1WVBA

Crystal structure of human arginase i: the mutant e256q
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
309
structure length
309
Chain Sequence
SRTIGIIGAPFSKGQPRGGVEEGPTVLRKAGLLEKLKEQECDVKDYGDLPFADIPNDSPFQIVKNPRSVGKASEQLAGKVAEVKKNGRISLVLGGDHSLAIGSISGHARVHPDLGVIWVDAHTDINTPLTTTSGNLHGQPVSFLLKELKGKIPDVPGFSWVTPCISAKDIVYIGLRDVDPGEHYILKTLGIKYFSMTEVDRLGIGKVMEETLSYLLGRKKRPIHLSFDVDGLDPSFTPATGTPVVGGLTYRQGLYITEEIYKTGLLSGLDIMEVNPSLGKTPEEVTRTVNTAVAITLACFGLAREGNHK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Arginase 1
publication title Crystal structure of human arginase I: the mutant E256Q
rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 102
structure length 309
sequence length 309
chains with identical sequence B
ec nomenclature ec 3.5.3.1: Arginase.
pdb deposition date 2004-12-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00491 Arginase Arginase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.800.10 Alpha Beta 3-Layer(aba) Sandwich Arginase; Chain A Ureohydrolase domain 1wvbA00
1T4SA 4CEVA 4GSZA 3THHA 4HXQA 1WOIA 4ITYA 1WVBA 1T4TA 4RHKA 4DZ4A 1P8MA 1GQ7A 4IU5A 1GQ6A 1T4RA 4IE3A 1WVAA 4IU4A 2PHAA 4GSMA 4Q3RC 4Q3VA 4RHIA 1HQ5A 5HJ9A 3MFVA 1HQHA 3MMRA 1TA1A 4Q3PA 1WOHA 1PQ3A 4Q41A 1HQXA 2EF5A 1CEVA 3E9BA 4IU1A 4RHJA 1HQFA 1P8SA 1ZPEA 4RHLA 4IXVA 4IXUA 1ZPGA 3SJTA 4IE1A 3THJA 5RLAA 3LP7A 4MYLA 3TH7A 3NIQA 1TBHA 1P8PA 1P8QA 3E6KA 4RLAA 5HJAA 3CEVA 3SKKA 4HZEA 4MYNA 3E8QA 4GWDA 5CEVA 1P8OA 4Q3TA 4Q40A 4IU0A 4GSVA 2RLAA 3NIPA 3THEA 4IE2A 3F80A 4I06A 4FCKA 2EIVA 3TF3A 3E6VA 3PZLA 1D3VA 4MYKA 2AEBA 3KV2A 4RHMA 2CEVA 1T5GA 4FCIA 3LP4A 2PHOA 3LHLA 3MJLA 4Q42A 1T5FA 2PLLA 4Q3RA 3NIOA 1P8NA 3DJ8A 1TBJA 2EF4A 3GN0A 2A0MA 1RLAA 4RHQA 4MXRA 3M1RA 1WOGA 3SL1A 1TBLA 4GWCA 1R1OA 1HQGA 1P8RA 3E8ZA 1T4PA 3MFWA 3RLAA 2ZAVA 4Q3QA 4G3HA 3GMZA 1XFKA 4MYFA 4Q3UA 4HWWA 3SL0A 4Q3SA
chains in the Genus database with same CATH superfamily
1ZZ3A 1T4SA 5EEIA 4BZ5A 4CEVA 4GSZA 2GH6A 3THHA 5G1AA 4HXQA 5EENA 2VQWG 1WOIA 4ITYA 1WVBA 1T4TA 4RHKA 5ICNB 4DZ4A 3ZNSA 1ZZ0A 1P8MA 1GQ7A 4IU5A 4ZURA 1GQ6A 4BZ6A 4LY1A 3MZ7A 1T4RA 5G12A 4IE3A 4ZUPA 1WVAA 3EWFA 4IU4A 2PHAA 4GSMA 5FUEA 4Q3RC 5G1CA 5G0XA 4Q3VA 4RHIA 2VCGA 5THSA 2V5WA 4QA5A 5THUA 5EFHA 5EEFA 3RQDA 5D1CA 3MAXA 3F07A 1HQ5A 4BZ9A 5HJ9A 5BWZA 1HQHA 3MFVA 3MMRA 1TA1A 3C10A 5DC7A 5G0JA 3Q9EA 1WOHA 1PQ3A 4Q3PA 5EFNA 4Q41A 1HQXA 5EF7A 2EF5A 3EZPA 5DC5A 5EFJD 3Q9BA 4CBYA 1CEVA 3E9BA 2VQJA 4ZUNA 4IU1A 4QA3A 4Q3SA 4RHJA 5FCWA 4LXZA 1HQFA 4A69A 1T64A 1P8SA 1ZPEA 4RHLA 4IXVA 4IXUA 2VQMA 1ZPGA 5G0GA 4QA0A 4IE1A 3SJTA 3THJA 1T67A 4CBTA 4RN2A 4CQFA 5RLAA 3LP7A 4MYLA 3TH7A 3NIQA 1TBHA 1P8PA 1P8QA 3E6KA 4RN1A 4RLAA 5G0IA 3SFFA 5JI5A 5HJAA 3CEVA 3F06A 4QA7A 1VKGA 3EW8A 5THVA 3SKKA 4HZEA 4MYNA 3E8QA 4GWDA 5A2SA 5DC8A 5CEVA 1P8OA 4Q3TA 4Q40A 2VQVA 4IU0A 4GSVA 2RLAA 4QA2A 3NIPA 5DC6A 2VQOA 5EEKA 4ZUOA 3THEA 3MZ6A 5G13A 1C3RA 4IE2A 3F80A 4I06A 4FCKA 4ZUMA 2EIVA 2VQQA 3TF3A 5G3WA 3E6VA 3PZLA 4QA6A 3SFHA 5G10A 1D3VA 4MYKA 2AEBA 3Q9FA 3KV2A 4RHMA 2CEVA 5D1DA 5EFKB 5EEMA 1T5GA 4FCIA 3LP4A 4BZ8A 4BZ7A 3C0ZA 2PHOA 3EZTA 3ZNRA 3LHLA 5LI3A 3MJLA 4Q42A 4RN0A 3C0YA 1T5FA 5IX0A 2PLLA 5G0HA 4Q3RA 3MZ3A 3NIOA 5G1BA 1P8NA 3DJ8A 4QA1A 5EF8A 1TBJA 1W22A 3MENA 2EF4A 3GN0A 1C3SA 2A0MA 5IWGA 1RLAA 5G11A 4RHQA 5G0YA 2V5XA 3M1RA 1WOGA 1C3PA 4MXRA 4ZUQA 3SL1A 1TBLA 4GWCA 4QA4A 4BKXB 1R1OA 1ZZ1A 1HQGA 1P8RA 3E8ZA 1T4PA 3MFWA 3RLAA 2ZAVA 1T69A 5G17A 3MZ4A 4Q3QA 4G3HA 5EFGA 3GMZA 1XFKA 4MYFA 4Q3UA 5EFBD 4HWWA 3SL0A 3F0RA 5D1BA 5THTA 3Q9CA
chains in the Genus database with same CATH topology
1T4SA 4CEVA 4GSZA 3THHA 4HXQA 1WOIA 4ITYA 1WVBA 1T4TA 4RHKA 4DZ4A 1P8MA 1GQ7A 4IU5A 1GQ6A 1T4RA 4IE3A 1WVAA 4IU4A 2PHAA 4GSMA 4Q3RC 4Q3VA 4RHIA 1HQ5A 5HJ9A 3MFVA 1HQHA 3MMRA 1TA1A 4Q3PA 1WOHA 1PQ3A 4Q41A 1HQXA 2EF5A 1CEVA 3E9BA 4IU1A 4RHJA 1HQFA 1P8SA 1ZPEA 4RHLA 4IXVA 4IXUA 1ZPGA 3SJTA 4IE1A 3THJA 5RLAA 3LP7A 4MYLA 3TH7A 3NIQA 1TBHA 1P8PA 1P8QA 3E6KA 4RLAA 5HJAA 3CEVA 3SKKA 4HZEA 4MYNA 3E8QA 4GWDA 5CEVA 1P8OA 4Q3TA 4Q40A 4IU0A 4GSVA 2RLAA 3NIPA 3THEA 4IE2A 3F80A 4I06A 4FCKA 2EIVA 3TF3A 3E6VA 3PZLA 1D3VA 4MYKA 2AEBA 3KV2A 4RHMA 2CEVA 1T5GA 4FCIA 3LP4A 2PHOA 3LHLA 3MJLA 4Q42A 1T5FA 2PLLA 4Q3RA 3NIOA 1P8NA 3DJ8A 1TBJA 2EF4A 3GN0A 2A0MA 1RLAA 4RHQA 4MXRA 3M1RA 1WOGA 3SL1A 1TBLA 4GWCA 1R1OA 1HQGA 1P8RA 3E8ZA 1T4PA 3MFWA 3RLAA 2ZAVA 4Q3QA 4G3HA 3GMZA 1XFKA 4MYFA 4Q3UA 4HWWA 3SL0A 4Q3SA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1T4S A;  4CEV A;  4GSZ A;  3THH A;  4HXQ A;  1WOI A;  4ITY A;  1WVB A;  1T4T A;  4RHK A;  4DZ4 A;  1P8M A;  1GQ7 A;  4IU5 A;  1GQ6 A;  1T4R A;  4IE3 A;  1WVA A;  4IU4 A;  2PHA A;  4GSM A;  4Q3R C;  4Q3V A;  4RHI A;  1HQ5 A;  5HJ9 A;  3MFV A;  1HQH A;  3MMR A;  1TA1 A;  4Q3P A;  1WOH A;  1PQ3 A;  4Q41 A;  1HQX A;  2EF5 A;  1CEV A;  3E9B A;  4IU1 A;  4RHJ A;  1HQF A;  1P8S A;  1ZPE A;  4RHL A;  4IXV A;  4IXU A;  1ZPG A;  3SJT A;  4IE1 A;  3THJ A;  5RLA A;  3LP7 A;  4MYL A;  3TH7 A;  3NIQ A;  1TBH A;  1P8P A;  1P8Q A;  3E6K A;  4RLA A;  5HJA A;  3CEV A;  3SKK A;  4HZE A;  4MYN A;  3E8Q A;  4GWD A;  5CEV A;  1P8O A;  4Q3T A;  4Q40 A;  4IU0 A;  4GSV A;  2RLA A;  3NIP A;  3THE A;  4IE2 A;  3F80 A;  4I06 A;  4FCK A;  2EIV A;  3TF3 A;  3E6V A;  3PZL A;  1D3V A;  4MYK A;  2AEB A;  3KV2 A;  4RHM A;  2CEV A;  1T5G A;  4FCI A;  3LP4 A;  2PHO A;  3LHL A;  3MJL A;  4Q42 A;  1T5F A;  2PLL A;  4Q3R A;  3NIO A;  1P8N A;  3DJ8 A;  1TBJ A;  2EF4 A;  3GN0 A;  2A0M A;  1RLA A;  4RHQ A;  4MXR A;  3M1R A;  1WOG A;  3SL1 A;  1TBL A;  4GWC A;  1R1O A;  1HQG A;  1P8R A;  3E8Z A;  1T4P A;  3MFW A;  3RLA A;  2ZAV A;  4Q3Q A;  4G3H A;  3GMZ A;  1XFK A;  4MYF A;  4Q3U A;  4HWW A;  3SL0 A;  4Q3S A; 
#chains in the Genus database with same CATH topology
 1ZZ3 A;  1T4S A;  5EEI A;  4BZ5 A;  4CEV A;  4GSZ A;  2GH6 A;  3THH A;  5G1A A;  4HXQ A;  5EEN A;  2VQW G;  1WOI A;  4ITY A;  1WVB A;  1T4T A;  4RHK A;  5ICN B;  4DZ4 A;  3ZNS A;  1ZZ0 A;  1P8M A;  1GQ7 A;  4IU5 A;  4ZUR A;  1GQ6 A;  4BZ6 A;  4LY1 A;  3MZ7 A;  1T4R A;  5G12 A;  4IE3 A;  4ZUP A;  1WVA A;  3EWF A;  4IU4 A;  2PHA A;  4GSM A;  5FUE A;  4Q3R C;  5G1C A;  5G0X A;  4Q3V A;  4RHI A;  2VCG A;  5THS A;  2V5W A;  4QA5 A;  5THU A;  5EFH A;  5EEF A;  3RQD A;  5D1C A;  3MAX A;  3F07 A;  1HQ5 A;  4BZ9 A;  5HJ9 A;  5BWZ A;  1HQH A;  3MFV A;  3MMR A;  1TA1 A;  3C10 A;  5DC7 A;  5G0J A;  3Q9E A;  1WOH A;  1PQ3 A;  4Q3P A;  5EFN A;  4Q41 A;  1HQX A;  5EF7 A;  2EF5 A;  3EZP A;  5DC5 A;  5EFJ D;  3Q9B A;  4CBY A;  1CEV A;  3E9B A;  2VQJ A;  4ZUN A;  4IU1 A;  4QA3 A;  4Q3S A;  4RHJ A;  5FCW A;  4LXZ A;  1HQF A;  4A69 A;  1T64 A;  1P8S A;  1ZPE A;  4RHL A;  4IXV A;  4IXU A;  2VQM A;  1ZPG A;  5G0G A;  4QA0 A;  4IE1 A;  3SJT A;  3THJ A;  1T67 A;  4CBT A;  4RN2 A;  4CQF A;  5RLA A;  3LP7 A;  4MYL A;  3TH7 A;  3NIQ A;  1TBH A;  1P8P A;  1P8Q A;  3E6K A;  4RN1 A;  4RLA A;  5G0I A;  3SFF A;  5JI5 A;  5HJA A;  3CEV A;  3F06 A;  4QA7 A;  1VKG A;  3EW8 A;  5THV A;  3SKK A;  4HZE A;  4MYN A;  3E8Q A;  4GWD A;  5A2S A;  5DC8 A;  5CEV A;  1P8O A;  4Q3T A;  4Q40 A;  2VQV A;  4IU0 A;  4GSV A;  2RLA A;  4QA2 A;  3NIP A;  5DC6 A;  2VQO A;  5EEK A;  4ZUO A;  3THE A;  3MZ6 A;  5G13 A;  1C3R A;  4IE2 A;  3F80 A;  4I06 A;  4FCK A;  4ZUM A;  2EIV A;  2VQQ A;  3TF3 A;  5G3W A;  3E6V A;  3PZL A;  4QA6 A;  3SFH A;  5G10 A;  1D3V A;  4MYK A;  2AEB A;  3Q9F A;  3KV2 A;  4RHM A;  2CEV A;  5D1D A;  5EFK B;  5EEM A;  1T5G A;  4FCI A;  3LP4 A;  4BZ8 A;  4BZ7 A;  3C0Z A;  2PHO A;  3EZT A;  3ZNR A;  3LHL A;  5LI3 A;  3MJL A;  4Q42 A;  4RN0 A;  3C0Y A;  1T5F A;  5IX0 A;  2PLL A;  5G0H A;  4Q3R A;  3MZ3 A;  3NIO A;  5G1B A;  1P8N A;  3DJ8 A;  4QA1 A;  5EF8 A;  1TBJ A;  1W22 A;  3MEN A;  2EF4 A;  3GN0 A;  1C3S A;  2A0M A;  5IWG A;  1RLA A;  5G11 A;  4RHQ A;  5G0Y A;  2V5X A;  3M1R A;  1WOG A;  1C3P A;  4MXR A;  4ZUQ A;  3SL1 A;  1TBL A;  4GWC A;  4QA4 A;  4BKX B;  1R1O A;  1ZZ1 A;  1HQG A;  1P8R A;  3E8Z A;  1T4P A;  3MFW A;  3RLA A;  2ZAV A;  1T69 A;  5G17 A;  3MZ4 A;  4Q3Q A;  4G3H A;  5EFG A;  3GMZ A;  1XFK A;  4MYF A;  4Q3U A;  5EFB D;  4HWW A;  3SL0 A;  3F0R A;  5D1B A;  5THT A;  3Q9C A; 
#chains in the Genus database with same CATH homology
 1T4S A;  4CEV A;  4GSZ A;  3THH A;  4HXQ A;  1WOI A;  4ITY A;  1WVB A;  1T4T A;  4RHK A;  4DZ4 A;  1P8M A;  1GQ7 A;  4IU5 A;  1GQ6 A;  1T4R A;  4IE3 A;  1WVA A;  4IU4 A;  2PHA A;  4GSM A;  4Q3R C;  4Q3V A;  4RHI A;  1HQ5 A;  5HJ9 A;  3MFV A;  1HQH A;  3MMR A;  1TA1 A;  4Q3P A;  1WOH A;  1PQ3 A;  4Q41 A;  1HQX A;  2EF5 A;  1CEV A;  3E9B A;  4IU1 A;  4RHJ A;  1HQF A;  1P8S A;  1ZPE A;  4RHL A;  4IXV A;  4IXU A;  1ZPG A;  3SJT A;  4IE1 A;  3THJ A;  5RLA A;  3LP7 A;  4MYL A;  3TH7 A;  3NIQ A;  1TBH A;  1P8P A;  1P8Q A;  3E6K A;  4RLA A;  5HJA A;  3CEV A;  3SKK A;  4HZE A;  4MYN A;  3E8Q A;  4GWD A;  5CEV A;  1P8O A;  4Q3T A;  4Q40 A;  4IU0 A;  4GSV A;  2RLA A;  3NIP A;  3THE A;  4IE2 A;  3F80 A;  4I06 A;  4FCK A;  2EIV A;  3TF3 A;  3E6V A;  3PZL A;  1D3V A;  4MYK A;  2AEB A;  3KV2 A;  4RHM A;  2CEV A;  1T5G A;  4FCI A;  3LP4 A;  2PHO A;  3LHL A;  3MJL A;  4Q42 A;  1T5F A;  2PLL A;  4Q3R A;  3NIO A;  1P8N A;  3DJ8 A;  1TBJ A;  2EF4 A;  3GN0 A;  2A0M A;  1RLA A;  4RHQ A;  4MXR A;  3M1R A;  1WOG A;  3SL1 A;  1TBL A;  4GWC A;  1R1O A;  1HQG A;  1P8R A;  3E8Z A;  1T4P A;  3MFW A;  3RLA A;  2ZAV A;  4Q3Q A;  4G3H A;  3GMZ A;  1XFK A;  4MYF A;  4Q3U A;  4HWW A;  3SL0 A;  4Q3S A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...