1WUZA

Structure of ec1 domain of cnr
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
103
structure length
103
Chain Sequence
GNSQIHYSIPEEAKHGTFVGRIAQDLGLELTELVPRLFRVASKDRGDLLEVNLQNGILFVNSRIDREELCGRSAECSIHLEVIVDRPLQVFHVEVEVRDINDN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural diversity of the first cadherin domains revealed by the structure of CNR/Protocadherin alpha
rcsb
source organism Mus musculus
molecule tags Cell adhesion
molecule keywords Pcdha4 protein
total genus 12
structure length 103
sequence length 103
ec nomenclature
pdb deposition date 2004-12-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08266 Cadherin_2 Cadherin-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.60 Mainly Beta Sandwich Immunoglobulin-like Cadherins 1wuzA01
3Q2VA 1ZVNA 5CO1A 4ZMWA 1OP4A 4XXWC 4AQAA 1FF5A 4NUQA 4QD2E 2OMYB 4APXB 3UBHA 4AQAB 3K6IA 4ZMNA 1EDHA 4XXWA 4ZMYA 2QVIA 2OMXB 3K5SA 1NCGA 3LNDA 1L3WA 4AQEA 3LNEA 4AQ8C 2WBXA 4AK1A 2A4CA 1NCIA 4ZMPA 2OMTB 5DZVA 1ZXKA 3UBFA 4AQ8A 2OMZB 3LNIA 4ZMTA 2YQGA 4ZT1A 2OMWB 2WHVA 3LNHA 4ZMQA 4AQEB 2YSTA 2EE0A 4OY9A 3Q2WA 2O72A 4NUMA 2A4EA 1NCJA 4NUPA 3K5RA 1WUZA 2QVFB 3K6DA 4ZMOA 5JYMA 4APXA 1WYJA 3LNGA 5KJ4A 3MVSA 2OMVB 1NCHA 1SUHA 1Q1PA 3QRBA 4ZTEA 5CZRA 5JYLA 4ZMZA 2X2UA 3K6FA 2WCPA 2V37A 4AXWB 3FF7A 2WD0A 4NQQA 1O6SB 2OMUB 4ZMVA 3LNFA 3PPEA 3Q2NA 3UBGA 4ZI8A 3FF8A 4AXWA 4ZMXA 3Q2LA 4ZMLA
chains in the Genus database with same CATH superfamily
2WZ6A 5LUMA 3L9RA 2XWCA 1DBML 4PJIE 4GXUN 2VLJA 4PAZA 5DC4B 3RPIA 4L5FH 2BDNL 3H7LA 3GT6A 4P2AA 4HBCL 2J56A 5E8PA 5CFAA 4YSUA 3MV8B 3MV8A 4N6QA 5C0BA 5I1AA 3JYCA 2DQIH 3HZVB 4DO6A 3AT9A 4JRYD 4Q9CA 1MI5B 3K3QA 1FH5L 5AL0A 1QBLL 4Z7QE 1KTLA 1WH0A 4Z7VB 5HYQA 1KIQB 5HHQB 5AVYB 2ENJA 1BXVA 1SM3H 2WLHA 1QEWA 3QFDB 1A6TB 1NGQH 2HTKD 2Q7NA 2X42A 2P24A 4AW4A 2O5XL 2AK1H 4O2EA 2R1YA 1PZ2A 2OW6A 1BVNP 1KBVA 1YY9D 4Y5XC 2YD4A 2NY3D 4MA8H 5JORB 3KXFE 2HT4D 1QI4A 3ZMNA 4HOMA 3EJCA 2DM2A 3WKML 1S7RB 2NYYC 3VFOB 2DMBA 3TS8A 2X9WA 4N28A 1MAMH 1FI8C 3UX9B 4KKLC 3RWGB 3E2HB 3TA3D 4KJYA 4HIJA 3OPZL 4EKXA 2W60B 2FX9H 5D9SB 3GB7B 5C09B 4K3EL 3BYYA 4YJZL 1GC1C 1HHGA 1YEJL 5HY9B 1RL1A 2XQ0A 4F37K 3HZKB 1X5JA 1A9BB 1OL0A 3SDXA 2WNWA 1ZA3B 4G80A 4NXSA 5EU6A 1R5VB 2A6KB 4G1EA 1JZ6A 1IIIA 5LBSL 2V7NB 3NACL 3MRDB 3S3DB 4XBPB 1OF2A 3PGCA 2OV0A 3PQYD 4PJ7F 1KCUH 3HB3B 4WV1B 3S4SB 1EEZA 3QHZL 2ILLA 5H94A 4Y5YB 1A4KA 3ARGD 3GSUB 2X4PA 2X4UA 3BQVA 4H1LH 4EI6A 2BCKA 1CICA 3TCLB 1CGYA 1E65A 1OB0A 3QDMB 2BNRA 4DGVH 3FO2B 4I3RL 3UTTD 4L1LA 3VWJD 3AQYA 5JYLA 5CP3A 5HDWA 5I15L 4RGND 1LO0L 3FRPA 3Q6GH 3UIYA 4FQXD 3KPNA 4G9FE 5JDSA 1QTPA 3IETA 4P5TD 5TE6L 5GS1C 3Q6FA 2JV6A 1O9VA 1KIUB 3RY5A 2AXWA 2I60L 4ODVL 4BK5C 3D30A 3H6JA 1FZJB 4OF8A 4BCZA 1KLFB 4F58L 5GRJL 5KBPA 2X2HA 2OZ4L 2C1PB 4Y4FB 4K3DH 2XOTA 4EI5C 1A6ZB 4NT6B 1QFUH 1SGKA 5E6ZA 4YFLI 5E2TL 1JWMA 2XX1A 3V0JA 1T1ZA 2BOBB 1YUKB 1IZKA 3MA7A 1ETZB 3KCPB 2COQA 3K2UL 4PS8A 5DO2C 1KLGB 2P28B 4HG4J 1TTUA 2P5WD 4PJDF 2QEJA 1A7NH 3DURB 5IQNA 4BZ1A 1H6FA 3ARUA 3L6FA 2GJ6E 1ROWA 5CD3A 3AREA 5K9QG 3BVDB 4KO9A 4NJ9H 2Z3FA 1ZTMA 2P8MB 2FR4A 4QWWC 4HS8L 4O2CA 1QFWL 4OZIA 2MRYA 1X5XA 4ZXBD 3W37A 4PH8A 5BPPA 4YO0B 2F74A 4R96A 4TSCH 3OAWA 3NFNB 5IMMB 1MCPL 1SLUA 1U3NA 3AT0A 8FABA 2WBXA 3TFKD 1CLZH 1VEPA 2IBBA 4HQQL 4FQ2H 3T77B 2PR9A 4TNVK 2EDXA 3B37A 4KY2A 4KNQA 4N0FA 5HYIA 4P2QA 4XP9L 3UTQA 1BQHG 4XXCA 2HMIC 1MFEL 1QSVA 1NGYB 2J2ZB 1UD2A 2W80C 4MAZA 4JNXA 2VQ1B 4W9FC 3R19A 1RZKH 2H3NB 3EF4A 4HS3A 4ONHB 1BVNT 4YH6A 3UC2A 3RJQB 4K7FA 3S36H 1IQWL 3WHE1 2D4FA 4UUJB 4G43B 4X4ME 4PRNA 1OAQL 3MTRA 5GGSY 4P57B 1PDKB 1EUTA 1HYRC 3NRFA 1FZOA 3D4ZA 3V0WH 3WNMA 1AHWC 2K3HA 4NX0A 3ULUC 2DWTA 2XJKA 4TOYH 2P44B 2EUZA 2QFPA 5K93A 4JK0D 1LWRA 4QCIB 2A6KA 4LSRL 2NT0A 5I23A 1B0WA 4MBRA 5JYMA 1WEJL 3BD3A 2C3XA 3O9WD 4LLQA 1M7IA 4X8XA 1HCYA 3P02A 4HIQA 2B9AA 3SGDI 5FO9B 4ZAKC 1AC6A 4FTVA 5D9SA 3U7YL 4PRAB 2AK4A 3NDZE 2KQMA 4PJFF 4M56A 5B22A 2QVKA 4I4WB 5EUOB 3RHWK 3WFBH 1OY3B 3FU7B 3S3JA 1WZLA 5JIKA 5HI4C 4DP2X 4FYTA 1F4AA 4UT9L 3LRSB 3VXQA 4BRVA 3US9A 1IE5A 1F90H 1OB1A 1JUFB 4M7ZB 2WLNA 4LSDA 3B9KD 2QLVB 4PGEB 2PO6C 4IMLA 1QEWB 4FJZA 4HK3J 1RPUA 4QOKD 3QR2A 2EVJA 2BZ7A 1WJ3A 4N2KA 4JJ5B 2JB5H 4NS0A 3S96B 2V17L 1GZQB 4DKEL 4EIBA 1ZXQA 2CGYA 4OGYL 4ZMWA 2Q76B 2X12A 4WU7A 4ODTL 2CUAA 4QI3A 2BSDA 2LTQB 4JPVH 4NUQA 3BQUC 3GMNB 3C6LA 1H8OA 4APXB 2FEDC 4G6JL 4G7VL 2JFCA 3RFZB 3TO4D 3L3DB 3MROA 2CSPA 3DPBB 2FLBT 1RI8A 2DIAA 4JY5L 3T1FB 4DTGL 2NDGA 4G72B 2BSRB 2B15A 4FG4A 3SO3C 4LCIL 4PG9B 1INDL 1SQMA 2OMXB 5G5DA 1AQMA 1H8NA 2F7PA 4XNAA 2LU5A 1BM3H 1UOLA 1PZ5B 3IJSA 4MS8C 1LO4H 2X70B 4UMGA 5AAWA 3HB3C 4WV1C 3CXDH 1CD8A 3ULVL 2XXFA 1GS7A 1UTDA 2A73A 4WW1A 4YWGL 5D7JD 3ULSA 5DMGD 3KPOA 1BZQK 3HI1B 4Y2DD 1T4KA 5EOTB 3HLAB 2EXTA 3QARA 2E76C 2BVOA 2GIMA 3REVA 3VE0A 3QUYB 3I6SA 3QXDA 4RESB 5D1QA 1AO7B 4F37F 3OAUL 3TJEL 3T6QC 4RA3A 3FTZA 5AB2A 3L1FA 1U93A 3SY0A 1Z2KA 2AJUL 4AT6A 5I6NA 4I8DA 4MJ6A 4YDVB 3ZE2E 4LXFA 2O5YH 3PHOA 3FT9A 5DZPA 4P2OA 1I1RA 4TNGA 4CRPA 1HWWA 3EFOA 3NJNA 4E9LA 4XHQA 3PF2A 4ZTPL 3CSBA 3UOAB 3DGDA 5FF6A 1TVBA 5AYUL 3Q06A 1UA6H 1RZIB 4GBXA 5KSVA 3DECA 3CZFB 3TF4A 3D0VA 3HW7A 4X4MA 2XHNA 1JGUL 3D12B 4HUWA 4HIIB 4PN6A 4IRSC 1MREH 4O5LH 4XMUA 4XCNB 1AKJB 2VR7A 3TBVB 4W9HC 3HI5H 4ANWA 4E9SA 2J25A 3TYGL 5EC1A 1EAOA 2UWEE 5SWSD 2MNUA 3VFGH 2C8NA 2NXZD 3JV0A 4M3JA 5C3TA 1MRCL 5GRUL 5LJYH 1HZHL 5FUZH 2E8YA 1PNCA 5BQ7A 4JO2H 2KZWA 1CN4A 3NH7L 3NIDB 3WKYA 4YK4C 2ZWLT 3EDDA 2WP3T 1TYJA 2Q8BH 1HH9A 2V9UA 3T8XB 2P80D 4LOVA 2J73A 1X4YA 1NC4B 3AB0C 5KSBB 1NBZB 2CCLA 1QP1A 2Y5EA 4FOMA 1C08B 3W39B 4GIAA 2G75A 4G3YL 1H9DA 4H25A 1ZS8A 4RWYH 3D4YA 1P7QD 3VXPB 4OB5L 4G7YL 3SPVA 3R18A 3KLKA 4JPKL 4KGLA 4KROC 1FGVH 3VVVA 2ESVA 4OCWH 4UINH 3O8XD 3ULVE 3L4WA 4MXQD 1A64A 2ZZUT 1FL6A 1Z32X 3TNMA 3HC3L 5HHNA 3TO2B 1BAWA 5J6HA 5I1KL 1N68A 4LDCA 4HHAB 3SDDC 4Z7UF 3WL9B 3SEPA 1HAWA 1RIVL 5A6IA 2V2WB 4LL4A 4ABQA 4KV5F 4JO8A 3AU1B 4BDVB 1RIHH 2P8LA 2VSMB 4U1HA 3VXUE 2AQPA 2RHEA 4I3GA 5CILH 3S48A 3VXTA 2FJFA 3O9WB 4NRXB 4AK1A 2J55A 4LSPH 2F7QA 3MXVL 4HKBB 1OP3K 5I2IA 1M1XB 3ZIYA 1RU9H 2ADFH 2E7BA 4R84A 1EAPB 2WLYA 2P48B 1B6UA 4KJQD 3OZLA 2F7IA 4GUOA 1VFBB 2X4TB 2P43B 4MQTB 4QRRD 2PN5A 1V3KA 3E8UL 3F12B 4G83A 4U1MB 4W9GC 4UILH 4HV8B 5HHPA 1KB5H 5I74C 1E0OB 3NPZB 4GRWE 4YDLC 2OX5B 5I17B 1J5CA 3ZKXB 3UZQA 1DQTA 4Z3IA 1M6OA 4JW3A 1JXKA 3FCTA 3QJUB 1E90A 3SGDH 3L3JA 5IQ9A 3GJEA 3D2UD 3NCBB 2DQMA 4P2RB 3GHEH 4NXKA 4OJEH 1Y6KR 5EN3A 2BFVH 3MUY1 2ADIA 5C0CA 12E8H 2OZNA 1WFNA 2CHDA 2KYIA 3PWLA 4MB4A 4FFZA 1SJXA 4J8RB 2WXGA 5J9PB 2VL4A 2IXQB 4Z77B 2OZ4A 3MRPB 4IOSD 4XO3A 3NEXA 4U1NB 1D7CA 2HCZX 4QXVA 5DQJA 3P40A 5EO1A 4ZD3H 3LEXA 4C58B 5PCYA 4L8SC 2OMVB 4HKXA 2HKFL 4LLUB 1A6UH 3T0DA 1GGUA 2APTA 4JZOA 3OV6A 5DJZB 3PDOB 3P3RA 3N0PB 1NKRA 4OFVA 2ZP9A 2KI6A 3P3UA 4L48A 1PY9A 2ZX8A 3APNA 3PNWB 4MRCA 5GS0H 5D72H 4U3XA 3BLKA 3SKNA 5L2KD 5MENA 1AMYA 2NSMA 4NWUH 4YGVA 1ZLVH 2BOCB 2YN3A 5T3XL 3RI5F 1RZFH 4ZMVA 2YC1B 5L6YH 2A1WL 1TJIH 1KDIA 2UUDH 4G5AA 2ZIDA 4E2OA 4L9LC 4MNQA 5EWIH 1W72A 3DI3B 4JY4B 1BJ1H 4WENB 3FH7A 1LNUB 2CNYA 3Q1EA 2B77A 2FT8A 3N9GH 3LKOA 2CAKA 5B39A 4DP5X 3HS0B 2FWOA 4FTVE 15C8L 1C5CL 2EE6A 3LQAC 5C6TH 4JG1L 5BNXD 1XZ0A 5DMJB 3IFOA 5BO1L 3GYRA 4Z3FA 3VQMA 5DQDL 3MRQA 4F7PB 4F24A 3UBHA 3AG1B 3EYQC 3QZNA 4U1SA 5AWNH 5GGSA 1NCCH 1OT4A 3BSZA 3X1EA 1YQVH 5IBUG 3LN5A 2OFQA 2PWEA 1NSNL 3MA9L 4JFHD 4DPAX 4KHXL 3LNDA 2EEBA 2MKLC 2CBOA 2UXGA 3B2UC 3OKLA 2KHAA 3FSAA 3RDTD 5I19L 2J1YA 2YPLB 2X4TA 3RAJH 1A14H 4ZTOL 4K5PA 4HLZH 1S46A 3CGTA 4NB7A 1J0KA 3FONA 3H6AA 1O5PA 1IGYB 5GZOA 5I5MA 1DQJB 1NFDF 4PRBB 2BVEA 2CJUL 4BELD 3SE4A 2NY4C 3WY2A 4BFOA 5I1DB 3PWUA 4GXFA 4GH7B 3C5JB 2N0KA 1EEYB 1VGEL 4HHAA 2EECA 4P3CH 2P5EA 1XGPB 1A9VA 4KDVA 5IZ7A 3O8XC 3ULUD 4TVUA 4Z78B 2A0LD 1MFBL 3JVGC 5GGUB 4FQ1L 4ZBJA 3L1OH 5JOFA 3JUZA 4BIKA 2YPLA 5D7EA 4QAWA 2CA4A 2VLRA 3VXNA 3IJEB 4H13C 1SEQH 1HHKB 4LBAA 4GYBA 4NQTA 5CSZB 5CS7A 2A83B 4BK4A 2X6VA 3C2AL 3D18A 2BIIA 5D2LF 5EV7A 3CZKA 1BREA 5SV4A 4PJBE 2OJ1A 3EAKA 1NC4A 3IJHA 3UJIH 2YSSA 4IJ3C 4KI1A 4WK0B 3OX8B 2XV2A 3DGGA 2MSPA 2VM3A 3F6JA 4PGBA 2DWSA 1TITA 4QRPA 5ELIA 1JGLL 1VEOA 3X1BA 3QIBB 4MDRA 1JZ5A 1DBAL 1XF2A 3LKQB 4R5VA 4ZSOA 4DN3H 3BWUF 3QEHB 3P4MA 3VE0B 4M7JH 1KCLA 5E2UL 3QC6X 3V5HA 4BM7A 1BVOA 5INCA 5DI8A 3PIQB 4X6DB 5E2WH 3WFCH 1PNDA 5E51A 1WCBB 1TXKA 4ZODA 3T0XA 3U30B 1DUYA 1HE7A 4TM9A 4BUGA 2A9MH 4NZRH 1NZRA 2X89A 3DX6A 3IDIB 2G5BA 2EEFA 2R2BB 4U6HB 2KT6A 2ZOWA 3BT0A 1EBPA 4N2HA 3VD1A 2CNZA 3PDOA 1KCKA 4I13B 4JO1L 2O5NA 5DJZA 5EFIA 3TLRA 3EOYG 4LRNH 4O2FB 5K9KA 2XFXB 3ZE0F 2F5BH 4UTAL 3LKNB 1U9KA 1WC7B 3ARBA 1LYQA 4L3ED 3AJ7A 3MJ9H 2ZXWB 2PYFB 2QQKH 1ZT4A 2H6UA 2YA0A 3F6IA 5HXMA 1G7PA 3O6FC 3RX5A 4E41D 3LN4A 3M45A 3CXHJ 4HT1L 4JQXC 4ZMYA 2YN5A 1BVZA 1J9SA 3B3IB 3R1GL 2D7OA 2CHXA 1DO5A 2JQMA 3G5XB 2BP8A 3G08B 4FAAB 3RBGA 3TEXA 1JPEA 2NY5L 4Q9RH 4Z95L 2GSIA 3HI1A 1Y0LB 1BD2D 1NANI 3DX1A 1U8HB 1WFUA 2NY1C 3ECUA 4F1SA 5JZ7C 4GAYB 4PJ8A 5LNEA 1P4IH 3IXAB 3MUJA 1ASQA 2X70A 3KBHE 4K3JL 1FIGH 3NTCL 2GAZA 4UOW1 3L95B 5HDBF 5EDXA 1J0IA 1MLCB 2CJ3A 5ESVB 2ZT9C 2OMZB 5EIVA 5JLZA 4N2DA 4PG9A 1EZVX 3K72A 5EU4A 4R7DA 4XC1L 2IADB 1FORL 3HG1B 4QTHB 1OO2A 3GRBA 1DANT 1PQZB 1IKOP 3O41B 4NAJA 3VXRE 4ZX4A 4HH9B 4ZX6A 4U1HB 1P1ZA 1TO5A 3U82B 1YUHB 1KTKE 5B39G 7FABH 4JE4B 1UD3A 4AYSA 2AEPH 2CHWA 2YQ3A 1P6FA 3LV3A 5D1ZC 5C0AA 1M2VB 2BP5M 1KFAH 1RJYA 1RJYB 3RZWA 4OSUL 4O51B 2HXAA 3V6ZB 5E08L 5EH1A 3GMMA 2JLLA 1BOGB 1EFXB 2QADC 3GGWA 1LO5A 2Z0UA 4HWZA 1Q4NX 1XX9C 1ORQB 4F5CA 1R6VA 2OTWB 4NFBA 4N20A 1OSEA 4JFEE 1DVUA 1PZ3A 5D1XC 1YNTF 35C8H 3WHXA 2FATH 2WXJA 1JF5A 2IGFL 2Z1PA 1FVDB 3IGKA 1TQSA 3US1A 4PYHA 1IGJA 1NJ9B 4PS7A 4O9HL 4PWKA 5C2BH 3KPRE 4Y16B 3AC0A 3MFGB 5D71L 3F7YB 1IM9D 2YS4A 2YFOA 5T1KB 1U4FA 4HW6A 4OFYD 3SGKA 4Z3HA 1Z9PA 4KKCC 2OXHB 4A2GA 4C56E 3MAWA 1GMEA 4MMZC 5D4IA 4P3WA 5JW5B 4JVWA 5DZJA 3IF1B 1ZEAH 3EDFA 4AGNA 3L4XA 1WZ1L 5DEFA 3JUYA 1FNSH 5F7EH 4OV5B 1A4CA 2YK1L 5LG1A 5DK3A 3TXAA 2BY1A 4DFIA 2ZYHA 4GSXA 3ARFC 2UWEF 1PW3A 1XT5A 5E5MA 1KXTB 1NTDA 3NQKA 1BXUA 25C8L 2P3YA 5DHYB 3OKYA 4OGXH 3O0RH 3JV5A 3AU0A 2OR7A 4CVWA 3QG6B 4K7PY 4OM0H 4RZKA 3VFVA 5D2NC 5CJQH 4CADA 5F3HA 5EA0L 3WFEH 5AVSB 2XQYA 4XMWA 4XWGL 3B7TA 4GP8B 4HUMB 4MJ6B 3CD4A 4YDVA 1IAMA 4HIEA 4DAGH 1CDGA 5ANMA 4DP1X 1B3JA 4M9PA 3FO9A 5JUEH 4HF5L 2X38A 2XXCB 5L9DH 4DP0X 4XAKD 5IF0B 1YNTB 2AERT 1T66D 3MCYA 2VW6A 3CSPA 3FQXB 1TF4A 1Q9WA 1AMXA 2F08A 4DEWA 5IBTH 5JXAL 3S8GB 2H1PH 4CAGA 3HS0C 3KLHC 4XNYH 3DOIA 1E50A 2ZP0T 3WIIL 2VN6A 2BSTB 1WD8A 3NCYS 4A7QA 3MLPA 3CFDB 2NY3B 3CBKB 1ZJAA 4YHYB 5CJ5A 4M6OL 4UM8B 5HHXL 4OZFG 3BH9A 4UYPA 2QADD 2IFFL 3TPUB 1RZGA 3AWFA 4FFVD 4B7LA 1MPAH 3X12A 4YAQB 4X9BA 1ZLVK 4YFDB 5T3ZE 5E23A 1Q72H 2V9RA 4NI3A 3GLEA 1C7SA 3RVWC 3BI9X 4PCTA 4BQBA 1JV2A 3LHAA 2QJDA 4LGPB 5IW1B 1KELL 1CGWA 1HH6A 5B7FA 3FSWA 4DCQA 1A0QH 1IGCH 1M42A 3ZBMA 3NCXA 4EOWL 3ZVVA 1QO3B 3EHBC 4LVNC 3DGCR 2CGRL 5F8QC 2VDMH 1IAIH 4GY4A 1U41A 3OSKA 2OMWA 3KD4A 1DBKL 1I1AA 4MFHA 3O4LD 4NNXA 1H3VA 3GS0A 4XBGA 5LGYA 4XN9A 1MAKA 5C09D 3JT0A 2OPCA 1WITA 4IQHA 1KZQA 3HMXL 5DU7A 4AITA 3CLEH 4FNPA 1GSMA 4PRBA 4TXVB 4Y5XA 5GIRA 3BKYH 1GKOA 1HHIB 2I7SA 2GBAA 4OUOA 5AAMA 5T1KD 5JPMB 1QUNB 2ZCZA 5D4HA 1L9RA 2FIKB 4QYAA 5DD0H 5F1IB 2MOVA 1K72A 1G7JB 3BEVA 3UJJL 4KPHH 1UJ3B 4R7NB 2VDOH 1T83A 2DTMH 4K2UL 4LEXH 4RMUA 2NNRA 3BD5A 1EMTH 2Z8SA 1ULVA 3QXAB 4FQXB 1P84K 4AG4L 3L5XH 4X4XA 2E74C 4PRIB 5F1NB 3SDXB 5JHLL 4H5SA 2FBJH 5C9KA 3B2UD 4YQXH 4ZO7A 3B8SA 4C4UA 4OZIF 1U42A 3UZEC 2G3XA 1XF3A 2G60H 1JG9A 4L1HA 5EZPA 5KBLA 2VZSA 5LCVA 4UIMA 5JW5A 3NSJA 3LQZB 2OTUA 1IC4L 1JPSL 3ARGB 1E4HA 2FSEB 1QYGL 1U8KA 4MAYD 4YSDA 1MF2L 1LL1A 1J12A 1KEGL 3VFOA 1T21B 2VERN 3U0TA 4LHUA 3QYNA 1CDUA 3GHBL 3PWNA 5CHNA 1A9EB 1S4IA 4BFEA 4OIBA 3U25A 1AXIB 2EDYA 4GAFB 2CDEA 4PHZA 4NRYA 2WQRA 1NOAA 3D39D 5IVZB 5I9QC 3D52A 4LFHG 2P24B 2YAOA 3O2VH 4WEBH 4C56D 4I87A 3KMDA 2VLMD 1MG2C 1Z7JA 3WNPA 3IAGC 2YMTA 2CJTA 2XZQL 4Z7VA 3MRCA 3ETBF 5HYQB 1RXLA 2CK0L 2B20A 1RUPH 3DX0A 3FUHA 1ZRUA 3UBXG 3DIDA 4KTEL 4ODUA 6FABH 4ONGL 4TRPH 4M8UA 5CLZA 2J6EL 1E3XA 1T1XB 2JLPA 3R06B 4PTUA 4LPCA 1CMOA 1FDLL 2ZTBA 2PO6D 1YJDH 4GAJH 4ZSOE 4ZMQA 4KTYA 3RUGE 2KLTA 5HBBA 2ZXQA 4JFFE 1JZDC 2DMCA 4HA1A 1TQWA 4NGHL 4WUUD 3LIZL 1QSED 2CD0A 3MLXH 1D9KC 1KLUA 4IU2B 4NQCD 4PGCB 3OR6B 2WXIA 5EEZA 4DERA 1OVZA 3FB6B 5MHSD 1M1SA 2NY2D 4HJ1A 4KNUA 4MA1C 4FNRA 3ULVF 1Z3RA 5IM7A 5DVMA 2VO5A 1QBBA 2F19L 2FJSA 1BXAA 2VLKD 3PP4L 5J6GA 2G3NA 4WW2B 2D2OA 3VDCA 4R7DB 1EFQA 1SNRA 1XCXA 3V9EA 4RMBA 2OMZA 5HVFB 5JLZB 1ZE3H 1GSKA 3QIWA 1D5BB 4UYQA 1ACZA 3GSWB 4X6BA 1RUMH 5CEZE 5JXED 3EHBB 4WJG3 3HI6H 4JN1H 2L4OA 3SCMD 3K8KA 3N3EA 4JM2B 2OA9A 4UM9A 4WO4D 2DMGA 1KLFA 2NTFB 3ZHDA 1OPGH 1T5WA 4NIYE 3SYOA 1F8TH 3V0AC 4YNYB 4QRUB 1R5IB 4X7CC 3K2IA 1IJNA 1N12A 3FF8A 5GZOC 1RERA 1FUNA 2C9RA 3HKZA 4HX1A 4KXDA 2EIKB 2X4OA 3OC5A 3SE4C 2XACC 1Z0NA 2O5XH 1YN6A 4ZNEA 4OBRA 2EYSB 3B5TA 1SHXA 5DDHA 5D6CB 2XKNA 3VFRA 2K3TA 5FS5A 4XNUL 1S6NA 5CCHE 3NIFB 2QKIA 2PXYB 3MODL 3ZUNC 5AG9A 1Z9SB 4K9EC 1CDYA 4L4VB 2R4SH 4MMZB 2GT9B 4L4VE 4MS8D 3QAZB 3ZL2A 3GFUA 4B3VA 5ADOH 1JP5A 2IBZX 2SEBB 4GPVA 5DD5H 5FM8A 4UQCA 1DLFL 2FX9L 3VFPB 4NUGH 4HSCX 4WSKA 2HSIA 3U0WH 4JR9H 4YOKA 2DLIA 1G5GA 3QO0B 4YHPB 5K39A 1MVYA 1BFVH 1H15B 3UBXA 1RK1A 2BWQA 1QFWI 5ES4B 1G7HA 1DVFB 1EZLA 4G9FB 2OAAA 1FPTL 3L9BA 4NNPL 3CG8A 4HMEA 3PGDA 5AOLA 3V0DA 2RA1A 4LHUB 3C9NB 1FVEA 1F42A 3ABKB 4NP9A 4C56B 1JDCA 3ARTA 1FNLA 2E6JA 3U6RA 4QRRE 2BLFA 3BUBA 3LQZA 1YPZA 1F11B 1WQVT 1HHJA 3PGDB 4IRZL 4P23B 2VAJA 5MEOB 1VCBC 4JANB 5D5ME 1BPVA 3NBNA 1T4WA 3D0VB 2EXYD 3RVUC 1F4HA 1LO0H 3ORJA 3PABA 1KBGL 4GLRI 5IBUB 1HHKA 1T7VA 2BZDA 2HTLD 3S36X 5TE6H 5FF6B 2FUTA 1TR7A 4OI8A 3A22A 2YD9A 4BSWA 5BJTA 4DESA 1KUMA 3MACH 4FL4B 2CRZA 1ILSA 1SJHB 5E2VL 3ZZQA 5CGMA 4Y5VC 5IQ7H 4NN7B 4PRPD 1I9IH 2UY7B 3BWSA 1UYWL 3IDUA 4JFFB 3C5JA 2IALB 1DBBL 2QFRA 5FM5M 4QHNA 4AWJC 4V1DA 4AC4A 2H2SD 4LHUG 4HOZA 3DHUA 3RY4A 2OP4L 4G8GA 4N1HB 3AWGA 5HGDA 3ARGC 4LRIA 1VFMA 2W88A 4P5MA 3DDFA 4FQIH 3HBQA 3NSDA 1UKQA 2B59B 5EUKA 1X3DA 5LBGA 3QNYB 3ULSB 4F91B 3SDCB 4XNXL 3V52H 1QFWH 4UM9B 3U36A 1E5BA 4AXWA 4FN0A 1A9EA 1H6UA 1YNKL 3PWNB 3SKUD 1AKJD 1M7UA 1T0PB 2J1KA 1ERNA 2BY2A 3A6CL 1S78D 4RSVA 1JMZA 4TSCL 3X12B 9CGTA 1VESA 3AQXA 4K7PX 1DFBH 1E9PB 4KHTL 1F56A 4PM1A 3WJLA 1TQBC 1P7KB 3NAAL 4FABH 5CBAB 3ATFA 1N8ZB 3SDAA 4ANKA 1U4EA 3UCQA 2Q8AL 2IOMA 2X9ZA 2ZKHL 3QDJD 2WLIA 1RLBA 1U3JA 3AS1A 2GTWB 4LF3A 4D0CB 2NY5C 1TMQA 3VM7A 4APQB 2XPGB 4AVIA 2DQGL 1B4JH 2Y6SC 4PWGA 3WN6A 1CU4H 4YSOA 4NKQB 4M43L 3SDCA 2CIIA 1QSFD 1SBSH 2TRHA 4JRFA 4AEHL 1GZQA 4U1LA 5F1IA 3KPMA 3EW3B 3MLRH 3FO9B 3IDMA 4AGQA 2CR0A 4OZFB 3MLTB 5DJAA 5EBWA 4G8IB 5J12C 3A6BL 3MNDA 1YECH 3AXHA 3DK0A 4G6MH 1A1MA 2OW7A 1OAYH 3OJDA 4KJWD 3UBFA 2X53A 4LSRH 1LJMA 4YSCA 4I18A 4YE4L 5SX4I 2YPVA 4HWUA 1DUZA 1QW8A 4X6DE 4JM2D 3CIAA 4R6UA 5ID0A 4Y1AD 1JF1A 3B9KC 5IJBC 5DJ8B 1NGWA 1ADQL 2XZZA 3D3VD 2F5AL 1GGTA 1ZWIA 4HIXH 5KANG 5FGRA 2G2RA 2WOYA 5IKCA 1U8KB 3W0WB 1MHEA 1EV2E 3QNZB 2Y9RT 1KPRB 2RGSA 4KI5F 4UT6H 4YDZA 4AOFA 4F8OA 4LCUB 5AB9A 2HLAA 1VFUA 1HINH 3D6GA 1OE1A 2A77H 3F5WA 4GW1A 2EDDA 1E4KC 2EZ0C 4Q6IC 4Y19A 2V2TB 2E9JA 4A6YA 4BZ2H 1FO0A 4ODSL 5IHZB 3EOBA 3IJYB 4BA0A 3RLSA 1BBDL 2NXZC 2GJZB 1KT2A 4GUPB 3CSYB 4PJ7B 3QK0A 3UPRB 3VFUB 4GW5B 3MV7E 3MRKA 4WTZG 2GJRA 3TIEA 1BAFH 3W5NA 3U4BH 4NQED 3MLSH 3DMMD 3OVUB 1CFQB 3ESUF 4I2XE 3K8LA 3QPQC 5E5LA 3B6SB 5IY5B 3ARDB 3G5YA 5GIRB 1H8SA 1HKLH 1O7DC 1ZVHA 3H54A 3QO0A 3RVTC 4OZ4A 4PJHB 4ZOAA 1P5VB 1JPTL 5DD3L 4DFHA 3GK8H 4PGDB 5M95B 1TQTA 1KNOB 4OQ1A 5KZCD 2H2PD 4J4PD 4ILDA 3GJFH 5J7CC 1FL6B 2XWZA 2QQLH 1IEHA 4L0YA 1SUJA 4X0KB 1QKZL 4YWGH 3WDHA 5KS9A 3QEQA 4MD0A 1THAA 4UTBA 1CPUA 5I73C 3K4ZA 3GSRB 4L3EE 1LGVA 2DWEA 5KSAB 2FEJA 5IW6A 2LFGA 1KENL 2HTKC 3B83A 3NPSB 1G7IA 2VMEA 3KWWA 3ZDXB 2AGJH 3K72B 4S0HA 3UMNA 1NCGA 2ZSWB 1EJ6A 3D3VB 3TZVB 5SV3A 5ILTH 1AS6A 2VDNH 3BE1L 2IAAC 1DSWA 3IPEA 5IB1A 5LGHL 4WI3A 5K59E 43CAA 4FFTA 1QR1B 3F7LA 4P4RB 3ZT7A 5BRQA 2Y3AA 4Q6YA 1CFTB 3D0AA 4LP4A 1PS3A 2DS4A 4YEFA 3U2JA 4OT1L 1BYOA 1XSOA 4ZQKB 4PMEA 3Q6FB 3TZVA 4MMYA 4LL9A 3QI9A 3KPNB 5JDSB 3U2IA 4ELMB 2ICEB 2YAMA 1G9MH 3NABL 3P3SA 2J8UB 2BMKA 4P49A 1K8IB 4PJEA 2JKWA 4XHJC 3HUJB 4XTRC 1RZIA 3FQWB 4OCSL 1L9OA 4YXHH 5HI3C 3TYGH 3V6BR 2V3EA 1MWAH 4JREB 1TJMA 2O72A 4BBWA 1WZKA 2ZOLB 2HFGL 1BOGA 1EFXA 3KJ6H 3LH8A 1AZCA 4JY6B 4PUBL 5ICZA 2EZ0D 3G5VA 4ZUSA 1H5BC 5FUZL 5HDBE 1NCJA 2ITDA 1MCBA 4P04A 1JZ8A 43C9B 1I1YB 1Z9NA 1U8LB 1KPUB 4GKOA 4LLVB 4OF5A 1HI6A 2VXUL 4PJ9C 4PJIA 5E8NB 1AP2A 5GGTA 2VH5H 1WYJA 4LIQL 3H7BA 3QQDA 3X13B 3SPGA 1MOEA 4OLXH 1RP8A 2BW5A 4P5TC 1JBJA 1XIWA 5IESL 1D2OA 3FK3A 4E41B 4URTB 1AG6A 4Z7OF 3P4MB 4JREC 1E5YA 2YGNA 2WCPA 4MJIA 3MV7A 1TEGA 3GQFA 2V0AA 4N8CL 4QT5B 1TPXC 2VQ4A 3T09A 3FUJA 4X4YA 4MDIA 2X4NB 1T21A 1DVYA 2A4ZA 5IG7B 2WLJA 3VD0A 1YMMD 1TNMA 4A6YB 1OZUA 5CD5C 2EVHA 3BSZH 5FYJH 4LCUA 2BS9A 4XRCB 2ZKWA 3G08A 3Q2VA 2F53A 2EO7A 1T5XB 2M8XA 4MCNA 3IM1A 2AI0L 3H3KA 2LABA 3PHSA 3RFZA 2H26A 2L7JA 4LKXB 4QYOB 5T3ZH 1M57B 5JPNC 3HG1D 1OM3H 5I74B 2W8CA 3O6LH 5IT2L 5F0PB 3ZTNL 1QG3A 3MRBB 2X6UA 1PFOA 1U92A 2YEZA 4LCWE 3IGUA 3V5KB 4ELMF 4J5VA 1Z3GL 3BRGC 3FQ4A 4LHJB 4M7KH 2KZ1B 2GJ6A 4X2UA 1ASPA 1OSPH 4U1JA 1L9SA 5KANI 2C3GA 4O2FA 1PYWA 4OCXL 5K9KB 4MKTA 3AXIA 4GT0A 5I5IA 1TJHL 4M1DL 3LNEA 5C0FB 5KVFH 4KI5C 4EE2A 1WD9A 1QI3A 1I9RL 4E9VA 5DJAB 4TULL 1GJIA 1HE8A 5T3XE 1DBJL 3KVDD 4JHWH 2EDKA 3LD8B 2BFVL 4LZKA 2YUXA 3SDDB 5DZVA 3OLDA 1HDMB 3MTXA 5HDQH 1NCAL 5AALA 3JWNG 4AJWA 2FH8A 1MLCA 1WVZA 1ZTXE 1JN6B 5D7IE 4KRMB 2HJLB 4Z7QF 2ZYRA 3ET9F 2Y69B 2EE2A 1P84J 2K7PA 1AZBA 2VRAA 2HKFH 5DXWA 1Q9LA 4RWHA 1GPOH 4BGDA 1LEIA 5T1DH 2ZX7A 2X3AA 1PG7L 3D1MC 2FX8L 3FT1A 4ZFGL 3DV6A 3FO1B 3BAXA 4IOIB 1R3HB 3C5ZD 8PAZA 1LO2L 1J1XH 3LH2H 3DSNB 2V9TA 3P0VH 3DETC 4XO5A 5CFHA 2FHFA 5DJDB 4ELME 1UQSB 4O00A 3N41F 4A39A 4PV9A 3MUUA 4JO5A 3SOBH 3VD9A 1OCOB 4IKNA 2VXTL 2GUOB 5CSZA 1DN0B 4G43A 1MN4A 3ZTEA 3EO9H 3LS5L 3T0EC 5A2LH 3CMOL 4LBEB 4K5OA 4GG6E 4PVLA 4KRLB 5F7AA 1WIPA 1ZHBA 2JF1A 3LEVL 1AGEB 3FN0L 5F70A 2WVUA 4EN3C 1F3RB 3QDJE 4IMKC 4ONHA 5E1IA 1NAMH 1Q1PA 3I9GH 1XCQA 1EK3A 5FV1L 4JG1H 5E5UB 3V6OE 5I30L 1XTLA 1ZTXL 3CTTA 1E9QB 3P1VA 3SN6N 3EZJB 1ZLSH 1JVKA 2ZSVA 4JFDA 3MUZ1 1E30A 4X9FA 2CUMA 3Q0HA 3LMJH 4JL2A 1ZCRA 3WNOA 3THMH 5DCCA 3NJKA 1T0NB 1T1YA 2JB6B 1XD1A 3KS0H 4WWKC 5E1AA 3RE0A 3BPNC 3TJPA 3TTSA 5DSCB 1MQKH 3MA9H 2UVFA 4FXLA 1I7UB 2QGBA 1T7XA 3VGAB 1M56B 3HR5A 4I0PC 2EIBA 2DM4A 3RAJL 7TAAA 5KN5A 3L6FB 3NZHH 1CG9A 4Z76A 4JQIA 5A6LA 4OI7A 3NIDF 4UANA 1OARH 1A2YB 1T0MB 2JI1A 2ZP8A 3B43A 3DOHA 5HI5D 2JTYA 2EO1A 1ETZA 1B0GA 2Y2WA 2CJUH 4H8WL 2EIMB 3QHFL 3ZKSD 2YOCA 3NESA 4Z7UA 5LB1A 3IF1A 4W9LC 4FKKA 4F2ME 4NBZB 4K5MA 4N6RA 1TU2A 2FJHB 5DJCA 3PWJB 3RWHA 2ROXA 3MLVL 3QNZA 4FQQB 4AUUA 3FT4B 5FYKH 3IU3A 5AUMA 2H3XC 3N06B 4M6MH 4MNQB 3C5ZB 3O81A 1EERB 2R69A 4YLQT 1Q0YL 4KDTC 5C0JB 2Z7YA 3D85D 5DFAA 4GSRA 2ZWNA 1XV8A 4AKQA 2QDWA 4YUEL 2YHGA 4EDXA 1RQ5A 2OL3B 1JHKH 2FZ3A 4NP4H 2DTSA 3VWKA 4H4NA 1KZYA 4J3BA 1YEIL 2VC2B 3HRZB 4GRWH 4LEBA 3GSOA 2GT9A 1DDHA 2YAFA 1F6AB 2ZYIA 5C9JA 2C3HA 2VWEC 2ZUXA 4AQ1A 4AI7A 3IDMB 1QABA 2W38A 1IM3B 2F54B 4LIQE 1OSYA 4RZCB 3V6ZA 1QWNA 2NCEA 4LCWD 3GDCA 3DUSB 1NCDH 3IS0X 3P3YA 3JZYA 4NPKA 3SGKC 1BGXL 4RMVA 5F0MB 3QG7H 5J1TC 2B4CC 3ISRA 3RZCB 3QDGB 4K7PL 5E2WL 2DJMA 1U8NB 2YZ1A 3SODB 3H9SA 5A2CA 4NWTL 1A9BA 2NY7L 5JIQA 1IEAA 1PQZA 3O41A 4IBYA 1R5IA 2FYVA 4OIFA 3SDAB 3MRMA 5ISZD 4P9HL 2EVFA 2IH3A 3ARFA 1XGUB 2QTVA 4GKSA 3A24A 4M03A 1A7OH 2NX5D 3ZX1A 3IMUA 3ATBA 1LD9A 4TQHA 3O6MH 5E9DD 3MJ6A 3CCHB 5E56A 1KIPB 4WVRA 5GSRB 4D8OA 3G6JF 1UB6A 3IPBA 4Q6KA 3IU4H 1KY6A 3FTGB 1LM8V 1PLGL 2QQKL 3MYJB 5CMAA 4IBVA 1JZFA 2XICA 2WD0A 2DQFA 1R34A 2OMUB 1QFOA 5EORL 3A21A 4HT1H 1G9NC 2VLLB 2QHRL 2CIKB 2WKOF 3BVTA 3LN9A 4XAWL 3IDJA 2GYSA 2ITFA 3NFPB 4MVBD 3EOTH 3LN4B 3WI9A 2AABL 4C47A 2V2WA 4X50A 4Z95H 3OHXA 3OR7A 4JFFA 3CVIH 2MTAA 2J1XA 2WANA 3NJFA 1RJZB 3CSFA 1U8JA 4P06A 1K4DA 1FIGL 2Y24A 3P77B 5EG6C 4WI2A 3VRJB 5HHMB 1G7QA 5JQ6H 1A6AB 4ODUB 3SE3C 3P9MA 3O11B 3PHAA 1IAKB 1LEKB 2PWHA 4QLRA 3T04D 1ZS8B 2GW5A 3KLLA 3BJLA 1LP9E 3TN0C 1S7SA 2O30A 2Q3ZA 4AYID 1GOHA 3KPPA 1T4KB 2WLZA 4JUSA 2FEEL 3T8XA 2E59A 4KV5E 3UZQB 1EGJH 1OAUL 3CQQA 2B0SH 1PZSA 2OJZL 1CB4A 2L8AA 1TZIB 4PY8J 2AEPL 4JZJC 5DRXA 4I88A 1F58H 3VFNB 1LD9B 3ISWA 5CN2A 4ES9A 4BZ1H 1RFDL 3B7SA 3RNKB 4I85A 1MIML 3UXFA 3WDJA 3CFKA 3B56A 3DVGA 4Y5YC 5KBKA 3GZKA 2IC2A 3LZNA 4ORGB 3X1FA 3AWEA 2Z65C 4JFQA 3EJYC 5EU3B 1J8KA 3MV9A 2WJ5A 4UNTA 1Q1JH 3H9SB 1II4E 3DX8A 3U83A 3GZQA 2P45B 4ES8A 4XVUD 4A7VA 1N10A 3ZE2B 3BP7B 2FATL 1IGTA 1OAKH 2IGFH 3EJZC 4NM4H 4XZUA 1OTUC 3ZDWA 2NLJB 1D5IH 3CN3A 3PWVB 3TTYA 1CDJA 4O9HH 3TO2A 5IFHL 1ZHKA 1ZT1A 3KLQA 5DMKB 2W9EH 4OFPA 2VWEE 3QUYD 5D8JH 4MA7H 5FCUL 3GSOB 4JM4L 5DD6A 4PIBA 4R7XA 5J3HC 3CNKA 4PG2A 2X4RB 1Y18A 3CLWA 4WI9A 2X4OB 4R4BB 5FM5O 3GLDA 3MDJA 4M1GL 4ZG1A 1D6EB 4UQ3A 1WA1X 4XP4L 1X5FA 2HRGA 2FLRT 3ECBA 3FUMA 1KWGA 2AJVL 4HJGA 5KZCB 3AS2A 3S6CA 1UD4A 4MNGA 3RU8H 1T2JA 1LHZA 3FT4A 4OGXL 4W9DC 4YHOH 1A7PL 5EBMA 4X6DF 2A6DB 3MRRB 1OCZB 3VSUA 4RMTA 4OM0L 1OP5H 3BUIA 4NBXB 3COOA 2EVGA 5HYEA 3EDEA 2E6PA 2XA3A 1BMZA 3AQZA 3AY4A 3RWDA 5CAYB 1BW8A 1ETB1 4U0RC 2Y1VA 2KQNA 1PTZA 4FQPA 3P9MB 4UAOB 2ZWZA 2B1AL 3C60A 2B1HL 2IIJA 1YC7A 1WFOA 2EDJA 2ICES 3GM0A 3AABA 4HF5H 4ESKA 4B50A 5L9DL 1YDPB 3DX9B 2Z93A 3FQRB 3S34L 1KTDA 2IAMC 1NC2B 4DZ8A 1MW0A 2MFNA 3VGAC 3W38A 1MCWM 3CDZA 1BFSA 1GVIA 3BH8B 2VXSL 3ZYZA 3FHEA 5F88B 1G0XA 1KN2H 2VQ1A 3QHTC 3UAFA 1X9QA 2ZCLL 1AFVL 4K9EH 2YC1A 2OR8A 3NFPA 4P2OB 4R7LA 4AMWA 5AG8A 1ZAGA 4LVHB 5L2JA 1CGVA 2HUEA 5B7EA 2FIRT 3FOLB 4CN1A 4E9TA 3FBKA 2WO4A 1Z66A 4IRJB 4DGIL 5KSUB 4B9KC 4MJ2A 4ELDA 3N1PC 3ZW3A 4NN6C 4LPUA 1PLAA 4CADB 3AG2B 5GSRA 1MPAL 2F74B 3Q44A 4HUNB 3LRKA 3MJ8B 3LNIA 3QCVH 4OZIB 4NO0B 5E6IB 2A73B 2HT3C 4ZO9A 1KXTA 2CDEB 2VQTA 2GK2A 2HN7B 3EJTA 5E6RB 3T0EE 2GK0A 4IOFD 7PCYA 3L4VA 1IAIL 2ZAIA 2E7DA 1I8AA 2K78A 5CN1A 4ZX5A 4S2SA 2HJFB 2XTJE 1E4XH 2AJSH 4S1QL 1AGFB 1G7MB 2FLMA 1YYLH 2H9GA 3TWCL 5LHDA 4K4KA 3O3DB 2EP6A 3U2SB 5HPOA 4B53A 4XN1A 2ZPKH 4AUJA 4PB0H 3T4AB 1ZSHA 3QRFM 4MDJB 1N4XH 1SOSA 5CNHA 4XMLH 3UO1L 1GGIL 1B2WH 1F5WA 1NFIB 4LSVL 3AXLA 4YXLH 1ZD6A 4OZGB 3SKMB 5C9JB 1C1EL 3N04A 4UT7L 5HVGB 3N1MC 2IWFA 2C1OB 2LE9A 4JDVB 4K9JA 2PW2A 2FIKA 4U1IB 3ATEA 2D31B 1I1FA 4GRLC 1CXHA 1EIBA 2OYMA 2HJKA 5LN8A 5D7IB 4IMLB 4RCAA 5L4IA 4F7KA 2PP7A 2DYRB 2VUYA 4XZ4A 4YQXL 2D7NA 4IKKA 4OD1L 1JUFA 4EI6B 1LO5B 3PU7A 5I1GL 4OKDA 1JGEA 1A4KB 1A6VH 1U3HB 3WD5L 1RK7A 3FSVA 3EYVA 3HNVL 4MXVE 5G2NA 1H8LA 2GJ6B 1L6XA 4KFMA 4N2MA 3WLWC 3FQUB 2EQDA 4XBPA 2L3BA 5DZLA 2FSDA 3P30H 5IGXH 1W9XA 1MJUL 2ZWYA 3FULA 2YUVA 1I53A 2WXKA 2IPUG 4KXZH 4Z7UB 3VXOB 4FTVB 2ZUWA 3E0GA 4LP8A 5CD3B 3LTVA 1CVRA 4BKSC 2EIJB 3NCWA 3CVHL 5CEXB 3W39A 1JDAA 2HVJB 2N0MA 3KCPA 3B2PA 1H0DB 5ESVA 5E1GA 2QQNH 3CXFA 3L2MA 1QPKA 3P9WB 3HR5B 5FV2A 5GJTL 5IG7A 2OL3L 4ZFZA 2P26A 1GCFA 2O1AA 2N7AA 3DDGA 4OLZH 5C0RH 4RIRA 3S0PA 4KQ3L 4MCZA 1NCBL 5HJ3B 3REWA 2EEXA 1JIBA 2VDQL 2XWJA 3SOTA 5IROC 1NGZA 3NDYE 5JNYB 2FGWH 4I0PD 1TJGH 1QBML 4H20H 3C87A 5D55A 3V0VA 4Y9GA 2IDTA 2DH3A 2ICWB 1OCWH 1MI5A 4MX7B 3F84A 2F19H 3ML9A 4OQTH 4OD3H 3NZSA 4WJ5A 4A63A 2CKBH 3K6SA 2NR6C 2J1WA 2UZXB 3BMVA 3ZDZE 2XVLA 4FG6C 3FDWA 4ADGA 4DEPC 1NIBA 1A65A 1TFPA 2ZKMX 3OAZH 3KPQA 1J8HE 4NUJA 1AY1H 2Z31B 3BPLB 5BV7C 2ITDB 8FABB 1X5GA 3PJSA 4KQ4H 4KZDL 3L5WA 1T89A 3EH3B 3MNWA 3MRIA 3QUXA 3F8UB 2IANE 2CKNA 1JXDA 3FT0A 2CU9A 3VMNA 3ZKMD 4H88H 2Q10A 2YD8A 3GBLA 3LXBA 3TWYA 4KC3B 5DRZA 5E5MB 3WNJA 4JFPB 5DUJA 2VKWA 4BXVA 3DURA 2O93L 3DMMC 4PMFA 1QLRB 3QUMA 1P1VA 5H4ZA 1E28A 4P4KB 3SPHA 4U1GB 5C7XL 2KUTA 3U0PA 3F00A 4PS4H 4YBLC 4EI5B 1JFHA 5EC2A 2HFTA 5KWYC 1CFTA 3LKQA 1BQLL 3GMRB 3QUZD 4YSTA 3MOBH 3UAJD 2K6WA 1VDGA 4K94L 1P4BL 1H3UA 1UA7A 1ZANH 2YPKB 5SWQB 5EZJA 2BO0A 1VZGA 1INQA 5JORA 4O4YL 4NJAH 2JMRA 5FO7B 3TC9A 4ZMLA 3KR3H 3SHSA 5KVGH 1BZ9B 3ATDA 3ASWA 1JTTA 4XO9A 5CGYC 5CINH 1QLEB 4JCMA 2VLRE 3MX0A 5SWZD 1MFCL 2VLRB 1MHCA 1YEKL 5F72S 4K55A 4F57L 3GF8A 5KTEH 4QPEA 4DUXA 3CPUA 2VZOA 4PJIF 3KLDA 3V6FA 3TIDB 4FQCL 4OD2B 3P11L 3CX2A 1AZUA 4OBSA 4P9MH 5F44A 4Y88A 3ZZSA 4WV1A 1G43A 1FFPB 2DLTA 4M8QA 2VN4A 3KDMA 3ZT6A 1T22A 4PJ8C 1V27A 3EO0B 3ZTDC 2JKIS 3PWUB 1BJMA 1OW0A 3AQDA 5SX5K 4PJHA 4M6AA 1CDHA 4JQVA 2QDVA 5CZVH 4TSAL 3TNNB 5HYSB 1UUNA 1BD2B 2RCSL 1RIUL 5F21B 1S8DB 4ZUWA 4PJEF 1HHGB 5HY9A 3SDXF 4EJ1C 4NHCL 5IMLA 3VU1A 3V7AE 4YDJB 2ZNWA 1SXSA 2OK0H 4IU3A 4JRXA 1YJDC 1KBGH 4J27A 5EU4B 1MFAL 2DICA 1QLEL 2DQCL 3PDDA 3TIEB 2YKKA 3FUNA 4MJIB 5J06A 3V5DA 1DL7H 2GAZB 1GGCL 4ZT1A 1FG2B 1JXFA 4GRLB 1OCRB 3QJXA 3QZWG 5T1LA 3DJRA 1QA9B 2QSQA 2EDWA 3OG4B 1HEHC 4PU2A 1DVXA 5BRPA 5FECA 3PQYB 2DQ6A 1MELA 4AZ8B 2A9CA 5IV2A 4PR5A 1KPRA 4MYWB 1YMMB 4J12A 2ZF8A 1QQDA 2PETA 1UACL 3P2TA 3E38A 4PB9H 5IUSA 3U1PA 4L2LA 4JGNA 4ZXBC 3VGBA 2DI9A 2B1OA 5JO5A 3ARDC 2KMWA 1MCWW 1A5FL 4FQIL 4H44C 5D1XA 4PV1C 4AJVA 3BZ5A 2IDQA 1NMBL 1JF1B 1XMEB 2DJUA 2HPOA 4YGVB 3QPKA 4X5WA 4YDIL 2AJXH 3BYTA 2WMPA 4F15C 1OAZH 2E9BA 1NBYA 4JCWA 3SE3A 2H32H 2D31A 3EGXA 4LSQH 3BWAB 2CO2A 2X2UA 4WUKH 4EI5D 1E6JL 4OFQA 2W81C 3GUFA 1O6SA 5EZIL 2AXGB 4AVHA 1KBWA 1SEBB 3BQUD 1FLRH 3ESPA 1D9KD 3EO1B 4RGNB 2QHLA 2NXYB 1JHTB 1FYHB 5EO1B 5HTSA 4CL7A 3GMRA 1VZHA 3P0GB 1CI3M 1IQDB 5E6SB 3PV6B 1D7FA 2HWZL 3BAYA 4QHMB 5D7LA 2BNQE 4M43H 3JWOC 4LCYA 2GTWA 4JDTL 3TZVC 1R3IH 3O2DL 5HGAB 3S88L 3MLRL 1M3JA 1E2ZA 1JWSA 2LU4A 3EFFA 3OKMB 4FNLL 1N64L 3ECWA 2HKHL 4QD2E 5DS1A 1GS8A 4FMVA 3IN2A 3M6DA 3A6BH 3UTSB 1YECL 4LESA 4G6ML 4D9RD 3SBPA 1EJFA 3IDGA 2DQIL 4TQIA 3AROA 2ETWA 4NKMB 5ALCL 4NT6A 5D7SH 4TYUA 1C5DB 4LAQL 4J3OF 4N2CA 1FH5H 4ATWA 5CJXA 4IKLA 1Z5LA 4CN4A 2D03H 1BQKA 5H35B 4X5LA 5G4MA 3QISA 4XOBA 2C3VA 1PLBA 4ODXA 4Q4IA 1RULL 3S5LA 1M1XA 4A6YL 5A3ID 5GGUA 1CO1A 4GKZA 1OQXA 5F6IB 2VDLB 4G59C 1DLHB 4P3DA 3WOVA 3GS4A 4GP5B 5E7BA 2P8LB 3IMBA 3HPJA 2IDCA 3OAYH 5H8DA 4MMXB 2JJWA 3T2PA 2DQHL 3UEQA 3L48A 1IGYA 4M9OA 2BHZA 2NY3C 2OQJB 3WCYA 4FCAA 3C60B 4XPGH 3WENA 3EOBB 5LBSH 3NA4A 3NACH 5I6XB 2YD7A 1JGDA 1JNNL 5F6IC 1WWBX 1GGBL 4H25B 5LAPA 3F5WB 1U91B 3N42F 5D70H 3ATAA 2X2IA 2MJWA 2X1PA 1HEZA 2XG4A 5I1CH 3AY4C 1NPUA 5HDBB 5DVNA 1AE6H 5HI5C 3ZL4H 3RDTB 3GK8L 3MREA 4F7TB 5LGJB 1KJ2B 1MJJA 1XZ0B 3IRPX 4ODHH 4I3RH 4ZS6D 3FUKA 4DGVL 5K9OB 4FXKA 1YEGH 3CZLA 4NQDD 5ID0B 3QJFA 3PL6A 2K6ZA 2YRLA 4LOUD 4Z1PA 5DHXB 1QKZH 5DFTA 3RVWD 1K6QL 1J9TA 4GOSA 5ALBH 5FYJU 2YIHA 3FB8A 3QCTL 3CH1A 4QNPF 5DJ2A 3SGEI 3WLWD 5BW7A 2MCPH 4WCYL 1H15A 4L0ZA 2AKRB 5L7XH 1KTLB 1DSYA 4K3DL 1MIEH 1QUPA 2HT2D 2PYEB 3BD4A 3HE6A 3QORA 4MLIA 4YBQD 1Z9MA 4RMWA 1FVCA 2NXYC 3UTPE 4G70B 2EDTA 4LQFH 5B1JA 3GEWB 4L4TD 4UU9B 4FQLH 3LXUX 5LGHH 3WO3B 1AR1B 1M6UA 1W0WA 3LSOA 2GEQA 4LF3B 2V5YA 5GGTH 3WU1A 1KJ2L 1RUKH 3DNKA 3QNXA 2I07B 2ZUQB 4EXKA 5J9PA 4AT6B 4ZMNA 5EU5B 4KWUA 3PNRB 4LCWB 3SDXE 1MCOH 3TT1H 3GI8L 1N2RA 4BWTA 3GEFA 2FUQA 5E4EC 4KNTA 3PG2A 3WJJC 4LCYB 4N0YH 4UQEA 1M05A 1XB8A 4J3SA 2HX8A 1CLYL 4FQ2L 1AD9B 1MH5B 2HP4A 4R8WH 1JHTA 2OJEB 3J07A 1IC5L 3M1BB 3FFCA 2HFGH 4JFEB 1NCWH 2CDGB 5LGKA 1P5UB 4F7EB 1FYTB 5FW6A 1CTNA 3QIWB 4J7RA 4ENZA 4ODWA 4HLJA 4N0UE 5E99L 2BNUB 2HZHA 2AJ3B 3KG5A 2WGXA 4TQ8A 1NEZB 3DK2A 3IGFA 3SD2A 1JGIA 1S7TA 3ARRA 1YLBB 4IKJA 1GZPB 2JCCE 1O6VA 2WKOA 1IBHA 3UCRA 1DP0A 4HUXA 1HXYB 2A38A 2XY2A 3RP1A 3SYQA 3UYPB 4R4FL 2XI9A 3B7UX 3CBRA 4QRPE 2R1XA 5IHHA 2AXFA 1CL7L 3ERXA 4XE0A 5JO5B 4F80A 4URKA 4KZEL 2WYHA 4N8CH 5AOKA 4CVZA 3NFSH 4DVBA 1DZ0A 2CXKA 2JXMB 4U1KB 4PJBA 2Q86A 4B0MB 2NXZB 5DMIL 2GKIA 4I1PA 3IFLH 4GRMA 2F58L 3FTGA 2X3BA 4L4TB 3BSZL 5E00A 1XXFC 4B96A 2VB5A 5FUOH 2MHAA 4A2FA 1JI1A 4JFHE 3ZO9A 1BFTA 2VLKB 5F7NC 3B9EA 3MBWA 2D7TH 3O9WC 4NC0B 1CICC 4PP2A 1OM3L 1USZA 1FVEB 2WLMA 1AD9A 1XGUA 2IH3B 3ARFB 4OF3A 4LCVA 3FYEB 4J4PC 3FT3A 4XCFL 4L9LB 4YC2C 4NQCE 1WAAA 4M7KL 5JHAA 2VR6A 1D5XA 1R47A 1MQ8A 4EUPH 1BQHA 2H32A 2E7LA 3F2LA 3SQBA 1ZLUH 1HCVA 2W5PA 1RZJL 2FGZA 3LHPL 2BSED 3ILPB 1PDKA 3B1UA 4QY8A 5EULV 4JO4H 4PRDB 1R3LB 3NCCB 4HHGA 2AZUA 5LN4A 4UUJA 2YA2A 5FKAB 4TL5A 5CBEA 3K0WA 1YAZA 1G7JA 1ROCA 2WQVA 3BEVB 3QH3A 1CR9H 2KL6A 4FDWA 2MIZA 2ORBL 4TLSA 3WIHL 4UMSA 3VSVA 5JPMC 1XGYH 3L4CA 1UCBL 2CMRH 4U6YB 1JXGA 2JJTC 1GPOL 4U3SA 3AREC 5DT1H 1K2DB 1N3NB 3CXDL 1ODAA 4MJHA 4JFQB 1FSKB 4Q4EA 2FX8H 5I28A 4ETYA 4ZFGH 2NOYA 3T77A 3S7GA 2EE3A 3WFHB 1OD9A 1IARB 5GPRA 1MJ7L 4H8PA 4QXGH 3MV11 1I1AB 3LQAH 1SXAA 4K5LA 4FQQA 1D6VL 2J20A 3ZDZB 1DVFD 4G9FD 2BP3A 1Q0XH 3KHQA 2VDPB 1V3LA 2Y07H 3R4RA 4JFEA 5FDWB 3OQ3B 4FLQA 4NSKA 3VA2C 1M7DB 1RZ8A 4F5CE 4U6TA 1YPZF 1UM5L 4PJCA 4UOQA 5HHMD 4U4IA 5FWQA 4YAQA 4D0DA 4JM2F 1G0YR 1FBIH 1N6VA 2E46A 4LNRA 5CCKL 3JVFC 3TVMC 2YMXH 1JWMB 3SO5A 4P23D 3M17B 4EIUA 5EPMA 4U6XA 2R0LH 3TYFA 5I18H 4YK4B 5DSCA 2C4FU 4JB9H 4AE0A 4ACPA 2XA8L 2W07B 4XMPL 1HSBA 5BUAA 4ENEC 5J4MA 1TJXA 3BWUC 1YPZE 3HI5L 3OXRA 4R3SA 5CJOL 3MQIA 1O6TA 4MMXA 4YSSA 2CUIA 1F3DJ 1MVUB 5DK0A 2AVGA 4PEEA 4XCCL 1WRFA 4IGBA 4IEFB 4ZAKA 5GRUH 1F02I 2CIKA 4JPQA 3V0VB 4JO2L 1SZNA 3O2WH 2FQFA 4WGKA 4KJPD 4DSYA 2EYTB 2Y06H 1YEDB 4R0LA 4K8RL 1EO7A 3RGBA 3SGJC 4F8LA 2GITA 4KUZL 3F7PC 2BSSB 2BFGA 3L4YA 3OKEA 3KXFB 3QPQD 3ZKMC 3DXAA 5DHYA 3GS7A 5EU6D 3CWGA 5GGVY 1ZVNA 4AV0A 3P3TA 1AGCA 3CDGA 1GJWA 5I0ZA 4F8NA 4XC3L 4PR5B 2H6OA 4QGTA 2GI0A 2GY5A 1CD9B 4OCWL 3PQYA 1WBYB 2XV3A 4YUEH 5T1LB 1P7BA 3GDBA 1JHKL 1MRDH 3ULVD 3QJSB 1U91A 4X4XB 1CK0L 1CD1B 3VGHA 3B4NA 2VDLL 1YEIH 1W0VB 4D2NA 3CFTA 4M93C 4N68A 3SPJA 5I6MA 3OGOE 3L3HB 4S1RL 2C7UA 3KPSD 3OLGA 4P2YA 1PKQE 3KXFA 4P57A 4NO3B 1REIA 2F61A 2X4SB 2YAHA 4ABWA 3I9IA 3ZUCA 1OHZA 4RAVA 4Y5XB 5LBSA 1C12A 1S5HA 2MPAL 4HH8A 4K7FB 3G9VA 1F86A 4P46D 5EZLB 1MCJA 3QG7L 4J3WA 2DH2A 3GLZA 1JZIA 2NUTA 1NBYB 3ZGHA 3U4AA 2Y7QA 3KPRB 4QRQA 1AYRA 2WMPB 3I50H 1R24A 1E42A 2I27N 2Y1ZA 2EDOA 3HZVA 1LO3L 1XBRA 2OMWB 3V4VH 3BUDA 4RNRA 3RDJA 1MG3C 2EKSA 3AXLB 2GBUA 3FO0H 4G8FB 5C0GB 3PP3K 5I76A 5KVEE 5I8CB 5IW1A 3GHEL 3NP3A 5D7IF 1F4WH 5DS8B 3RPIB 3EG9B 1W72H 5I1HL 4Q97A 2V8LA 4U6VH 3ARED 2VL5B 1A3LH 3GJFB 1I9JL 5AL8A 1NEUA 1TVHA 2YWYA 3GIZH 5D2LE 4FEMA 3ZY7A 3B8YA 4FNTA 3STBA 4D3CH 1TTGA 2HJFA 4S2SB 3H0TA 1DQDH 2Y1AA 5IIEA 1A6UL 2Z91A 4UDUB 1XH3A 2AP2A 4PJCB 3V4LA 4JZNB 4FFZL 2ZYSA 3EOTL 3I3BA 2IAMA 1E8XA 1RZPA 3CVHB 2C4XA 3CQPA 4GBXC 1ZY9A 4MNGE 4QXUH 2MKWA 1FG9C 1LE9B 5MP6L 5D72L 3U1QA 3VJ6B 4HUKB 5TF1H 4UAOC 5KUMA 1T1YB 4RFOL 2FVNA 3BDYH 4BFRA 3VTMA 2GTZB 5DUBA 3QQDB 1O6SB 4L8CB 1M71A 2FEEI 4IRJA 4QTFA 5KUKA 3GTTA 3UG4A 4BSJA 2BC4A 1L9TA 2XG5B 1RJLA 2EXWC 3H9YA 5KG9A 4I0PB 5DO8A 4UB0L 1FQ9C 3LH9A 1XSJA 3VI3B 4OJDH 4ZUSB 3DO7A 4TNEA 4F8PA 1SXCA 2ZOLA 1OAUH 2CDFB 3MI6A 2OJZH 2IFGA 4NUJB 5FYJD 2X4PB 3NPSC 1UUSA 1F58L 2ZOKA 1AQHA 3ULUF 1NCCL 4CN6A 1EEZB 1UQSA 4TTDC 1UM4L 3K6SB 4OIIL 3MRLB 4KJQC 4EUPA 1S9VB 3EYUH 3DSNA 4A2MA 1NSNH 3CHRA 4L3EB 1QW9A 2BC4B 3UIZA 4I2XB 5I19H 5JW4R 1NWPA 4LPTA 2KDGA 2MNWA 5GRYA 3VCLA 4Q9QL 3CHXA 4OLVL 3T65A 2DOCA 2WVVB 2XWJB 5HHOD 3PIQA 2OMTB 1XDTT 1DO6A 1RV6X 3I75A 2CM5A 5AW4B 1AHMA 1F45A 3WUWG 4D9LL 4NQCB 1XVSA 4JKPH 4I3SH 3VB8A 1QAWA 2O6FA 1HXMB 2ITEA 3RX9A 1XF2B 4C54A 1AJ7H 1BBJA 5FYLE 5BMFH 4QXTB 5DD1L 4B41A 2HTLC 4NO5A 5B21A 1Y18B 2G0KA 1WA2X 3OX8A 3K80A 4RMSA 5BZWA 2Q9OA 1A4JB 4AK2A 3TL5A 2XBTA 3IDNA 3DV4B 4WW2F 1L0PA 4J6RH 4DNLA 5D93C 5DRZB 4ZUTB 4B97A 2DBJA 2FECI 4PJ9A 3WNKA 1WF5A 3FQ1A 3VXSA 2Y36L 3P69A 3QORC 3MNWB 4DVBB 5D5MA 4Z7WA 3TO4A 5EHFA 1J1PH 5ITBH 5I76B 2Y5QA 3C8KB 3UJIL 3GMOB 2R1XB 3H53A 3BVUA 1GTFA 2IPKB 3W9DA 4DUVA 1EEQA 2IV9A 2YD3A 3GKZA 4YHOL 1YEEH 3F85A 5CIPB 5T5FA 4C83A 1CZ8L 2DQDH 4WJ5B 1JGLH 1GZPA 3QEUB 4TQEH 1UATA 2Z0BA 1OTUD 1PG7W 1S7QB 3OLIA 4DN3L 4F9PC 4OZGE 3DVGB 4PCKA 5GGQL 2NQ3A 3T0ED 2X7LB 4L8SA 4B9YA 3L16A 1UKSA 3C5SB 3FRUA 1AYOA 3ESOA 3JT2A 2X6AA 1K4CB 4MCZB 4HUUB 2CDGA 4MS6A 1KT2B 1SHSA 2GJZA 4GUPA 5FOBA 1JYWA 1NFIA 1TZIA 4QT5A 4PJ8B 2OR9L 4UTCA 3KLAA 2YPVL 2DKUA 1MLBA 3BLBA 2B39A 4HC1L 3VI4E 4PPTA 4JO1H 1JPGA 3N1FC 4JMNA 1DQLL 5D2LA 2F5BL 2I5YL 3BZFB 2HT3D 2UYLB 2XFGB 1J5OH 1CFVL 3ZPDA 1BFOA 4G6FD 1FL5A 3N85H 3PWPA 3E6HA 4JJHA 3T2LA 1CE1H 5H37H 3OKOA 4HIHA 1TQVA 1MUJA 2WUBL 3QNXB 4N5ED 2C9UA 1TO4A 1NGXA 1ZPLA 1QSEE 3LKOB 3S5ZA 4PRPB 5CLTA 2ZCHH 3ZMRA 3R1GH 3LPFA 5F9WC 3ZR6A 1IKFL 3QUXB 3V4PA 4Y1SA 4DPCX 1U3HA 4I48A 1QRNB 4RH4A 1EHKB 2NY5H 4Z3GA 2NQCA 1YEDA 4R0LB 3UYOD 5SWSA 3OLEA 1KYFA 3VGEA 3JV6A 4G8IA 1ZV5A 3HUJA 3UFIA 3BXNA 4DW2H 2AJSL 3NIGF 4PJXA 1AD0A 1WBXA 2BMKB 2H8PB 4L5FL 5CLXA 1YYLL 2X1OA 3SDDD 2XN9B 2VLME 2VYRE 3MN8A 4M62L 3K91A 1NMCB 5MEPB 4U1LB 3FL7A 4OI9A 1QSZA 3GIVB 3LVEA 4PB0L 4X83A 3BISA 3OTTA 4UZUA 4BH8B 4AMKL 2XPGA 1N4XL 3CDZB 1FFTB 5L2KE 1BEYL 2GSMB 3OPUA 2AW2A 3KPSE 3IDYC 5TQ2L 1NGQL 2UX6A 2Z8VC 4QRPB 2NY4B 2VR8A 4RIRB 3QUMH 4UT7H 2CCWA 1NANH 5FKPA 2WBJD 3ZRSA 2X4QA 1HIML 3QUYC 1QNZL 4MA8L 3JWNH 2O6CA 1X7QB 3DTXA 3O8XA 3QIUB 5DZAA 3WS3B 3HLKA 2APVA 4W9KC 3K6DA 1YYML 4UF7C 3WY3A 3VXRA 5E8EB 4YZFF 2HLFC 4JKKA 1MFDL 1A6VL 4IKIA 4RZCA 4P5MB 1XGRB 4NZUL 4JFUA 3WIAA 1VFAA 4NM8H 4F7CA 1UWFA 3ARPA 1XGPA 4QUOA 3INOA 1S9KC 3HRZC 3E9UA 1XR8A 3AADB 1MJUH 1N0XL 1DN2A 1XTMA 5FYLD 5KYNA 4JCLA 1OAXH 4UIKL 5I8KH 2JIXD 2OL3A 4OLUH 5HJBA 2JJTA 3H42H 2A9NH 1KYDA 3EYFA 3EYFB 4XPBH 1PVHA 2P1YA 3PP3H 3RIFK 1PEZA 4PJ5A 2FJGA 1OIOA 5AW8B 4ODXB 4I1NB 1DR9A 4OFDA 1ZEAL 4WY7L 4XMZA 5J6HB 4CSZA 3F7KA 3QJTB 4OLZL 4KK9D 3NEEA 5DRWB 3PCYA 5AW3B 1C5DA 1FE8L 1W6WA 1YQ2A 5I15H 2F68X 2NRDA 1KJ3L 4HISA 2E9WA 3H9HA 3T3PB 2P49B 1OGAD 1GL4B 3SDCC 3MRNB 5CF3A 3JTBA 2CO3A 3GSQB 4DHLA 4IOSA 5ESQA 3T4AA 2G75B 4X7FC 4AIXA 1EDHA 1FP5A 2FNWA 3WEXB 4XXWA 4Z18A 3ZMEA 2AJZB 4UNIA 4EBQL 4F58H 2CALA 2A7BA 3C6LC 2BK8A 2H9GB 3B5HA 4ONFL 1HH9B 1BMWA 5M94B 2B16A 4GQRA 5IOPB 1RMFH 4FMFA 3O6FB 5F71A 5LG6A 4NQEB 3VWKC 5BQ7B 3HN3A 5KYUB 1NUNB 1KGCD 2B4CH 3K2UH 4RDBA 5JUEL 2DM7A 5EEYA 4LO9A 5CGYD 1BF5A 1A7NL 1XEDA 5JQHC 4OU3A 3DX3A 4H88L 2ENQA 3VAEA 4Q2ZB 2K7QA 2X87A 1E9QA 1HHHA 4NJ9L 5BVJA 5IJKA 3HHSB 1IAII 2L7QA 1BOYA 4P0DA 4Z9KB 2N7BA 2H1PL 5SWSE 2ZONA 1SLWA 3NP4A 4XNYL 1AO7D 1K5NA 1G7QB 4ABUA 4AE1A 1QWHA 1CIUA 1ET8A 3DOSA 3ZDYE 1U8JB 4TSBH 2LLLA 3R7QA 3RWJA 3KPMB 3VFWB 2YSTA 2WKGA 4A7GF 4HQQH 3W1ZA 5D1QC 4PS4L 5FHAH 3QZWA 4Y4KB 3DO7B 3H55A 5BZDA 3DHJA 5C6WH 1BQLH 1HNFA 4M7LL 4WHYH 4APQA 1N19A 4QO1A 2IWKA 5D5MF 1IBFA 2VDOB 1EAJA 1WHOA 3VRLE 2Z93B 3FQRA 3OKOB 4HIHB 3VVWA 4P2RA 5FM4A 4NJAL 3RTLA 5IV2B 2R2HB 3BAEH 1T5WB 2G9HA 4Q56A 3RIAF 3LRLA 1MHPL 3GXNA 4K5NA 4AM0Q 3MCLH 1UB6B 5CINL 3BO8A 1SVBA 1OAQH 5I5RA 2ICWI 3KNBA 4NQUA 3QDME 3T1WA 1IM3D 2F54D 4K23L 3RTQA 1P4LB 4GS7B 2V8MA 3JV4B 4WFFE 3CFEA 1MVFA 3FFCB 3MHZA 3F12A 1WIOA 2HVBA 4WW1B 3RJOA 4NQSA 3HCVB 1KTRL 1MH5A 2IH9A 3FMGL 1KSRA 4NPJA 5TGBB 1QASA 4EUPG 4P9ML 2IOOA 4Y7OC 1JZ7A 4B9CA 1MCEA 2C9AA 4RDQF 2P5ED 4TPRL 3UG5A 5IB3A 4IS6A 5DD0L 5BRZD 3WNLA 1EO8L 2R23A 4BK8A 3MCKA 3O6FD 4KPHL 2VDOL 3QZPA 4K2UH 2NW2A 2YRZA 2WCSA 4H0HB 1UKTA 5JW3H 6CGTA 4XPTL 2NY1B 4NHCH 3M88A 3BGFC 5HHNB 1I82A 3W57A 1X5ZA 2EKSB 3HUJF 2FT7A 4OD2A 4QRRB 3TN0A 1E5ZA 4HCRH 4F7MB 5AD0B 2XKSA 2LU7A 1F90L 1ZT1B 3JWNE 4RNRB 3WKPA 3JTSB 4HSAC 4OVVA 2VDQB 3SPVB 3B9DA 5D96C 4QYOA 1IC4H 4X4ZA 4UOZA 2YQBA 4LCCB 4FHKA 1JXJA 1TDQA 3KPRA 5DRNB 3L7EB 3F7RA 5C1MB 4EDXB 3LXAA 1A7RH 4ZW8A 4DVRH 4AMXA 3MV9B 3T2OA 5FX3A 5MEOA 4IBQA 3BKJH 1ZT7B 3WJMA 2PYED 2DIJA 5TJWK 2ALAA 2AANA 3CFKB 4CVUA 2EEAA 1E3ZA 4G7VH 4CGUB 4GQZA 4X0NA 3S5LG 5I26A 2DQUL 3T5WA 1A21A 3CC1A 2JI2A 4ONGH 1IAOB 3HJEA 4L4JA 2PP8A 4BSVB 4PTTA 2WHVA 3K6NA 1HVXA 2UZYB 5I16A 4GAJL 3VCLB 1BM3L 4TVPH 5KYWA 1OAZL 4HIIA 1PSKH 1T3FA 1JI2A 4UTAA 3ULVH 3UMTA 1XGQB 1IL1B 4L3EA 2E8ZA 1CI5A 4Z7AA 2SEBA 2EUWA 2A4EA 5KS9E 2J6EA 4YHKL 2GHWB 5B1JC 4G7SB 5GSVB 4JFWA 1LP9B 3GMPB 5IROD 3MRIB 1C16A 1HOEA 5DVOA 2EXSA 5EZIH 4HG4K 2R27A 1GY2A 3FS9A 1XMWA 1JK8A 4XNDA 3F01A 5C92A 3VYOA 2IG2L 2M26A 1RUML 2XV6B 4KXCA 4WLCA 4GKNB 3CBJB 1NGYA 1OPOA 2J2ZA 1CXKA 1L4IA 3O4OB 3KPTA 3IDJB 3UTQB 4ALAH 4FNLH 2NZ9D 2HKHH 1NBVL 2COVD 4ZTPH 4HCIA 2J57A 3T8MA 2CO6B 4FFWD 5DJXA 3L2LA 3S35X 4KDWA 5E8DH 4JL1A 5K1VA 3Q2NA 5ALCH 2MWCA 4OLWH 1IBZA 5D7SL 1KYOK 3GXMA 5ACZB 3CCHA 3Q9PA 2R56L 4QHLA 3CZGA 3ZT5A 1NDGA 4GI6A 4Y9EA 4Y2DC 3B9KB 2J21A 1G6RL 3LAFA 3GSNA 4PJHF 4JG9A 4UDUA 4XNMB 2VDPL 3MLZH 1FF5A 2BCMA 4HLEA 4PRHD 1LK3L 5GRVL 5BOJA 4X5XB 5DJ6B 2P7TA 5HGHA 4UV4H 1CFBA 5HGAA 3ARSA 4JHBA 4M93B 4CC4A 2VLJE 4X0KA 4YSQA 2Q7AA 3VU2A 5DD5L 4NN5B 3QDGA 3AACA 4GMTH 2BJMH 2DQTH 5E1AB 4KITB 5IF0A 2UXVA 2VDRB 3TO4C 1KACB 3VGGA 4ZFFA 1BIHA 4X7EC 1KBBA 4RQQA 1HQ4B 3RUGA 4G3YH 1YEFL 1YEHH 3HA0A 1EHLH 4G8EB 3T0WA 1G7LA 1TMCB 4M5SA 4G7YH 3WELA 4PGEA 3MGOB 4Q89A 2IPTH 3EGXB 2PABA 2FQDA 3KWXA 1DEEA 1NWOA 3ZQ9A 2R0ZH 1FFOB 4OTXL 1PYWB 3HC3H 4LVEA 3U46B 2PW2B 4U1IA 2PCFB 4RFEA 5I0DA 5C0JA 3J8F7 4IRZH 2XYCA 4NRYB 5EO9A 2WNKA 4I4WA 3DRTA 4JFTA 5EUOA 4A7GA 2GUOA 1EZVY 4XPFL 2OSYA 1B88A 3BAKA 2K1MA 3VFTA 1N18A 3STZA 5TH2A 2R8SH 1I4FA 4QF1A 5JHDD 1RU9L 1T5XA 1BYPA 3HG2A 3ZK0A 5FB8A 4EN3A 1K6QH 4FS0A 2XWTA 2XWTB 1ACYL 4UQ2A 3C08H 3LPPA 4HZLA 5EU6B 3MACL 3I84A 1JF6A 2DD8L 1E5AA 1WBYA 4UILL 2NY1D 5HGGS 3NZ8B 1I9IL 4GRLA 2BNQA 2UXFA 1EJOL 4GXVH 1AGCB 4LPYA 1J1OL 5CP3H 4LQFL 3KZ8A 1CIDA 3MV7B 3OAYK 3EKCA 3GMQA 4M7LT 2NDFA 3DXAB 4A7UA 4FQLL 2GIYA 2QLYA 5G4NA 3HS9A 2PTTB 3P73A 3WHXB 2WC7A 4I1RA 2PW1A 1FC1A 5JPMA 4X80H 2XNAB 4XP6H 3V4UL 1NDMB 2ED8A 4HHWA 12E8L 5DUML 5E00B 3SE9H 3VYNA 1XHHA 3KPSB 3VM5A 4XVSL 3RY6C 4JGUA 4PFEA 5HYSA 2VT0A 4O02H 3QPXH 2Q86B 5HHQA 3UC0H 3ALPA 5DURB 4IEFA 2GBVA 3D8MA 4IGBB 4Z8FL 1KJMB 1FFPA 1XCQB 3EDJA 4HEPA 2Y1YA 3FUIA 1RKRA 4WI8A 3NAAH 3TPKA 4FA8A 4FABL 2E56A 4IBWA 1IC7L 1U36A 4N90D 5HJGA 3L81A 2WB1A 1JV2B 2HYMA 1X6LA 4PRPE 4ETQB 4UWQB 1AANA 1TTFA 1R17A 4EKJA 3IB4A 4JEGB 1BX2A 3FU3A 1K8IA 4NWUL 4HD5A 4DWHA 1RZFL 1WS8A 1CU4L 4BFFA 1JE6A 2HFEA 3ARBC 4BH7B 3DJSA 1E7UA 2I25N 4ATTA 1E9OB 5GS1A 2QKIC 2P8PB 1N6UA 1PZCA 1I8LC 1UENA 3D4CA 3FFCE 4S0TD 4MDIB 4YGAB 4J3OD 2ZUQC 5ICYB 5E7FA 2HVKB 1V54B 3X1GA 5BO1H 5E8OA 4FA6A 4Z7NF 2A99A 5I8EA 2OLDA 3FRPG 4LARL 5LNGA 4MYPA 1JOIA 3RPBA 4M61A 3FOMA 1VACA 2DYSB 4ZYKA 4ZPVB 3MLWL 3U1SL 5D1ZB 2XN2A 2I7OA 2V9QA 1OEZW 4NQDE 1D5ZB 2YRBA 1T89C 2H45A 1NLBH 5IW6B 5BZXA 3HNSL 3IRZA 3O6KL 1KG0A 1HI6B 1GZHC 1W8NA 3QEQB 1IC1A 4AX3A 4AQEB 5FUOL 2OSWA 2X4UB 4FFYH 3VGDA 1RUAH 3N2JA 4W6YB 5K59F 1J8HB 1ZHKB 4K3GA 2DDQH 4XOAA 5GSVA 4NN6B 4R7VA 2BX5A 1C5BH 1JSYA 4U6HA 3N6YA 5I1LA 3HBZA 4BFIA 5DHDA 2PCPB 2YBRB 4YBLB 3FN9A 1CDBA 4R26H 4XXCC 4E0RB 4XMKL 4Y4FD 1DVTA 2MOGA 2ZXBA 3FTVA 4L8DB 1CFSB 4LHUD 5D1ZA 5EBLA 5F3BB 1IBGL 3OD3A 4HWBL 1PMYA 1WAAE 3U4BL 3U4KA 2MPVA 1S7XA 2Z31D 3EFDL 4I89A 3D39A 4P2QD 3PS6A 4Y5VA 1BHGA 5L88H 2X6BA 4Q9BA 3CN0A 3TA4D 5BV7H 4C56A 4W1TA 1A7BA 5KYXB 3NG5A 1J9CT 1LMIA 1C9SA 5DC9B 3FT3B 3C12A 5DRXB 3SJVE 2VMJA 3QFGA 3WKNA 1OGSA 2XY1A 2XN9E 4RGOH 3L7FA 4V11A 4XWOD 3MBWB 1CL7I 1G9NH 2R0KL 3QNFA 3MLUH 1TLKA 2KLSA 2NY6B 4YHPA 5K39B 3UBXB 4G82A 1XEUA 1GKEA 1CTMA 1QSEA 2RD0A 2EDLA 1WA0X 2D9QB 3QW9A 4M7JL 3S4SG 2UVEA 1AP2B 4MMZA 2AMGA 3WFCL 1FO0L 1OTSD 2FB4L 1MJ7H 3WJLC 4CVZB 4XR8C 1WGOA 2VR5A 4RSYA 4R2GC 2R69L 1AXSA 1E2VA 4HMCA 3UTOA 4TVSa 5DZ9A 3UO8B 1EHNA 3GKWL 5FYKU 2V6HA 2WAHA 1GHFH 1WWWX 2FQGA 2J5LB 2CO7A 2PWFA 3QIWD 4UTBL 3ILEA 3FQWA 5C6PB 4C4KO 2VLLA 2VC2L 2YOAA 3X14A 3MZTA 4G6KH 1ILUA 4UM9D 4UTAH 1F1GA 2OMUA 3OB0H 5CCKH 4L0PB 2X2YA 5IHUH 3P73B 3NN8A 4GO6B 2BNUA 5JW4Q 2Y7LA 1ZXKA 3EIFA 3FPYA 2CIIB 2FO8A 4CMHB 4GW5A 2OXGB 1ZSDB 2NSQA 2CM6A 2EH7H 4X7SL 3RVVD 4EVNA 5KJRH 5C0ND 4KGJA 3WEMA 3ZKQD 5EIIA 3IDGB 4XMPH 1FO0B 1N9PA 3BDXA 3KM1A 4GFXA 5IHZA 2JJSA 2IQAA 1PX8A 5A1AA 3BAIA 4OCSH 4G6AC 1EXUB 3BN9C 3BOVA 4N0CD 3IYLW 4WW2A 3RVVC 3WSQH 3IVKB 2BP8B 5FGSA 3PQYE 1CWVA 3W0WA 3HS0A 4LGRB 3A23A 1SMOA 1E9PA 4YSAA 1G7IB 3KWWB 3MOAH 3FB6A 5AW9B 5B4MD 1A8ZA 1LNUA 3C09C 1HX0A 1ZWIB 1V7MH 2W0FA 3SBWC 5FA3B 1HL5A 3HC0B 3L3IA 4P99A 3B9VA 5DVLA 4P2CG 4QR7A 3LKNA 2ADJB 2PCFA 2XWBA 3PJNA 3LSOB 4RFEB 3UTTE 2TAAA 4RX4A 4HJJH 2C4FT 4PGZA 3GSNL 2E4TA 3TVMD 2CK2A 3RIAK 1ZGLM 4G8GB 1F2QA 3LDBC 4AL8L 4CNIB 3FC8A 4WHTA 3RGVC 4N1EA 3LEYL 2IALA 4G8EA 2QPFA 2RQEA 1T2QL 1KFAL 3PYCA 1PL3A 2UY7A 4HEME 5ETUA 1EJ8A 2X2JA 1WCBA 4NKIH 2DBLH 2ITCA 1CK0H 4MZ2A 3ROOA 4J6IA 3UJTH 2W0FB 3K2KA 1FN4B 1YMME 4M5YL 1CFQA 2XN9D 3ASOB 4YHNA 4V2CB 5IOPA 2XKUA 3DBSA 4B0MM 3W9EB 4P2OD 2ZUUA 4LVOC 3BQUB 4X5XA 4OKVA 4HXAH 1KJ2A 1MJJB 5F97E 2NMSA 1XF3B 5TF0A 3QZOA 3LY6A 4BKLA 3T6WA 3GSNB 3L3GB 5KYYA 5EN2A 4LSSL 4RAUB 2WQAA 4PI2A 1LK2A 1LMKA 1ES0B 3SYCA 5HHME 4JHUA 4MXWH 3UAEA 2WYTA 5HHPB 2VRQA 1ESOA 3P4NA 4QRTA 2WXNA 5KN5B 2B08A 3IJEA 1KC5H 4DKFH 4M1DH 2YGVA 4MNGB 2VXQH 1CYGA 1QR4A 5BZZA 1U8OA 1I9RH 4BV1A 2D3LA 4FQHB 5DJ8A 5FYLH 1ZHLB 5F7EL 3SJVD 2YK1H 4KKRA 3WS6A 5IB5A 1DTUA 1W72L 5BS0A 5I1HH 2B5IB 2D3VA 3ZHNA 4YIQB 4PJHE 3KLSA 4I18B 2ID5A 3VXMD 4Z23A 1A3LL 2MCG1 4WWNA 3IKCB 4E9YA 1JK8B