1WVNA

Crystal structure of domain 3 of human alpha polyc binding protein
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
74
structure length
74
Chain Sequence
b'PLGSQTTHELTIPNNLIGCIIGRQGANINEIRQMSGAQIKIANPVEGSSGRQVTITGSAASISLAQYLINARLS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Poly(rC)-binding protein 1
publication title Structure and RNA binding of the third KH domain of poly(C)-binding protein 1.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Rna binding protein
total genus 22
structure length 74
sequence length 74
ec nomenclature
pdb deposition date 2004-12-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00013 KH_1 KH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1370.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S8; Chain: A, domain 1 K Homology domain, type 1 1wvnA00
2CTEA 2CTLA 2CTFA 1ZZIA 2AXYA 1DT4A 1TUAA 1WE8A 4WALA 1X4MA 2BL5A 3VKEA 4QMFB 2MJHA 3AEVB 2JEAI 4JVYA 2CTJA 2YQRA 4NBQA 2JEBI 2OPVA 1VIHA 2E3UA 2JZXA 2JA9A 5JEAG 4JVHA 2OPUA 4LIJA 1X4NA 1J5KA 4OO1G 1ZZKA 3U1KA 1WVNA 4BA2I 4BA1I 2P2RA 5K36G 2Z0SA 1KHMA 2FMRA 2HH2A 5C0XG 4AM3A 1DTJA 2JVZA 2ANNA 3V69A 4B8TA 4IFDG 1EC6A 2PY9A 1VIGA 2CTMA 2CPQA 2JE6I 2QNDA 2BA0A 1ZZJA 4WANA 1J4WA 1ZTGA 2ANRA 4AIMA 1K1GA 2CTKA 2NN6G 3L7ZC 2PQUA 2DGRA 2HH3A
chains in the Genus database with same CATH superfamily
2CTEA 2CTLA 1XNQH 2F4VH 4DV1H 4JI3H 1DT4A 4WALA 1WTJA 2LTMA 2BL5A 1WHRA 2MJHA 5LL6b 1NXUA 2LRRA 4B3RH 3GKUA 2Y3MA 2E5LH 1FKAH 1VIHA 2E3UA 2JZXA 4LFCH 4B3SH 4OD6A 4LIJA 1X4NA 4OO1G 1I94H 3J7AK 1WVNA 5LMUH 1N36H 4B3TH 1PQXA 5IWAH 4DV7H 1IBKH 2P2RA 2FMRA 3EZJA 4JI8H 2HH2A 5C0XG 4OX9H 2UXDH 1SEIA 2PQUA 4DV2H 4IFDG 4B8TA 3OTOH 4FJSA 4LFAH 2PY9A 1EC6A 1N32H 4G08A 1X0AA 2JE6I 2X06A 3RF2A 1XMOH 1ODHA 5DT9A 4FJUA 4AQYH 2D9IA 4H8AA 4EC5A 2LTLA 4AIMA 4DR3H 3T1HH 2NN6G 4JI5H 5BR8H 4LF6H 3GR5A 2HH3A 4NZRM 2CTFA 4DV3H 4YY3H 1N34H 2UU9H 4NXMH 4LF8H 1TUAA 1WE8A 2O4CA 1X4MA 1IBMH 3VKEA 2CTJA 2K1HA 4LF7H 2FPHX 3NCVA 4JI1H 1VBIA 4PDBA 4JI0H 2UXBH 2OPUA 2VKCA 3U1KA 3QD7X 5K36G 4DR7H 3J80W 3T1YH 4LFBH 1N33H 2UUCH 4DV5H 1S20A 4DR2H 4LF4H 4WANA 3KDKA 1J4WA 4DV4H 1J5EH 1K1GA 2UUBH 2CWFA 4KHPH 4QMFB 3AEVB 3FAUA 2M6QA 2CPMA 2JEAI 4JVYA 5A2QW 1I6UA 2ZM6H 4JI4H 3JAMW 2LF0A 2G8YA 4GKJH 2JA9A 4JVHA 4E9JA 1HNWH 4LF9H 1ZZKA 1V8CA 4BA1I 4BA2I 2UXCH 5IT9W 3J81W 1DTJA 2JVZA 4OCHA 3V69A 4X62H 4JV5H 1FJGH 1XRHA 2ZQEA 1HNZH 2QNDA 1ZZJA 5LMNH 1ZTGA 4JYAH 2UUAH 4B8CD 3UOEA 2PT7G 3L7ZC 4X65H 1XNRH 1F0XA 2HHHH 1ZZIA 1AN7A 2AXYA 3I0PA 4NXNH 4DV0H 4DR5H 4DR6H 1S03G 1UG8A 2YQRA 1HNXH 4NBQA 4LF5H 4JI7H 2JEBI 2OPVA 3OETA 4NZTM 5FLXW 1IBLH 4K0KH 2A1SA 3GABA 2FFMA 5JEAG 4B3MH 1J5KA 4GKKH 4YHHH 3KDGA 2M8WA 2Z0SA 1KHMA 1MSZA 1X9ZA 4X66H 4AM3A 4DR4H 4JI6H 2ANNA 3OSSD 4DUYH 1XMQH 1VIGA 2CTMA 4X64H 1V9NA 2CPQA 4DR1H 2BA0A 4DUZH 4DV6H 1HR0H 2VQEH 2VQFH 4JI2H 2ANRA 2CTKA 3SB1A 2CWHA 2DGRA 1Z2IA
chains in the Genus database with same CATH topology
2CTEA 2CTLA 2CTFA 1ZZIA 2AXYA 1DT4A 1TUAA 1WE8A 4WALA 1X4MA 2BL5A 3VKEA 4QMFB 2MJHA 3AEVB 2JEAI 4JVYA 2CTJA 2YQRA 4NBQA 2JEBI 2OPVA 1VIHA 2E3UA 2JZXA 2JA9A 5JEAG 4JVHA 2OPUA 4LIJA 1X4NA 1J5KA 4OO1G 1ZZKA 3U1KA 1WVNA 4BA2I 4BA1I 2P2RA 5K36G 2Z0SA 1KHMA 2FMRA 2HH2A 5C0XG 4AM3A 1DTJA 2JVZA 2ANNA 3V69A 4B8TA 4IFDG 1EC6A 2PY9A 1VIGA 2CTMA 2CPQA 2JE6I 2QNDA 2BA0A 1ZZJA 4WANA 1J4WA 1ZTGA 2ANRA 4AIMA 1K1GA 2CTKA 2NN6G 3L7ZC 2PQUA 2DGRA 2HH3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CTE A;  2CTL A;  2CTF A;  1ZZI A;  2AXY A;  1DT4 A;  1TUA A;  1WE8 A;  4WAL A;  1X4M A;  2BL5 A;  3VKE A;  4QMF B;  2MJH A;  3AEV B;  2JEA I;  4JVY A;  2CTJ A;  2YQR A;  4NBQ A;  2JEB I;  2OPV A;  1VIH A;  2E3U A;  2JZX A;  2JA9 A;  5JEA G;  4JVH A;  2OPU A;  4LIJ A;  1X4N A;  1J5K A;  4OO1 G;  1ZZK A;  3U1K A;  1WVN A;  4BA2 I;  4BA1 I;  2P2R A;  5K36 G;  2Z0S A;  1KHM A;  2FMR A;  2HH2 A;  5C0X G;  4AM3 A;  1DTJ A;  2JVZ A;  2ANN A;  3V69 A;  4B8T A;  4IFD G;  1EC6 A;  2PY9 A;  1VIG A;  2CTM A;  2CPQ A;  2JE6 I;  2QND A;  2BA0 A;  1ZZJ A;  4WAN A;  1J4W A;  1ZTG A;  2ANR A;  4AIM A;  1K1G A;  2CTK A;  2NN6 G;  3L7Z C;  2PQU A;  2DGR A;  2HH3 A; 
#chains in the Genus database with same CATH topology
 2CTE A;  2CTL A;  1XNQ H;  2F4V H;  4DV1 H;  4JI3 H;  1DT4 A;  4WAL A;  1WTJ A;  2LTM A;  2BL5 A;  1WHR A;  2MJH A;  5LL6 b;  1NXU A;  2LRR A;  4B3R H;  3GKU A;  2Y3M A;  2E5L H;  1FKA H;  1VIH A;  2E3U A;  2JZX A;  4LFC H;  4B3S H;  4OD6 A;  4LIJ A;  1X4N A;  4OO1 G;  1I94 H;  3J7A K;  1WVN A;  5LMU H;  1N36 H;  4B3T H;  1PQX A;  5IWA H;  4DV7 H;  1IBK H;  2P2R A;  2FMR A;  3EZJ A;  4JI8 H;  2HH2 A;  5C0X G;  4OX9 H;  2UXD H;  1SEI A;  2PQU A;  4DV2 H;  4IFD G;  4B8T A;  3OTO H;  4FJS A;  4LFA H;  2PY9 A;  1EC6 A;  1N32 H;  4G08 A;  1X0A A;  2JE6 I;  2X06 A;  3RF2 A;  1XMO H;  1ODH A;  5DT9 A;  4FJU A;  4AQY H;  2D9I A;  4H8A A;  4EC5 A;  2LTL A;  4AIM A;  4DR3 H;  3T1H H;  2NN6 G;  4JI5 H;  5BR8 H;  4LF6 H;  3GR5 A;  2HH3 A;  4NZR M;  2CTF A;  4DV3 H;  4YY3 H;  1N34 H;  2UU9 H;  4NXM H;  4LF8 H;  1TUA A;  1WE8 A;  2O4C A;  1X4M A;  1IBM H;  3VKE A;  2CTJ A;  2K1H A;  4LF7 H;  2FPH X;  3NCV A;  4JI1 H;  1VBI A;  4PDB A;  4JI0 H;  2UXB H;  2OPU A;  2VKC A;  3U1K A;  3QD7 X;  5K36 G;  4DR7 H;  3J80 W;  3T1Y H;  4LFB H;  1N33 H;  2UUC H;  4DV5 H;  1S20 A;  4DR2 H;  4LF4 H;  4WAN A;  3KDK A;  1J4W A;  4DV4 H;  1J5E H;  1K1G A;  2UUB H;  2CWF A;  4KHP H;  4QMF B;  3AEV B;  3FAU A;  2M6Q A;  2CPM A;  2JEA I;  4JVY A;  5A2Q W;  1I6U A;  2ZM6 H;  4JI4 H;  3JAM W;  2LF0 A;  2G8Y A;  4GKJ H;  2JA9 A;  4JVH A;  4E9J A;  1HNW H;  4LF9 H;  1ZZK A;  1V8C A;  4BA1 I;  4BA2 I;  2UXC H;  5IT9 W;  3J81 W;  1DTJ A;  2JVZ A;  4OCH A;  3V69 A;  4X62 H;  4JV5 H;  1FJG H;  1XRH A;  2ZQE A;  1HNZ H;  2QND A;  1ZZJ A;  5LMN H;  1ZTG A;  4JYA H;  2UUA H;  4B8C D;  3UOE A;  2PT7 G;  3L7Z C;  4X65 H;  1XNR H;  1F0X A;  2HHH H;  1ZZI A;  1AN7 A;  2AXY A;  3I0P A;  4NXN H;  4DV0 H;  4DR5 H;  4DR6 H;  1S03 G;  1UG8 A;  2YQR A;  1HNX H;  4NBQ A;  4LF5 H;  4JI7 H;  2JEB I;  2OPV A;  3OET A;  4NZT M;  5FLX W;  1IBL H;  4K0K H;  2A1S A;  3GAB A;  2FFM A;  5JEA G;  4B3M H;  1J5K A;  4GKK H;  4YHH H;  3KDG A;  2M8W A;  2Z0S A;  1KHM A;  1MSZ A;  1X9Z A;  4X66 H;  4AM3 A;  4DR4 H;  4JI6 H;  2ANN A;  3OSS D;  4DUY H;  1XMQ H;  1VIG A;  2CTM A;  4X64 H;  1V9N A;  2CPQ A;  4DR1 H;  2BA0 A;  4DUZ H;  4DV6 H;  1HR0 H;  2VQE H;  2VQF H;  4JI2 H;  2ANR A;  2CTK A;  3SB1 A;  2CWH A;  2DGR A;  1Z2I A; 
#chains in the Genus database with same CATH homology
 2CTE A;  2CTL A;  2CTF A;  1ZZI A;  2AXY A;  1DT4 A;  1TUA A;  1WE8 A;  4WAL A;  1X4M A;  2BL5 A;  3VKE A;  4QMF B;  2MJH A;  3AEV B;  2JEA I;  4JVY A;  2CTJ A;  2YQR A;  4NBQ A;  2JEB I;  2OPV A;  1VIH A;  2E3U A;  2JZX A;  2JA9 A;  5JEA G;  4JVH A;  2OPU A;  4LIJ A;  1X4N A;  1J5K A;  4OO1 G;  1ZZK A;  3U1K A;  1WVN A;  4BA2 I;  4BA1 I;  2P2R A;  5K36 G;  2Z0S A;  1KHM A;  2FMR A;  2HH2 A;  5C0X G;  4AM3 A;  1DTJ A;  2JVZ A;  2ANN A;  3V69 A;  4B8T A;  4IFD G;  1EC6 A;  2PY9 A;  1VIG A;  2CTM A;  2CPQ A;  2JE6 I;  2QND A;  2BA0 A;  1ZZJ A;  4WAN A;  1J4W A;  1ZTG A;  2ANR A;  4AIM A;  1K1G A;  2CTK A;  2NN6 G;  3L7Z C;  2PQU A;  2DGR A;  2HH3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...