1WVNA

Crystal structure of domain 3 of human alpha polyc binding protein
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
74
structure length
74
Chain Sequence
b'PLGSQTTHELTIPNNLIGCIIGRQGANINEIRQMSGAQIKIANPVEGSSGRQVTITGSAASISLAQYLINARLS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Poly(rC)-binding protein 1
molecule tags Rna binding protein
source organism Homo sapiens
publication title Structure and RNA binding of the third KH domain of poly(C)-binding protein 1.
pubmed doi rcsb
total genus 22
structure length 74
sequence length 74
ec nomenclature
pdb deposition date 2004-12-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00013 KH_1 KH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1370.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S8; Chain: A, domain 1 K Homology domain, type 1 1wvnA00
5JEAG 2CTJA 1K1GA 4B8TA 4BA2I 4OO1G 2E3UA 1WE8A 2BL5A 1X4MA 2HH2A 3U1KA 2JA9A 2JE6I 1ZZJA 2PY9A 4BA1I 1J5KA 1ZZKA 2ANNA 2FMRA 2PQUA 1KHMA 1TUAA 1VIGA 2CPQA 2CTFA 3L7ZC 4AIMA 4QMFB 2JEBI 4WANA 1DTJA 2BA0A 2MJHA 4AM3A 2CTMA 2JVZA 1ZTGA 3AEVB 4JVHA 2YQRA 4JVYA 2CTLA 2OPVA 5C0XG 5K36G 2CTKA 2ANRA 1J4WA 2P2RA 1EC6A 2OPUA 2AXYA 2Z0SA 3V69A 2CTEA 2HH3A 4WALA 2JEAI 1ZZIA 1VIHA 2JZXA 1WVNA 2QNDA 4IFDG 1X4NA 1DT4A 2NN6G 4NBQA 3VKEA 2DGRA 4LIJA
chains in the Genus database with same CATH superfamily
3EZJA 1UG8A 2CPMA 5IWAH 3J7AK 3QD7X 2E3UA 4JV5H 2JA9A 1ZZJA 1V9NA 4BA1I 4LF9H 2O4CA 4YY3H 4LF5H 1FKAH 1F0XA 2LTMA 4G08A 4AIMA 2UUAH 4WANA 2BA0A 4GKKH 4DV3H 4DV6H 2E5LH 4JVHA 1IBKH 4JI0H 2D9IA 2OPVA 4DR5H 4OCHA 4DV0H 4B8CD 5BR8H 2P2RA 4LF7H 1VBIA 4JI2H 1J4WA 4JI4H 2AXYA 3OTOH 2CTEA 5LMNH 4DV2H 2Y3MA 1Z2IA 4AQYH 2LF0A 1ZZIA 1VIHA 4B3MH 2M6QA 1IBMH 4KHPH 2CWFA 2G8YA 1I6UA 2JZXA 1N36H 2LRRA 3GABA 2ZM6H 5JEAG 1K1GA 5A2QW 3SB1A 4JI8H 2BL5A 2PY9A 2JE6I 1J5KA 4DR2H 2CWHA 4PDBA 2ANNA 1KHMA 2CTFA 1NXUA 4LFAH 2JEBI 2VQEH 1WHRA 1DTJA 5FLXW 4X62H 4AM3A 2CTMA 4JI1H 4LF8H 1N32H 4JVYA 5C0XG 2K1HA 1S20A 2ANRA 1EC6A 4FJUA 3V69A 4DR3H 3UOEA 4DR4H 4WALA 4LFBH 2JEAI 5LL6b 1J5EH 1IBLH 2QNDA 2LTLA 4X66H 1X0AA 4DUZH 1S03G 4DR6H 4DV5H 4B3RH 4NZTM 1I94H 1X9ZA 2DGRA 4X64H 3J81W 1N34H 4LF4H 3T1YH 2CTJA 1XRHA 4B8TA 4BA2I 1XNRH 4JI5H 4B3SH 4FJSA 4OX9H 2FMRA 1PQXA 3L7ZC 2HHHH 4QMFB 3KDKA 4H8AA 1HNZH 3T1HH 2UXBH 4LF6H 3AEVB 1ZTGA 3KDGA 2UXDH 1MSZA 2YQRA 4JYAH 2UUBH 4JI6H 2F4VH 2CTKA 4DV4H 4JI7H 4NXNH 2OPUA 2Z0SA 4OD6A 4NXMH 4K0KH 1SEIA 1ODHA 4IFDG 4DUYH 1DT4A 2NN6G 2FPHX 1XMQH 1N33H 4LIJA 2UU9H 1HNXH 4YHHH 4E9JA 5DT9A 4JI3H 4GKJH 4OO1G 3U1KA 1WE8A 2HH2A 1X4MA 2PT7G 1V8CA 1ZZKA 2X06A 1FJGH 2VKCA 2PQUA 1TUAA 1VIGA 2CPQA 4X65H 3OSSD 4DV1H 1WTJA 1XMOH 2MJHA 4DR1H 2M8WA 2JVZA 2A1SA 3I0PA 3OETA 4DV7H 2CTLA 1HR0H 2VQFH 3GKUA 3FAUA 3NCVA 2ZQEA 5K36G 3JAMW 2FFMA 1XNQH 4LFCH 5LMUH 4DR7H 4NZRM 4EC5A 2HH3A 3J80W 2UXCH 2UUCH 1AN7A 3RF2A 4B3TH 1WVNA 1X4NA 1HNWH 4NBQA 5IT9W 3GR5A 3VKEA
chains in the Genus database with same CATH topology
5JEAG 2CTJA 1K1GA 4B8TA 4BA2I 4OO1G 2E3UA 1WE8A 2BL5A 1X4MA 2HH2A 3U1KA 2JA9A 2JE6I 1ZZJA 2PY9A 4BA1I 1J5KA 1ZZKA 2ANNA 2FMRA 2PQUA 1KHMA 1TUAA 1VIGA 2CPQA 2CTFA 3L7ZC 4AIMA 4QMFB 2JEBI 4WANA 1DTJA 2BA0A 2MJHA 4AM3A 2CTMA 2JVZA 1ZTGA 3AEVB 4JVHA 2YQRA 4JVYA 2CTLA 2OPVA 5C0XG 5K36G 2CTKA 2ANRA 1J4WA 2P2RA 1EC6A 2OPUA 2AXYA 2Z0SA 3V69A 2CTEA 2HH3A 4WALA 2JEAI 1ZZIA 1VIHA 2JZXA 1WVNA 2QNDA 4IFDG 1X4NA 1DT4A 2NN6G 4NBQA 3VKEA 2DGRA 4LIJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5JEA G;  2CTJ A;  1K1G A;  4B8T A;  4BA2 I;  4OO1 G;  2E3U A;  1WE8 A;  2BL5 A;  1X4M A;  2HH2 A;  3U1K A;  2JA9 A;  2JE6 I;  1ZZJ A;  2PY9 A;  4BA1 I;  1J5K A;  1ZZK A;  2ANN A;  2FMR A;  2PQU A;  1KHM A;  1TUA A;  1VIG A;  2CPQ A;  2CTF A;  3L7Z C;  4AIM A;  4QMF B;  2JEB I;  4WAN A;  1DTJ A;  2BA0 A;  2MJH A;  4AM3 A;  2CTM A;  2JVZ A;  1ZTG A;  3AEV B;  4JVH A;  2YQR A;  4JVY A;  2CTL A;  2OPV A;  5C0X G;  5K36 G;  2CTK A;  2ANR A;  1J4W A;  2P2R A;  1EC6 A;  2OPU A;  2AXY A;  2Z0S A;  3V69 A;  2CTE A;  2HH3 A;  4WAL A;  2JEA I;  1ZZI A;  1VIH A;  2JZX A;  1WVN A;  2QND A;  4IFD G;  1X4N A;  1DT4 A;  2NN6 G;  4NBQ A;  3VKE A;  2DGR A;  4LIJ A; 
#chains in the Genus database with same CATH topology
 3EZJ A;  1UG8 A;  2CPM A;  5IWA H;  3J7A K;  3QD7 X;  2E3U A;  4JV5 H;  2JA9 A;  1ZZJ A;  1V9N A;  4BA1 I;  4LF9 H;  2O4C A;  4YY3 H;  4LF5 H;  1FKA H;  1F0X A;  2LTM A;  4G08 A;  4AIM A;  2UUA H;  4WAN A;  2BA0 A;  4GKK H;  4DV3 H;  4DV6 H;  2E5L H;  4JVH A;  1IBK H;  4JI0 H;  2D9I A;  2OPV A;  4DR5 H;  4OCH A;  4DV0 H;  4B8C D;  5BR8 H;  2P2R A;  4LF7 H;  1VBI A;  4JI2 H;  1J4W A;  4JI4 H;  2AXY A;  3OTO H;  2CTE A;  5LMN H;  4DV2 H;  2Y3M A;  1Z2I A;  4AQY H;  2LF0 A;  1ZZI A;  1VIH A;  4B3M H;  2M6Q A;  1IBM H;  4KHP H;  2CWF A;  2G8Y A;  1I6U A;  2JZX A;  1N36 H;  2LRR A;  3GAB A;  2ZM6 H;  5JEA G;  1K1G A;  5A2Q W;  3SB1 A;  4JI8 H;  2BL5 A;  2PY9 A;  2JE6 I;  1J5K A;  4DR2 H;  2CWH A;  4PDB A;  2ANN A;  1KHM A;  2CTF A;  1NXU A;  4LFA H;  2JEB I;  2VQE H;  1WHR A;  1DTJ A;  5FLX W;  4X62 H;  4AM3 A;  2CTM A;  4JI1 H;  4LF8 H;  1N32 H;  4JVY A;  5C0X G;  2K1H A;  1S20 A;  2ANR A;  1EC6 A;  4FJU A;  3V69 A;  4DR3 H;  3UOE A;  4DR4 H;  4WAL A;  4LFB H;  2JEA I;  5LL6 b;  1J5E H;  1IBL H;  2QND A;  2LTL A;  4X66 H;  1X0A A;  4DUZ H;  1S03 G;  4DR6 H;  4DV5 H;  4B3R H;  4NZT M;  1I94 H;  1X9Z A;  2DGR A;  4X64 H;  3J81 W;  1N34 H;  4LF4 H;  3T1Y H;  2CTJ A;  1XRH A;  4B8T A;  4BA2 I;  1XNR H;  4JI5 H;  4B3S H;  4FJS A;  4OX9 H;  2FMR A;  1PQX A;  3L7Z C;  2HHH H;  4QMF B;  3KDK A;  4H8A A;  1HNZ H;  3T1H H;  2UXB H;  4LF6 H;  3AEV B;  1ZTG A;  3KDG A;  2UXD H;  1MSZ A;  2YQR A;  4JYA H;  2UUB H;  4JI6 H;  2F4V H;  2CTK A;  4DV4 H;  4JI7 H;  4NXN H;  2OPU A;  2Z0S A;  4OD6 A;  4NXM H;  4K0K H;  1SEI A;  1ODH A;  4IFD G;  4DUY H;  1DT4 A;  2NN6 G;  2FPH X;  1XMQ H;  1N33 H;  4LIJ A;  2UU9 H;  1HNX H;  4YHH H;  4E9J A;  5DT9 A;  4JI3 H;  4GKJ H;  4OO1 G;  3U1K A;  1WE8 A;  2HH2 A;  1X4M A;  2PT7 G;  1V8C A;  1ZZK A;  2X06 A;  1FJG H;  2VKC A;  2PQU A;  1TUA A;  1VIG A;  2CPQ A;  4X65 H;  3OSS D;  4DV1 H;  1WTJ A;  1XMO H;  2MJH A;  4DR1 H;  2M8W A;  2JVZ A;  2A1S A;  3I0P A;  3OET A;  4DV7 H;  2CTL A;  1HR0 H;  2VQF H;  3GKU A;  3FAU A;  3NCV A;  2ZQE A;  5K36 G;  3JAM W;  2FFM A;  1XNQ H;  4LFC H;  5LMU H;  4DR7 H;  4NZR M;  4EC5 A;  2HH3 A;  3J80 W;  2UXC H;  2UUC H;  1AN7 A;  3RF2 A;  4B3T H;  1WVN A;  1X4N A;  1HNW H;  4NBQ A;  5IT9 W;  3GR5 A;  3VKE A; 
#chains in the Genus database with same CATH homology
 5JEA G;  2CTJ A;  1K1G A;  4B8T A;  4BA2 I;  4OO1 G;  2E3U A;  1WE8 A;  2BL5 A;  1X4M A;  2HH2 A;  3U1K A;  2JA9 A;  2JE6 I;  1ZZJ A;  2PY9 A;  4BA1 I;  1J5K A;  1ZZK A;  2ANN A;  2FMR A;  2PQU A;  1KHM A;  1TUA A;  1VIG A;  2CPQ A;  2CTF A;  3L7Z C;  4AIM A;  4QMF B;  2JEB I;  4WAN A;  1DTJ A;  2BA0 A;  2MJH A;  4AM3 A;  2CTM A;  2JVZ A;  1ZTG A;  3AEV B;  4JVH A;  2YQR A;  4JVY A;  2CTL A;  2OPV A;  5C0X G;  5K36 G;  2CTK A;  2ANR A;  1J4W A;  2P2R A;  1EC6 A;  2OPU A;  2AXY A;  2Z0S A;  3V69 A;  2CTE A;  2HH3 A;  4WAL A;  2JEA I;  1ZZI A;  1VIH A;  2JZX A;  1WVN A;  2QND A;  4IFD G;  1X4N A;  1DT4 A;  2NN6 G;  4NBQ A;  3VKE A;  2DGR A;  4LIJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...