G9KA 5FUZH 1P5UA 2RAMA 2C9QA 3BP6B 3EO0A 3OZLA 1NEPA 3WAJA 1AYOA 1ETZB 1FZMA 1I8IA 1KCRH 1XSJA 3RNKB 5JQHC 4ZAKC 1TTGA 5AOJA 5G4MA 1UM6L 2DYPB 2X1WL 1F90H 2CLRA 1N9PA 1ZVSA 5KJRH 4RA3A 2GUOA 3LZPA 1XX9C 1D5MB 4AIEA 1P4UA 2DD8L 3QEUB 4ONGH 1OARL 3TA3A 4PYHA 1IM9D 4PJ7F 3I6SA 4QGYA 2F7IA 1TVDA 1EHLL 5JXAL 3VDCA 1JZIA 4NJ9H 3OR6A 2AVFA 1U36A 1FFOA 2YIHA 3MBXL 4N2KA 3IT8D 1JWSA 3LNDA 1AYRA 4A2GA 5FYJE 4JLRB 1MVYA 4HUMB 2H26B 4EI5D 4KI5F 3N85H 1MCRA 3TL5A 2EIJB 1JUFA 4ZQKB 3FU0A 2FEEL 4Q4IA 3BSZA 4MZRA 4HMDA 1BZEA 1UM5L 2AJXL 2EDFA 3ETTA 1QFWL 5KBLA 1UWXH 3L3DB 3FQRB 4U1LB 3WE1A 3BP5A 2EIEA 3JV5A 4JCMA 4TLUA 4A55A 1DYZA 3MJ9H 3NIDE 4PR5A 4YK4B 4HUWA 2XXFA 3LN5B 4XBPB 2P5WA 3D9AL 4YHPA 1ORSA 1RU9H 5DRNA 5ISZD 1I7TA 4Y4HD 4FAAB 5BVJB 3MMEA 3CVIL 2Q7YA 1TSHA 4JO3H 1NDTA 3PCYA 3HFML 4QCIB 4YLQT 1NOFA 4HLZG 3GTTA 3SD5A 1CE1H 1J8HB 1XH0A 4ZZKA 2FHFA 3ABLB 3IMTA 4JM2C 1M6UA 3DUUA 5HYJE 3OKKA 2YPLE 3P02A 4WFHD 4HZAA 4FZEH 4P9MH 2VDMB 2AK4A 1ZTXH 5EN3A 2AQNA 1NC2B 4U1GC 3AACA 4DF9A 2X2HA 3GSRB 5I8EA 5DC9B 4XZ4A 5HVFB 3WJLC 1XCQA 1UM4H 2VMCA 3ZKSD 5DQ9B 3LPFA 3RY6C 1A1NB 3HG1E 5DZ9A 4M7JH 4UM8A 3DXAB 3KLHD 1R47A 4K8RD 5I30L 4IRZA 2XG4B 3PWNA 2X7LA 1RMFH 2GSIB 1IEAB 1IC1A 3NN8A 1R19A 4R4FH 2VLKA 4BUGA 3JTSB 3EJZD 4G8IB 2O5ZH 3VXTB 4KUCF 3MLTA 2A6KB 5CEXB 1I53A 3GSWA 4M4PA 5E2UH 2EYSA 2MCAA 2D0HA 5I0DA 1UZ6F 1G7IA 1U95B 1WFUA 4QXTB 2AI0L 4GAYA 1AXTH 3BAWA 4RDBA 4YJZL 4IK6A 3B2VH 1X44A 2BVPA 2IAAC 4HUXA 4OZFA 3VNYA 1XGUB 1DTUA 4CMHC 2J2ZB 12E8H 4LQFL 1TZAA 4UDUA 3NABH 3HAEH 2V17H 4JJOA 4KY2A 3V0FA 1HH6B 3BIKA 5F1IA 2NW2B 1XIWA 4X99B 1R4XA 4EQ3A 3QSKB 3JWNE 2P44B 4HFWB 3RWDB 2YC1B 2XQBL 4PVMA 1HSBB 2PW2A 1NCTA 3ARBC 1OP3H 5TD4A 2ZXDA 4NHUB 4OCWL 1L7TH 5G5DA 5T3ZL 4AC2A 1M9SA 1AACA 3SKOA 2DQTL 2ZUSA 4IGBD 4MBOA 3DLQR 3ME0B 2RR3A 3F64A 5E6IA 1B0RB 3EHBB 5LGJB 5TF1H 1DN0A 4MA1C 5D1XC 4LLQB 4BFRA 1TVBA 4K15A 5BZWB 5LO7A 4BBWA 4CAGA 1K4CB 3OMIB 1WZ1H 2E8ZA 3PABA 3VD3A 4R0LC 1RULH 3UYPA 1NKOA 2X09A 3I6KB 1SGKA 1JK9A 1TZOA 3FB8B 4RZCA 5JNYA 2ZPKH 1H3TA 5SX5K 3V4PA 1G43A 1YNKH 1AE6L 2YS4A 4OCNC 4P2OC 1CCZA 1D6EA 2HFFB 2ZOTA 2N0MA 3IDNA 5I1EH 5D1QE 1MH5A 4X83A 2ROXA 1DVFB 1YEJH 3QP3A 3SB3A 5T3XH 3NJJA 5EBGA 4HUNB 3WFEH 5B8CA 1SXNA 3K6SB 5GGVL 4GRWE 1DFBL 4R97B 3PJNA 1Q1JH 3OX8A 4FMFA 3QJHA 1UACL 2XWRA 4LIQH 3O0LA 2DYPD 4U1MA 4OLXH 4HK0B 2YPVL 1QEWA 1UXLA 3HC0B 3LZRA 5AVTB 5HDRA 2QDWA 1A0QH 1D6VL 2Q76A 4UILH 1QLEH 4KJPC 3PWLB 4HWEL 3T77B 3VB9A 2C26A 4DVBB 3L4ZA 5IQ7H 4R26H 5C2UB 1EZVX 3WTYA 3B7UX 1ZRUA 4OZIE 3QUZA 3MRLB 2Y72A 3FCSA 3CG8A 1O6VA 2GC4C 2JKRM 2NY6B 3TT1L 3GXUB 2MQ0A 1YVLA 1UXSA 1UZ8A 1R5VB 3C5ZB 3QQDB 4PGJA 1DJYA 3T3PF 4ENZA 1QHPA 3LDBB 3SO3B 4LLVA 3UO1H 2RHEA 1LQSR 4PLJD 3VWKA 5G55A 3VXSE 2VDQB 2R4RH 2X53A 4JDZA 3UBHA 4B7IA 2OTUA 3FHEA 2ADIA 2P45B 3WHE1 4ODUA 3ULUE 3C09B 2OMUB 2R0KH 4FX5A 4M61A 4P2RA 5CIPH 2P4AB 2N0KA 3X11B 4AL8H 4HKJA 1K4DB 5AZUA 3ULVE 4P2YA 1BXUA 3UFIA 2B8OT 1TT6A 3MYJB 4G8GA 3QI9A 2X4RA 3SDAA 5E8DH 1RZJH 4M3KB 3UG4A 4M48L 4I13B 2ENPA 3Q8AA 2CHNA 1H8LA 2CK0L 4L4VB 5F7UA 3FB6A 1WFOA 1QOKA 5KBDA 3UEQA 1MDAA 3TYGL 2O1AA 4ZT1A 5KVDE 1JV2A 2E9JA 1NC2D 1T2QH 1ZT1A 1OF2A 2X89A 4O00A 1HN1A 1L6XA 4JZJB 3LRKA 4KRNA 4Q8BA 2W0FB 3I6LE 1EH9A 5D7LE 2NY5L 3B1TA 4QD2E 3SDDA 2UXVA 2IFFH 2K7PA 1H3PH 3DXAD 4WWKB 4KWUA 5BUGA 4PJCB 4XBGB 1DQDL 2Y7NA 4B97A 3I3DA 2WLYA 1UJTA 1MVUB 1P6FA 1FZKB 3H9SE 2I85A 1AZRA 4K5MA 2A9MH 1SVZA 4IU2B 2FJHB 1USZA 3TVMC 4FA7B 5KANI 5IB3A 4V1DB 2R2HB 5GS1B 3CJJA 3LIUA 4NP4L 2RACA 4TUJA 4FZ8L 3VYNA 2G3ZA 1BP3B 4XB7A 2BIMA 2IGFH 1T6WA 2AEPL 4Y1SA 3A4AA 1IZJA 3K71A 1N5YL 3AC0A 3ZJAA 4N90E 3UEZA 3WFBL 3U4EB 3P2DA 2PW1A 3PHQA 4N1HB 3W0WA 2HMIC 1CDYA 1IKFH 4OT1L 2QSVA 2PP9A 4UTBH 3Q8BA 1A7PH 1RZ8B 2EDEA 3DVIA 1RKRA 3KYMA 3L4VA 5IEKB 2XA8L 1R17A 2DLFL 3D0VB 3HEIB 1ACCA 4Q74A 4DCQB 5GS1A 3KLLA 4RWYH 4I88A 1MIEL 5JIIA 2XTJB 5IJDC 4K3HA 5TTRA 4O9HL 1NPUA 3WHXA 1U8CA 4D2NA 1PD0A 1WFIA 4X6FA 3HZKA 1HQ4A 5DQJA 3B9AA 5BUAA 2DJ4A 1C08B 2BVQB 3VI3A 3EJRA 4QO1B 3WXWH 3KYOA 1PLBA 2FGWH 2ZSWA 1B9ZA 1S9YA 2EEXA 3C5JA 3GIVB 5J3HC 4BFGA 4X7TB 3GLZA 2EIDA 4LKCB 1JGIA 4AQ8A 4A6YA 5J9PB 5JW3H 4MB1A 4APXB 4DNLA 3EHBD 2FWLB 5JHAA 1SBSL 1YAZA 3CC5A 2QV2A 3IS1X 1K5WA 2CRMA 2MPAH 2P46B 3CFMA 4GUQA 4L9LB 5LNDA 5I19H 5AZEL 4KPHL 4JKNA 3T8VA 4HKZA 4DEPC 2ZF9A 2KQMA 5CLTA 5GRZA 5GZOA 4W9CC 2G2NA 5D2LF 4AYFA 1I8MA 5TE4L 3ZLQC 2XXCB 3RVUD 3D3VE 3PPEA 4Q97A 2ERJB 3KW8A 1X3DA 4PJIE 1ZLUK 5BVPL 4Q9QL 2E7LC 5F0LB 4ZMYA 5T1JA 2K9FB 1JF1B 3MRPB 5HYSB 3ZW3A 3KPNA 4WGWB 1IC4H 5D72L 2B14A 3MR9B 5GZND 2WNKA 2WVVB 5E08L 3KE0A 2X4PA 3TNNB 4BZ1A 1ZVYA 2XI9A 4J3OF 1JGDA 3P0VH 1U8PB 3E0GA 1CJYA 1S7SB 2BINA 4X50A 1OTUD 4RNRA 1HESA 2V3DA 4Y5YB 3AG1B 1UC6A 2E6JA 3LQAC 4LVNC 2BC4B 3DVNA 4U1KA 3BYYA 2A9NL 3DX7B 1Q0XL 4HIHB 2GJRA 1G6RB 2A4ZA 4HH9B 1U8LB 1PX4A 1VGKB 3AB0C 2R7EA 1EDYA 3HZYA 4W9FC 4CGUB 4KQ4L 4D0DA 2OXHA 3RQ3A 2DB8A 2IALA 2E7CA 5BW7A 1KXVA 4KXZI 4ZW7A 1E28A 4F7EA 4YHLL 3GNMH 4UT6A 1NUFA 2DH2A 3LEXA 3C5ZD 4NNPH 3NPZB 1N6QH 1U3JA 4OCXL 1NA8A 5FWQA 2QSCL 2VR3A 4RFOL 4AM0A 3VTMA 2ZXCA 3NP3A 3RUGF 1UKQA 3UJIH 2FVNA 3GRGA 2RALA 1Y0LA 4JG1L 5I1JL 3GI9H 4PJBA 4YSQA 3VFOA 3N1MC 2ZICA 6FABH 2ESVB 4H1LH 3WO3B 1L9SA 4AGOA 4PYGA 3O6FB 5IESH 3OR7B 4RMUA 3VD5A 3RUGB 3PL6A 1I31A 1MAJA 4CNIA 3GFUA 4MA8L 5BV7H 4OUUA 4L4VD 3QUMA 5TH2B 1IV8A 1AXIB 1S3KL 1KG0B 4LSRL 1XGPA 4P4KB 4YSSA 5JYLA 4ZXBC 5KSBA 4Y8DC 2AXGB 4JG0L 4JKKA 1BVLA 1T3FA 2VDLH 4U1SA 5DK0B 3IDXL 4MJ2A 1ZVHA 2FWSA 4YSPA 4I3SL 5JR1H 3OLDA 1NCJA 2XC8A 1TSRA 1SMAA 1QLRB 3ROOA 3D0AA 5DF0A 2BP5M 3V0WL 5DJ8B 2VDQL 4O2EA 1PLGH 1FI8C 4PV1C 1DBMH 1W72A 3RKDC 3LKPA 5GGQH 5K9OB 1BZOA 1MHEB 4V1DD 3OQRA 3VFRB 3CK0H 1XD1A 2ZSVA 3MRJB 3QIWB 3IRPX 3WLWC 3H2WA 2XYCA 2YEVB 3WO4B 1HEJC 5DJ6A 2ZOLB 3RGVB 3VXUA 4GEIA 1IGJB 3RIKA 3CD4A 3QK0A 1BEYH 2J8UA 2XVBA 3TZVC 4BFFA 4PLOB 3TO2B 3WELA 4OQTA 4LLYA 1HIMH 4JM0A 4Q52A 4P5MA 2YMXH 1HNGA 2WXGA 1E4XH 3RJDA 1EAOA 3ZE2F 1WIOA 2YGOA 5DD0L 1AD0A 4XP9H 1Y6MR 2A77L 3PFQA 2FYVA 5DSCB 3DSNA 4PRDB 1U8IB 1KB5B 2D7OA 5B38G 5KSAC 3L3KB 2XTJD 1V54B 2F58H 1XCTB 4S1QH 1FGVH 1SXZA 2OR9H 3ECBA 1RPUA 4UQEA 3H55A 4P3CL 1R75A 2HX8A 3REWA 3AM8A 3O6ML 1DQKA 1TPXB 1VJSA 2ENSA 4GUCA 4L3ED 2ADJA 3TBBA 3UBXG 1WWCA 4DKEH 2J8HA 5CP7B 5E4IA 3AWGA 1H9DA 3DMMA 5TQ2L 5FO9A 5F7EH 5GGTA 1CIUA 3S37H 1HS6A 1ED3A 3IXAB 1BVNT 1DJGA 3IJSB 2W60A 4U6VL 3QNXA 4YQXH 1E8ZA 2X0WA 2WWNA 5F1NB 2AEOA 1AZZC 4GQRA 4PCSA 3RX8A 3VXRE 1CQKA 1OSZA 3FTUA 3P3YA 3S5LG 4DPCX 4OM0L 4QHLB 4BDVA 1HI6B 2AZAA 2VLJE 1C8PA 3MTXA 5FK9B 4V2CB 3EF4A 2PETA 2OQJA 3F7VB 1AGDB 3VWJB 43CAA 2F7PA 2AKRA 1LVEA 5D1ZA 5GSRA 1ZCRA 2CR6A 3CMOL 4GLRI 4W6YB 5AEAA 5DRXA 4P46C 4XCYB 1E9QB 1X4ZA 5I9QB 2X4SA 1WC7A 4A2EA 5EIIB 3SYCA 1B9KA 4X4XA 4ONFH 2BCKA 3GLAA 4JPIB 3OKLA 2VSMB 3AUVA 4KMQA 3WFZA 4YLCA 1NEZG 1TJIH 3JV6B 2DKMA 2FEJA 4L8SC 2SEBA 3EIFA 3U83A 5C0BE 3E7JA 3S35X 4NQDA 1UOLA 4GG8A 2ZWLT 4LCUA 2ZCLH 4ZSOB