1WVNA

Crystal structure of domain 3 of human alpha polyc binding protein
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
74
structure length
74
Chain Sequence
PLGSQTTHELTIPNNLIGCIIGRQGANINEIRQMSGAQIKIANPVEGSSGRQVTITGSAASISLAQYLINARLS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Poly(rC)-binding protein 1
publication title Structure and RNA binding of the third KH domain of poly(C)-binding protein 1.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Rna binding protein
total genus 22
structure length 74
sequence length 74
ec nomenclature
pdb deposition date 2004-12-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00013 KH_1 KH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1370.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S8; Chain: A, domain 1 K Homology domain, type 1 1wvnA00
2NN6G 2HH3A 3AEVB 2DGRA 2JZXA 1KHMA 1TUAA 1VIHA 4NBQA 2P2RA 4JVHA 2PY9A 5JEAG 1X4MA 2CTJA 2QNDA 2JE6I 4BA2I 1DT4A 1ZZJA 2CTKA 2PQUA 2ANNA 1ZZIA 4OO1G 4AIMA 5K36G 2Z0SA 2JEBI 3U1KA 2JEAI 2E3UA 2BA0A 4LIJA 1J5KA 1X4NA 1J4WA 2HH2A 2AXYA 4B8TA 1WE8A 4WALA 2CPQA 4WANA 3V69A 2CTLA 2OPVA 1WVNA 4QMFB 1EC6A 2JA9A 2FMRA 2JVZA 2ANRA 2BL5A 2CTEA 4JVYA 1VIGA 1ZZKA 3VKEA 1DTJA 4AM3A 2CTFA 2YQRA 1ZTGA 2MJHA 1K1GA 4IFDG 2CTMA 5C0XG 4BA1I 2OPUA 3L7ZC
chains in the Genus database with same CATH superfamily
2DGRA 1MSZA 4JI4H 1HR0H 2JZXA 1KHMA 1TUAA 5A2QW 5JEAG 1X4MA 2CTJA 4B3SH 1DT4A 1N32H 2CTKA 2PQUA 4OO1G 5K36G 3U1KA 4LIJA 2LTMA 1FJGH 1X4NA 1FKAH 2LRRA 4DUYH 3RF2A 1N34H 4WALA 4LF4H 1V9NA 3SB1A 4B3MH 1WVNA 1EC6A 4B3TH 2ANRA 2FPHX 1VIGA 4YY3H 2CTFA 5C0XG 2UXDH 2ZQEA 4X64H 1UG8A 4BA1I 1S03G 5IWAH 5LMNH 2NN6G 4DR2H 3KDGA 4DV7H 4DV3H 2JEAI 4JI2H 4NBQA 5FLXW 3UOEA 5LL6b 5LMUH 4DV5H 3T1YH 2P2RA 3OTOH 1AN7A 4LFCH 2M8WA 1ZZIA 4K0KH 4LF6H 4KHPH 2JEBI 2FFMA 3JAMW 3T1HH 4JI3H 2BA0A 3EZJA 4LF7H 1F0XA 4LFAH 1HNWH 4NXMH 4WANA 1IBLH 4LF5H 2CPQA 3V69A 2CTLA 4QMFB 4JI8H 2JVZA 4FJSA 4DV4H 2BL5A 2CTEA 2CWHA 3J80W 4G08A 5BR8H 1I6UA 4AM3A 1ZTGA 4DR5H 1K1GA 4DV0H 2UU9H 2UUBH 4IFDG 4EC5A 1N33H 2K1HA 3GR5A 1XNRH 3AEVB 4JV5H 4LF9H 2CPMA 4NXNH 2CWFA 1VIHA 4GKJH 1SEIA 4NZTM 3GABA 2X06A 3GKUA 4JI7H 3OETA 1IBMH 1XMQH 5DT9A 4AIMA 4X65H 1I94H 2M6QA 4JI0H 2UUCH 2F4VH 4B8CD 3NCVA 4B3RH 2HH2A 2AXYA 4B8TA 1WE8A 4DR4H 2OPVA 1S20A 2VQFH 4NZRM 1X0AA 5IT9W 1XMOH 1WHRA 1VBIA 4JVYA 1ZZKA 2UXCH 4YHHH 2VKCA 2LTLA 4X66H 4DR6H 2A1SA 2G8YA 4DR3H 3OSSD 2MJHA 1J5EH 1PQXA 2CTMA 1HNZH 2LF0A 4PDBA 2OPUA 3L7ZC 1HNXH 1WTJA 4GKKH 1XNQH 2UXBH 2HH3A 1XRHA 2D9IA 2ZM6H 2O4CA 4JVHA 2PY9A 2VQEH 1Z2IA 2QNDA 2JE6I 4OCHA 4AQYH 4JI6H 4LF8H 3QD7X 1ZZJA 1N36H 4BA2I 4LFBH 2ANNA 4DV1H 3KDKA 4OD6A 2Z0SA 4JYAH 2E3UA 1J5KA 1X9ZA 1J4WA 3J81W 4JI5H 4DV2H 3J7AK 4H8AA 4JI1H 4X62H 2JA9A 2FMRA 4DR1H 4OX9H 3VKEA 4DV6H 1DTJA 1V8CA 2YQRA 2Y3MA 1IBKH 4FJUA 2E5LH 3FAUA 4E9JA 2HHHH 3I0PA 2UUAH 2PT7G 4DUZH 1ODHA 4DR7H 1NXUA
chains in the Genus database with same CATH topology
2NN6G 2HH3A 3AEVB 2DGRA 2JZXA 1KHMA 1TUAA 1VIHA 4NBQA 2P2RA 4JVHA 2PY9A 5JEAG 1X4MA 2CTJA 2QNDA 2JE6I 4BA2I 1DT4A 1ZZJA 2CTKA 2PQUA 2ANNA 1ZZIA 4OO1G 4AIMA 5K36G 2Z0SA 2JEBI 3U1KA 2JEAI 2E3UA 2BA0A 4LIJA 1J5KA 1X4NA 1J4WA 2HH2A 2AXYA 4B8TA 1WE8A 4WALA 2CPQA 4WANA 3V69A 2CTLA 2OPVA 1WVNA 4QMFB 1EC6A 2JA9A 2FMRA 2JVZA 2ANRA 2BL5A 2CTEA 4JVYA 1VIGA 1ZZKA 3VKEA 1DTJA 4AM3A 2CTFA 2YQRA 1ZTGA 2MJHA 1K1GA 4IFDG 2CTMA 5C0XG 4BA1I 2OPUA 3L7ZC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2NN6 G;  2HH3 A;  3AEV B;  2DGR A;  2JZX A;  1KHM A;  1TUA A;  1VIH A;  4NBQ A;  2P2R A;  4JVH A;  2PY9 A;  5JEA G;  1X4M A;  2CTJ A;  2QND A;  2JE6 I;  4BA2 I;  1DT4 A;  1ZZJ A;  2CTK A;  2PQU A;  2ANN A;  1ZZI A;  4OO1 G;  4AIM A;  5K36 G;  2Z0S A;  2JEB I;  3U1K A;  2JEA I;  2E3U A;  2BA0 A;  4LIJ A;  1J5K A;  1X4N A;  1J4W A;  2HH2 A;  2AXY A;  4B8T A;  1WE8 A;  4WAL A;  2CPQ A;  4WAN A;  3V69 A;  2CTL A;  2OPV A;  1WVN A;  4QMF B;  1EC6 A;  2JA9 A;  2FMR A;  2JVZ A;  2ANR A;  2BL5 A;  2CTE A;  4JVY A;  1VIG A;  1ZZK A;  3VKE A;  1DTJ A;  4AM3 A;  2CTF A;  2YQR A;  1ZTG A;  2MJH A;  1K1G A;  4IFD G;  2CTM A;  5C0X G;  4BA1 I;  2OPU A;  3L7Z C; 
#chains in the Genus database with same CATH topology
 2DGR A;  1MSZ A;  4JI4 H;  1HR0 H;  2JZX A;  1KHM A;  1TUA A;  5A2Q W;  5JEA G;  1X4M A;  2CTJ A;  4B3S H;  1DT4 A;  1N32 H;  2CTK A;  2PQU A;  4OO1 G;  5K36 G;  3U1K A;  4LIJ A;  2LTM A;  1FJG H;  1X4N A;  1FKA H;  2LRR A;  4DUY H;  3RF2 A;  1N34 H;  4WAL A;  4LF4 H;  1V9N A;  3SB1 A;  4B3M H;  1WVN A;  1EC6 A;  4B3T H;  2ANR A;  2FPH X;  1VIG A;  4YY3 H;  2CTF A;  5C0X G;  2UXD H;  2ZQE A;  4X64 H;  1UG8 A;  4BA1 I;  1S03 G;  5IWA H;  5LMN H;  2NN6 G;  4DR2 H;  3KDG A;  4DV7 H;  4DV3 H;  2JEA I;  4JI2 H;  4NBQ A;  5FLX W;  3UOE A;  5LL6 b;  5LMU H;  4DV5 H;  3T1Y H;  2P2R A;  3OTO H;  1AN7 A;  4LFC H;  2M8W A;  1ZZI A;  4K0K H;  4LF6 H;  4KHP H;  2JEB I;  2FFM A;  3JAM W;  3T1H H;  4JI3 H;  2BA0 A;  3EZJ A;  4LF7 H;  1F0X A;  4LFA H;  1HNW H;  4NXM H;  4WAN A;  1IBL H;  4LF5 H;  2CPQ A;  3V69 A;  2CTL A;  4QMF B;  4JI8 H;  2JVZ A;  4FJS A;  4DV4 H;  2BL5 A;  2CTE A;  2CWH A;  3J80 W;  4G08 A;  5BR8 H;  1I6U A;  4AM3 A;  1ZTG A;  4DR5 H;  1K1G A;  4DV0 H;  2UU9 H;  2UUB H;  4IFD G;  4EC5 A;  1N33 H;  2K1H A;  3GR5 A;  1XNR H;  3AEV B;  4JV5 H;  4LF9 H;  2CPM A;  4NXN H;  2CWF A;  1VIH A;  4GKJ H;  1SEI A;  4NZT M;  3GAB A;  2X06 A;  3GKU A;  4JI7 H;  3OET A;  1IBM H;  1XMQ H;  5DT9 A;  4AIM A;  4X65 H;  1I94 H;  2M6Q A;  4JI0 H;  2UUC H;  2F4V H;  4B8C D;  3NCV A;  4B3R H;  2HH2 A;  2AXY A;  4B8T A;  1WE8 A;  4DR4 H;  2OPV A;  1S20 A;  2VQF H;  4NZR M;  1X0A A;  5IT9 W;  1XMO H;  1WHR A;  1VBI A;  4JVY A;  1ZZK A;  2UXC H;  4YHH H;  2VKC A;  2LTL A;  4X66 H;  4DR6 H;  2A1S A;  2G8Y A;  4DR3 H;  3OSS D;  2MJH A;  1J5E H;  1PQX A;  2CTM A;  1HNZ H;  2LF0 A;  4PDB A;  2OPU A;  3L7Z C;  1HNX H;  1WTJ A;  4GKK H;  1XNQ H;  2UXB H;  2HH3 A;  1XRH A;  2D9I A;  2ZM6 H;  2O4C A;  4JVH A;  2PY9 A;  2VQE H;  1Z2I A;  2QND A;  2JE6 I;  4OCH A;  4AQY H;  4JI6 H;  4LF8 H;  3QD7 X;  1ZZJ A;  1N36 H;  4BA2 I;  4LFB H;  2ANN A;  4DV1 H;  3KDK A;  4OD6 A;  2Z0S A;  4JYA H;  2E3U A;  1J5K A;  1X9Z A;  1J4W A;  3J81 W;  4JI5 H;  4DV2 H;  3J7A K;  4H8A A;  4JI1 H;  4X62 H;  2JA9 A;  2FMR A;  4DR1 H;  4OX9 H;  3VKE A;  4DV6 H;  1DTJ A;  1V8C A;  2YQR A;  2Y3M A;  1IBK H;  4FJU A;  2E5L H;  3FAU A;  4E9J A;  2HHH H;  3I0P A;  2UUA H;  2PT7 G;  4DUZ H;  1ODH A;  4DR7 H;  1NXU A; 
#chains in the Genus database with same CATH homology
 2NN6 G;  2HH3 A;  3AEV B;  2DGR A;  2JZX A;  1KHM A;  1TUA A;  1VIH A;  4NBQ A;  2P2R A;  4JVH A;  2PY9 A;  5JEA G;  1X4M A;  2CTJ A;  2QND A;  2JE6 I;  4BA2 I;  1DT4 A;  1ZZJ A;  2CTK A;  2PQU A;  2ANN A;  1ZZI A;  4OO1 G;  4AIM A;  5K36 G;  2Z0S A;  2JEB I;  3U1K A;  2JEA I;  2E3U A;  2BA0 A;  4LIJ A;  1J5K A;  1X4N A;  1J4W A;  2HH2 A;  2AXY A;  4B8T A;  1WE8 A;  4WAL A;  2CPQ A;  4WAN A;  3V69 A;  2CTL A;  2OPV A;  1WVN A;  4QMF B;  1EC6 A;  2JA9 A;  2FMR A;  2JVZ A;  2ANR A;  2BL5 A;  2CTE A;  4JVY A;  1VIG A;  1ZZK A;  3VKE A;  1DTJ A;  4AM3 A;  2CTF A;  2YQR A;  1ZTG A;  2MJH A;  1K1G A;  4IFD G;  2CTM A;  5C0X G;  4BA1 I;  2OPU A;  3L7Z C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...