1WUZA

Structure of ec1 domain of cnr
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
103
structure length
103
Chain Sequence
b'GNSQIHYSIPEEAKHGTFVGRIAQDLGLELTELVPRLFRVASKDRGDLLEVNLQNGILFVNSRIDREELCGRSAECSIHLEVIVDRPLQVFHVEVEVRDINDN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Pcdha4 protein
publication title Structural diversity of the first cadherin domains revealed by the structure of CNR/Protocadherin alpha
rcsb
source organism Mus musculus
molecule tags Cell adhesion
total genus 12
structure length 103
sequence length 103
ec nomenclature
pdb deposition date 2004-12-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08266 Cadherin_2 Cadherin-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.60 Mainly Beta Sandwich Immunoglobulin-like Cadherins 1wuzA01
2A4EA 1FF5A 2QVFB 4ZMOA 3UBGA 4ZTEA 1EDHA 5JYMA 3PPEA 3FF7A 1NCIA 1Q1PA 4ZT1A 2OMVB 2V37A 2WBXA 3LNDA 3Q2VA 4ZMQA 3Q2NA 5JYLA 2OMUB 1NCHA 4ZMNA 4AQ8C 1NCJA 2X2UA 2OMZB 3FF8A 4ZMVA 5CZRA 4APXB 1WUZA 4AK1A 3K5SA 3LNGA 2OMXB 3LNEA 1OP4A 3LNFA 1NCGA 4NUPA 2O72A 4OY9A 2WCPA 1SUHA 1ZXKA 3K6FA 3LNHA 4AQAB 4ZMXA 3QRBA 4ZMTA 4ZMYA 1O6SB 4XXWA 4QD2E 1ZVNA 2OMTB 4AQAA 1L3WA 4ZMZA 4NUQA 3K5RA 3Q2LA 1WYJA 2YQGA 4ZMPA 4ZMLA 3UBFA 4AQEB 2WD0A 2YSTA 3UBHA 4NUMA 3K6IA 4APXA 2WHVA 4AQEA 4AXWB 2OMYB 5CO1A 3MVSA 4ZI8A 3Q2WA 5DZVA 3LNIA 3K6DA 4AXWA 4ZMWA 4AQ8A 2EE0A 4XXWC 5KJ4A 4NQQA 2OMWB 2QVIA 2A4CA
chains in the Genus database with same CATH superfamily
5CLZA 5GISL 4M4RB 2QVFB 4LASH 3RY4A 2CXKA 3MRHA 2YGNA 1ZV9A 4JO5A 1R3LB 3P4OB 4G7VL 1EXUA 5EEUA 3OKKB 4Y2DA 4EKJA 2A73B 2I25N 5DEGB 5KVFE 1A4KA 1OAQL 2AXHA 1D5IL 1KDJA 1VFUA 4YC2C 1XCTB 2G4GA 4B9KC 1BAGA 5C71A 4MD5A 3CXFA 5DLML 1KG0B 1SHSA 1QATA 1I3VA 2V2XB 3MJ8A 3OHMB 4DF9A 1GZQA 2XLLA 1SVCP 2ZWKA 3BHBB 4HOWA 5EBWB 3WIHA 5C0AE 4FTVA 3VMOA 4XXDA 3MREA 3ZE0E 4ODSH 3QCTH 5HHNB 5J6HA 1TYEB 3IRZA 3WJJA 4WW2B 3JV4A 2HH0H 5FM4A 3STLA 2J73A 5CBEB 1HNYA 3QEUB 3NJNA 2NYKA 1XGTB 1LJMA 3IMTA 1A4CA 2GJJA 1EHLH 3B1TA 4X6DA 2OV0A 3WUWA 1BVKA 1U33A 1UATA 2W9DL 4X4ME 2JFCA 3MLZL 2F54E 3RUGF 1IEBB 2GTQA 4AL8L 1LXMA 4DGYH 1TZAA 3RI5F 3V4UH 2Y7OA 4MXVE 4FAAB 3HC4L 2OTWB 3WMPA 4N0RA 1FAKT 2X0VA 2XI9A 15C8L 3L3OA 2M1KA 3G6AB 2H5UA 4ZUTA 3QNYA 1UENA 3C8KB 3LPFA 3RDTA 1JGIA 3KDMA 3KL3A 5E2TH 3QORA 2MCPH 3JYBA 3FQNB 3L3KA 3VD5A 5HGAA 1K4CB 3FO9A 5LUMA 3FN9A 43CAB 4KXZI 4JBSA 3L3HB 3GXIA 4TV3A 1BOYA 1U91A 3GMLA 4XC3L 4FLQA 1QSEE 2Y22A 5DRZA 4XNQA 4JNXA 1U42A 4K3HA 3TT1H 4WHTA 4BZ2H 3GBLA 4KZEL 1KIQA 3BAIA 4BGLA 1PLAA 2QKIC 4PI2A 4DKTA 4LARL 4I9WD 5JUEH 2K3TA 1MCQA 4XPTH 4KO9A 3L7FA 1PKOA 3OZLA 4UIKL 4OF5A 1WWBX 5DD3H 1BLIA 4FTVD 1AD9B 1WZLA 3WO4B 5GSRB 1CI5A 1P1ZB 3WOVA 3Q8BA 3QIWC 3KLAA 4QHNB 3F83A 4ZUWB 1FORL 4FDWA 5TE4H 2Y5TA 5C0IB 4FADA 3BP5A 4JY6B 1KGIA 1U36A 2V5RA 4OU3A 4JAMB 3UADA 3BJ91 5KUKA 4LZKA 1Q9WA 1E5UI 4F93B 1DJZA 1L9QA 2BW5A 3H9YA 3L5IA 1EXUB 3S37L 3VNZA 2NY0C 2PKDA 1P84K 1BSIA 1SHWA 3T6QC 4JFUA 2GHZA 1DVTA 3OGCA 1T0OA 4XBMA 4MD5B 4NQVA 1ORQB 5DQDH 1M4KA 1CLVA 3RDTD 1C7SA 4E9QA 4FZ8H 4TSBL 3QORD 1GZQB 1IGIL 2DKMA 4QGTA 1MCOL 4DGIL 4FTVB 4G80A 4RBPH 4XXDB 3BPNB 3MREB 4FEIA 3AAZA 3QPQD 4K7PL 4HGKC 1MRDH 3STLB 2DQ6A 1G0DA 5DHYA 1KGUA 5CKAA 1XB6A 2G5RA 3VWJA 1A4AA 4YSAA 4F5CE 3US1A 3PWVA 1BVKB 1KYAA 3QUZA 3WUWB 3LS5L 2QV4A 1KGCE 3I9PA 3DMMA 3I85A 2WN3A 3SB3A 4QXUL 2FLRT 4CVXA 3V0FA 4CJ0A 4M62H 1HYRC 1YNLH 2BY2A 4L0ZA 3I3BA 4POZC 5I0XA 3ZDXB 3AG3B 1NFDA 2TSBA 4GLRI 4ZUTB 3QNYB 3RVVC 3RDTB 3GJFH 1NKRA 3T2QA 3V52L 1FE8H 3KDMB 2Z4TA 3RFZA 2OL3A 3QORB 3UO8B 1DJHA 3L3KB 1UJ3C 1BREA 3KJ6H 3AITA 4KK9C 5HGAB 4A39A 1AC6A 1LP9E 3KMDA 4CMHB 2OR9H 3GMMA 2WWOA 3R4RA 4JFEA 2BPBA 5T3XE 2OR7A 1L6PA 2WQSA 3OWRA 3M45A 1ZGLP 2GSGA 3N43F 5GZOA 2ZX7A 4X8JB 1KIQB 1YPZE 1NOFA 5I18H 2AJYL 5HDRA 1JIBA 1NPUA 1IBFA 4QAWA 1RZ7L 1WWWX 4NHUA 1I7ZA 3L7FB 5GZND 2Z6FA 5E8NA 4M6NL 4OGQC 4AYEC 5GRVL 1VERA 1WGVA 5E8OA 3LZLA 5K9JH 1A7RL 3EFFA 4BWTA 5JIIA 3JZYA 3V6BR 3ESVF 3G5WA 3HMXL 3BSZH 3MLTA 3KLAB 3VH8A 1LWRA 4Q2ZA 1VESA 3MXVL 5E1AA 1BYOA 2Y5TB 3BP5B 2XU9A 1QACA 5EF3A 1ZCRA 3QUZD 5BO1H 4NDMA 3AVEA 4F33A 1KEGH 3DMMD 4XCCH 4PU2A 4A7QA 3LN4B 1NGZA 2JCWA 3UFIA 1LE5A 1T5XB 1SLUA 1YYLL 5EORL 4W68A 1VGEH 1UCTA 4FFWC 1SBBA 4ODWA 1I8LC 3OGCB 1T4KA 1JV5A 1KIRA 2EIBA 2WXPA 3GTTA 4HJJL 4NQVB 3X11B 2OCJA 1ZPUA 2R9HC 2VDQH 3QXDA 5JDSA 3U6XA 4KK6D 4JB9L 2RMNA 4U2YA 2XXGA 2FO4A 4XN9A 2K4AA 1QTSA 1OE3A 4RX4A 1UASA 3FT0A 4G80B 2N59A 4NPKA 4LL9A 5FDYA 1UCBH 1QBLH 2AXJA 4PJBF 2X9YA 5DHYB 4JFED 2WXLA 3WFZA 1Q1PA 4OF8A 5FFLA 4UCFA 5CGYC 4NKDA 4D0CB 2MOGA 3EH3B 3PWVB 3QUZB 5GZOD 4ABWA 3DMMB 3FN0H 3B5GA 3OKEA 1NUDA 5SX4H 1YJDH 4K7PY 4EBQH 3SYPA 4ANKA 2BP8A 1SHXA 5D4JA 4NNYA 3BZFA 4CVXB 5HVWA 3DYMA 3L48A 4JGUA 5LBSH 2PYEA 2AXWA 2DWDA 2F15A 4HIIA 2W80C 3LQMA 3QJFA 1NFDB 1RIVH 2YN5A 3VI4F 1AYOA 3MPCA 3RFZB 2OL3B 2N0MA 2VOTA 3PP3H 3T9WA 4FG2A 5GGTA 5CCHE 4KUZH 4GP8B 1CGTA 3WHE0 3QJHB 1WHOA 4MGXA 1JNLH 2Y5QA 2NY5L 4GSDH 3BP6A 2WJ7A 4NZTL 4JFEB 1UT9A 5BZWA 4DAGH 2X4NA 2XQBL 3WTWA 5JO5A 2N56A 4HZAA 3EO0B 5EDXA 3LEVH 3X12B 5I24A 2GSGB 4MJIE 1NDMA 4LU5L 1M7UA 4LSTH 1HYSC 1MPAL 1TPXB 3X14B 4NHUB 1I7ZB 5J57B 4RX4D 4TSAH 1PYWA 5E8OB 3EFFB 3ILQC 4LP5A 2DD8L 2NQ3A 1E65A 1QNZH 3PXJA 4JM0A 2YD5A 3UBFA 1P7QA 2D9QB 3MLTB 4G72B 3WKMH 2F58L 3VH8B 4Q2ZB 3DOIA 5LBVA 2XZAL 4JREB 1TQTA 5CZVH 1GS8A 2IMMA 2ZUTA 3X1GA 1YPZF 3D34A 3LX9A 4LCIH 5KG9B 1P9MA 2HKHL 4JPQA 4NDMB 4F33B 3U30B 5E9DA 2Z65C 3RY6A 3L1FA 1NGZB 2OXGA 1ZHNA 1UGKA 3LIZL 5CO1A 1PIGA 5ECJE 3C5ZC 2AI0L 4ODWB 1UTDA 2PYED 2WPGA 3ARFA 1AKJA 1M1XB 1T4KB 3GZKA 1R3KA 3CBKB 3QXDB 1YG9A 2YA0A 5JDSB 1HEJC 4JN1L 1KXHA 2FO4B 3WTUA 3OHXA 2CO4A 2OR8A 2NCMA 2EVFA 2QJDA 5ESVA 2F68X 1KYFA 5T8IA 4YL9A 2HVBA 3GMOA 3IGUA 1IGTA 1B2YA 1DQTA 1RFDH 3WMSA 2EEXA 1MFAL 4ONGH 3QQ3A 5SWZA 4PH8A 2CU9A 1LGVA 2AEOA 3IDJB 4HC1H 4BGDA 5DWUH 4URTB 3OKEB 5DVPA 4TYUA 1RERA 2BP8B 3BZFB 3ATDA 4FQLH 4KTEL 4U6YA 4D0BA 2DQDH 5E1HB 2ZAIA 3EH1A 4XI5C 2DWDB 5K1NA 4HIIB 4JE4B 3RVWD 3QJFB 5HYSG 3CZEA 1ZLUK 3ZY7A 2EDXA 1P7QD 1W0WA 5EU3A 2Z0BA 3KLSA 4LGRB 2H6PA 1QG3A 1CFSA 2CK2A 3BVTA 2NRDA 4MZRA 2CKNA 2RHEA 3B9VA 3BUBA 1E4WL 2BIPA 2JJVA 1A64A 2IADA 3BP6B 4PS3A 5E9DD 5CD5C 5BZWB 3VD3A 3SEPA 1JHLL 4N8CH 1NDMB 1F4WH 2QR0A 1VGKA 2IALA 2L7JA 2OSLA 3FCTA 4DEPC 1CBVH 1BM7A 1KXVC 2ERJC 5CUSH 1BMWA 5KYXA 4OZHE 3SBQA 2FUTA 1JGLL 1PYWB 4OCWH 3U9WA 4JRXA 4YBLC 1OSZA 1U9KA 3R06A 2XRAL 3JWOH 1A66A 2QTEA 1P7QB 4HUXA 4XPGH 1BQLH 4LOUC 5SWZD 3MOAL 3NSCA 1UWEL 4KHTL 2V9RA 3NIDB 1MVUB 2LV4A 2O5ZH 5E9DB 2AJVH 2OXGB 1ETA1 5E2TL 4NQSA 2DWTA 5FFOA 1PQZA 3BZEB 1TTGA 3N41B 1JJUA 4RGND 1RZIA 2MOVA 1TQWA 3LS4L 2R4RL 1R3KB 1OM9A 3H7BA 2AQNA 2WOBA 4BZ1L 1PAZA 3E3QE 3OHXB 1J86A 1KCSH 3TBBA 4ALAL 1MW0A 3PG2A 4WU5A 5ESVB 3AS3A 1LK3L 3PHOA 1TMQA 3SGJA 4O51A 1GJWA 2Z3FA 3B2XA 3GMOB 4Y7MA 1IGTB 2CJSA 3QZWG 4ZOAA 1QUPA 3CFCH 1ZWIA 2FIKA 5JUEL 1B0RA 3QQ3B 5SWZB 5F3HA 1AE6L 1EIBA 4NUJB 2P9RA 3EOAA 2JWYA 3P02A 2VISA 4FCAA 3FRUA 4Y4FC 4HPOL 5KVFH 2OCCB 1T89A 2XVGA 2K70A 3EYVB 1DO5A 2G0KA 1ASPA 4P2RA 1EHAA 1OL0A 2AK4A 2NY4C 4D0BB 4JR9L 3K74B 2VN5A 4RGNB 1R3IH 4R90H 2Y6SC 2WSKA 3KPOB 3MACL 5JQHC 2R56H 4MAYA 2RCSL 1NAML 5EU3B 1GPOL 5HI4C 1HEHC 3PL6D 1CFSB 3KWVA 1IC5L 5EBMA 1LE9A 3QJOA 4LEOB 5MEQB 4NLHA 3GBNH 1R46A 2EILB 4GW5A 3T6ZA 5CCJA 9CGTA 1M2OA 3CFEA 4K5LA 4NIKB 5E51A 4FZ8L 4XN8A 5B7EA 2W8CA 1R19A 5AKTA 5JHBA 4F3FA 1DQKA 1JZ2A 1YVLA 2QR0B 4RMVA 3DV4B 3O0RL 5A2JH 3FCTB 5BQ7B 2BZCA 2L4OA 2PCXA 1X5ZA 3QRGH 3BVNB 2WO3B 2XWEA 3PGDA 5A6LA 2EICA 7FABL 5IWLC 4ES9A 5DGRA 3QFDA 1OSZB 2AJSH 3R06B 4M6MH 2R39A 4HUXB 1QTPA 4X9YA 3PL6B 4NC0B 2VE6A 1VLXA 1FL5A 2VDKL 5ESAB 1PG7W 4XMUA 5GS2D 2EDJA 1ERNA 3CFDA 1N70A 3QCUL 5FYJU 3J07A 4LPUA 2GUOB 2CG9X 4YQXH 5E6IC 4NQSB 4OZHF 1A6TB 4P2RD 1GZHA 3T8VA 2MNJB 1JD7A 3B56A 1RZIB 1U58A 2VC2L 4PHXA 3H7BB 4WUUB 1D7CA 1HQ4A 1OY3B 4G3YL 2OULB 1BD2A 1FL3A 1QSZA 2DEWX 3AXIA 4WU5B 5HJBA 3PHOB 1WV7T 1GJIA 4O51B 3RPKA 4V1DD 1LHZA 4JZJB 4FNRA 5E7FA 4DP5X 1JZDC 1ZWIB 2FIKB 2ID5A 2L04A 1B0RB 2Q3ZA 4TNEA 3GBEA 4AXWA 3WY4A 4Z7IA 3AU1B 3MBWB 3EOAB 4TULH 2VISB 1HWHB 3FRUB 3S5LA 3FOMA 3S3PA 5I73C 4GI8A 3RKPA 4P2RB 5EU4B 1NMCC 5IY5B 3ZTEA 3BPLC 1XH3B 2B1AH 4XHJD 4WCYL 3UERA 1LEIA 1JPGA 2O6FA 4LDLB 5E5MB 2QTVA 3BUQA 5I71B 5JA9A 3IJYA 3PQYA 4WTXA 3UMTA 4ZFOL 4FTVE 4UT9A 2VRKA 1Q38A 5EBMB 1KCUL 1LE9B 4V1DB 4GW5B 4FQHA 2Y7QB 4G7YH 3AS0A 4MZ3A 1W9XA 1MNUL 4MQ7B 4ZFZB 3BPOB 2XQYA 5JPMC 4HEMA 4N1CA 4AENA 1J0HA 2H1XA 4F3FB 3VG0L 3KVQA 3I74A 4XNUL 1C5BH 1TO4A 5FOJA 4YEFA 4OGYH 5D1XA 2Y3NA 3IDGA 1ZANH 4J8QA 1LO4H 3IJEB 5DFVD 5J9PA 3ZDXE 2DMKA 3PGDB 1BD2D 2C4XA 4Y7OC 4PJ5A 3QFDB 4I5BB 4TLSA 5EBLA 5INCA 3H3KA 1IGYA 1YEHH 3NZ8A 1IC1A 4XP9L 4YE4L 4UQIM 1F97A 2CCWA 4X80H 1NCUA 3TCXA 1FL5B 3HPJB 3DTDA 1BGXL 4UOZA 1SOXA 1ZLDA 5T3XH 4XB7A 1JZHA 1OT4A 5AVUB 1AQHA 4ZOBA 2LW3A 1G0YR 2X7LB 5DT1H 4M1GL 5AWNL 4JMXA 5L7XH 4O58L 3WAJA 1ZY9A 4AZ8A 3PP4L 2GFBA 4PRDA 5F0MB 5AZEH 1CFVH 1F4YH 1UZ6F 1SDDA 4NRYA 2NR6C 4KJWD 5C0DA 1KYOJ 3PQYD 5EG6C 1HQ4B 1KBWA 4MX7A 3PGFH 1BD2B 3FB8A 5DC2A 5ISZA 5FDWA 4IBWA 1MHEA 2A0LC 1TVHA 3O2WH 4S0TD 2CGRH 1UYWL 4DP8X 2IOIA 3OZKA 4XVTH 1XV8A 5DVOA 2ATAA 1BXUA 1FYTA 2ZYRA 3JT0A 2O5YL 3PAZA 4AXWB 1DQJA 4OCXL 5LVEA 3ARYA 2EDLA 1WTGT 4UOJA 4GMTL 3L4VA 3TJEH 2HA1A 5IQOA 4F7KA 5GGQL 1I9IH 1QABA 3FOMB 2XTLA 2CRIA 4GT7A 3BO8A 3DETD 2RD0A 2J8OA 3MX0A 1E4KC 1TTBA 4FQ1H 4N9OB 1FNSL 5D1XD 3P4NA 5GGVL 4N2LA 5KJRH 4IJ3C 2WXOA 5F93C 4OCLC 4PJ5D 3UC0L 5I1HH 1LEIB 1JPGB 1M2VA 3NAAL 4P9ML 1V5JA 2W65A 3PWPB 4GUPA 4PFEA 4B0MM 3D85A 1TG8A 3IJYB 3PQYB 4WWOA 4JLRA 4YZFE 1XWVA 2C9XA 3ARQA 2J43A 4MWFA 4OLWL 1JZGA 1IZJA 2DQHL 2WY3B 5IHUL 2GIYA 4PEEA 1VCAA 1XD0A 4X8GA 3T0ED 1UWXK 2DI7A 1BF5A 3LPPA 5JIMA 4O02L 5I28A 2D7TL 3FQ4A 2JK5B 4HPYL 2A9BA 4GQQA 4AENB 3APFA 4X9BA 3O2DA 3C60A 2YUWA 3FT2B 4JFWA 1DBJL 3WL9A 2JB6A 4RH4A 1OAKL 1T1ZA 1RFDL 5D1XB 3IDGB 2ZG2A 3TH4T 1JE6A 1D5ZA 5AKVA 1NFDE 4EZMA 4Y1AD 5ISZD 4GG6F 3HAEA 3PS6A 4PJ5B 1V05A 1VPOH 3MCYA 5EBLB 5INCB 2BHZA 5J5EA 1A3ZA 1NOLA 2I27N 3NZ8B 5DSCA 1JN6A 4F7MB 3SJVA 4X6DF 4GAJH 4Y5YA 3SE3A 1QHPA 4ETQA 3W11C 1P4BL 1R34A 1BW8A 3FTXA 3UGXA 5DWPA 3T0EB 4KRPD 4R7VA 2BY3A 4GP5B 4JFEE 2E74C 4OCMC 2VWEC 3Q48A 4NQEA 4GQZA 3TPUA 3K6FA 3F6JA 2VR9A 3LNHA 3ZDXF 4ETYA 1IQDA 2R7EA 3P9LB 4QRAA 4AZ8B 4EI5B 4NM8H 4PRDB 2GFBB 3CDGB 5KYNA 2BH0A 2QHLA 2WJ5A 4ZDHA 1A7OL 1MCFA 1SDDB 4NRYB 3WJMA 3B7UX 5C0DB 3D85D 4X4XA 5GRWA 4QWWC 5T1KD 1GW0A 2APTA 3FB8B 4Y1AB 5ISZB 4RDQF 5EO9B 1MHEB 1NEZA 4XC1H 3GTVA 3G5XA 5T3ZD 3QUMH 3KM2A 3QH3B 5IQLA 4NXSA 1FIGL 1UWYA 2UWEA 4TUJA 2ENQA 4DPBX 3N91A 4MNHA 1DQJB 1A6WH 3FFDB 3G3LA 3W0WA 1HCZA 5ICUA 3QUXA 3C60D 4KRPB 5BV7L 3Q2CA 4L8BA 5CLTA 3WE6A 1YJDC 1ZA3A 3B9EA 3BO8B 4UMSA 3MX0B 3ZE2B 4R4ND 4MDIA 3HE6D 2Q10A 4LCYB 1BQLL 1OZUA 3RL1A 1MLCB 2FO1A 3P54A 1YQ2A 4G6AC 3KYNA 3IDNA 5DZOA 3VQ1C 1M2VB 2EXTA 4M61A 4PI0A 1GGTA 1SXNA 4GUPB 2F9BT 1XGYH 5T1MA 2ZF8A 3SJVD 2VZ3A 4JVPA 4JLRB 5T1KB 3WDIA 4MWFB 4PM1A 4CSZA 1XAKA 3Q5TA 1CD1A 6FABL 4HBCL 2E7LC 4BRJA 1WBZA 2WOYA 4HWZA 1SM3L 1KB9K 2DJUA 1KXTA 2LLNA 4EIUA 4NQED 5C2BL 4NN6C 4JO3H 2CKBH 3RYMA 2B5IC 3C60B 4U2ZA 3WL9B 3BKJH 3T65A 3SO5A 2XZQH 2JB6B 3HLAA 3FTUA 5GSVB 1T1ZB 4OFPA 3V4VH 4U1NA 4LKCB 4YZFF 5EZLB 3HE6B 2PYEE 4J39A 3KPRD 1D5ZB 4FKKA 4NN7B 4NO0B 4AJYV 2AQTA 1YYML 4XX1G 4A6YB 3HAEB 4HBQA 4AIZA 4NWTH 1OAZL 3L2NA 1S9VB 3MTRA 5DEFB 5DSCB 4CJ1A 3CX5K 3SJVB 1NBVH 4X7SH 1EJFA 1U3JA 5C97A 4ETQB 2AQ2A 3RGHA 1A8ZA 5TJWK 1CLCA 3W0WD 5B1JC 2BS9A 3GMPA 1B3IA 3QUXD 1KTDA 2BINA 3WY2A 4NQEB 5ACLA 2MSPA 2ZWSA 4JJHA 5IJVA 2ZUQC 5L8JB 1IQDB 2R7EB 4N8VG 3RWIB 3VFRB 4XVJL 4YHOH 4P04A 3OAZK 5D7SH 4Z18A 1R5WA 5BCAA 1OGPA 2R2BA 2HX8A 3QWQB 3WJMB 4U31A 5C0FA 3SDDA 4X4XB 2GSMB 3KPRB 1KJVA 5D1ZA 4NBZB 4Z3TA 5ABDE 1MAMH 5C3TA 1NEZB 3G5XB 2E9BA 1X44A 4FNUA 4TQEL 4HG4J 1PZDA 1LO5B 3KLKA 1ASOA 4KY1L 3ZO9A 3MNWB 1AGDB 4Z7VA 3WEAA 1NIAA 2OLDA 4X50A 2J4WH 2R0WL 1HH6B 4M5YL 1NSNL 2Z91A 4HUKB 3GI9L 4Y2NA 4OJDH 2AERT 1PNCA 1ZLWK 2KMWA 3W0WB 3NIDE 2FTAA 2Z64C 3QUXB 3VXSA 5E9DE 3EYQC 3RA7H 2YGOA 1DL7L 1XHHA 1Z66A 4M6ML 4BA0A 2DBLL 1YEEL 2JKIS 4JQVA 1ZA3B 1JF1A 3P9MA 3TWCL 3HI5L 3GSQB 3VRLE 3K80A 4NOFA 3KYNB 3GHEH 4AQ1A 5C0RL 2AQQA 2J1KA 3RVXD 1BG1A 1BZQK 1CL7H 1WTLA 1R0AL 1JWUA 5T1MB 4IK7A 2OCFD 4YLCA 5KN5A 4ZUVB 3MRKA 3UZEA 1JL8A 1E6JL 5K39A 2Z34A 3OXRA 2BSSA 3SE8H 4F8NA 4J6IA 1KXTB 3ASOB 4PGZA 1Y18A 3MYZA 1R4XA 3MGTA 1H3XA 1X5IA 3CZJA 5JW4Q 4GAGL 3N42B 5SWZE 3OAUH 4DEUA 4NKOA 5DS8B 1XGUA 5I1KL 5FGBA 2GI7A 4JFXB 1R1CA 4HWBH 1DQMH 4UTCA 1X5JA 1ML0A 4S1SH 3HLAB 3UYRL 3BT2L 1V7ML 2A74B 1GGCL 2YUXA 4U1NB 2R1YB 3R19A 1TQUA 4P06A 3SDDD 3EYSL 4RGNE 5D1ZD 4W81A 3REVA 4AIZB 2A6KB 3HMWH 2FZ3A 4LE8A 4LNRA 2WCSA 1V27A 2B3IA 3ARGA 3AG1B 3JWOC 2BY1A 1GGBL 1CR9L 2EJ1A 1BHGA 5H8DA 4R3SA 5KAQF 4JPIA 1JI1A 1U2CA 1IVTA 1KTRL 1RMFH 3GMPB 3VXSD 2P8PB 4LVHC 4Z7UF 2R0KH 2ALWA 1KTDB 2H6OA 3GPEA 3EG9A 3LEYH 4J3UA 2KZBA 3JBG7 3O8XC 3BYYA 2QQLL 2E4FA 2WKLA 3MJ7B 4LXFA 1GIGL 3MGOA 1R5WB 2R2BB 2DQIL 4MCZA 5JHDD 1T03H 4I77L 2Z7WA 3SDDB 2G2RB 3H9SA 5D1ZB 3VI3A 4NNXA 4RAHA 4A2FA 2VW7A 5KWYC 2XYBA 2ENYA 2XKSA 3F7YA 5EHFA 4RA3A 5D96C 2G60L 4HKZA 1IQWL 4YSTA 2R69H 3DPBB 4U1KA 4Z7VB 2B9AA 4DUXA 3WTXA 5I5JA 3BCFA 4H7VA 5GRZA 3NA9H 1LYQA 2C3XA 1KGXA 2Z91B 3LTVA 1UZ8A 4HSAC 2NDFA 5KVDE 2HT3D 3QVAA 1OAUL 1C16A 2X5PA 4ABVA 3VXSB 1MWAA 3VFNA 3GUTA 4NO2A 1MY7A 1P2CA 3EHBD 3QR0A 4BBWA 1ID5I 4LLWA 1GW6A 2XFXA 2M2DA 1AC0A 2QSTA 3P9MB 2L7UA 4IOFD 2C9PA 3NFSH 4K9EL 3G04A 3EGSA 2DQTL 3GXPA 1CU4H 4YBHA 4AQ1B 1IUZA 3E9TA 4FXGB 1HHGA 3H85A 5JHDB 2WYTA 4X0NA 1QMUA 1H6EA 3ARGD 3RJDA 1JWUB 2VIRA 4GO8A 1KN4H 2B59A 3NIDF 3TL5A 4HIPA 4GJTB 2N1TE 5K39B 2HSIA 2BSSB 3SPCA 3L4YA 1ETB1 1Y18B 2YJQA 2NX5A 3WXWH 1WFUA 2BSED 1Q9KA 3N41F 1T3FA 3NJHA 4HIHA 3VFGH 3C12A 1W6WA 1JPFA 4AQ8A 2IANA 5KVMC 3EHBB 4K5MA 1DCLA 3FONA 4WUKH 5T5NG 2N0KA 3IJHA 3PGCA 4P2RE 3L3DA 3EIFA 4HGWA 2A4CA 5JPNC 1S78D 2H9GA 3GB7A 3H9SD 2DWXA 3RHWF 3NCJH 4M3HA 3WIHH 3G6DH 2WV3A 3TJEL 3CMGA 1MFDH 3ARGB 3B7YA 4MS8D 1OE2A 4K23H 4S1DC 3S4SA 1DVZA 1XXDC 3MV8A 4QMEA 3GXUB 4R3SB 3RBGA 3E1F1 4S0SD 4V1DE 1QFUL 2OX5A 4KX8A 4OD2A 2Z31A 4OR1A 4JDVA 2XA8H 4CVWA 1TDQA 2MJWA 4FI7A 3LNDA 5CD3B 3IAGC 2D73A 4K8RL 4KZ0A 4MMXC 1OCZB 5TQ0L 3RWHB 3HA0A 2QGEA 2X6MA 3MGOB 3CVHA 4MCZB 1JRHI 1HHKA 2ZCKH 3AU0A 3H9SB 2IBGA 3VI3B 4NNXB 1FNGB 5C0ND 4YSCA 4HJ0D 4KJYA 2D0HA 3F7YB 3N9GL 4N24A 3S2CA 4IDLA 4KX7A 3APCA 1WGOA 3QUGA 4JFOB 1Z6JT 3UO1H 4DUVA 5MERA 2YGQA 3IMUA 3RU8L 1UZ8B 2DJSA 1C16B 1CJYA 4D8OA 3RZWA 1MWAB 3VFNB 4R2GC 3GUTB 4NO2B 4AH2A 2O93L 5I30H 3MUJA 2XFXB 4LLWB 4GXVH 3TBSA 2ADFL 1C8QA 1BVNP 3EBIA 5EH1A 5I0WA 2IBZX 3G04B 3PDDA 5IMOA 3ZMRA 3MOQA 1HHGB 1RHHA 5IVXA 1RUPH 2F5BL 2IDSA 3BDBA 1IC0A 4U1SA 4Y4KA 2BJML 1BD2E 3MV8D 1OO2A 5DHVA 1T1WA 5KOMC 2UX7A 1UH3A 3LVTA 3DX2A 5C0EB 2FECI 5DK0A 2YUVA 1EO8L 2ZXQA 4DZ8A 4HV8A 2VDRB 1E67A 3CC5A 1Q9KB 1T3FB 4HIHB 3L45A 1N5YH 5IB1A 3RPIB 2A99A 3KCPA 1EQWA 4MCYA 4UT6A 4ZTOH 4Y9EA 4K07A 4NNPL 2A77H 3RHWK 3BZ4A 4AJ0A 1WEJL 3PGCB 1FV1B 4W9KC 2GBAA 3L3DB 4I18B 3RX5A 1T83C 2WO2B 1E30A 2H9GB 1RV6X 2EDMA 2WZ5A 3GB7B 2YMXL 4WFHD 1S5IL 5I74B 4HVBA 2FT8A 4L1DA 3GJFK 1MVFA 4W6WB 4QUOA 3FHQA 3PWPE 3TX4A 3PQYE 1OK8A 1ZXQA 4RSYA 1CE1L 5IUSA 3NYKA 1N4XL 4K9EC 1F1GA 1VADA 3UBGA 5JOFA 3PF2A 2XG5A 3T71A 2CRYA 2AJXH 3FU3A 1PX3A 2EKSA 5K1VA 1A14H 1FCCA 3TIDA 1IKNA 1S9WA 4JDVB 5L88H 3EBHA 3AG2B 3FF7A 3G6JF 4HEME 1UXSB 5F0JB 2IPUG 3F6IA 1E5BA 2VUYA 4QHMA 3KPQA 1BAWA 3CVHB 2DQCH 1A9EA 3P11L 2IH3A 1NOAA 3LCYA 4NAJA 1HHKB 5D1XE 5DVNA 2XY2A 4XAWH 5FM5O 3KBHE 4Y4KD 2OL3H 3US0A 4PJ5E 4KJYB 3ELAT 5K9OB 5AYUL 4PG2A 4JKMA 1TJIH 2DYPA 1TVBA 3B9DA 4S1QH 4PRNA 5MERB 4DFIA 2QFRA 1I85A 3DSNA 1WCBA 4ZMVA 3UEZA 3W2DL 2EE9A 3QJXA 1BMZA 2DS4A 3GSNA 4U6VL 3T0EE 3EH4B 2PP9A 4WLCA 4DGUA 3ATEA 3TBSB 3WIAA 4LDCA 4UTBL 4PRHA 2FDBP 1X5AA 1HH9B 4XNXL 2FB4H 3STBA 4YVUA 3UJIL 3WNPA 1N67A 5E24E 2P8MA 1P6AB 5IMOB 5B7MA 4IOIA 5E8DH 1RHHB 4XPFL 5IVXB 4JCLA 1E0OB 3L3IB 5IF0B 2UZIL 4PAZA 2Y2YA 3RKDC 1MWOA 3SYOA 4PLNC 3GRWL 4Y4KB 4K8RC 1AGBB 4Y1AE 5ISZE 4N87A 5DHVB 1T1WB 4AVKA 5AVRB 5ES4B 5IW6A 4F58L 2J1WA 4PPTA 1G7JA 5DK0B 4BKTC 4N26A 2LTQB 3H0TB 4IMKA 3HBZA 4ZMPA 2VO5A 2EDKA 4OLZH 3CC5B 1PZBA 3W9DA 3JUYA 5IR1A 4Q9CA 5IB1B 3KCPB 4MCYB 4N5EC 1JPTH 2J88L 1CVSC 8CGTA 4MRCA 3NSJA 3QJQB 3BZ4B 1UEYA 3UXFA 3ZE2E 5TQ2L 4KY2A 2VMCA 3V4PL 1ZJBA 3MLXL 1CK0L 3MHZA 3TVMA 2O61A 3VFVA 1Q0YH 3O2VH 4R5VA 3VVVA 5TDNB 2R29A 3JWDL 2DYPD 4F15C 2CRZA 2XN9A 2JIXD 2C3VB 3MNVB 2EDEA 4MRBA 4L23A 1G5AA 3P3RA 1Q4NX 2MTAA 4HJ1A 4J4PA 1PEWA 1OTTD 1VADB 4GSQA 1TZOA 5T3ZE 5JOFB 3VD9A 1OW0C 5F7KC 5IT2L 1OP3H 2EKSB 3GLZA 4QCIB 3HJEA 3TIDB 2JELH 3C08H 1S9WB 3VXPA 1B9ZA 3MRBA 2CBMA 1AZCA 4PRHD 1EJOH 1WD9A 3BGFC 4KI5D 1N6QH 4QHMB 3KPQB 1HINL 4NXKA 5FKAB 1NCAL 1XGRA 4U3SA 1NCDH 1QBAA 2XQ0A 2J1XA 2BP0A 4MD4B 3MRIB 1J0ZA 1EMTL 2DQEL 3MCKA 4L48A 1QEXA 4N2MA 4X7FC 4CILA 1LNUA 3BP4A 4DKDC 4KZDL 3EJPA 5GGTH 3U79A 4OLXL 1UXLA 4M48H 3MRMA 4LLDA 2DYPB 1TVBB 2WXKA 5L0QB 1NCBH 3SJVE 2JIXB 3HKFA 2WYIA 3SOTA 3KCWA 1KY6A 1HEZA 2ZUWA 2X4PA 3QG7H 4IGBA 1FZKA 2WQVA 4XO9A 3GSNB 5DMIL 1DUZA 2VM9A 3KGRA 1OP5K 4QYOA 1FZOB 3A24A 4NQEE 1IC7H 1YUKB 3BDXA 4YOKA 4PRHB 5I17A 2IAMC 2YD7A 3FUKA 3TVMD 4AK1A 3FSAA 3IAQA 2P8MB 3BWSA 3LHPL 5FAAA 4IOIB 4PYGA 4JY4A 4W9ZA 1GYWA 3GKWL 2XN9D 4PWFA 3KPRE 2YS4A 3UAJA 5C08D 3U2JA 1N64H 5F3FA 5IJKC 2L7EA 2HRPL 5IW6B 4FNLH 4F8PA 5FLUA 1RVFL 1BFTA 3OMAB 3GM0A 4P0DA 4HFUL 1YN6A 3TFKC 1UH2A 3GF8A 3K5RA 3W0WE 3W9DB 2X4RA 5IR1B 3MA9L 4UT7H 5HJGA 1ZT4B 5HBBA 3VB9A 1RJLA 2HFGL 1A7QL 1J48A 2A1WH 4NJ9H 4UUJA 1KGYE 3X1FA 3U0WL 2W5PA 5HXMA 3SDAA 4YFEA 2HKFL 3DVIA 2HLEB 2C1PB 1FRGL 5C7XL 1JZFA 1NLDL 3TVMB 3S97C 3VFVB 5IQ7L 4GFXA 1A1MA 3L6FA 3IGLA 2NNFA 2WQUA 3OKYA 5KYUB 5ANMA 1SXZA 2XN9B 2YJLA 5C08B 5I9QB 2VNCA 2FD6H 1WLHA 4H8VA 2XV0A 1RIUL 4IGBD 4M93C 4MJHA 1RZQA 3WFCH 5TPWL 1SMOA 3V0EA 1AHWC 2J44A 4Y89A 4Z7WB 1WZKA 2DV6A 3ZE2F 2W60A 4LSSL 1PD1A 3VXPB 3D39D 3MRBB 2EVGA 1KCVL 5F89A 1ACYL 3OL2A 4N6QA 1X9LA 4JQIA 1SBSL 4KVNL 5BPPA 1JRHH 2FYYB 2ROXA 4JKPL 2WWKO 5DUPL 4ZX3A 1XGRB 2DQMA 4U3SB 1OWRM 5I0VA 3QQ4A 1NCCL 1RZFH 4OD1H 2IH8A 3MCKB 5BRPA 3UAJD 2DEYX 4UQ3A 2XQYK 8FABA 4ODUA 3BP4B 5CJXC 5CEYA 3SYCA 3WENA 4KU1A 1U41A 2DM2A 3ELQA 2Q3XA 1M71A 1NCIA 4KQ3H 4J6RL 4Y5XA 3V8CA 4I88A 1HEZB 4N8VB 4Z7QB 2X4QA 2EVIA 2X4PB 2VDMB 4IGBB 3X1BA 5EOQH 4YHML 5KTEH 4F1SA 4XGZA 5E5LA 1DUZB 1K9TA 4FQXA 4QYOB 1WO2A 1S9YA 4LQFH 4HDIA 2Y36L 1OTUC 3JWDC 3TZVD 3D39B 3LV3B 4BXVA 5I17B 2YK1H 3SDAD 3P73A 4JL2A 4PYHA 1NCJA 2NY1C 4FKHA 3MBXH 3PDGA 5CP3H 3E3QC 1ADQA 3NT0A 5J1SC 1K3IA 2J55A 3TNNA 3N06B 4Z5RA 3UTZB 3HG2A 4KTYA 5FHBL 1CURA 1KGWA 1JVKA 2QEJA 1GL4B 4D3CL 4MAZA 2VMJA 1WAAE 4OGZA 4R0LA 4G6JH 3FU0A 4E68A 3VFUB 4HXBL 4JO4L 2F2HA 3EDDA 3GNML 4Z7VE 3SQBA 4CKQA 5KVDH 1DJIA 1QYGL 1YN6B 1AS8A 1CIUA 2VZVA 2BCMA 2OS7A 3IJ9A 1Y1UA 2X4RB 2CM5A 3VXSE 3IWUA 4PW3A 4ZMZA 5ALBL 1RJLB 2AQ1A 4Y4HD 1JMXA 3TZVB 3GBML 3GDBA 3D30A 2WN2A 4TNWF 3SQOH 3RG1C 3SDAB 4CU8A 1DFXA 2LLGA 1RPKA 3CBRA 5AAWC 3B5TA 4K3JH 1K2DA 5I1IH 1NAKH 2IPTL 4U49A 1A1MB 1SMAA 2GBUA 5JHDE 4OZIB 2UWEF 1E4XI 2VXSL 5ANMB 4X83A 5KJ7E 5B1BB 1OCRB 4GKNB 3T77A 3KVDD 1PBYA 5EBGA 5F7UA 1CGXA 4PLJC 1S7QB 2VZTA 4M8RA 5EIIA 3G9VA 1CFMA 2HLFC 1MNNA 1TTFA 4PVBA 4FQXD 4WV1A 5EEXA 2IDTA 4KKBD 3UTSA 1HTYA 3BAWA 4YHZL 4WO4A 1IJNA 5GS2H 2W60B 1RUPL 1MCHA 2OYMA 3MYJB 5K1JA 5F89B 4FA8A 3VW3L 4IQHA 1CD8A 3UBXA 1K4DA 4R84A 4TF4A 3X3FL 1Z3RA 3HN3A 5F1KC 2LOEA 6TAAA 4Y4HB 4XVUD 1X6LA 4YHNA 3GHPA 4F9LA 4XXWC 3QQ4B 1T20A 1W72A 2Y2WA 2DMBA 5I6MA 1YEWA 4UQ3B 4ODUB 2W95A 5CEYB 1MFMA 1TQCB 5CHNB 5ADPH 1EZSA 4CRPA 1M71B 4ZTEA 3N42F 2A77L 4L29B 4EUPA 5K33A 1NPJA 1J1PH 3QFJB 4XCNA 2AEPL 4F8OA 5HHPA 1UOWA 1PLGH 5AW5B 4FQXB 5E00A 2HLAB 1S9YB 4HDIB 4W93A 1XFPA 5C0CD 3FU6A 4XTRD 4WK4B 3WTYA 2DQUL 3MFGB 4WEBL 5F6HJ 2OKMA 3P73B 1WBYA 1U3HA 4ESKA 2FQDA 3S48A 4J3BA 4P4RA 2R2EB 5IEHA 1AACA 1T22A 3PHAA 3TNNB 3H9SE 3VI3E 3S96B 1U3ZA 3WO4C 3F7RA 4R0LB 4Q14A 4G8FA 4U6HA 2HT4D 2I60L 4MBRA 2D7PA 2VUOA 1HSAB 2AABL 4N2GA 3UTSD 3S34H 3CDCA 1JZEA 2O5NA 5CGMA 1KFAL 3ENEA 1AO7A 3DLQR 4G8GD 3AW5A 4WW1A 4TS6A 3AWFA 5DXWA 2CDEA 2VITB 3H9HB 5C0CB 3IGFA 3KJ4B 4JS7A 4DFHA 4O4YH 4P2OA 1XIWA 5AB1A 3NOIA 4S1QL 4PLKD 4JPVL 1K2DB 1RSYA 4C56A 3WIFA 3CAFA 4ZUSB 3HI1A 1NBQA 1NMBH 2BSRA 4IRSA 3CLEL 3QWRA 1RIHH 1WYJA 5D1ZI 3ABGA 1A3LL 3BPNC 2E56A 3K4DA 4NKMA 3T77B 2NUPB 3OKDA 5ECGA 5AB0A 1JNJA 4UV7L 3WJJC 2Q76A 3SYAA 5FYLL 5EIIB 2R0ZH 3ARPA 3IS0X 5CR1A 2FB4L 1FNAA 4WV1B 2CA4A 1DYZA 5B1CA 4U1IA 3TN0A 3UTSB 3GLDA 4P4KA 4KKCD 1ASQA 3D25B 4G8GB 3IKKA 1BEYL 4LPWA 3UBXB 4TLKA 1K4DB 3GPSA 2P5EB 5DA4A 4KI1A 4U3XA 4MS6A 3IKCA 1CLYH 2APXA 3UG4A 1OLLA 4R26L 4DTGH 1E42A 2C9QA 4IBTA 4XP5H 1QOKA 5TK4A 4KTDL 4LEXL 3L3OC 1T20B 1W72B 5F9OL 3K7UA 3UG3A 2CMRH 1HL4A 4FA7B 4F24A 3RDTC 2Y0SA 3AUVA 4WJ5A 4M1CD 3QORC 2EE0A 3L4UA 1YECL 4G5ZL 4UT9H 3Q6FB 4QRRB 4JFTA 4EUPB 1RZGA 3HOGA 4LCWA 1C1EH 3MV8E 1BZOA 4LPYA 4PB9H 1MOEA 4XCNB 1EAJA 1T04A 1S8DA 2XN0A 3BC9A 3QPQC 1AO7D 1OP9A 3D87B 3PHQB 5HHPB 2L8AA 3F3HA 2WMPA 3FO0H 4X6CA 4BKSC 5E00B 4S11A 3D33A 4TRPH 2XICA 1AY1H 4P2OD 4AVJA 1TUPA 1HS6A 1KNOA 4P5MA 4XP1L 1WBYB 2GAZB 2AFNA 1JFHA 4N4YB 5DC0A 4C56D 1D7FA 3VDAA 4IRSD 3ETTA 2Q2LA 5IEHB 5IG7A 3QWRD 4M43H 4Z78A 3QEGL 4WFHE 3BUDA 3A4AA 4YIQB 4OT1H 3W3BA 4QXVA 2NZ9D 4L3FA 5I1JH 2ZXCA 3CSPA 2KPWA 4M8VA 5EO1A 5FB8A 4H20L 2FL5B 5CSZB 3WY3A 2PUQT 4MJ4A 4P59H 4YC2B 3ULUD 4DKAA 1G7LA 2BVEA 3FULA 1AO7B 1B88A 1BBDL 1TJHL 2JTYA 2YD2A 1OSEA 3FUDA 3N85L 4PSPA 2CDEB 3DUSB 5KANG 3DURB 2G9KA 3RTLA 4P2OB 4CDGC 2AXGB 4L4JA 3HFML 3VI3F 1T2QL 3VA6A 1J5OL 4L1TA 1QZ1A 4U6XA 5CU9A 4C56B 3WIFB 4OZFA 3GS0A 3HI1B 5JHLL 2BSRB 5IVXE 4IRSB 3ETBJ 2MPAL 4LPTA 4LCWD 2E59A 4NRZB 3ZUCA 1EFXA 3M17A 3GLAA 1PZAA 2JKWA 2Q76B 4XPBL 2WB1A 2Y69B 1E2ZA 2IEPA 3GIZH 4U1IB 4QTFA 3U9PH 3VWJC 1MIML 4LSRL 3FHAA 2WXGA 1MCDA 1ACCA 1MHPL 3QUZC 3VGHA 1IEAB 1N0LA 3DMMC 3ZKMD 5AL0A 1MCEA 4PBXA 3KAAA 4JG1L 4DK6A 5I1CL 3SE4A 1CDIA 2MPVA 4FQ2H 3ZR6A 5CILH 3WMQA 3GXMA 3KXFD 1G9MH 3D51A 5HDLA 1N7ML 2XA3A 2OP4H 4UTAA 4WJ5B 4KK6C 4KBPA 5E6RB 1CT8B 5GJSL 3RFZC 3PV6A 4BCZA 4IBYA 1KTJA 1RZGB 4LCWB 5F7AA 5T3ZH 3QS2A 2ZWNA 5C8JB 2NNAA 4DJMA 5B38G 4X6CB 2DMHA 2GJ6A 1VEPA 2BY0A 3OZ9H 4OUUB 1I3RA 3O2DH 3F58H 3H7LA 5GZOC 1KNOB 4P5MB 4QTHA 4RISH 5DVMA 1A47A 1QASA 4KMTL 3W38A 4DQOL 1CCZA 4YZWA 4J2XA 2FGWH 5DRNA 5CJ8A 4A6YH 3B2VH 3HAEH 3KXFB 4Z78B 1W6LA 5EZIL 4A7VA 1GS7A 2ZXEB 4FXKA 3J7HA 4OLVH 4DIXA 3IBEA 5EO1B 1FSKC 4ZQKA 1E8WA 1A3QA 1MSPA 4JREC 3RZCA 3MLVH 1CFNB 4UNIA 2YWYA 2PMZA 1H8NA 3CHOA 1P4IL 3LZPA 1WH0A 1RSFA 3B37A 5GRJH 3WSQH 3U30C 3MLYL 5DHMC 2G3MA 1PPIA 1MJUL 1ZT1A 4PRHE 2XVLA 1CF8H 4MJ6A 4YXKH 2VXTL 5E95B 2A9ML 4RMWA 2Y1ZA 5LXGL 1X5FA 5BVPH 3LPOA 4KI5E 4QHPA 1FZMA 4U6XB 4BDVA 4L9LA 4YK4C 4XVSH 4UINH 1KJ3L 3MUGA 3CFUA 2Q20A 5I19H 2EIZA 2D31A 5C6PB 3M17B 1T80A 4JFDA 3ZSSA 1DUYB 3U4KA 3ZGHA 1Z5HA 4JFZL 3HUJB 2GJ6D 2EE2A 4AGQA 1LLAA 4KDTA 2ARJA 4UQEA 3NACH 2WNWA 1F4HA 3V6ZA 3KLDA 3I6SA 1HU8A 1Z1WA 1ANUA 4R96A 4XXCA 3WUZA 3S36H 3W81A 2FECL 4XPAL 3MOBH 4ZMLA 2WD0A 4L3EA 3HCVA 4R4FH 1NCNA 4WK2B 3BW9B 3U7YL 1I8AA 1CB4A 4HF5H 1NDGB 3PLYA 5TH2A 1RZ8A 4LT7A 2CK0L 1UT1A 3PUUA 1F11A 1DDHA 2XN9E 4DUWA 1GC1L 1Q0XH 3WV0A 1NEUA 5C08E 2NSQA 1HE7A 1S4IA 3NMEA 3LXAA 1QKZH 1IX2A 2GJ6B 4Z7WE 1L7TH 2GW5A 3MODL 2O5XH 4JDZA 1I3RB 1BVOA 1ZOXA 4WTWA 4OFYA 3HHMA 2DLIA 3ECUA 4M00A 4PP1C 1YNKL 1A6VL 2B14A 4XX1E 2H3XC 1EZVX 1UEMA 4AEHH 3EDFA 3KPPB 1U8NA 1RI8A 5FWRA 4AZUA 5KBKA 2BMKA 2CHDA 4FXLA 2JMRA 5DRNB 4WWKA 3L5WA 3RVWC 1UKQA 2G3ZA 1UM5L 1ZSDA 2PR4L 3CN0A 4FXKB 1J1OH 3JV6B 4JFDD 1KV3A 4NUGH 5EUOA 1EEUA 2DQJL 2AZAA 3FW6A 4QKXB 2MHAB 1ZV2A 1URIA 3QWOA 2OMVB 1EXHA 4Z7QE 5HHQA 1DQDL 5DMYA 1P9MC 3EGXA 3VVWA 2P5WD 3CDZA 5IBUB 4HCRL 5ICXA 1CFTA 1A1NA 3RY6C 1MFEH 1IBGH 2YAEA 1MFCL 3IEAA 4OF0A 1G7MB 5F7EH 5JW5A 4XNYH 2P26A 2FT7A 1E7VA 3D39E 2AAVA 2H7WA 2WWMD 4XMKH 4F2FA 1E3FA 3ARFC 4MJ6B 5DJZB 3ZYJA 1JUFA 1VSCA 1H3PL 4NFBA 4BDVB 4L9LB 5DJ6A 3OHXC 1I53A 2GQHA 5IBTH 3MUGB 3NSFA 3WEBA 4IKLA 1V3LA 1I9JL 1RURL 3S35X 4RAUB 2D31B 4JFDB 4Z0BH 3QUKA 2MKLC 2XWXA 1TLKA 3OC8A 1NH6A 1ZVHA 4G6FD 3FYEB 2VDOL 1ZXKA 3DGDA 4PJEA 1KCRL 3SY6A 4DCQA 4ZUUA 4ZMTA 4OVUA 2YSSB 1T7VA 3FB6A 1MF2H 4HWEL 1KJMB 2P24A 2P5WB 4MNQD 4R96B 3OR7B 4CBPA 3FK3A 1OGSA 4MTMA 5LWYH 3FQYA 1N3NA 1IM3A 1HL8A 1OSYA 1TJGH 1WSST 2UX6A 2UY6A 3QUHA 4TQIA 3GLEA 4N2HA 3CUPA 2AQ3A 2JQMA 3L08A 4NLAA 4LSPL 1IGML 3IK2A 1OAYL 5DYOA 3MSPA 3RFRA 4ODXA 4W9IC 2E9JA 1WCQA 2RBLA 3UCRA 3LSOA 4OZIE 5TH2B 1RZ8B 1TETH 3BVUA 4EN3A 5DD1H 5ANME 2CO1A 1DDHB 2LR4A 3C5ZD 1WA1X 3F65A 2IBBA 4PJDA 3HNSH 4S1RH 3LJ3A 2HUHA 5H37A 3AREA 4Y5VA 3S3SA 4OM1L 4G6FB 4LMQE 1A25A 3FUNA 4KAQH 2DWEA 1KLUB 3ZDYB 2G2PA 4JDZB 3VA2C 3B3IA 4NZDA 4DP6X 4MNQB 1G9NH 2ESVA 5DRWA 3LZFL 1YEFH 3MLRH 1MFBL 3SBWA 4BHUA 2JTDA 5DMKA 2OMYA 1U8NB 3OX8A 1XMEB 2AV1B 1EANA 1AI1L 5T1LB 3CVIL 4CSPA 3L5WB 3RPBA 3QJTB 3OB0K 3PXLA 3VE0B 1OKEA 4LCCA 5CGTA 1IAOA 2GG1A 1ZSDB 3TO4A 3LRLA 3P77B 4N25A 5EUOB 3VWKA 4ZS6D 4H88L 1M9WA 3QQDB 3EUUA 4KKRA 4TNGA 2JE8A 3C5ZB 3PL6C 3CLFL 3QFJE 4DTGL 1SOKA 1F13A 2ROYA 5H2BB 3O41A 1G7PA 3EGXB 3CDZB 2VW6A 2NY7L 5CN2A 5D70L 1CFTB 1A1NB 1HWWA 5E5RB 5ICXB 4DPRA 1RCYA 5JW5B 3QQ9C 1D6VH 1CUOA 1IM3D 4UT9L 1JUFB 4KXCA 1VCBC 2OMUB 3GWJA 4XN4A 5FFGA 5DJ6B 5CD5D 1JVOA 1BVLB 2AVFA 4GRWB 1HZHL 4NKQB 5ID1A 4Z7QF 2A9NH 1JK9A 1M53A 4TRPL 4ZFGL 3OF6A 3SGJC 4QY8A 3ARED 1EUUA 1NJ9B 1KC5L 3T3MF 5KYYA 1J87A 4PJEB 5AVYB 1GY2A 1QI3A 4ZUUB 4DCQB 3G7TA 1MWAH 4KV5E 3LNEA 2WLHA 4NB7A 4M43L 2P24B 3RDJA 4JG0L 2ESVD 4EI0A 1DO6A 1L9NA 2YGVA 4LO9A 1T89C 5C0CE 3LIZA 1N3NB 3PAUA 1IM3B 2UY6B 1FPTH 2DQGL 1MFVA 1A5FH 4M9PA 1T6BX 3MRDA 4FULA 2X3BA 5DYOB 4ODXB 2YFOA 2Q1EA 4GINA 2VABB 5IW3A 3DJTA 3LSOB 2BIIA 2VXUH 2QZ5A 3VWKD 3QRLA 5I71C 4MAYC 4P05A 1ID2A 3BRDA 2OTUB 1SN2A 4PJDB 2EO7A 3SGKA 4ACPA 5EOCL 5C6TH 3ECBA 3AREB 5HP5A 4Y5VB 2VDRH 3V0IA 2ERJB 2HRGA 2DWEB 3FXIC 4RNRB 3UTSE 3BPOC 4O2EA 3ZE1F 2DTML 4OCNC 3U0TA 4G8GE 1RL1A 3PJSA 2ESVB 2P5EE 1ROWA 4HK0A 2IFFH 5DRWB 5EF0A 5IB5B 2J6EL 4MCMA 5DMKB 2OMYB 3KWTA 3OX8B 1ZK9A 4D2NA 2BP3A 2YWZA 3F7QA 3V55A 4W9DC 1KYOK 3P0VH 1N10A 4Q0XL 4QRPD 1IAOB 3MRCB 3SBPA 4AY0A 2CO2A 3OF6D 4I87A 4CN1A 3VWKB 2OK0L 2GPZA 1QWNA 2R27A 4R97B 1B6UA 2NY4D 2Y4SA 4N2CA 3NIGB 4ENED 1E5AA 4MB3A 1EEYB 3O41B 4I3RL 4QNPE 4JVWA 5FKPA 2OP4L 3EJCA 3KW7A 4IBVA 5F72S 3CXDL 1GZHC 2CPUA 2X05A 5JQ6H 1ZEAL 3CVHH 3MROB 1T0NA 1FDLH 4HYTB 1M3JA 3D1MC 1A0QH 1PG7H 5DFVC 5ID1B 1EPFA 3RVTD 2YPKA 5ILTH 3FMGH 4QRPB 2RB8A 4LOVA 3W5NA 2X89A 4GUCA 1DBMH 4QRUA 1ZE3C 3HHRB 4QY8B 3V0HA 4WSGA 3EYUL 1DVSA 5L8KB 1MLBB 3QNZA 4K5PA 5KYYB 5JXAL 1W91A 2NY4B 4J8RB 2JJTA 1RZPA 4OGXH 4KJQD 1AO7E 1BWMA 3I9GL 3NVQA 1U92A 1T2XA 5DVLA 4HETA 1WF5A 5GJTH 4P9HL 5E2WL 5A6MA 2KDYA 1DANU 3OPZL 2CLZA 4UB0H 5DHDA 3GZOA 1NUNB 4OLEA 1AXSA 2PCPA 4NQXB 3DGGA 5CFHA 3MRDB 1BXXA 1GMEA 5SV4A 2DY2A 4DW2H 3EXLA 4ZMXA 4C56E 2QFPA 1FFPB 3LKOA 3MRFA 4OTXL 4V2BA 3ARBA 3VQLA 4KJWC 3WSQL 4A68A 3B2DC 1Y6MR 3O11B 2G75A 3ABZA 4YSSA 2A2QT 1PJWA 4M5ZL 3M1CA 3H2QA 1ZK5A 3DO4A 5DHVH 4QI3A 4BXSV 1Q94B 2W0KA 1CXHA 1GGUA 3ECBB 4AV0A 1HWGB 3CZKA 3F84A 5KVEL 4N1HB 5BVPL 1E4XL 2ZKHL 3K2MC 4KVCH 1L9RA 1CXFA 4OB5L 1IMHC 1I75A 3ULUE 3IGAB 4UT6H 4XVSL 1QWUA 4I4WB 1A9VA 1OXYA 3LMJL 3N1FC 1OCCB 3T8XA 4YDKH 3UJTH 1A7NL 4HK0B 4NFCA 1VAHA 2WZAA 1BEXA 3O6LH 3I02B 4NZRL 3DETC 4FYSA 5D1XC 5FYKU 3CIQA 1WZ1H 3IFOA 2IWFA 3Q5YA 3BAYA 2X89D 1S3KH 3FL7A 5F1OB 2B4CH 3KPTA 3QIBA 3ZYOA 2ED8A 2EDDA 4LAQH 1NAMA 1MCCA 4LK4A 1EJ6A 1JZ4A 4LCWE 2D03L 3SPGA 4YSUA 4ZMWA 5FIEA 4GIOA 2YGPA 4HA1A 3SDYH 4HCGA 2HVJA 4X6CE 4PJHA 4GRLA 4I3SL 4D7BA 1ZV5A 2CIIA 4OI9A 4W9LC 2XDHA 2IWKA 5CJOH 1FF5A 5AW2B 2FNWA 1CTNA 3STZB 3ZU8A 2XBTA 3NCWA 2DIAA 5ALCL 2WP3T 1T0NB 4LLUA 3ARBD 2X1XR 32C2B 5EF2A 2YFNA 3M1BA 1DTUA 4HJEA 1NLBL 3KXFE 1F6AA 3A6CL 2YPKB 4PWHA 3S6CA 3VDCA 5C0JA 3CSTA 1SEQL 2W94A 4QRUB 4TQ8A 3A67H 3UROR 1BJ8A 5G4OA 1ZS8A 5I73B 4CSSA 3ZMEA 4PY8I 2ODIA 2OAAA 3QNZB 3NZSA 2NNCA 4U33A 2WZPA 2E27L 5EA0L 3GSNH 4OM0H 3V0WL 3BPLB 3B7TA 4KRPC 1Q72H 2BDNL 1U92B 4Q97A 2C9RA 1X5XA 1DE4A 2Y7MA 4XPHH 4B60A 5I76B 1VIWA 2CLZB 4L4TB 1OF0A 2E9GA 1DLFH 5F1NB 4M4PA 5C70A 5AAMA 2HJLA 5J06A 3DPDA 5T1DL 3MRLB 1G9MC 1FGNH 4HKBA 3LKOB 3MRFB 4JJ5A 1RZJL 3ARBB 1LDPH 4N90D 2Y24A 5MP6H 5JPMB 1IEHA 1NL0H 1CE6A 2YQBA 1OPGL 1RPUA 2X88A 3LXCA 3K8MA 1M57B 4WHDA 4UILH 1RZKH 3C5SA 3KNBA 2UXGA 3HUJE 4GRLD 1FG9C 1FZJB 1U93A 3T09A 4GO6B 1J0KA 3NFPA 1M6OB 3EJUA 3ZQ9A 3C60C 4L2LA 4NUQA 4WQOA 1TZGH 4WRLA 5CJQL 1WFTA 2HYMA 4R4NC 3HE6C 5CF3A 4NN7C 4JEGB 2YSTA 3RWDA 4JZOA 3K6SA 2R29H 4OKDA 5HYJA 1F8TL 1FHNA 2VXVH 4P2AA 2R8SH 1NAMB 3K1DA 4YXHH 3ULUF 4HHAB 4C4KT 1AHKA 3D06A 4OBSA 4Y5YC 2WZPD 3SE3C 2XWZA 1C5CH 1KN2L 5BZDA 4QRTB 1TTUA 2NSMA 1IE4A 1KBGH 2FT6A 1X9UA 3RWJA 2ZXGA 4PJHB 4GRLB 5E8PA 3SZ6A 5IVOA 2GJ6E 4OCRL 5K5YA 3LNIA 4YFLF 5AYTA 2COQA 1DR9A 4W9FC 1AQKH 1H3WM 2FCBA 1H15A 3BEWA 2FSEA 3L95B 2OYPA 3CVDA 2UXFA 4LLUB 3H6JA 4UQDA 4TL5A 4YFLI 5DJXB 3CWGA 5AW3B 4G8EA 1F6AB 4JN2A 4EQ3A 3IGKA 4X6CF 2OMWA 3OKOA 3VM7A 4PGEA 1ZS8B 2Y07H 3D2TA 1YEFL 4ZTPL 1EVTC 1OF2A 2VDMH 3M6DA 4IW4C 5GRUH 5IJBC 1B0IA 2W1NA 2VDKB 5C9KA 4LP8A 2JQZA 2JI2A 4G5AA 4GIAA 4IJ3B 5BJTA 3QUXC 2PWGA 3LB6D 1JDDA 5CEZL 1G7QA 1DEEA 3FN3A 5DI8A 1KB5L 3RAJL 5I6KA 3JYCA 3GMQA 5AD0A 4ES8A 1U95A 1BX2A 4E9RA 2HJLB 1QSFA 1JSYA 3NCEB 2VC2B 4PV1C 4HKBB 5HYJD 2FX8L 4Z3FA 2WBWB 1TCRA 1A6ZA 1KEML 1XL4A 1O7SA 2AP2A 5FK9A 4B41A 5HGDA 4JFDE 4L4VD 5DUML 3FYIB 2YRBA 2VR6A 1ETZA 1P4LA 2BXZA 2VSDA 1JGEA 3KNBB 5F0LB 3DOSA 5F1IA 1U93B 1DSFH 4RRPA 2JKSA 4EO5A 5EWIH 3IDYB 2WQXA 3T1WA 4JGJA 3PIQA 3NFPB 4ERSH 2QMKA 1P69B 4L5FE 3MU3A 2F53B 3BE1H 4ZMYA 3LKQB 1PEZA 2P5WE 4KOBA 1JK8A 5CIPA 2A74C 1YEGH 3I2CL 3Q01A 1YHPA 5I6LA 3NTCL 4WJG3 3N40F 3Q2LA 4JZOB 2AJUL 3SOBL 1GSMA 3K6SB 1J9CT 1CDYA 3WXVL 5HYJB 1HI6A 2OJEA 5MEPA 1AAJA 1GA2A 3EOTH 4ZFOB 5BRQA 1JGDA 3N1MC 5D7IF 5DO8A 1SY6L 2IH1A 2GTWA 2IDCA 5DFWH 3MRGA 2ZIDA 4L4VB 1IM9D 1Y7VA 4D0DA 2H0EA 1HZLA 3RWJB 2XZCH 5E8PB 5L6YH 3PWUA 4O02A 1I4FA 1Z3GL 2OZNA 3ZDYE 3ZSTA 1G5GA 1Z9NA 4JQIH 4C57C 4MNQE 3PDOA 1CDHA 1H15B 1QSFD 3BEWB 2FGZA 4M3JA 2PF6A 4BFGA 4GBXA 3SDDC 1F58H 1YQVL 3MN8A 3N40P 5D1ZC 3CMOH 3NJIA 4G8EB 4JN2B 4FS0A 3APDA 3RWFB 2YPLD 3WNKA 1L0YA 1WD8A 1F1AA 3N5AA 4BE6A 4MVBD 1QPXA 2OMWB 3OKOB 5EUOE 3MNZA 4U05A 4LQ1A 5GHWH 4W1TA 4MD0A 3SQRA 1OF2B 4R8WH 4TLUA 3H3PL 3UTOA 3V6FA 5DK3A 4AM0A 4CGTA 2BRRH 4IIQA 1IM9B 5BJTB 5FM5M 2IBZY 1G7QB 1DEEB 5SWQA 4LCVA 3Q13A 3N6YA 1YN7B 3C8DA 4JQVC 3GMQB 1U95B 1BX2B 2B8OT 1ZS2A 5I16B 1QSFB 3HRPA 4F2MB 1ADQH 1Q1JH 1MEXH 4AQ1C 1I8UA 1RUKL 2H2SD 5E4AA 7CGTA 2AEQH 1T7YA 3F01A 1A6ZB 4GRWE 5TE6L 3C2AL 1DJWA 1IC4H 5FK9B 1XSIA 4MJ2A 2YPLB 3K6OA 5DD5H 5KSBB 3UZEC 4XVOA 1ILUA 1D5BA 4W9HC 1P4LB 3QC6X 2CO3A 5AVWB 5JQ6L 4FXTA 4N68A 5KYWB 4MA8L 3HZYA 2NNRA 4PJEE 3OV6A 4CC4A 5HJ3A 2WGXA 3DUUA 1J0YA 5FGBC 1F6FB 3PWNA 2HT3C 3L1OH 1CLOL 4G43A 4ANWA 5AZ2L 1HHIB 2YXFA 3ZTNH 1KCWA 3EHBC 1JK8B 1G9NC 2W91A 3VXQA 3FH7A 1DVFA 1U2YA 3OG6B 2YLKA 5CIPB 5TFSH 3V5HB 4AYFA 4NKIH 4GBXD 4WDIA 1BYPA 1F90L 1WZAA 1YUHA 4JKLA 2ADJA 5MENA 4NQDA 3O3AA 4W9GC 4OCSL 5IHWA 4Y1SA 1HI6B 2OJEB 3ARGC 2BSBA 4FFVD 4JDEB 4HEPG 1QBML 2ZUQB 4NWUL 5HYQA 3FTZA 1JGDB 4PJDE 4RESB 2IH1B 2GTWB 3EO9H 2R23A 3MRGB 4ZOCA 3D7PA 2JVUA 3BAJA 5F9AC 1TNMA 1VZIA 4ZSOA 4KQ4H 2D7OA 2ZTBA 3IU3A 1N5AA 3PWUB 3OQ3B 4O02B 3OJMB 1ZVSB 4J3OD 4BFNA 1P7KA 3IMVA 5JOEA 2WIIA 2F8VA 3LKPA 2ESVE 3PDOB 4K3DL 2YPVL 5E9NA 2WLZA 1ONQA 2WTPA 1W72H 1LO2H 5LG6A 3CE1A 2DDQL 4MXWL 4Y16A 4GBXB 4KVCL 1S78C 1WVZA 3SKNA 2MTPA 4HUWA 5HHXL 2BVTA 3EZ8A 1FG2B 2V7NB 2XX0A 5DUBB 4EUPH 3F85A 1LEKA 2XJLA 4MD0B 1IAIM 4MS8C 3WN6A 3ZDYF 4L2YA 5F96H 5F44A 1NPNA 5IMMA 3GSRB 3NIGE 4PB0H 3V6FB 4AM0B 1UVQA 3GBDA 4U4BA 4IIQB 3RUGB 12E8L 2A38A 3VMPA 3QDAA 2FH6A 1CI3M 5SWQB 2R59A 3MLUH 1C9SA 1DVFD 1ZTXL 5D5MA 2OZ4L 4LAQL 2KUTA 4TN9A 4QKTA 4GI6A 2CCLA 1B0WA 1MJ8L 3MQIA 4TNFA 4OJAA 3UPRA 4M7KH 5EUOF 4LGSB 3FPYA 5MEND 1NGQL 2WNGA 4NQDD 1F2XK 5GS1A 2VXQL 1IFHL 4JPSA 1FJ1A 2YMTA 4NN5B 5LGYA 2QVTA 4QRPE 5C0NC 3AZUA 4HJ0C 1K3ZA 4ODHH 4ZMQA 4JL1A 3I3DA 1D5BB 2VH5H 5DJDB 5LDSA 3KPNA 1B4JH 4YO0B 1SN0A 4CL7A 1FO0L 2A6JB 1I1YA 2WTRB 5HDQH 2VAAA 5HJ3B 1DANT 1UB5A 3BWUC 3PWNB 5EO0A 4DGVL 4G43B 3VRIA 4AQ8C 2FH8A 4I2XA 5BV7B 2N01B 1MXGA 1MVYA 1UM6H 4H1LA 1DVFB 4XMLH 4GRWF 1SDAB 3E8VA 4OD3L 3K4ZA 4Y16D 1TCMA 5D72H 4WDIB 2OMZA 3O9WA 5K93A 1NIBA 5I74C 1YUHB 5HHVH 1Z9LA 3X1NA 2EXYD 4APQA 2ADJB 4LVHB 5MENB 4NQDB 3U48A 3O3AB 5BO0D 4C83A 4PJEF 1A6UH 3BDYL 4X8CA 3QHFL 4X4KA 1XQ4A 4PGJA 5HYQB 4LFHD 5IGXH 5IKCB 1O6VA 3P0YL 1M7IA 5E99H 2R23B 3VXMB 2V9QA 4OQTA 1QRNA 1YMHB 4ZSOB 2XV3A 3IU3B 2Z31C 4J23A 1CXIA 1A8JH 4AKQA 1P7KB 3W82A 5D2LA 4I7ZC 1NL0L 4WVRA 2WIIB 3U2SB 3LKPB 1N0XL 1F56A 2OW7A 1HXMB 4FFZA 5EU6A 3K4AA 5FUOH 3VFSA 2XPYA 4FD0A 4OIAA 1F4XL 2IV9A 5IFAL 2J5LB 4M5SA 1H3GA 2WZ0A 1JWSB 3CFIC 3QT2A 1URZA 4Y16B 4PJDF 1ZT7B 2IDQA 3TA3A 4LLYA 1X9QA 2M8XA 3F00A 4X0KA 4PUBL 4HUWB 1KWKA 4ONFL 3QCVH 1D2OA 1FCGA 4TTGA 2J3SA 1BAFL 1LEKB 1UOKA 2GEEA 3HVDA 3WDJA 4CA4A 1JG9A 4OJFH 3VACA 1O6SA 3F7PC 5IMMB 3V7MA 4U3HA 2CHNA 1HVXA 3BAEH 4RA0C 4U4IA 2FWOA 4KUCD 4MQXD 2ZCLL 3VGBA 2G5UA 1H6TA 4G6MH 1YEKH 2E4TA 3DWTA 1UHVA 4NX0A 4M7JL 5D5MB 3ZR5A 2R8SL 5GGRA 2LHAA 3O9WD 3X1EA 4BHUI 3FT4A 4O9HL 1L9SA 4IHOA 3GMNB 4APQD 4DZBA 1XBDA 2UZXA 3O6ML 4Q58C 3SYQA 3H9ZA 5GS1B 3K72A 4NZUL 1FJ1B 3NIGF 2AITA 1IU1A 4O2FA 1GGIH 4Y4KC 3SDCA 3N1GC 1EX0A 3ZT5A 3U36A 1XB3A 1QRND 4JRYA 5HI5D 3KPNB 5GS0L 3BKCL 1SXBA 4HFWA 5GXBB 4LF3A 5D6CA 1I1YB 1RUAL 2AZUA 5PCYA 2VAAB 4I1RA 2P7TA 3WUWG 3Q2VA 5ITBH 5JPNB 1FLRH 3VRIB 5CBAA 2AXFB 4RFOH 4I2XB 4HU2A 4KROD 5EU6D 4HXAL 2CE6A 5AW6B 1JNNH 5IP4A 5HI3D 3MCG1 4OCYH 5EF1A 2NY6D 5EIVA 3C6EA 2VDML 2OMZB 5GRUL 3T3PF 2QPSA 4I48A 4N0CC 3QJUB 2X9WA 2MQ0A 4WO0A 4APQB 3ROOB 1HXYA 4BWUA 2CUAA 2L3BA 4YH6A 4C83B 5IHHA 4DN4L 4AMKH 1ZA6A 3P2DA 4AUYA 2YD0A 2J1ZA 4O00A 5EEYA 4RDQG 3LZNA 4PREA 4BKLA 5I15L 1QRNB 2IWGA 5H94B 1WA2X 2CO7A 4CNIA 4YX2H 1YNTA 3IDXL 3QGVA 5GISH 1IKNC 2OMBA 1AMYA 3MXWL 4G7VH 1B9KA 1JCKA 1I9EA 4KROB 2CUIA 5EU6B 3VFSB 1OAQH 1UUSA 3AT9A 1D5IH 3G08A 4XOCA 2W0FA 4BWWA 5DHEA 5D9SA 4J7RA 4OBRA 4AGMA 1UFUA 2NY6B 2KBGA 2JSFA 5DLMH 3SDCD 4X0KB 4ERSL 4DKEL 4PJBB 3RNQB 3IFNL 4JRYD 4PG2C 1AGFA 2OBGA 4N90E 3WD5L 5L0QC 1I85C 1KPUA 1YEGL 4HAKA 2ZWLT 4GUQA 1OTTC 4LSUL 1ZLVK 2FWOB 1L0PA 5F7BA 2HPTA 1CGSL 3GRGA 4PJHE 3VFPA 4AEIL 1QEWB 2F74B 1IVLA 1FUNA 3U4AA 2W9DH 1AIZA 3MLZH 1LK2B 3BH9B 1EWHA 3V7AE 4AL8H 4JM4L 3OG4B 4KK8D 3U1SL 1CTOA 3LD8B 5GGRB 3FQRA 2XN2A 4ZO7A 3VI4B 4A1RA 3FT4B 3HC4H 3WO3B 4KI5C 3BQUA 3RE0A 15C8H 3FQUA 2UZXB 5SWSA 1OVZA 2XZCL 4E0RA 3K72B 1TZIA 1TEYA 4O2FB 4FA6A 4H25A 4G1EB 4ZMOA 2EH8L 1DBKL 3EKCA 2OFQA 5JIHA 2ZX5A 4JRYB 4H26B 5B7FA 4HFWB 4IMKC 4JY5L 4LF3B 5DFTA 4OZ4B 2WLIA 4I9XA 1OPOA 1JZ7A 2P7TB 4XC3H 4PGCA 3UH8A 5AAPA 2WXFA 4MQSB 1AP2A 5CBAB 4C59B 3GSWA 2EXWD 4OIIL 3HZMA 2ZPKL 4KZEH 4AYBA 5L9DL 5JW4N 3UJJL 2RACA 1K8IA 2BCKA 4CW1A 3IMRA 1GOHA 4LARH 4NI3A 4UMGA 4I48B 3TVMC 2LAGB 4UIKH 3FDWA 2R4SL 1OB1A 3VX1A 1L9TA 1MDTA 1ZA6B 2WQ8A 1HX0A 5I9QC 1DZ0A 3CXHK 3GTNA 2N7AA 3WNOA 3U4BL 4PREB 4BKLB 1FORH 2IIJA 2Q9OA 2ZXDA 4KGLA 2CO7B 3LNGA 4CNIB 4LRNL 4XCEB 1RULL 1QVOB 4QHUA 3WLBA 4EDWL 1GAFH 2AEQL 4JKKA 2BNUA 1NGPH 3CV5A 2QT6A 4K8RD 3S37H 3MRRA 1NFKA 4K94L 1WJ3A 5DZ9A 1CDJA 3BQUD 3G08B 4TQHA 4ZBJA 5HDBF 2XG4A 1J0IA 5D9SB 3FC8A 5KSUA 5SWSD 2KL6A 1P6FA 3WAKA 3LDBC 4F57L 4EVNB 1X4XA 4JRLA 3AACA 1U8LA 1U8IA 1IGCL 2DQFA 5E8EA 4TSBH 1DVUA 1OARL 5HYJE 1MCOH 4DGIH 1UZGA 3V4LA 1AGFB 3VH8G 2P46B 3GXTA 4MXQC 2YUZA 4PBVC 1WITA 4KKPA 4CVZA 2OSYA 1DDTA 4K7PH 4NOBA 5DZJA 4L4VE 4IGBC 4PIRF 4ZAKA 5FYKL 2HX7A 5IB4A 5IEKA 3LZOA 7PAZA 2BFGA 4A66A 4Z7OB 3UGUA 4X7DC 3LS5H 5DEJA 1ICTA 3R7QA 2X6CA 4QXUH 4FZEL 4P3DA 3FQRB 3Q2WA 4HLZH 2F8XC 1PNDA 2N4IA 1DSWA 1V8HA 3BQUB 3PCYA 4NC2B 2YOCA 3FQUB 5SWSB 4B95C 4PW4A 4KQ4L 3NN8A 5FO8A 1TZIB 3NUKA 3O3DA 3V52H 4H25B 2AQRA 3L3JA 3UAJC 4A2LA 5BS0A 3KLLA 4ZNCD 1KTLA 1MRCL 5E0FA 4PJHF 4IKKA 3W37A 2F0CA 3FU9A 1XGQB 5AOIA 4N0YL 1SVBA 2XZZA 1T21A 4UQAA 1LO2L 2WLIB 1HNFA 1K8DB 2AMGA 2B0SL 4PGCB 3H53A 3VD7A 1AG0A 3L4XA 3H2WA 5KAQG 3KPLA 4ELDA 1AP2B 1J1XL 3V6OA 4QXGL 4L8SA 1G4RA 2HN7B 1A4JB 1WBXB 3CZLA 3HZMB 4G9FA 5CN1A 1E50A 3VFOA 4WI0A 3TZVC 2AJYH 1K8IB 4UTBA 1XAUA 4CW1B 3ALPA 1NWOA 3SDAC 1RZ7H 5F96L 5HDWA 1I3GL 1QSFE 2ZKYA 4F2ME 4M6NH 1G6RA 4Z6AT 4KH9A 4FLOA 4GRWH 5HYIA 3IJSA 1A7RH 2NPLX 3B2MA 4HIXL 1VACA 2YIHA 2ATKA 1DJSA 2JLPA 1EGJL 1REIA 3GRWA 3F7VA 1XZ0B 4V33A 2YPLE 5KSBE 3ULVF 2RTTA 2OTPA 4GW4B 4ZAKD 3L7EB 3MXVH 4OSUL 3FH5A 1KTBA 2X40A 2LABA 3IDUA 4KO7A 4QHUB 4U1GB 3WLBB 4ZX5A 1BYNA 3MA7A 2BNUB 5KW9L 4W4OA 1IO4C 5EORH 1DBBH 1YYLH 3MRRB 4HUMB 5KBNC 4JHVA 1NCGA 3MZTA 5KSUB 4HJJH 4YSPA 5D4IA 5ETUB 1TR7A 1U8LB 5FX3A 3V4PA 3UP6A 1U8IB 3TFKD 2DQFB 1BFSA 3HNVL 2J8UA 3OMIB 1JZJA 2GJRA 4JB9H 3KYOA 5E2VL 1DFBL 2YEZA 4LRIA 4NSKB 1RLWA 3U6XS 4Q6IA 1PX8A 1TQCC 5I1LA 3ZHDA 2E47A 1U8KA 1LDSA 3CU7A 3HR5A 2VRQA 4Y5XC 5H37H 1X5GA 3R7RA 2DLFL 3VGAB 4PN6A 2ZYIA 1NBYA 1Q0EA 1R24A 4ZAKB 1L9OA 2OMTA 5IB4B 4FQXC 3RRQA 4JDTL 2ZCZA 1KPVA 4N0UA 3TURA 3AXLB 3A21A 4KKBC 4G9FD 4IKNA 1QO3B 2BS71 3OTTA 4NPJA 4PRAA 1XCQA 2I26N 3IU4L 3SY0A 3HFFA 4N2EA 1E27A 4P3DB 4PG9B 3TFBA 2VR3A 2WANA 4HMCA 5F88A 4ZW6A 4B3EA 3VFMB 4XVUC 1V7NL 3BVVA 2C4FU 3ARTA 2DEXX 3ULUL 5FYJD 2EDOA 1OOWA 3BUYB 4Y8DC 3VD2A 4HH9A 3O3DB 4FQQA 3L3JB 1HAUA 4U1HA 3QFGA 5TDPB 3QR2A 2NY2D 4DP1X 2XYCA 1WDAA 1KTLB 4H0HB 4R0LC 2VQUA 3KM1A 1N9PA 4K94C 4PBWD 4LHUA 5LNDA 3CZNA 2VM4A 4HS8L 5BVJB 2NY5H 3WN5A 1F2QA 4NZTH 3RUGE 1BA9A 3P30L 3KPLB 2XQBH 1PKQB 5E2UL 4G9FB 2LVCA 3KJ4C 2ICWA 3VFOB 2FBOJ 4WI0B 3B9KA 4LU5H 5LN4A 3D3VA 2AMUA 1XB8A 1MPAH 3L8QA 2EDHA 4F20A 4KPHL 1TKWA 1XCXA 1AHWB 2TAAA 2ZE0A 4GXUN 3IJSB 4PV9A 1VACB 3MRPB 2HT2D 2ATKB 2DD8H 3GS4A 4N8UA 5D7KD 3S2AA 4ELMA 5L2JA 3HPLA 3VB8A 3F7VB 4FP8L 2NY2B 3MDJA 4P5TA 1IT9L 4WKZA 2F58H 5JW3L 1D5RA 2XZAH 4DNLA 2X3CA 2H8PA 4KKQA 2EKJA 2PTTB 2YD9A 2DJMA 3BUTA 4MQTB 4WV1C 4HMDA 5E23A 1N18A 2HKAA 3I6GA 4WO4C 3ZPDA 3QO0B 4ZO6A 4BV1A 5A2FA 2IG2L 3MA7B 2Z92A 1AQMA 4GAYA 1IBDA 3LIZH 1KPRB 1TJXA 1QW8A 2AI0H 1UQSA 1JHTA 2ZJSL 5C09D 4F9LC 1GCFA 4PLKC 4RZCA 3V4PB 2R83A 3BGMA 4GG8B 3ZGIA 1VFMA 2J8UB 3QJRB 3U9UA 3WTSA 3KYOB 4JN1H 4DP2X 2ZKWA 5MENE 4Q6IB 1FLRL 4NQDE 4ZS7L 4Z0XA 3DX7A 1U8KB 5IHZB 4LHUD 3HR5B 3NEXA 3C75A 2Z1KA 1T4WA 1NBYB 4KNSA 3OLGA 3VXME 1R24B 4RGOL 2OMTB 5J1TC 4EXKA 2NY1B 1MFAH 3BH8A 3MRQB 4ZSOE 5DZPA 1KPVB 4N0UB 4P3WA 1R5VA 4KKCC 3HE7A 4PRAB 1XCQB 2ATPA 3B9KD 5E5UB 2HFFA 3D3VD 3SY0B 2XN1A 1R3HA 1U3HC 4KTEH 5F88B 3GEWB 1ZHLA 1OAJA 4NM4L 1WRFA 4YLQT 5C09B 1BZ9A 3NABL 4HHGA 1MREH 1SPDA 1HKFA 2MFNA 3LN5B 3PJNA 4HH9B 3FU7B 2P52A 4FQQB 4OJEH 4U1HB 1RPQA 5A2AA 4KRLB 4P5TD 4M1CC 4UNUA 2W0PA 2WLJA 2XWCA 4LHUB 5D7EA 4AYID 3S35L 4PS4L 3KH4A 4LSQL 1E4WH 3TO2A 2NMSA 3WN5B 2H32A 3DK2A 3OAYH 1A6AA 1DLHA 1NQBA 4UTAL 3ZIYA 4AE1A 2ZSVA 5BUAA 2EUXA 1JHLH 3GJEA 2CIKA 3WKNA 5IIEA 4P2OC 3B9KB 1XIWC 5D5ME 3D3VB 4FQCH 2Q8AL 2QVIA 4X9IA 4GG6A 5FO2A 5DR5L 1TKWB 3LKNA 2YC1B 1JGLH 4IRSC 3EAKA 4UOQA 4PV9B 5C0BA 1YY9D 4ELMB 2WBJD 5L2JB 2XRAH 3LH2L 4FLRA 2VJ0A 5LGJA 4FNQA 4P5TB 2NZ9C 5FM8A 3ZRFC 2IOOA 4FGMA 2C3WA 2Y3AA 2H8PB 2Q6WB 3NH7H 5D71L 3M7OA 3MOAH 4J3OF 2G5BA 2HZHA 3CDYA 3KYKL 1UWEH 3I6GB 4KHTH 3HE7D 4P4KC 5D4QA 3ULUC 4KITB 1X5HA 2NW3B 4S10A 5E6ZA 2Z92B 4I2XE 3PHSA 3U6RB 3U1PA 1UQSB 4M3KB 1JHTB 3MCLL 4N28A 4Q9QL 3LS4H 4WI2A 2R4RH 2V3DA 2XIBA 4PJAA 5DTFA 3BGMB 3QZLA 4BZ1H 4X99B 2Y1VA 4L8CA 1CC3A 1A1OA 3D0AA 5I75B 3T5WA 4ALAH 4BQ9A 4P3CL 1LO3L 2VDLL 4Y2DD 2VO8A 1KCKA 3DX7B 1LK3H 1WZMA 2WBJB 4X4YB 1X9RA 4X9FA 2XV6B 5I1GL 2QQQA 4WNSA 3S3DB 4L1BA 1V55B 1QRNE 1UM4L 1G9EA 2D7MA 3BH8B 4XOBA 1EZVY 1AE6H 4HJGA 1R5VB 2ATPB 5DVKA 4OIBA 4HPOH 5AVXB 1U8QA 3TJPA 3ZKMC 1R3HB 1YEJL 5EU6E 1PCXA 1ZHLB 3VM5A 3NCMA 4H2AA 1XF3A 2NOYA 1LTXA 4JR9H 4P5SA 5GS3A 3FAXA 1G84A 1L0QA 4JGNA 5C0BD 4L5FL 3AQYA 3MACH 3MRHB 1DBAL 1GAFL 2FK9A 5KBMA 3BKML 4PJBE 1NGPL 1NAMH 1YMMA 2K6WA 1GPOH 2RCSH 5DS2A 5I1DA 4U6TA 4Y2DB 2HPOA 1IC5H 2X6AA 1A4KB 4E9LA 3PAYA 3PXHA 3TO2B 2D3NA 3QPXL 3ZMNA 2H32B 4FQPA 1A6AB 4PD4K 3ZL4L 1TYRA 2ZSVB 3I50L 2VYRE 2ENSA 3MJ8B 3S5LG 3IFLL 4NJAH 1A65A 2CIKB 3NSXA 2N1KA 5FCUL 5IIEB 1TNNA 1XEDA 2F8OA 5J6HB 3O0RH 3NJFA 5IV2A 3JV4B 1FGVL 3VI4E 5A3ID 4GG6B 1IAMA 1AIFA 5D1QA 1JWMA 4KNQA 1MQKL 3LKNB 4HLEA 7FABH 3KYAA 4X6DB 5C0BB 1DVYA 4A2DA 5I8CA 1CFBA 4MYPA 3V5KA 3GXDA 4JRYE 3BT0A 5BQDA 3CG8A 1MCBA 2VDKH 5H35A 2C3HA 4K3GA 2XQYG 3HKZA 5D5MF 3L3OB 35C8L 2QHRL 1GKEA 3QCUH 3RWCA 1PZUB 1G87A 2Y06L 4HJUA 1JERA 4W4NA 3SE4C 3FO9B 2ZOTA 5AW0B 4TOYL 2FR4A 1RHFA 1VFOA 2EO9A 2VC2H 3R4DA 4PJAB 5DTFB 1IL1A 1U91B 4L8CB 3GMLB 2B1HL 3LKRA 2GABA 1A1OB 1MXDA 3FOLA 5DRZB 4XNQB 4HH8A 4WHTB 4G3YH 2YKLL 2ZOOA 3GKZA 2ZUVA 4AIOA 2YA1A 1JTTA 3LZRA 2GC4C 4A7UA 4KUCF 3FPXA 4OV5A 3P3UA 3INUL 5LN8A 2Q3AA 5AW1B 2VR5A 1OIOA 3ABLB 3NQIA