1WVRA

Crystal structure of a crisp family ca-channel blocker derived from snake venom
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
221
structure length
221
Chain Sequence
NVDFDSESPRKPEIQNEIIDLHNSLRRSVNPTASNMLKMEWYPEAAANAERWAYRCIESHSSRDSRVIGGIKCGENIYMATYPAKWTDIIHAWHGEYKDFKYGVGAVPSDAVIGHYTQIVWYKSYRAGCAAAYCPSSKYSYFYVCQYCPAGNIIGKTATPYKSGPPCGDCPSDCDNGLCTNPCTRENEFTNCDSLVQKSSCQDNYMKSKCPASCFCQNKII
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of a CRISP family Ca2+ -channel blocker derived from snake venom.
pubmed doi rcsb
molecule keywords Triflin
molecule tags Toxin
total genus 62
structure length 221
sequence length 221
ec nomenclature
pdb deposition date 2004-12-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00188 CAP Cysteine-rich secretory protein family
A PF08562 Crisp Crisp
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.740 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Crisp domain 1wvrA02
3.40.33.10 Alpha Beta 3-Layer(aba) Sandwich Pathogenesis-related Protein p14a CAP 1wvrA01
2VZNA 2DDBA 1XX5A 2CQ7A 3U3UC 4IFAA 1WVRA 3Q2RA 3U3LC 5JYSA 3Q2UA 4P27A 4D53A 1SMBA 4NUOA 2EPFA 2GIZA 4TPVA 3NT8A 1CFEA 4AIWA 4H0AA 2A05A 3S6VA 4NUKA 5ETEA 3S6SA 3MZ8A 2DDAA 4NUNA 3U3NC 1RC9A 3S6UA 4G2UA 4NUIA 4LY5A 1XTAA 1QNXA 1U53A
chains in the Genus database with same CATH superfamily
1XG1A 2COBA 2FMYA 4IF4A 3HKZA 2K9QA 2LNBA 3HGGA 2E35A 3KLNA 1ON1A 4X0GA 1FIAA 3G6EI 3R61A 3Q5FA 4A3CJ 2H8WA 1SFUA 1AA7A 4RGXA 2X9DA 5EDNA 4XKVA 5L3DA 3JSOA 4E7KA 2HXIA 4DZPA 3RTRA 1Z3XA 2MG4A 2JQ7A 4ESJA 1TWAJ 1PYVA 3CJQB 2C6YA 5M3MJ 4QIWN 3FHNA 4U87A 5FROA 4LG3A 3WTUC 2L4AA 1D5YA 3OYMA 2R7FA 3PL8A 3TOBA 1X58A 3FK7A 3WTTC 3DXJF 1MNEA 3V8KA 1SMTA 1SVLA 2KFDA 3BP8A 2NVUB 4PFOA 2ESNA 2O6GE 3WHBA 2Z9OA 2DA6A 2TDXA 4XLNF 1YQAA 5EEAA 5EF6A 3MKZA 2Q2EA 4HF0A 1W4MA 2CRGA 4LK0F 3A0HC 3HOVJ 4V2GA 4EV0A 1UB9A 4LGWA 3BT9A 3KZZA 3VSLA 1WJCA 2DA5A 2NVXJ 4N4OB 4D9JA 3WTXC 2R7DA 5F27A 3P9KA 2L2OA 2PJRB 4CCMA 5IOYA 4U7DA 1OCCH 3CCEI 3ZN1A 3IH3A 3KE2A 4KN7X 2LY1A 3E6MA 1K4SA 3WGGA 4BBSJ 1ZN2A 1QHHD 1SFOJ 2KIFA 1A5JA 1S7AA 5FKMA 2GOXB 2DA4A 4KFCA 3PJRA 2NRAC 2HFHA 1OYWA 1N75A 2IPQX 3HTUA 1S7OA 1ACIA 3WTYC 1B8IA 3FKJA 4E6KG 1D1CA 4FISA 5CVVA 2KRHA 5FKOA 4HRIA 4OAZA 3HDDA 3KEYA 1BJAA 3I5UA 4LG0B 1YW7A 3SDGA 1MDMB 4A2UA 3E5QA 2V1DA 1IZ1A 4HQMA 5HDKA 2XF5A 1O3TA 3TBIA 2HNHA 1KQ8A 1QNTA 2HDWA 1K7AA 3TW7A 2L7KA 3HXLA 3HJEA 4AYBN 5CKTA 1MMSA 3RJPA 1GHCA 1OCPA 4PFPA 1ON2A 1B8IB 4XRSG 5JI6A 2Y48A 4UUSB 1A04A 1IN8A 1XX5A 3V7RA 3F8CA 1A31A 4FTHA 2OQRA 3OYFA 1MIJA 3OOUA 1R5ID 1ENHA 1DUXC 4DBRA 3Q0UA 4OINF 2IJLA 2YUSA 1LDKB 1U9NA 1BIAA 1X3WB 4M3GA 2HDCA 4E7HA 3LNQA 2KZGA 2NYXA 4L9TA 5D6EA 2W25A 4BHPA 1BR1A 1S72I 4H4KC 1EKEA 4C30A 3H9JA 4XOTA 2LBFB 2COMA 3BR6A 1VQ9I 3LAJA 2O0YA 1FLIA 2VJ5A 5GTHC 4Q47A 4KT5C 1OYIA 1SVOA 3FXLA 5J40A 3VFZA 1X1CA 1YG2A 4U0VA 4HBLA 5HODA 1JGSA 2W1OA 4N0BA 2OA4A 1QBJA 2LDUA 3DBRB 1VQPI 4IJAA 2VPRA 1QZEA 3VOEA 5K5RA 4GGGA 2E1OA 4JP0A 1OCRH 1VZ0A 2BY3A 1REPC 4C3HJ 1IN4A 2DJNA 2W82A 3J7AO 1EH6A 2LK2A 2XRNA 2ME6A 5L3CA 1MZBA 4WXCA 1IDZA 1O4XA 4QSHA 3ZR8X 4P5OA 3E6CC 3LA7A 4PJJA 4AVZA 5DDGA 1OR7C 2GBYA 2JUCA 1JKQC 1AHDP 1HW2A 3RKXA 2ADUA 1ITYA 5ERIA 3E1SA 4IEJA 1KYWA 1MBJA 2FJ1A 4KIBA 3COAC 4XK4A 3JREA 3VEPA 2VASA 5B66C 3CESA 3MEXA 5EYRA 2CW8A 1FPQA 5C4XJ 5LBQA 1BIBA 1CF7B 1XDUA 2YX7A 2IXSA 1X4OA 2A5WA 3OV8A 1H9GA 2VB6A 3Q3SA 3G1LA 5L3BA 4IHYA 2MH2A 4KUMA 2L54A 3BROA 3LMMA 3NWTA 2M30A 1H0MA 2VN2A 3H3ZA 1QNXA 3KEOA 1BN5A 3WG9A 2OC6A 2VQLA 4F93B 4GFBA 1FOYA 5DM7F 3S93A 2X51A 1STZA 5ICGA 3HUGB 1ONVA 2K3PA 4I99C 3D0SA 2L9VA 1Y0NA 3DEUA 2MYSA 3GTPJ 2ZO4A 2K9LA 3L2CA 3S16J 2K40A 3TP0A 2R7WA 1J09A 2AO9A 1P92A 2DYSH 4MQVA 3RDIA 2F48A 3FM5A 4HF2A 3QP5A 3U3NC 3Q9VA 2DMTA 4F52A 5KVRA 3ZOBA 3GTKJ 1HBXG 5J1UA 4LLNA 4Z2YA 3TL4X 1NH3A 3GTGJ 2LF7A 1BW5A 3E7LA 1MD0A 4G94A 2EA4A 4JYKA 3AG3H 3DFGA 4XSXF 1WVRA 1K6YA 4Y7NJ 2BY0A 2EV5A 2DA3A 5GP9A 2DFFA 1ETWA 4M6VA 1TC3C 2EZKA 1R1VA 4BXUA 1VQ4I 4EJTA 1RIOH 2K86A 1S3JA 1SEUA 1LDJA 3KP4A 1DPRA 3DU6A 1IN5A 1UHSA 2XV4S 3PNYA 2K85A 4QPOA 4AIWA 2GA1A 4RM3A 2BVLA 2EK5A 3OYLA 9ANTA 2OAZA 5K7HA 2XF7A 5DCMB 3HTSB 4B3AA 2VQHA 5FLVA 1TWCJ 3ROUA 4I0BA 2QYOA 1TP4A 2CUJA 2M8GX 1FEXA 2JA5J 1E3PA 2DOFA 3IRQA 3ML6A 1Y39A 3CMMA 3GMEA 4MIMA 1T6SA 4HZFA 1YRNA 3CMYA 3OL4A 5F0CA 2H1LA 1BJZA 1G4DA 2W48A 4PJ0C 1IW7F 4HQEA 4UVBA 3CF5F 2UWMA 2IW5A 4IKFA 1WRJA 3MKLA 3T1BA 4E4HA 3AG4H 1FOXA 4XN0A 2FX0A 2BY1A 1BL0A 3W3CA 1FYMA 4DNCA 3G1OA 1HKQA 1RI7A 3TOAA 3DTEA 1VQOI 1ZLJA 3S32A 4HX8A 1Z67A 1Z7UA 3PSIA 3I55I 4B43A 3PO3J 3K69A 4C2UA 1QPMA 3JW4A 4ZYDA 3NT8A 4RDUA 1MBEA 4FETA 1Q1HA 2N8GA 2NS0A 4RGRA 3VYUB 5FRNA 1X19A 2XPVA 1ETYA 2FBKA 1HKTA 4BJ6C 5J8FA 1G59A 1TQPA 3DBLB 2FE3A 3ZMSA 3EETA 5FKNA 3O6BB 4MHGA 2ZFUA 3DQVC 2XB5A 1P9QC 2M8EA 3K4KA 3SEZA 3OWTA 4FCYA 2GLOA 2ZNZA 2JVGA 2QQAA 3CDIA 4B1RA 1HSTA 4RAGA 4BJ5C 4NC6A 4IOAF 1WI9A 3LA2A 3KLOA 3DEWA 3GFJA 2KHMA 4BQQA 2R0QC 4Y15A 3FXQA 4NUBA 4CH7A 2D1HA 4A3DJ 4ZDLA 1LNWA 3ERMA 2OBPA 2VBXA 3QQAA 4HG2A 4S04A 2JRMA 1RETA 3MWMA 2OCEA 1CQTA 4BHCA 5EGOB 5ICFA 2L3DA 4HNUA 3RZDJ 3W6VA 2GOMA 5HLGA 2DDBA 3I9V2 2HDDA 5CLSA 1MH3A 3RZOJ 4IQJA 5KAFC 1PP7U 3R4KA 2PX9A 2NNNA 3TKYA 1IGNA 2FMLA 1GDTA 3CP2A 3CF2A 5LEJA 3FKIJ 2XVCA 2F4IA 4CCOA 2ZFWA 4LMYA 4XLFA 3CUQC 1T33A 3PIPF 1VQ7I 1IRXA 4F55A 2L9RA 2P5VA 2OJED 3ZQFA 3HOSA 4UVAA 2VI6A 1P7JA 4ZDOA 2KRFA 3M1CA 4QTRA 2EIMH 3WTSC 2EA2A 4XKBA 2KDOA 2QSFX 1MMGA 2YX4A 1LEAA 3FZVA 1WJFA 3U1DA 3W6KB 2F5FA 1B6AA 1A6QA 4H0AA 4A6DA 3QP6A 3AKZA 3JRHA 4HF1A 1NK3P 4G7OF 3MZ8A 1QQIA 3F6OA 1FX7A 1BI0A 5HS8A 3CCQI 1MGTA 4MFEA 5IT9K 3TDZC 3HIFA 4M6XA 4UHTA 4JBAA 4NUIA 2A69F 1LEBA 3ERED 3TDUC 2VQGA 4UY8I 2HOSA 3CQZJ 1UZCA 1Y56A 4HX7A 2HYFA 1Z21A 5DTDA 4Q5SF 3IL2A 4U88A 1JUPA 2E19A 4FX4A 3BCBA 3S3MA 1YYVA 2OPTA 5GPCA 4UB6C 5EG0A 4PSXA 4G7ZF 1LE8A 1A6IA 2BHZA 1BOBA 3O8GA 1O3QA 3LFKA 3EQLF 5JYSA 4RM2A 5FFXA 3FHZA 2XROA 2IA1A 4EATA 5BMZA 4B3XA 4HDVA 1YS6A 3CCJI 3SFIA 1B72B 4RAYA 5D5VB 1LVAA 2HI3A 2QGUA 1ZH5A 3MD2A 5GAHJ 3K70C 1A35A 2IEKA 5LHIA 2QZ8A 2YU3A 5HS7A 2DU9A 1BI3A 2VKVA 1H88C 1ORKA 3K1NA 5E1WA 2A6TA 2JA7J 4IFAA 4PUSA 1FBUA 2JSPA 1JHFA 4Y33A 3WE3A 5A2QZ 3QOEA 1JXSA 1JUMA 2AHQA 3KIOA 2HOTA 3QODA 2PMZN 1VQ5I 5E3LA 5HDGA 2JK3A 1R5GA 4HYEA 4EGYA 1HA8A 3DP7A 4AIDA 1VFCA 1RR8C 1HLVA 3RQIA 1I5ZA 1JKRC 3J7AY 1WKMA 4CCNA 1IXRC 4RS8A 1RUNA 2HTJA 3K70D 4R8HA 3GZ6A 4BDYA 5KNLA 2KZVA 3DKWA 3S8PA 2H27A 5KK1A 4Y52J 3FXUA 2E60A 2W7NA 1W0TA 1OISA 4HX4A 1IV6A 2V6EA 1USSA 1PVEA 3MVPA 4AYBA 5F0FA 1AOYA 4YIIA 3IKVA 4PGGA 3QU6A 3GXOA 1E3OC 3EDPA 4YIRX 4DQ2A 4W1UA 1JJ6C 1D3YA 2DOEA 2VXZA 2OF7A 3GBGA 3H1CA 5J8CA 1ZTRA 3BR3A 4ZYEA 3L2QA 1FOKA 2X1EA 2KKOA 3D5RC 3LSKA 2CS3A 4D1QA 2FQ3A 4MLOA 1HOMA 3R0AA 1XTAA 3LSJA 1CGPA 5CJ9A 3SYTA 2O03A 2E2HJ 1WZ2A 3HHHA 1SD7A 2MD5A 3HM5A 2QKMB 4NB5A 4BEHA 1SMYF 1W5TA 3BJ6A 3ISPA 1LFBA 1HW5A 2YR2A 1FBSA 4AUXA 3K1MA 3EYYA 2PN6A 3NQOA 4M9XA 2P7VB 2L4MA 3O8HA 4Q48A 3WE2A 3S6SA 4M3EA 1Y1WJ 1FT9A 5GAEJ 4BL0B 2STTA 3TGNA 4L0YB 3LQRA 2JZYA 3ZRGA 5BS6A 4MEXF 4I2OA 4L5EA 4ZYAA 3OYDA 2H8RA 3JAMZ 3MAJA 2ISZA 2W57A 4EJVA 3ZQIA 3FXKA 3CCUI 2Z1DA 2XAHA 1DP3A 4A3GJ 5CQEA 5K7FA 5D5WB 5IYBJ 2B63J 2LR8A 2Z16A 2NVYJ 3B73A 4D7MA 4RLQA 1Z7LA 1Z1DA 2XGCA 3ZMZA 3A2KA 3VYTB 1LVKA 1BR2A 5GTIC 4DGWB 5ED4A 1VTNC 1JGGA 3MN2A 4RB3C 4ZYGA 2HVQA 3FX3A 4JX4A 5L3FA 1QVUA 1S29A 3OR1C 5CVIA 5L3GA 1TWGJ 4M9ZA 1XMXA 1GLNA 1IG7A 2O3FA 1FY7A 5TGTA 3ZQHA 1S8NA 2K27A 2VKDA 4TPVA 1DU6A 5C4JJ 1S7EA 4CYCB 4A12A 5DUKA 1VQMI 1LFPA 1X4PA 3RSNA 2Y30A 3QU3A 4HDUA 2CQQA 1U8BA 4P55A 1XGNA 2EILH 4CDGA 1SFXA 2HQAA 3S2DJ 4LY5A 2FNAA 2ZXJA 2M5WA 3IP4B 2LTPA 2P81A 3OSFA 3S15J 2IA2A 3BTLA 3F22A 2JT1A 3U3UC 1GVDA 5LGTA 3FMQA 3MKWB 1ZQ3P 2CU7A 1IXCA 2ZKZA 3DPTA 4EM1A 2KDZA 1TW2A 1FC3A 2Z33A 1MNMC 1MW7A 2CW0F 2DW4A 4IHSA 1RPWA 2MW8A 1D8KA 1UG0A 3H9GA 4NBQA 3MZHA 1U0JA 2CQKA 2CSOA 2P4WA 3MMYB 3S3NA 3BTJA 3F3XA 3CCYA 2LKSA 3OYKA 4C2TA 1R7JA 1V54H 2HR3A 2LLKA 4IPAA 3L2RA 1ZRCA 2CWEA 4F3QA 3DWLE 4W97A 5CVUA 2PJRA 2GWRA 5F64A 1ETQA 2OTLI 3RKQA 1C0WA 1JTXA 3RPUA 2EIKH 1TWFJ 2DLLA 3KYCB 3JRAA 3JRIA 1NK2P 2Y69H 3C2GA 3IUOA 5LGUA 1HF0A 3F8BA 2NVQJ 2KPMA 2PI0A 2BGCA 4EJOA 3E5XA 5JVTA 1XMKA 1MH4A 2Z3YA 4BUPA 2FUG2 4BXFA 1X3UA 2DK5A 3L09A 5LGNA 3GVAA 1B4AA 3PIOF 1IRGA 1DQUA 1MJBA 2DMNA 2R4GA 3Q2RA 3U3LC 2E2IJ 2VBYA 1H9TA 1HSJA 1IJWC 5D4SA 3ABTA 4LG0A 4EM2A 5GADJ 3PFIA 1MDMA 4O3MA 2HGCA 2XHKA 1KQ0A 4UNOA 1OCOH 2LC2A 3S1MJ 2KJCA 2XDVA 1RUOA 2WY8Q 3DEEA 1UFMA 2TRTA 2J5OA 5IP7J 2DODA 2PMUA 1FP2A 4DIQA 2QUFA 4IHWA 2K4JA 2HU9A 1JE8A 1V5FA 3Q9SA 4E7JA 2AXLA 2I5UA 4EGZA 2O7OA 4BDZA 1S5LC 2RNJA 4UUSA 5BNGA 4BQNA 4EM0B 2FSWA 1IN6A 1JHHA 4OIRF 4XORA 3M3YJ 4UV9A 4BXXJ 1T0FA 4B8XA 1Z6RA 5EEGA 2LREA 2LP0A 4GXOA 1P7IA 2B0LA 3I58A 4M3DA 2RKHA 3DKXA 4XKWA 4XR6A 1TQIA 1W0UA 4BY7J 1M1EB 5DEQA 4DYQA 4KICA 2UV1A 3RIRA 3HL2A 2R7VA 5FJ8J 2IS6A 2WB1N 4XIDA 2R92J 2P7CB 1X2NA 2XPUA 1RESA 4WWCA 3L2UA 2LBFA 4CICA 4B44A 4KMFA 2R5YB 1D5VA 5C44J 1P4AA 5GAGJ 4IRIA 3K0LA 1IRFA 2P6TA 3ZQCA 1F4KA 2KJBA 2CV1A 2VIXA 1SMBA 3AL0B 3KX2A 1ZARA 1H8AC 3VDXA 1VQKI 2CUFA 2EV0A 4RB2C 3TW6A 2PFBA 2V79A 3SJMA 2X6XA 2LVSA 2DT6A 1U5TB 3MZYA 3BOQA 3BZCA 4MQ9F 5HLTA 4S05A 2CQNA 3WHCA 3JRCA 2E2JJ 2V9PA 1PUFA 3GTOJ 4MEYF 1TW3A 1ZGAA 1W7PD 2YU9J 4OIPF 4EJWA 2HWVA 4QPQA 4LB6B 5HDNA 1J0RA 2A61A 5F1JA 2LD5A 1IC8A 4B48A 3EUAA 1WWXA 4R79A 4D53A 1XMAA 1MBGA 2LG4A 5LFAA 2UZKA 3N4MA 2E5NA 3CJRB 4E7LA 1YE9A 2M3AA 3X2QH 1XN7A 3E0JB 1GV5A 5D8KB 1BW6A 3IWFA 1AWCA 2L0KA 4XN3A 2HOAA 4XBFA 4A3JJ 3GYHX 4ZH4F 1MBFA 2BHYA 2ACJA 1PUFB 4FT8A 1UHWA 1DGRM 1YJ9I 2VKHA 3EUKL 1L3LA 2GZWA 3G4SI 2X85A 1XCBA 4NC7A 1O7LA 2G7UA 1BC7C 2QENA 1TT0A 4ENJA 2UXXA 4I02A 3REOA 4NQWB 4P27A 1T98A 3BR5A 3RCOA 1XSXA 2E1CA 2ZMEB 1MMNA 3VYSB 1NHAA 4OMZA 1CF7A 3C7JA 3NEUA 4PSWA 1OFCX 3ECOA 4M3FA 5F0HA 3S14J 3OS1A 4G8XA 1IUYA 3F21A 1Y8RB 5DS9A 2DO7A 4AIJA 2WV1A 2YS9A 3P9CA 2P8TA 3K4BA 4D5FA 4BY1J 2F4MB 3U9GA 4C9YA 1W36C 1SAUA 3HUGA 3FDYA 4KDPA 4A3BJ 1X3ZB 3LOCA 4GRIA 2JRTA 1ZG5A 1W5CC 3IKTA 2LY9A 2X6YA 2A05A 3BTIA 4E7IA 4KT6A 3HG9A 1TZLA 1FIPA 2ETHA 1U78A 2M7AA 1ZELA 5IPAA 1ZRFA 4M9SA 1FBQA 5F1RA 5E18F 3PNTA 3F23A 3K10A 1U53A 2DFEA 1KZHA 2KQRA 3H92A 1KU2A 5M5XJ 2H6BA 4HLYA 1J5YA 4BU2A 4X6AJ 3K4JA 4MFDA 4FASD 1W36D 2BOLA 2E1MB 1IUFA 1VI0A 3K4CA 2DXIA 1PDNC 3HC7A 3WTZA 2QF7A 2JA8J 2ZJ2A 4B09A 1T8IA 3NWSA 3CUQB 3BR1A 3ASNH 3NARA 1N25A 4HAMA 4A3FJ 1LJ9A 1TBXA 2V1NA 5DCMA 2L5QA 3ABKH 3ECHA 4L0ZB 2PMZA 3EYIA 2X1CA 2HVRA 2ZSIB 2NS7A 4F92B 4XOPA 2R7UA 4YFNF 2M45A 4L9JA 3RYPA 3OL3A 5M5WJ 3IH2A 3DLAA 1FWZA 4N9HA 4UV8A 3J80Z 3UR3C 4X1EA 1X1BA 4C3IJ 4J19A 2PBIA 4FHTA 4XL9A 3CUOA 4L9VA 3TQNA 3UNGC 1OMIA 1IV8A 3H36A 4A3MJ 2R5ZA 2OQGA 2HPIA 3QAHA 4P9FA 3OIQA 4CCJA 1R4MB 4ZTFA 1V55H 1ZKGA 1EA3A 3JSPA 1YI2I 4WX9A 2W85A 2HTSA 1ZAOA 3LSTA 3R0JA 1MJ9A 3TO9A 1KU7A 2GXAA 4M73A 1F9NA 4YELA 4B4CA 1G3WA 4IRGA 4ASNA 4JK1X 1BC8C 2RREA 1HDDC 1PJRA 2CUEA 1T0FC 2MABA 5LRSA 1BOAA 1ZK8A 3EUHA 1P2FA 2KIUA 2FA5A 3MCZA 2R5ZB 1R9TJ 2R3SA 2MLKA 2WAQN 2GAUA 1YJNI 1ZR2A 2X6WA 4PJLA 4XM3A 2Y0SN 2M34A 3DKYA 2FU4A 2CFXA 1SC7A 2NNYA 1YW9A 4XLAA 1FSEA 3G3ZA 1BM9A 2LH9A 2VT3A 3F0CA 3LSGA 2XGEA 1KU3A 3CCSI 1OPCA 1G3SA 2O5RA 2Z2SB 2QWWA 2E36A 4AVPA 1I1GA 1B9MA 1DU0A 1WGXA 1V5GA 2QBYA 3WGHA 3T0YA 4K2EA 2DFIA 5CQGA 1LFUP 4HPQA 1U9OA 5EGOA 3PUBA 4IZZA 1EJ9A 1Y8QB 4LFUA 2F2EA 3P5JA 1RKTA 5DUIA 3OYBA 2XSDC 1SFKA 5B3SH 2QVOA 5H6RA 2EPFA 5E8IA 2O61A 4FX0A 4NNJA 2WAEA 2XSJC 2LF8A 1YLFA 5BQTA 2WBMA 4XLEA 2QBYB 1VQLI 4BE1A 2RV8A 4MO7A 4RLFA 1FJLA 3S6UA 3G73A 1J7KA 4A3LJ 3GTMJ 1R6RA 4A5NA 1XSDA 1JT6A 4XNFA 2DT5A 2PEXA 3C18A 1V3FA 4WXDA 5K1YA 4A6EA 1ULYA 3SDBA 3HOZJ 4HNTA 1WCMJ 4J00A 1I1SA 1TWHJ 3OYNA 2GQQA 3HRSA 1V4RA 2MD0A 3GTQJ 3ZCOA 4NUKA 2CJJA 1YHQI 3H3VK 3HEFA 2M2EA 1YO5C 4NUNA 1ZREA 4D7NA 4XICA 2RDPA 5J6XA 1UELB 3BG6A 1I39A 1EH7A 5FD6A 3KFWX 4A5MA 3V7SA 2VOPA 5DD4A 3BC8A 2DQRA 4CYDA 5IP9J 2VJIA 3JRBA 1PP8F 4RGSA 4KA4A 3ZP5A 2Q8KA 2PMHA 1QGPA 3CC4I 2CG4A 5E3MA 3BPXA 3OSGA 2R93J 3E6BA 1WH5A 3H5AA 3G1MA 1P4XA 4UXNA 5ICEA 3CCLI 5ETEA 3BPVA 1R36A 3I53A 1GV2A 2ID6A 5L3EA 1B72A 1R1UA 3F8NA 2XAGA 2Y9YA 5FFZA 1XSVA 1T39A 3GO5A 2VKEA 2HPMA 1AKHB 1TTYA 3FF5A 1ERDA 4RMNA 1MJAA 3HPHA 4IHVA 4P96A 4I0AA 4CO8A 1D8JA 4IXAA 4CCLA 3AAFA 1T38A 5FLXZ 4AD9A 3CC7I 4IHXA 3BQYA 5F04A 5IY5H 2R7RA 3WG7H 2RAEA 1Y1VJ 3BG5A 5JHFA 5DM6F 2IP2A 1OQYA 2V9KA 4ZYHA 3OR2C 4CUGA 1Z91A 3CMAI 1YJWI 2E5ZA 2XF6A 2DI3A 4I09A 3S3OA 4ZDPA 3KCCA 3E3VA 3F9KA 4LIUA 3K6GA 2LSOA 1ETVA 2DFHA 1LB2A 3FBIB 5B1BH 3HSFA 2OUMA 2G9WA 2LYCA 2E7XA 3CLQA 2W4SA 4TV7A 2WC2A 3HOWJ 4BHBA 1ODDA 3KZIC 2FD5A 1WQ2A 5EZGA 3CDHA 3PUFA 3OS2A 2ZJPF 5A2QK 3OIPA 3KPHA 4IX7A 3PFYA 3QYEA 2ICWG 1N77A 2ECBA 2QLZA 2L02A 1YIJI 4II2A 3V4GA 3CCVI 2KMUA 5J4YA 1XS9A 3GLLA 1UCRA 2WAFA 4XQFA 2MA3A 2XASA 2WADA 2K7LA 1WI3A 3BLYA 5ILVA 2EFPA 4UUTA 2GXBA 2OD5A 2XPWA 4HA8A 3R6SA 4OU0A 1T95A 4JOMA 2OTJI 1ZG3A 3CTAA 2B7EA 4HNVA 1MBKA 3V8JA 5LHHA 3OY9A 2WB1A 1JKPC 2VODA 2LKXA 5FKLA 1WJEA 3D1NI 4UVCA 1O3SA 2A6HF 2LOOA 3BG3A 3LQQA 3N05A 3DPUA 2F5DA 3EUHC 3A01A 2EH3A 3KP2A 3S2HJ 3JTGA 1LUJB 4L5IA 5J47A 3IV5A 4U7BA 5C3EJ 2V26A 2MLGA 1G8XA 2XAFA 1GT0C 4DJAA 5J1YA 5LD2C 3ONQA 3W2VA 3FXMA 3IAS2 1ZR4A 2A07F 1YIOA 2W24A 3RYRA 2G0EA 4LLGF 1GVJA 2OV7A 3BR0A 3QPLA 4M71A 4NUOA 3BG9A 2EIJH 2G7HA 4DBQA 2PJPA 5J3LA 2K4BA 2QSGX 2XKPA 4HLXA 4OWRB 2EINH 3A01B 1Y6IA 1U8RA 4Q4ZF 1E17A 5JHUA 1D0YA 4N9IA 5H2FC 5B5EC 1S9HA 1BI1A 2K02A 3GZ5A 3SXYA 1WFXA 1E0EA 1YW8A 4P9UA 5D6FA 3JAMK 3LAPA 3JCUC 3I59A 4Y17A 1ZLKA 4O5VA 4MTEA 3DLLF 3BZKA 4OOIA 4BS9A 3UKGA 1E3HA 2STWA 2VBZA 2KIMA 3ABUA 1WJAA 3DBHB 5E17F 4G6QA 3RKWA 2I10A 2KL4A 4CXFA 3KEQA 1LDDA 4ZZLA 3KP3A 2QKLB 4CYCA 5EZHA 3BDDA 4HEA2 1TLHB 2BZTA 5J4VA 4I6ZA 1A36A 4IOCF 4A0XA 3K2AA 2EQRA 3CJNA 5FGMA 2NVTJ 1FMVA 3H35A 1QZZA 3U21A 1R22A 2QQ9A 3I59B 2YPRA 1XGOA 2CW7A 3G71I 4L9NA 1I27A 3B6AA 3J81Z 3LSRA 2L01A 2RC4A 2K9MA 5LRRA 4XMYA 3S1NJ 2HQNA 3FMRA 4P1WA 4RAFA 4XRSA 3BTCA 3HPGA 2HZDA 2BW3B 1APLC 2HXOA 4EQQA 3E6DA 4HV5A 1HQCA 2W84A 5M5YJ 3ZGKA 2ELKA 2QQ8A 3RI4A 3H9QA 2BE5F 4EVIA 3QWLA 2QQBA 1X1PA 4FE4A 1XC5A 2JPCA 1L0OC 2AS5F 1VF9A 2KP6A 1XGMA 1I3QJ 4PJNA 1D0ZA 2JSCA 1AU7A 3NRVA 3RPQA 3F72A 2V4JC 3GUDA 1ZYRF 3VYRB 1UMQA 2X0LA 3IC7A 1U3EM 3ZN0A 2EWNA 4KITB 1K6OA 4I01A 2L7MP 4I76A 4QWQA 4NHJA 3JRFA 4FE7A 2RGVA 5IT3A 3T5XA 1K83J 2DN0A 2XRLA 1R49A 2WA0A 2ID3A 4XLHA 4YRVA 3ZQGA 1QRYA 4CHUA 3OYJA 4QLCU 2R7XA 3ZQLA 4EEFG 2LRDA 3DU5A 3KP6A 2JN6A 2P5KA 3F8FA 1IRZA 4GCVA 1CFEA 1R23A 2VJ4A 1ZRDA 4N4NB 3KYLA 2VE8A 4RB1A 4AIHA 2VPLA 1T56A 2K5CA 2X48A 4C3JJ 1J59A 3QPHA 2W00A 3ZQQA 1BR4A 2LMDA 1GXPA 5FKKA 4CSWA 3M7GA 4ITVA 1VQ8I 4ENNA 2NOJB 2PLYA 3M8FA 2Y31A 3IAM2 2FNPA 2LY2A 1YOVB 2JTVA 3HSRA 3IWZA 3LA3A 2GIZA 4PGHA 3A03A 1WJ5A 4LK1F 4A3EJ 4WXHA 2RQPA 4XSZF 5IOZA 4XRMA 4BH9A 1EV7A 4GYIA 4E7SA 2EFQA 5DYMA 4LITA 3L2VA 4AIKA 6PAXA 4YEJA 2A6EF 4BKXA 3DF8A 2MSYA 4ON0A 3RQ4A 2CQXA 3SFZA 2NOGA 3Q0VA 3MKYB 5BPDA 2FRHA 3W2AA 2Q2EB 2WAQA 1T2KA 2R5YA 2DMQA 1HW1A 1YS7A 2EZIA 2WY7Q 1ETOA 2EBIA 1SFEA 3TEDA 3HGYA 2Y0SA 4XRFA 2ELHA 4JQFA 2K3FA 5CPRB 3JRDA 1WSUA 1X1AA 2IA0A 1FOWA 3ZMUA 2DDAA 3JTHA 4HV6A 2CGPA 3TO7A 2QEXI 4PZJA 2BXYA 2BYVE 2XGXA 4KMUX 5E8GA 2P5LC 2OZ6A 1U5TA 3IRRA 1XD7A 2VC0A 3E97A 2L9NA 5BOXA 1Z6TA 1UJ8A 2VBWA 3L00A 1EH8A 1TT5B 2GXGA 5AIQA 1P6RA 3C2HA 1RRJA 4R1HA 2DPDA 3QYBA 2UUZA 2MC4A 2IS4A 3LSHA 2M4KA 2NAZA 2XIGA 2F6CA 2H1KA 1YITI 3QPSA 1VQNI 3HYIA 2M7BA 4GO1A 3FXRA 5E3NA 1ZGWA 2JMWA 1NTCA 3LSMA 2O9LA 1FP1D 2HKXA 2I8DA 3M4OJ 4Y13A 4KISA 3ZXSA 4Y4RA 3A0BC 5IP6A 2IT0A 2KIQA 5CYVA 1IN7A 1K4TA 3M07A 3ABLH 1JT0A 4YFKF 2E7WA 4GYGA 1IF1A 4ZZDA 4CGZA 3H0GJ 5ILSA 4NQWA 2M0CA 1ZGJA 3ASOH 2WWYA 2J5PA 2ZMEA 1QO0D 1UG2A 2IAIA 1YX3A 2RN7A 5EJCA 1R00A 2XB0X 4D0PA 2IS1A 5H20A 2VQCA 3WU2C 1DP7P 3OYHA 1QA6A 2EZLA 2ZNYA 1YX5A 3GWZA 5TJJA 4I98B 4G6TB 2YSRA 1Z05A 1FTTA 2KISA 3KP5A 2VC1A 2ZXWH 3DCFA 1N78A 4BNCA 4KIGA 4BE0A 4PCQA 1RNLA 2D1VA 4Z6YA 2HZTA 2HVSA 4XLCA 4G9YA 3I54A 4KIFA 3N97A 4XLPF 3BY6A 3PSFA 4G6DA 4OMYA 3G2BA 2QA4I 3IH4A 2CYYA 3BG7A 1MMDA 3KYDB 3ZMVA 1DPUA 4IVNA 4EMSA 5HS9A 2DCEA 2LFBA 1I50J 3S1QJ 2KRCA 3FK6A 4F91B 2DK8A 5F08A 5ILUA 3V42A 3LSIA 5TRDA 1SANA 2E71A 1D0XA 1BI2A 2Q1ZB 4UUVA 1SD4A 4LD5A 4ZTJA 2VONA 2CH0A 1WJDA 1TNTA 5IYDJ 2JVHA 1HC8A 3AFHA 2LKPA 3CUQA 5K5QA 1F43A 3M8JA 3GFIA 3I4NJ 5E1ZB 1WPKA 2L9SA 2XKOA 1LKXA 5FD5A 1S6LA 1O57A 5AIPA 2D5VA 3I4PA 1XB4A 2L7FP 2HYJA 1HCRA 2O8KA 4DYRA 2D2WA 3HZJA 3D5SC 3GZNB 4CZCA 3FBNB 2MH9A 1FMWA 2P6SA 5D5UB 3SZPA 1U2WA 2H6CA 3L7WA 4A3IJ 3CMEI 1MSFC 3QYFA 5LLQA 3HSEA 2CV2A 1QPIA 2XAJA 3HKZN 2ECCA 4HSTA 4ENMA 4I7HA 4BQAA 4L5JA 3U1KA 2HQRA 2ELJA 4BQOA 3A1YA 5K5OA 4NDLA 1R5HA 3M1EA 1ETKA 3TMOA 1MNDA 2IGOA 3HRMA 2BV6A 4E7ZA 1Y0UA 3JRGA 3RKYA 2OU2A 2XAQA 1I6XA 3H0DA 5J1RA 2ZBKA 3EPZA 3P9IA 1POGA 3FWEA 5E79C 4A69C 3J80K 2A3SA 3RPUD 1QVTA 3OYGA 1EF4A 3FMSA 2H94A 1FYKA 1VQ6I 4BE2A 5HLIA 3J7YJ 1RC9A 1X1DA 2DMUA 2V6CA 5FO5A 1W5SA 4NC8A 2A68F 2A5YB 3SQNA 2NS8A 1Z9CA 1WHUA 3L9FA 4M6YA 4DZJA 4PJMA 2AQFA 2X6OA 3WTWC 3VPRA 2EJRA 2BXZA 3SHFA 5TISC 3KETA 2JA6J 3K4NA 5HVQC 2ZJQF 1SAXA 1XGSA 1H89C 3H5NA 2VOOA 4E70A 4DYCA 1G2HA 5DCFA 1RZ4A 3AL0C 1YFHA 1ETXA 5FRMA 2IGNA 3A4CA 5HNFA 2DTZA 4IL6C 4KN4X 3WU1B 5FB2A 4CCKA 4DOZA 2Y2ZA 1U5TC 3MQ0A 2VE9A 5DV5A 1FZPB 1QHGA 4BGDA 1KONA 4V19K 1G3TA 4LOCA 1IXSB 1FTZA 2DMPA 3I64A 1JUSA 2OCCH 1R71A 2DPUA 4JX6A 4MTDA 3DPLC 4A93J 1GUUA 2V1XA 3CZ6A 1D1BA 1KGSA 2VJJA 3V8LA 3WGIA 2BY2A 2L7ZA 4WCGA 4AM3A 2FBHA 4L18B 3K1PA 3LFUA 4BAYA 1K78A 3PM1A 1FYLA 4FQGA 4UB8C 4AWXB 3NAUA 4ESFA 2Y75A 2MC3A 2R7TA 4EJUA 1T08B 2DAOA 2XAUA 2M0MA 5K7ZA 2BVMA 2VLAA 1LQ1A 1BBYA 3HBLA 1YRNB 5JR3A 1YTYA 2AQEA 2ZXIA 3FXJA 2AXTC 1QU3A 3GTLJ 3GTJJ 2EFOA 1MBHA 5KAIC 1B59A 2FOKA 2ME0A 2V9VA 4ANJA 3S2WA 1K78B 2B9SA 1ZHFA 2HYGD 2ZC2A 1RR7A 3BR2A 4A3KJ 2ZMEC 4KNYA 5D5XB 5E1XA 3I0TA 1IAWA 1SD6A 2TCTA 3CDLA 3DTIA 3V7CA 1HDPA 3GX4X 2IRFG 4ESBA 3WU0A 2PG4A 4KYWA 2CQ7A 4XKCA 3FM3A 4G12A 1F1ZA 1K61A 3LSPA 5CVJA 2R7ZJ 3BJAA 2DOAA 1JKOC 1R1TA 1OJLA 3O2PE 2GM4A 2M1BA 1OCZH 2R7SA 3GLXA 2VUMJ 2WV0A 4G7HF 4XONA 5JLXA 4IHTA 1RKWA 2JPBA 3HRTA 3AG1H 4RBOA 3SEQA 4AC0A 3J7ZI 1IDYA 4LLLA 2JJ7A 2DA7A 1AKHA 2DA1A 4YG2F 3B6CA 3OS0A 3H3UA 4M72A 3OIOA 4PK4A 1USTA 5ICCA 2Y9ZA 1SD5A 3S17J 2DTRA 2O8XA 2QM3A 3JR9A 4RB0A 5LHGA 1Q1VA 2JWTA 3M8EA 2E1MC 4BACA 3PNVA 3HHGA 3C3WA 3GFMA 1OCTC 2IS2A 2K9SA 4LB5A 1KA8A 5AONA 4YIFA 1IO2A 4HW0A 2FQ4A 5KCMA 2CMPA 2GIVA 3QRFF 1UHMA 2XGDA 2CO5A 3WTVC 2XC7A 5GPAA 3KP7A 5FLXK 1OLTA 3QPTA 1J2XA 2F5CA 3W2WA 3C2BA 4CZZA 3ABMH 1F36A 5BPIA 1X2MA 1V5EA 5LEKA 5M3FJ 3SZGA 4U0YA 1Z0XA 2ZB9A 1Z77A 2JA2A 3B02A 2FOWA 1B1BA 5IT9Z 1O3RA 2Z99A 3OYIA 3TP3A 3K4LA 5B1AH 3C1DA 4CA0A 4M74A 4GDFA 1QZYA 1TL8A 1DGWY 1J9IA 5E20A 4BJTA 1TNSA 2DBBA 4AU7A 3ZQ7A 5JVGF 2DA2A 2VXDA 2IVMA 4ABZA 3D5LA 3OYAA 4BBRJ 2RNGA 1ZG1A 2K9NA 1HKSA 1JJ8C 2DT7B 2ISYA 4MNUA 1KU9A 2IGMA 5FLMJ 5EEHA 3OYEA 4IRHA 5KHDA 5D8LB 1P4WA 1HXDA 1OKRA 3F8MA 4RA2A 3HOXJ 1DDNA 3GEZA 5JFRA 5EG0B 3HOYJ 1LPQA 2VZNA 2Y0MA 1LE8B 1XPXA 2VT2A 5DD8A 1JI8A 3R60A 1SVMA 4OAYA 2V7FA 4ZJZA 1O7FA 2QSHX 2CUZA 3LWFA 3FISA 3W6JB 2BBYA 3BQZA 3PQJA 3U2RA 2GA2A 3HOUJ 1VNDA 2E1NA 1J75A 1R4NB 1WH7A 2DYRH 2FEZA 3K4MA 3CJTB 2ZJRF 1TQMA 2FF4A 4II3A 4A0ZA 2EB7A 3WODF 5HNHA 2MGQA 4G2UA 3I4MJ 3CP8A 2EZHA 1NG7A 2RVCA 3FIWA 3TO6A 5E3OA 1BA5A 2IBDA 2UXNA 2ZSHB 1PUEE 2ZCWA 4B47A 3OYCA 2HS5A 3I3LA 3ULQB 1W1WE 4F7ZA 4HSRA 3CD6I 5CVRA 3ESWB 5HLHA 2HQ5A 3K2ZA 2VL8A 2CV0A 2M4GA 3ZPLA 4HOBA 4IQ4A 2XUBA 3PQKA 2Z5UA 2F4OB 3F6VA 2NXNB 3A02A 2HOEA 4OIOF 3HOTA 3VSKA 2M9HA 1W7PA 3L2WA 4O6JA 3PO2J 2P0WA 3ELKA 3ZMDA 2RQQA 4C2MJ 2OZUA 2DQLA 2ZXHA 3IHUA 3VODA 1D1AA 1MKMA 3DV8A 4RGUA 2KLOA 3OOPA 3HB9A 4ZC3A 2V1UA 1Z3YA 3QOPA 1K79A 2X1DA 3DTKA 3K9TA 2D45A 2MFZA 2BW3A 3AG2H 1E2XA 4D5CA 4LIVA 3P7NA 3CCMI 3BJOA 1R58A 1B9NA 3GFLA 3T8TA 1W7PB 2H09A 5HOOA 2F5EA 4IO9F 4A0YA 3I71A 3ZMTA 4BEHB 3MFKA 4LJZF 4M3BA 2R7OA 4Y3OA 3LL7A 2DJIA 3CLOA 3J81K 3VB2A 4YFXF 4V2FA 2X4HA 3GCMA 3CCRI 4WK8F 3L1PA 4DW6A 4KJZA 4BYYA 5D4RA 1MMAA 2MBFA 2HEOA 4PDKA 3VWBA 3S6VA 4ENKA 4RAZA 1I6HJ 2FBIA 3OMYA 3S1RJ 3FXOA 1GXQA 2PQ8A 4WF2A 2IGKA 3E5UA 4H0EA 3GW2A 2EFWA 4S0HB 3K7AJ 5F6FA 1FSHA 2ESHA 4ETSA 5IYCJ 3CO7C 2JUGA 1F5TA 3BCAA 4U0WA 1UAAA 3O3KA 3CC2I 3T8RA 3I56I 1MSEC 1XDSA 2EV6A 2F5VA 2HKOA 3BWGA 3H5RA 1KQ9A 3SZTA 5JLWA 3Q2UA 2KT0A 3CO6C 3M9AA 3BZ6A 1I3AA 5H6QA 2WTEA 3GF2A 2Q0OA 4J01A 1OR7A 1KYZA 2EFNA 1G3YA 3KZYA 1XCVA 2FXAA 4JX5A 1U6GA 2M87A 1JTYA 1NG6A 1G6NA 2E34A 2QCOA 2CFOA 2BEOA 3Q0WA 2R7QA 1OYYA 4MGRA 1FNNA 4OIQF 1WJBA 3HRUA
chains in the Genus database with same CATH topology
2VZNA 2DDBA 1XX5A 2CQ7A 3U3UC 4IFAA 1WVRA 3Q2RA 3U3LC 5JYSA 3Q2UA 4P27A 4D53A 1SMBA 4NUOA 2EPFA 2GIZA 4TPVA 3NT8A 1CFEA 4AIWA 4H0AA 2A05A 3S6VA 4NUKA 5ETEA 3S6SA 3MZ8A 2DDAA 4NUNA 3U3NC 1RC9A 3S6UA 4G2UA 4NUIA 4LY5A 1XTAA 1QNXA 1U53A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VZN A;  2DDB A;  1XX5 A;  2CQ7 A;  3U3U C;  4IFA A;  1WVR A;  3Q2R A;  3U3L C;  5JYS A;  3Q2U A;  4P27 A;  4D53 A;  1SMB A;  4NUO A;  2EPF A;  2GIZ A;  4TPV A;  3NT8 A;  1CFE A;  4AIW A;  4H0A A;  2A05 A;  3S6V A;  4NUK A;  5ETE A;  3S6S A;  3MZ8 A;  2DDA A;  4NUN A;  3U3N C;  1RC9 A;  3S6U A;  4G2U A;  4NUI A;  4LY5 A;  1XTA A;  1QNX A;  1U53 A; 
#chains in the Genus database with same CATH topology
 1XG1 A;  2COB A;  2FMY A;  4IF4 A;  3HKZ A;  2K9Q A;  2LNB A;  3HGG A;  2E35 A;  3KLN A;  1ON1 A;  4X0G A;  1FIA A;  3G6E I;  3R61 A;  3Q5F A;  4A3C J;  2H8W A;  1SFU A;  1AA7 A;  4RGX A;  2X9D A;  5EDN A;  4XKV A;  5L3D A;  3JSO A;  4E7K A;  2HXI A;  4DZP A;  3RTR A;  1Z3X A;  2MG4 A;  2JQ7 A;  4ESJ A;  1TWA J;  1PYV A;  3CJQ B;  2C6Y A;  5M3M J;  4QIW N;  3FHN A;  4U87 A;  5FRO A;  4LG3 A;  3WTU C;  2L4A A;  1D5Y A;  3OYM A;  2R7F A;  3PL8 A;  3TOB A;  1X58 A;  3FK7 A;  3WTT C;  3DXJ F;  1MNE A;  3V8K A;  1SMT A;  1SVL A;  2KFD A;  3BP8 A;  2NVU B;  4PFO A;  2ESN A;  2O6G E;  3WHB A;  2Z9O A;  2DA6 A;  2TDX A;  4XLN F;  1YQA A;  5EEA A;  5EF6 A;  3MKZ A;  2Q2E A;  4HF0 A;  1W4M A;  2CRG A;  4LK0 F;  3A0H C;  3HOV J;  4V2G A;  4EV0 A;  1UB9 A;  4LGW A;  3BT9 A;  3KZZ A;  3VSL A;  1WJC A;  2DA5 A;  2NVX J;  4N4O B;  4D9J A;  3WTX C;  2R7D A;  5F27 A;  3P9K A;  2L2O A;  2PJR B;  4CCM A;  5IOY A;  4U7D A;  1OCC H;  3CCE I;  3ZN1 A;  3IH3 A;  3KE2 A;  4KN7 X;  2LY1 A;  3E6M A;  1K4S A;  3WGG A;  4BBS J;  1ZN2 A;  1QHH D;  1SFO J;  2KIF A;  1A5J A;  1S7A A;  5FKM A;  2GOX B;  2DA4 A;  4KFC A;  3PJR A;  2NRA C;  2HFH A;  1OYW A;  1N75 A;  2IPQ X;  3HTU A;  1S7O A;  1ACI A;  3WTY C;  1B8I A;  3FKJ A;  4E6K G;  1D1C A;  4FIS A;  5CVV A;  2KRH A;  5FKO A;  4HRI A;  4OAZ A;  3HDD A;  3KEY A;  1BJA A;  3I5U A;  4LG0 B;  1YW7 A;  3SDG A;  1MDM B;  4A2U A;  3E5Q A;  2V1D A;  1IZ1 A;  4HQM A;  5HDK A;  2XF5 A;  1O3T A;  3TBI A;  2HNH A;  1KQ8 A;  1QNT A;  2HDW A;  1K7A A;  3TW7 A;  2L7K A;  3HXL A;  3HJE A;  4AYB N;  5CKT A;  1MMS A;  3RJP A;  1GHC A;  1OCP A;  4PFP A;  1ON2 A;  1B8I B;  4XRS G;  5JI6 A;  2Y48 A;  4UUS B;  1A04 A;  1IN8 A;  1XX5 A;  3V7R A;  3F8C A;  1A31 A;  4FTH A;  2OQR A;  3OYF A;  1MIJ A;  3OOU A;  1R5I D;  1ENH A;  1DUX C;  4DBR A;  3Q0U A;  4OIN F;  2IJL A;  2YUS A;  1LDK B;  1U9N A;  1BIA A;  1X3W B;  4M3G A;  2HDC A;  4E7H A;  3LNQ A;  2KZG A;  2NYX A;  4L9T A;  5D6E A;  2W25 A;  4BHP A;  1BR1 A;  1S72 I;  4H4K C;  1EKE A;  4C30 A;  3H9J A;  4XOT A;  2LBF B;  2COM A;  3BR6 A;  1VQ9 I;  3LAJ A;  2O0Y A;  1FLI A;  2VJ5 A;  5GTH C;  4Q47 A;  4KT5 C;  1OYI A;  1SVO A;  3FXL A;  5J40 A;  3VFZ A;  1X1C A;  1YG2 A;  4U0V A;  4HBL A;  5HOD A;  1JGS A;  2W1O A;  4N0B A;  2OA4 A;  1QBJ A;  2LDU A;  3DBR B;  1VQP I;  4IJA A;  2VPR A;  1QZE A;  3VOE A;  5K5R A;  4GGG A;  2E1O A;  4JP0 A;  1OCR H;  1VZ0 A;  2BY3 A;  1REP C;  4C3H J;  1IN4 A;  2DJN A;  2W82 A;  3J7A O;  1EH6 A;  2LK2 A;  2XRN A;  2ME6 A;  5L3C A;  1MZB A;  4WXC A;  1IDZ A;  1O4X A;  4QSH A;  3ZR8 X;  4P5O A;  3E6C C;  3LA7 A;  4PJJ A;  4AVZ A;  5DDG A;  1OR7 C;  2GBY A;  2JUC A;  1JKQ C;  1AHD P;  1HW2 A;  3RKX A;  2ADU A;  1ITY A;  5ERI A;  3E1S A;  4IEJ A;  1KYW A;  1MBJ A;  2FJ1 A;  4KIB A;  3COA C;  4XK4 A;  3JRE A;  3VEP A;  2VAS A;  5B66 C;  3CES A;  3MEX A;  5EYR A;  2CW8 A;  1FPQ A;  5C4X J;  5LBQ A;  1BIB A;  1CF7 B;  1XDU A;  2YX7 A;  2IXS A;  1X4O A;  2A5W A;  3OV8 A;  1H9G A;  2VB6 A;  3Q3S A;  3G1L A;  5L3B A;  4IHY A;  2MH2 A;  4KUM A;  2L54 A;  3BRO A;  3LMM A;  3NWT A;  2M30 A;  1H0M A;  2VN2 A;  3H3Z A;  1QNX A;  3KEO A;  1BN5 A;  3WG9 A;  2OC6 A;  2VQL A;  4F93 B;  4GFB A;  1FOY A;  5DM7 F;  3S93 A;  2X51 A;  1STZ A;  5ICG A;  3HUG B;  1ONV A;  2K3P A;  4I99 C;  3D0S A;  2L9V A;  1Y0N A;  3DEU A;  2MYS A;  3GTP J;  2ZO4 A;  2K9L A;  3L2C A;  3S16 J;  2K40 A;  3TP0 A;  2R7W A;  1J09 A;  2AO9 A;  1P92 A;  2DYS H;  4MQV A;  3RDI A;  2F48 A;  3FM5 A;  4HF2 A;  3QP5 A;  3U3N C;  3Q9V A;  2DMT A;  4F52 A;  5KVR A;  3ZOB A;  3GTK J;  1HBX G;  5J1U A;  4LLN A;  4Z2Y A;  3TL4 X;  1NH3 A;  3GTG J;  2LF7 A;  1BW5 A;  3E7L A;  1MD0 A;  4G94 A;  2EA4 A;  4JYK A;  3AG3 H;  3DFG A;  4XSX F;  1WVR A;  1K6Y A;  4Y7N J;  2BY0 A;  2EV5 A;  2DA3 A;  5GP9 A;  2DFF A;  1ETW A;  4M6V A;  1TC3 C;  2EZK A;  1R1V A;  4BXU A;  1VQ4 I;  4EJT A;  1RIO H;  2K86 A;  1S3J A;  1SEU A;  1LDJ A;  3KP4 A;  1DPR A;  3DU6 A;  1IN5 A;  1UHS A;  2XV4 S;  3PNY A;  2K85 A;  4QPO A;  4AIW A;  2GA1 A;  4RM3 A;  2BVL A;  2EK5 A;  3OYL A;  9ANT A;  2OAZ A;  5K7H A;  2XF7 A;  5DCM B;  3HTS B;  4B3A A;  2VQH A;  5FLV A;  1TWC J;  3ROU A;  4I0B A;  2QYO A;  1TP4 A;  2CUJ A;  2M8G X;  1FEX A;  2JA5 J;  1E3P A;  2DOF A;  3IRQ A;  3ML6 A;  1Y39 A;  3CMM A;  3GME A;  4MIM A;  1T6S A;  4HZF A;  1YRN A;  3CMY A;  3OL4 A;  5F0C A;  2H1L A;  1BJZ A;  1G4D A;  2W48 A;  4PJ0 C;  1IW7 F;  4HQE A;  4UVB A;  3CF5 F;  2UWM A;  2IW5 A;  4IKF A;  1WRJ A;  3MKL A;  3T1B A;  4E4H A;  3AG4 H;  1FOX A;  4XN0 A;  2FX0 A;  2BY1 A;  1BL0 A;  3W3C A;  1FYM A;  4DNC A;  3G1O A;  1HKQ A;  1RI7 A;  3TOA A;  3DTE A;  1VQO I;  1ZLJ A;  3S32 A;  4HX8 A;  1Z67 A;  1Z7U A;  3PSI A;  3I55 I;  4B43 A;  3PO3 J;  3K69 A;  4C2U A;  1QPM A;  3JW4 A;  4ZYD A;  3NT8 A;  4RDU A;  1MBE A;  4FET A;  1Q1H A;  2N8G A;  2NS0 A;  4RGR A;  3VYU B;  5FRN A;  1X19 A;  2XPV A;  1ETY A;  2FBK A;  1HKT A;  4BJ6 C;  5J8F A;  1G59 A;  1TQP A;  3DBL B;  2FE3 A;  3ZMS A;  3EET A;  5FKN A;  3O6B B;  4MHG A;  2ZFU A;  3DQV C;  2XB5 A;  1P9Q C;  2M8E A;  3K4K A;  3SEZ A;  3OWT A;  4FCY A;  2GLO A;  2ZNZ A;  2JVG A;  2QQA A;  3CDI A;  4B1R A;  1HST A;  4RAG A;  4BJ5 C;  4NC6 A;  4IOA F;  1WI9 A;  3LA2 A;  3KLO A;  3DEW A;  3GFJ A;  2KHM A;  4BQQ A;  2R0Q C;  4Y15 A;  3FXQ A;  4NUB A;  4CH7 A;  2D1H A;  4A3D J;  4ZDL A;  1LNW A;  3ERM A;  2OBP A;  2VBX A;  3QQA A;  4HG2 A;  4S04 A;  2JRM A;  1RET A;  3MWM A;  2OCE A;  1CQT A;  4BHC A;  5EGO B;  5ICF A;  2L3D A;  4HNU A;  3RZD J;  3W6V A;  2GOM A;  5HLG A;  2DDB A;  3I9V 2;  2HDD A;  5CLS A;  1MH3 A;  3RZO J;  4IQJ A;  5KAF C;  1PP7 U;  3R4K A;  2PX9 A;  2NNN A;  3TKY A;  1IGN A;  2FML A;  1GDT A;  3CP2 A;  3CF2 A;  5LEJ A;  3FKI J;  2XVC A;  2F4I A;  4CCO A;  2ZFW A;  4LMY A;  4XLF A;  3CUQ C;  1T33 A;  3PIP F;  1VQ7 I;  1IRX A;  4F55 A;  2L9R A;  2P5V A;  2OJE D;  3ZQF A;  3HOS A;  4UVA A;  2VI6 A;  1P7J A;  4ZDO A;  2KRF A;  3M1C A;  4QTR A;  2EIM H;  3WTS C;  2EA2 A;  4XKB A;  2KDO A;  2QSF X;  1MMG A;  2YX4 A;  1LEA A;  3FZV A;  1WJF A;  3U1D A;  3W6K B;  2F5F A;  1B6A A;  1A6Q A;  4H0A A;  4A6D A;  3QP6 A;  3AKZ A;  3JRH A;  4HF1 A;  1NK3 P;  4G7O F;  3MZ8 A;  1QQI A;  3F6O A;  1FX7 A;  1BI0 A;  5HS8 A;  3CCQ I;  1MGT A;  4MFE A;  5IT9 K;  3TDZ C;  3HIF A;  4M6X A;  4UHT A;  4JBA A;  4NUI A;  2A69 F;  1LEB A;  3ERE D;  3TDU C;  2VQG A;  4UY8 I;  2HOS A;  3CQZ J;  1UZC A;  1Y56 A;  4HX7 A;  2HYF A;  1Z21 A;  5DTD A;  4Q5S F;  3IL2 A;  4U88 A;  1JUP A;  2E19 A;  4FX4 A;  3BCB A;  3S3M A;  1YYV A;  2OPT A;  5GPC A;  4UB6 C;  5EG0 A;  4PSX A;  4G7Z F;  1LE8 A;  1A6I A;  2BHZ A;  1BOB A;  3O8G A;  1O3Q A;  3LFK A;  3EQL F;  5JYS A;  4RM2 A;  5FFX A;  3FHZ A;  2XRO A;  2IA1 A;  4EAT A;  5BMZ A;  4B3X A;  4HDV A;  1YS6 A;  3CCJ I;  3SFI A;  1B72 B;  4RAY A;  5D5V B;  1LVA A;  2HI3 A;  2QGU A;  1ZH5 A;  3MD2 A;  5GAH J;  3K70 C;  1A35 A;  2IEK A;  5LHI A;  2QZ8 A;  2YU3 A;  5HS7 A;  2DU9 A;  1BI3 A;  2VKV A;  1H88 C;  1ORK A;  3K1N A;  5E1W A;  2A6T A;  2JA7 J;  4IFA A;  4PUS A;  1FBU A;  2JSP A;  1JHF A;  4Y33 A;  3WE3 A;  5A2Q Z;  3QOE A;  1JXS A;  1JUM A;  2AHQ A;  3KIO A;  2HOT A;  3QOD A;  2PMZ N;  1VQ5 I;  5E3L A;  5HDG A;  2JK3 A;  1R5G A;  4HYE A;  4EGY A;  1HA8 A;  3DP7 A;  4AID A;  1VFC A;  1RR8 C;  1HLV A;  3RQI A;  1I5Z A;  1JKR C;  3J7A Y;  1WKM A;  4CCN A;  1IXR C;  4RS8 A;  1RUN A;  2HTJ A;  3K70 D;  4R8H A;  3GZ6 A;  4BDY A;  5KNL A;  2KZV A;  3DKW A;  3S8P A;  2H27 A;  5KK1 A;  4Y52 J;  3FXU A;  2E60 A;  2W7N A;  1W0T A;  1OIS A;  4HX4 A;  1IV6 A;  2V6E A;  1USS A;  1PVE A;  3MVP A;  4AYB A;  5F0F A;  1AOY A;  4YII A;  3IKV A;  4PGG A;  3QU6 A;  3GXO A;  1E3O C;  3EDP A;  4YIR X;  4DQ2 A;  4W1U A;  1JJ6 C;  1D3Y A;  2DOE A;  2VXZ A;  2OF7 A;  3GBG A;  3H1C A;  5J8C A;  1ZTR A;  3BR3 A;  4ZYE A;  3L2Q A;  1FOK A;  2X1E A;  2KKO A;  3D5R C;  3LSK A;  2CS3 A;  4D1Q A;  2FQ3 A;  4MLO A;  1HOM A;  3R0A A;  1XTA A;  3LSJ A;  1CGP A;  5CJ9 A;  3SYT A;  2O03 A;  2E2H J;  1WZ2 A;  3HHH A;  1SD7 A;  2MD5 A;  3HM5 A;  2QKM B;  4NB5 A;  4BEH A;  1SMY F;  1W5T A;  3BJ6 A;  3ISP A;  1LFB A;  1HW5 A;  2YR2 A;  1FBS A;  4AUX A;  3K1M A;  3EYY A;  2PN6 A;  3NQO A;  4M9X A;  2P7V B;  2L4M A;  3O8H A;  4Q48 A;  3WE2 A;  3S6S A;  4M3E A;  1Y1W J;  1FT9 A;  5GAE J;  4BL0 B;  2STT A;  3TGN A;  4L0Y B;  3LQR A;  2JZY A;  3ZRG A;  5BS6 A;  4MEX F;  4I2O A;  4L5E A;  4ZYA A;  3OYD A;  2H8R A;  3JAM Z;  3MAJ A;  2ISZ A;  2W57 A;  4EJV A;  3ZQI A;  3FXK A;  3CCU I;  2Z1D A;  2XAH A;  1DP3 A;  4A3G J;  5CQE A;  5K7F A;  5D5W B;  5IYB J;  2B63 J;  2LR8 A;  2Z16 A;  2NVY J;  3B73 A;  4D7M A;  4RLQ A;  1Z7L A;  1Z1D A;  2XGC A;  3ZMZ A;  3A2K A;  3VYT B;  1LVK A;  1BR2 A;  5GTI C;  4DGW B;  5ED4 A;  1VTN C;  1JGG A;  3MN2 A;  4RB3 C;  4ZYG A;  2HVQ A;  3FX3 A;  4JX4 A;  5L3F A;  1QVU A;  1S29 A;  3OR1 C;  5CVI A;  5L3G A;  1TWG J;  4M9Z A;  1XMX A;  1GLN A;  1IG7 A;  2O3F A;  1FY7 A;  5TGT A;  3ZQH A;  1S8N A;  2K27 A;  2VKD A;  4TPV A;  1DU6 A;  5C4J J;  1S7E A;  4CYC B;  4A12 A;  5DUK A;  1VQM I;  1LFP A;  1X4P A;  3RSN A;  2Y30 A;  3QU3 A;  4HDU A;  2CQQ A;  1U8B A;  4P55 A;  1XGN A;  2EIL H;  4CDG A;  1SFX A;  2HQA A;  3S2D J;  4LY5 A;  2FNA A;  2ZXJ A;  2M5W A;  3IP4 B;  2LTP A;  2P81 A;  3OSF A;  3S15 J;  2IA2 A;  3BTL A;  3F22 A;  2JT1 A;  3U3U C;  1GVD A;  5LGT A;  3FMQ A;  3MKW B;  1ZQ3 P;  2CU7 A;  1IXC A;  2ZKZ A;  3DPT A;  4EM1 A;  2KDZ A;  1TW2 A;  1FC3 A;  2Z33 A;  1MNM C;  1MW7 A;  2CW0 F;  2DW4 A;  4IHS A;  1RPW A;  2MW8 A;  1D8K A;  1UG0 A;  3H9G A;  4NBQ A;  3MZH A;  1U0J A;  2CQK A;  2CSO A;  2P4W A;  3MMY B;  3S3N A;  3BTJ A;  3F3X A;  3CCY A;  2LKS A;  3OYK A;  4C2T A;  1R7J A;  1V54 H;  2HR3 A;  2LLK A;  4IPA A;  3L2R A;  1ZRC A;  2CWE A;  4F3Q A;  3DWL E;  4W97 A;  5CVU A;  2PJR A;  2GWR A;  5F64 A;  1ETQ A;  2OTL I;  3RKQ A;  1C0W A;  1JTX A;  3RPU A;  2EIK H;  1TWF J;  2DLL A;  3KYC B;  3JRA A;  3JRI A;  1NK2 P;  2Y69 H;  3C2G A;  3IUO A;  5LGU A;  1HF0 A;  3F8B A;  2NVQ J;  2KPM A;  2PI0 A;  2BGC A;  4EJO A;  3E5X A;  5JVT A;  1XMK A;  1MH4 A;  2Z3Y A;  4BUP A;  2FUG 2;  4BXF A;  1X3U A;  2DK5 A;  3L09 A;  5LGN A;  3GVA A;  1B4A A;  3PIO F;  1IRG A;  1DQU A;  1MJB A;  2DMN A;  2R4G A;  3Q2R A;  3U3L C;  2E2I J;  2VBY A;  1H9T A;  1HSJ A;  1IJW C;  5D4S A;  3ABT A;  4LG0 A;  4EM2 A;  5GAD J;  3PFI A;  1MDM A;  4O3M A;  2HGC A;  2XHK A;  1KQ0 A;  4UNO A;  1OCO H;  2LC2 A;  3S1M J;  2KJC A;  2XDV A;  1RUO A;  2WY8 Q;  3DEE A;  1UFM A;  2TRT A;  2J5O A;  5IP7 J;  2DOD A;  2PMU A;  1FP2 A;  4DIQ A;  2QUF A;  4IHW A;  2K4J A;  2HU9 A;  1JE8 A;  1V5F A;  3Q9S A;  4E7J A;  2AXL A;  2I5U A;  4EGZ A;  2O7O A;  4BDZ A;  1S5L C;  2RNJ A;  4UUS A;  5BNG A;  4BQN A;  4EM0 B;  2FSW A;  1IN6 A;  1JHH A;  4OIR F;  4XOR A;  3M3Y J;  4UV9 A;  4BXX J;  1T0F A;  4B8X A;  1Z6R A;  5EEG A;  2LRE A;  2LP0 A;  4GXO A;  1P7I A;  2B0L A;  3I58 A;  4M3D A;  2RKH A;  3DKX A;  4XKW A;  4XR6 A;  1TQI A;  1W0U A;  4BY7 J;  1M1E B;  5DEQ A;  4DYQ A;  4KIC A;  2UV1 A;  3RIR A;  3HL2 A;  2R7V A;  5FJ8 J;  2IS6 A;  2WB1 N;  4XID A;  2R92 J;  2P7C B;  1X2N A;  2XPU A;  1RES A;  4WWC A;  3L2U A;  2LBF A;  4CIC A;  4B44 A;  4KMF A;  2R5Y B;  1D5V A;  5C44 J;  1P4A A;  5GAG J;  4IRI A;  3K0L A;  1IRF A;  2P6T A;  3ZQC A;  1F4K A;  2KJB A;  2CV1 A;  2VIX A;  1SMB A;  3AL0 B;  3KX2 A;  1ZAR A;  1H8A C;  3VDX A;  1VQK I;  2CUF A;  2EV0 A;  4RB2 C;  3TW6 A;  2PFB A;  2V79 A;  3SJM A;  2X6X A;  2LVS A;  2DT6 A;  1U5T B;  3MZY A;  3BOQ A;  3BZC A;  4MQ9 F;  5HLT A;  4S05 A;  2CQN A;  3WHC A;  3JRC A;  2E2J J;  2V9P A;  1PUF A;  3GTO J;  4MEY F;  1TW3 A;  1ZGA A;  1W7P D;  2YU9 J;  4OIP F;  4EJW A;  2HWV A;  4QPQ A;  4LB6 B;  5HDN A;  1J0R A;  2A61 A;  5F1J A;  2LD5 A;  1IC8 A;  4B48 A;  3EUA A;  1WWX A;  4R79 A;  4D53 A;  1XMA A;  1MBG A;  2LG4 A;  5LFA A;  2UZK A;  3N4M A;  2E5N A;  3CJR B;  4E7L A;  1YE9 A;  2M3A A;  3X2Q H;  1XN7 A;  3E0J B;  1GV5 A;  5D8K B;  1BW6 A;  3IWF A;  1AWC A;  2L0K A;  4XN3 A;  2HOA A;  4XBF A;  4A3J J;  3GYH X;  4ZH4 F;  1MBF A;  2BHY A;  2ACJ A;  1PUF B;  4FT8 A;  1UHW A;  1DGR M;  1YJ9 I;  2VKH A;  3EUK L;  1L3L A;  2GZW A;  3G4S I;  2X85 A;  1XCB A;  4NC7 A;  1O7L A;  2G7U A;  1BC7 C;  2QEN A;  1TT0 A;  4ENJ A;  2UXX A;  4I02 A;  3REO A;  4NQW B;  4P27 A;  1T98 A;  3BR5 A;  3RCO A;  1XSX A;  2E1C A;  2ZME B;  1MMN A;  3VYS B;  1NHA A;  4OMZ A;  1CF7 A;  3C7J A;  3NEU A;  4PSW A;  1OFC X;  3ECO A;  4M3F A;  5F0H A;  3S14 J;  3OS1 A;  4G8X A;  1IUY A;  3F21 A;  1Y8R B;  5DS9 A;  2DO7 A;  4AIJ A;  2WV1 A;  2YS9 A;  3P9C A;  2P8T A;  3K4B A;  4D5F A;  4BY1 J;  2F4M B;  3U9G A;  4C9Y A;  1W36 C;  1SAU A;  3HUG A;  3FDY A;  4KDP A;  4A3B J;  1X3Z B;  3LOC A;  4GRI A;  2JRT A;  1ZG5 A;  1W5C C;  3IKT A;  2LY9 A;  2X6Y A;  2A05 A;  3BTI A;  4E7I A;  4KT6 A;  3HG9 A;  1TZL A;  1FIP A;  2ETH A;  1U78 A;  2M7A A;  1ZEL A;  5IPA A;  1ZRF A;  4M9S A;  1FBQ A;  5F1R A;  5E18 F;  3PNT A;  3F23 A;  3K10 A;  1U53 A;  2DFE A;  1KZH A;  2KQR A;  3H92 A;  1KU2 A;  5M5X J;  2H6B A;  4HLY A;  1J5Y A;  4BU2 A;  4X6A J;  3K4J A;  4MFD A;  4FAS D;  1W36 D;  2BOL A;  2E1M B;  1IUF A;  1VI0 A;  3K4C A;  2DXI A;  1PDN C;  3HC7 A;  3WTZ A;  2QF7 A;  2JA8 J;  2ZJ2 A;  4B09 A;  1T8I A;  3NWS A;  3CUQ B;  3BR1 A;  3ASN H;  3NAR A;  1N25 A;  4HAM A;  4A3F J;  1LJ9 A;  1TBX A;  2V1N A;  5DCM A;  2L5Q A;  3ABK H;  3ECH A;  4L0Z B;  2PMZ A;  3EYI A;  2X1C A;  2HVR A;  2ZSI B;  2NS7 A;  4F92 B;  4XOP A;  2R7U A;  4YFN F;  2M45 A;  4L9J A;  3RYP A;  3OL3 A;  5M5W J;  3IH2 A;  3DLA A;  1FWZ A;  4N9H A;  4UV8 A;  3J80 Z;  3UR3 C;  4X1E A;  1X1B A;  4C3I J;  4J19 A;  2PBI A;  4FHT A;  4XL9 A;  3CUO A;  4L9V A;  3TQN A;  3UNG C;  1OMI A;  1IV8 A;  3H36 A;  4A3M J;  2R5Z A;  2OQG A;  2HPI A;  3QAH A;  4P9F A;  3OIQ A;  4CCJ A;  1R4M B;  4ZTF A;  1V55 H;  1ZKG A;  1EA3 A;  3JSP A;  1YI2 I;  4WX9 A;  2W85 A;  2HTS A;  1ZAO A;  3LST A;  3R0J A;  1MJ9 A;  3TO9 A;  1KU7 A;  2GXA A;  4M73 A;  1F9N A;  4YEL A;  4B4C A;  1G3W A;  4IRG A;  4ASN A;  4JK1 X;  1BC8 C;  2RRE A;  1HDD C;  1PJR A;  2CUE A;  1T0F C;  2MAB A;  5LRS A;  1BOA A;  1ZK8 A;  3EUH A;  1P2F A;  2KIU A;  2FA5 A;  3MCZ A;  2R5Z B;  1R9T J;  2R3S A;  2MLK A;  2WAQ N;  2GAU A;  1YJN I;  1ZR2 A;  2X6W A;  4PJL A;  4XM3 A;  2Y0S N;  2M34 A;  3DKY A;  2FU4 A;  2CFX A;  1SC7 A;  2NNY A;  1YW9 A;  4XLA A;  1FSE A;  3G3Z A;  1BM9 A;  2LH9 A;  2VT3 A;  3F0C A;  3LSG A;  2XGE A;  1KU3 A;  3CCS I;  1OPC A;  1G3S A;  2O5R A;  2Z2S B;  2QWW A;  2E36 A;  4AVP A;  1I1G A;  1B9M A;  1DU0 A;  1WGX A;  1V5G A;  2QBY A;  3WGH A;  3T0Y A;  4K2E A;  2DFI A;  5CQG A;  1LFU P;  4HPQ A;  1U9O A;  5EGO A;  3PUB A;  4IZZ A;  1EJ9 A;  1Y8Q B;  4LFU A;  2F2E A;  3P5J A;  1RKT A;  5DUI A;  3OYB A;  2XSD C;  1SFK A;  5B3S H;  2QVO A;  5H6R A;  2EPF A;  5E8I A;  2O61 A;  4FX0 A;  4NNJ A;  2WAE A;  2XSJ C;  2LF8 A;  1YLF A;  5BQT A;  2WBM A;  4XLE A;  2QBY B;  1VQL I;  4BE1 A;  2RV8 A;  4MO7 A;  4RLF A;  1FJL A;  3S6U A;  3G73 A;  1J7K A;  4A3L J;  3GTM J;  1R6R A;  4A5N A;  1XSD A;  1JT6 A;  4XNF A;  2DT5 A;  2PEX A;  3C18 A;  1V3F A;  4WXD A;  5K1Y A;  4A6E A;  1ULY A;  3SDB A;  3HOZ J;  4HNT A;  1WCM J;  4J00 A;  1I1S A;  1TWH J;  3OYN A;  2GQQ A;  3HRS A;  1V4R A;  2MD0 A;  3GTQ J;  3ZCO A;  4NUK A;  2CJJ A;  1YHQ I;  3H3V K;  3HEF A;  2M2E A;  1YO5 C;  4NUN A;  1ZRE A;  4D7N A;  4XIC A;  2RDP A;  5J6X A;  1UEL B;  3BG6 A;  1I39 A;  1EH7 A;  5FD6 A;  3KFW X;  4A5M A;  3V7S A;  2VOP A;  5DD4 A;  3BC8 A;  2DQR A;  4CYD A;  5IP9 J;  2VJI A;  3JRB A;  1PP8 F;  4RGS A;  4KA4 A;  3ZP5 A;  2Q8K A;  2PMH A;  1QGP A;  3CC4 I;  2CG4 A;  5E3M A;  3BPX A;  3OSG A;  2R93 J;  3E6B A;  1WH5 A;  3H5A A;  3G1M A;  1P4X A;  4UXN A;  5ICE A;  3CCL I;  5ETE A;  3BPV A;  1R36 A;  3I53 A;  1GV2 A;  2ID6 A;  5L3E A;  1B72 A;  1R1U A;  3F8N A;  2XAG A;  2Y9Y A;  5FFZ A;  1XSV A;  1T39 A;  3GO5 A;  2VKE A;  2HPM A;  1AKH B;  1TTY A;  3FF5 A;  1ERD A;  4RMN A;  1MJA A;  3HPH A;  4IHV A;  4P96 A;  4I0A A;  4CO8 A;  1D8J A;  4IXA A;  4CCL A;  3AAF A;  1T38 A;  5FLX Z;  4AD9 A;  3CC7 I;  4IHX A;  3BQY A;  5F04 A;  5IY5 H;  2R7R A;  3WG7 H;  2RAE A;  1Y1V J;  3BG5 A;  5JHF A;  5DM6 F;  2IP2 A;  1OQY A;  2V9K A;  4ZYH A;  3OR2 C;  4CUG A;  1Z91 A;  3CMA I;  1YJW I;  2E5Z A;  2XF6 A;  2DI3 A;  4I09 A;  3S3O A;  4ZDP A;  3KCC A;  3E3V A;  3F9K A;  4LIU A;  3K6G A;  2LSO A;  1ETV A;  2DFH A;  1LB2 A;  3FBI B;  5B1B H;  3HSF A;  2OUM A;  2G9W A;  2LYC A;  2E7X A;  3CLQ A;  2W4S A;  4TV7 A;  2WC2 A;  3HOW J;  4BHB A;  1ODD A;  3KZI C;  2FD5 A;  1WQ2 A;  5EZG A;  3CDH A;  3PUF A;  3OS2 A;  2ZJP F;  5A2Q K;  3OIP A;  3KPH A;  4IX7 A;  3PFY A;  3QYE A;  2ICW G;  1N77 A;  2ECB A;  2QLZ A;  2L02 A;  1YIJ I;  4II2 A;  3V4G A;  3CCV I;  2KMU A;  5J4Y A;  1XS9 A;  3GLL A;  1UCR A;  2WAF A;  4XQF A;  2MA3 A;  2XAS A;  2WAD A;  2K7L A;  1WI3 A;  3BLY A;  5ILV A;  2EFP A;  4UUT A;  2GXB A;  2OD5 A;  2XPW A;  4HA8 A;  3R6S A;  4OU0 A;  1T95 A;  4JOM A;  2OTJ I;  1ZG3 A;  3CTA A;  2B7E A;  4HNV A;  1MBK A;  3V8J A;  5LHH A;  3OY9 A;  2WB1 A;  1JKP C;  2VOD A;  2LKX A;  5FKL A;  1WJE A;  3D1N I;  4UVC A;  1O3S A;  2A6H F;  2LOO A;  3BG3 A;  3LQQ A;  3N05 A;  3DPU A;  2F5D A;  3EUH C;  3A01 A;  2EH3 A;  3KP2 A;  3S2H J;  3JTG A;  1LUJ B;  4L5I A;  5J47 A;  3IV5 A;  4U7B A;  5C3E J;  2V26 A;  2MLG A;  1G8X A;  2XAF A;  1GT0 C;  4DJA A;  5J1Y A;  5LD2 C;  3ONQ A;  3W2V A;  3FXM A;  3IAS 2;  1ZR4 A;  2A07 F;  1YIO A;  2W24 A;  3RYR A;  2G0E A;  4LLG F;  1GVJ A;  2OV7 A;  3BR0 A;  3QPL A;  4M71 A;  4NUO A;  3BG9 A;  2EIJ H;  2G7H A;  4DBQ A;  2PJP A;  5J3L A;  2K4B A;  2QSG X;  2XKP A;  4HLX A;  4OWR B;  2EIN H;  3A01 B;  1Y6I A;  1U8R A;  4Q4Z F;  1E17 A;  5JHU A;  1D0Y A;  4N9I A;  5H2F C;  5B5E C;  1S9H A;  1BI1 A;  2K02 A;  3GZ5 A;  3SXY A;  1WFX A;  1E0E A;  1YW8 A;  4P9U A;  5D6F A;  3JAM K;  3LAP A;  3JCU C;  3I59 A;  4Y17 A;  1ZLK A;  4O5V A;  4MTE A;  3DLL F;  3BZK A;  4OOI A;  4BS9 A;  3UKG A;  1E3H A;  2STW A;  2VBZ A;  2KIM A;  3ABU A;  1WJA A;  3DBH B;  5E17 F;  4G6Q A;  3RKW A;  2I10 A;  2KL4 A;  4CXF A;  3KEQ A;  1LDD A;  4ZZL A;  3KP3 A;  2QKL B;  4CYC A;  5EZH A;  3BDD A;  4HEA 2;  1TLH B;  2BZT A;  5J4V A;  4I6Z A;  1A36 A;  4IOC F;  4A0X A;  3K2A A;  2EQR A;  3CJN A;  5FGM A;  2NVT J;  1FMV A;  3H35 A;  1QZZ A;  3U21 A;  1R22 A;  2QQ9 A;  3I59 B;  2YPR A;  1XGO A;  2CW7 A;  3G71 I;  4L9N A;  1I27 A;  3B6A A;  3J81 Z;  3LSR A;  2L01 A;  2RC4 A;  2K9M A;  5LRR A;  4XMY A;  3S1N J;  2HQN A;  3FMR A;  4P1W A;  4RAF A;  4XRS A;  3BTC A;  3HPG A;  2HZD A;  2BW3 B;  1APL C;  2HXO A;  4EQQ A;  3E6D A;  4HV5 A;  1HQC A;  2W84 A;  5M5Y J;  3ZGK A;  2ELK A;  2QQ8 A;  3RI4 A;  3H9Q A;  2BE5 F;  4EVI A;  3QWL A;  2QQB A;  1X1P A;  4FE4 A;  1XC5 A;  2JPC A;  1L0O C;  2AS5 F;  1VF9 A;  2KP6 A;  1XGM A;  1I3Q J;  4PJN A;  1D0Z A;  2JSC A;  1AU7 A;  3NRV A;  3RPQ A;  3F72 A;  2V4J C;  3GUD A;  1ZYR F;  3VYR B;  1UMQ A;  2X0L A;  3IC7 A;  1U3E M;  3ZN0 A;  2EWN A;  4KIT B;  1K6O A;  4I01 A;  2L7M P;  4I76 A;  4QWQ A;  4NHJ A;  3JRF A;  4FE7 A;  2RGV A;  5IT3 A;  3T5X A;  1K83 J;  2DN0 A;  2XRL A;  1R49 A;  2WA0 A;  2ID3 A;  4XLH A;  4YRV A;  3ZQG A;  1QRY A;  4CHU A;  3OYJ A;  4QLC U;  2R7X A;  3ZQL A;  4EEF G;  2LRD A;  3DU5 A;  3KP6 A;  2JN6 A;  2P5K A;  3F8F A;  1IRZ A;  4GCV A;  1CFE A;  1R23 A;  2VJ4 A;  1ZRD A;  4N4N B;  3KYL A;  2VE8 A;  4RB1 A;  4AIH A;  2VPL A;  1T56 A;  2K5C A;  2X48 A;  4C3J J;  1J59 A;  3QPH A;  2W00 A;  3ZQQ A;  1BR4 A;  2LMD A;  1GXP A;  5FKK A;  4CSW A;  3M7G A;  4ITV A;  1VQ8 I;  4ENN A;  2NOJ B;  2PLY A;  3M8F A;  2Y31 A;  3IAM 2;  2FNP A;  2LY2 A;  1YOV B;  2JTV A;  3HSR A;  3IWZ A;  3LA3 A;  2GIZ A;  4PGH A;  3A03 A;  1WJ5 A;  4LK1 F;  4A3E J;  4WXH A;  2RQP A;  4XSZ F;  5IOZ A;  4XRM A;  4BH9 A;  1EV7 A;  4GYI A;  4E7S A;  2EFQ A;  5DYM A;  4LIT A;  3L2V A;  4AIK A;  6PAX A;  4YEJ A;  2A6E F;  4BKX A;  3DF8 A;  2MSY A;  4ON0 A;  3RQ4 A;  2CQX A;  3SFZ A;  2NOG A;  3Q0V A;  3MKY B;  5BPD A;  2FRH A;  3W2A A;  2Q2E B;  2WAQ A;  1T2K A;  2R5Y A;  2DMQ A;  1HW1 A;  1YS7 A;  2EZI A;  2WY7 Q;  1ETO A;  2EBI A;  1SFE A;  3TED A;  3HGY A;  2Y0S A;  4XRF A;  2ELH A;  4JQF A;  2K3F A;  5CPR B;  3JRD A;  1WSU A;  1X1A A;  2IA0 A;  1FOW A;  3ZMU A;  2DDA A;  3JTH A;  4HV6 A;  2CGP A;  3TO7 A;  2QEX I;  4PZJ A;  2BXY A;  2BYV E;  2XGX A;  4KMU X;  5E8G A;  2P5L C;  2OZ6 A;  1U5T A;  3IRR A;  1XD7 A;  2VC0 A;  3E97 A;  2L9N A;  5BOX A;  1Z6T A;  1UJ8 A;  2VBW A;  3L00 A;  1EH8 A;  1TT5 B;  2GXG A;  5AIQ A;  1P6R A;  3C2H A;  1RRJ A;  4R1H A;  2DPD A;  3QYB A;  2UUZ A;  2MC4 A;  2IS4 A;  3LSH A;  2M4K A;  2NAZ A;  2XIG A;  2F6C A;  2H1K A;  1YIT I;  3QPS A;  1VQN I;  3HYI A;  2M7B A;  4GO1 A;  3FXR A;  5E3N A;  1ZGW A;  2JMW A;  1NTC A;  3LSM A;  2O9L A;  1FP1 D;  2HKX A;  2I8D A;  3M4O J;  4Y13 A;  4KIS A;  3ZXS A;  4Y4R A;  3A0B C;  5IP6 A;  2IT0 A;  2KIQ A;  5CYV A;  1IN7 A;  1K4T A;  3M07 A;  3ABL H;  1JT0 A;  4YFK F;  2E7W A;  4GYG A;  1IF1 A;  4ZZD A;  4CGZ A;  3H0G J;  5ILS A;  4NQW A;  2M0C A;  1ZGJ A;  3ASO H;  2WWY A;  2J5P A;  2ZME A;  1QO0 D;  1UG2 A;  2IAI A;  1YX3 A;  2RN7 A;  5EJC A;  1R00 A;  2XB0 X;  4D0P A;  2IS1 A;  5H20 A;  2VQC A;  3WU2 C;  1DP7 P;  3OYH A;  1QA6 A;  2EZL A;  2ZNY A;  1YX5 A;  3GWZ A;  5TJJ A;  4I98 B;  4G6T B;  2YSR A;  1Z05 A;  1FTT A;  2KIS A;  3KP5 A;  2VC1 A;  2ZXW H;  3DCF A;  1N78 A;  4BNC A;  4KIG A;  4BE0 A;  4PCQ A;  1RNL A;  2D1V A;  4Z6Y A;  2HZT A;  2HVS A;  4XLC A;  4G9Y A;  3I54 A;  4KIF A;  3N97 A;  4XLP F;  3BY6 A;  3PSF A;  4G6D A;  4OMY A;  3G2B A;  2QA4 I;  3IH4 A;  2CYY A;  3BG7 A;  1MMD A;  3KYD B;  3ZMV A;  1DPU A;  4IVN A;  4EMS A;  5HS9 A;  2DCE A;  2LFB A;  1I50 J;  3S1Q J;  2KRC A;  3FK6 A;  4F91 B;  2DK8 A;  5F08 A;  5ILU A;  3V42 A;  3LSI A;  5TRD A;  1SAN A;  2E71 A;  1D0X A;  1BI2 A;  2Q1Z B;  4UUV A;  1SD4 A;  4LD5 A;  4ZTJ A;  2VON A;  2CH0 A;  1WJD A;  1TNT A;  5IYD J;  2JVH A;  1HC8 A;  3AFH A;  2LKP A;  3CUQ A;  5K5Q A;  1F43 A;  3M8J A;  3GFI A;  3I4N J;  5E1Z B;  1WPK A;  2L9S A;  2XKO A;  1LKX A;  5FD5 A;  1S6L A;  1O57 A;  5AIP A;  2D5V A;  3I4P A;  1XB4 A;  2L7F P;  2HYJ A;  1HCR A;  2O8K A;  4DYR A;  2D2W A;  3HZJ A;  3D5S C;  3GZN B;  4CZC A;  3FBN B;  2MH9 A;  1FMW A;  2P6S A;  5D5U B;  3SZP A;  1U2W A;  2H6C A;  3L7W A;  4A3I J;  3CME I;  1MSF C;  3QYF A;  5LLQ A;  3HSE A;  2CV2 A;  1QPI A;  2XAJ A;  3HKZ N;  2ECC A;  4HST A;  4ENM A;  4I7H A;  4BQA A;  4L5J A;  3U1K A;  2HQR A;  2ELJ A;  4BQO A;  3A1Y A;  5K5O A;  4NDL A;  1R5H A;  3M1E A;  1ETK A;  3TMO A;  1MND A;  2IGO A;  3HRM A;  2BV6 A;  4E7Z A;  1Y0U A;  3JRG A;  3RKY A;  2OU2 A;  2XAQ A;  1I6X A;  3H0D A;  5J1R A;  2ZBK A;  3EPZ A;  3P9I A;  1POG A;  3FWE A;  5E79 C;  4A69 C;  3J80 K;  2A3S A;  3RPU D;  1QVT A;  3OYG A;  1EF4 A;  3FMS A;  2H94 A;  1FYK A;  1VQ6 I;  4BE2 A;  5HLI A;  3J7Y J;  1RC9 A;  1X1D A;  2DMU A;  2V6C A;  5FO5 A;  1W5S A;  4NC8 A;  2A68 F;  2A5Y B;  3SQN A;  2NS8 A;  1Z9C A;  1WHU A;  3L9F A;  4M6Y A;  4DZJ A;  4PJM A;  2AQF A;  2X6O A;  3WTW C;  3VPR A;  2EJR A;  2BXZ A;  3SHF A;  5TIS C;  3KET A;  2JA6 J;  3K4N A;  5HVQ C;  2ZJQ F;  1SAX A;  1XGS A;  1H89 C;  3H5N A;  2VOO A;  4E70 A;  4DYC A;  1G2H A;  5DCF A;  1RZ4 A;  3AL0 C;  1YFH A;  1ETX A;  5FRM A;  2IGN A;  3A4C A;  5HNF A;  2DTZ A;  4IL6 C;  4KN4 X;  3WU1 B;  5FB2 A;  4CCK A;  4DOZ A;  2Y2Z A;  1U5T C;  3MQ0 A;  2VE9 A;  5DV5 A;  1FZP B;  1QHG A;  4BGD A;  1KON A;  4V19 K;  1G3T A;  4LOC A;  1IXS B;  1FTZ A;  2DMP A;  3I64 A;  1JUS A;  2OCC H;  1R71 A;  2DPU A;  4JX6 A;  4MTD A;  3DPL C;  4A93 J;  1GUU A;  2V1X A;  3CZ6 A;  1D1B A;  1KGS A;  2VJJ A;  3V8L A;  3WGI A;  2BY2 A;  2L7Z A;  4WCG A;  4AM3 A;  2FBH A;  4L18 B;  3K1P A;  3LFU A;  4BAY A;  1K78 A;  3PM1 A;  1FYL A;  4FQG A;  4UB8 C;  4AWX B;  3NAU A;  4ESF A;  2Y75 A;  2MC3 A;  2R7T A;  4EJU A;  1T08 B;  2DAO A;  2XAU A;  2M0M A;  5K7Z A;  2BVM A;  2VLA A;  1LQ1 A;  1BBY A;  3HBL A;  1YRN B;  5JR3 A;  1YTY A;  2AQE A;  2ZXI A;  3FXJ A;  2AXT C;  1QU3 A;  3GTL J;  3GTJ J;  2EFO A;  1MBH A;  5KAI C;  1B59 A;  2FOK A;  2ME0 A;  2V9V A;  4ANJ A;  3S2W A;  1K78 B;  2B9S A;  1ZHF A;  2HYG D;  2ZC2 A;  1RR7 A;  3BR2 A;  4A3K J;  2ZME C;  4KNY A;  5D5X B;  5E1X A;  3I0T A;  1IAW A;  1SD6 A;  2TCT A;  3CDL A;  3DTI A;  3V7C A;  1HDP A;  3GX4 X;  2IRF G;  4ESB A;  3WU0 A;  2PG4 A;  4KYW A;  2CQ7 A;  4XKC A;  3FM3 A;  4G12 A;  1F1Z A;  1K61 A;  3LSP A;  5CVJ A;  2R7Z J;  3BJA A;  2DOA A;  1JKO C;  1R1T A;  1OJL A;  3O2P E;  2GM4 A;  2M1B A;  1OCZ H;  2R7S A;  3GLX A;  2VUM J;  2WV0 A;  4G7H F;  4XON A;  5JLX A;  4IHT A;  1RKW A;  2JPB A;  3HRT A;  3AG1 H;  4RBO A;  3SEQ A;  4AC0 A;  3J7Z I;  1IDY A;  4LLL A;  2JJ7 A;  2DA7 A;  1AKH A;  2DA1 A;  4YG2 F;  3B6C A;  3OS0 A;  3H3U A;  4M72 A;  3OIO A;  4PK4 A;  1UST A;  5ICC A;  2Y9Z A;  1SD5 A;  3S17 J;  2DTR A;  2O8X A;  2QM3 A;  3JR9 A;  4RB0 A;  5LHG A;  1Q1V A;  2JWT A;  3M8E A;  2E1M C;  4BAC A;  3PNV A;  3HHG A;  3C3W A;  3GFM A;  1OCT C;  2IS2 A;  2K9S A;  4LB5 A;  1KA8 A;  5AON A;  4YIF A;  1IO2 A;  4HW0 A;  2FQ4 A;  5KCM A;  2CMP A;  2GIV A;  3QRF F;  1UHM A;  2XGD A;  2CO5 A;  3WTV C;  2XC7 A;  5GPA A;  3KP7 A;  5FLX K;  1OLT A;  3QPT A;  1J2X A;  2F5C A;  3W2W A;  3C2B A;  4CZZ A;  3ABM H;  1F36 A;  5BPI A;  1X2M A;  1V5E A;  5LEK A;  5M3F J;  3SZG A;  4U0Y A;  1Z0X A;  2ZB9 A;  1Z77 A;  2JA2 A;  3B02 A;  2FOW A;  1B1B A;  5IT9 Z;  1O3R A;  2Z99 A;  3OYI A;  3TP3 A;  3K4L A;  5B1A H;  3C1D A;  4CA0 A;  4M74 A;  4GDF A;  1QZY A;  1TL8 A;  1DGW Y;  1J9I A;  5E20 A;  4BJT A;  1TNS A;  2DBB A;  4AU7 A;  3ZQ7 A;  5JVG F;  2DA2 A;  2VXD A;  2IVM A;  4ABZ A;  3D5L A;  3OYA A;  4BBR J;  2RNG A;  1ZG1 A;  2K9N A;  1HKS A;  1JJ8 C;  2DT7 B;  2ISY A;  4MNU A;  1KU9 A;  2IGM A;  5FLM J;  5EEH A;  3OYE A;  4IRH A;  5KHD A;  5D8L B;  1P4W A;  1HXD A;  1OKR A;  3F8M A;  4RA2 A;  3HOX J;  1DDN A;  3GEZ A;  5JFR A;  5EG0 B;  3HOY J;  1LPQ A;  2VZN A;  2Y0M A;  1LE8 B;  1XPX A;  2VT2 A;  5DD8 A;  1JI8 A;  3R60 A;  1SVM A;  4OAY A;  2V7F A;  4ZJZ A;  1O7F A;  2QSH X;  2CUZ A;  3LWF A;  3FIS A;  3W6J B;  2BBY A;  3BQZ A;  3PQJ A;  3U2R A;  2GA2 A;  3HOU J;  1VND A;  2E1N A;  1J75 A;  1R4N B;  1WH7 A;  2DYR H;  2FEZ A;  3K4M A;  3CJT B;  2ZJR F;  1TQM A;  2FF4 A;  4II3 A;  4A0Z A;  2EB7 A;  3WOD F;  5HNH A;  2MGQ A;  4G2U A;  3I4M J;  3CP8 A;  2EZH A;  1NG7 A;  2RVC A;  3FIW A;  3TO6 A;  5E3O A;  1BA5 A;  2IBD A;  2UXN A;  2ZSH B;  1PUE E;  2ZCW A;  4B47 A;  3OYC A;  2HS5 A;  3I3L A;  3ULQ B;  1W1W E;  4F7Z A;  4HSR A;  3CD6 I;  5CVR A;  3ESW B;  5HLH A;  2HQ5 A;  3K2Z A;  2VL8 A;  2CV0 A;  2M4G A;  3ZPL A;  4HOB A;  4IQ4 A;  2XUB A;  3PQK A;  2Z5U A;  2F4O B;  3F6V A;  2NXN B;  3A02 A;  2HOE A;  4OIO F;  3HOT A;  3VSK A;  2M9H A;  1W7P A;  3L2W A;  4O6J A;  3PO2 J;  2P0W A;  3ELK A;  3ZMD A;  2RQQ A;  4C2M J;  2OZU A;  2DQL A;  2ZXH A;  3IHU A;  3VOD A;  1D1A A;  1MKM A;  3DV8 A;  4RGU A;  2KLO A;  3OOP A;  3HB9 A;  4ZC3 A;  2V1U A;  1Z3Y A;  3QOP A;  1K79 A;  2X1D A;  3DTK A;  3K9T A;  2D45 A;  2MFZ A;  2BW3 A;  3AG2 H;  1E2X A;  4D5C A;  4LIV A;  3P7N A;  3CCM I;  3BJO A;  1R58 A;  1B9N A;  3GFL A;  3T8T A;  1W7P B;  2H09 A;  5HOO A;  2F5E A;  4IO9 F;  4A0Y A;  3I71 A;  3ZMT A;  4BEH B;  3MFK A;  4LJZ F;  4M3B A;  2R7O A;  4Y3O A;  3LL7 A;  2DJI A;  3CLO A;  3J81 K;  3VB2 A;  4YFX F;  4V2F A;  2X4H A;  3GCM A;  3CCR I;  4WK8 F;  3L1P A;  4DW6 A;  4KJZ A;  4BYY A;  5D4R A;  1MMA A;  2MBF A;  2HEO A;  4PDK A;  3VWB A;  3S6V A;  4ENK A;  4RAZ A;  1I6H J;  2FBI A;  3OMY A;  3S1R J;  3FXO A;  1GXQ A;  2PQ8 A;  4WF2 A;  2IGK A;  3E5U A;  4H0E A;  3GW2 A;  2EFW A;  4S0H B;  3K7A J;  5F6F A;  1FSH A;  2ESH A;  4ETS A;  5IYC J;  3CO7 C;  2JUG A;  1F5T A;  3BCA A;  4U0W A;  1UAA A;  3O3K A;  3CC2 I;  3T8R A;  3I56 I;  1MSE C;  1XDS A;  2EV6 A;  2F5V A;  2HKO A;  3BWG A;  3H5R A;  1KQ9 A;  3SZT A;  5JLW A;  3Q2U A;  2KT0 A;  3CO6 C;  3M9A A;  3BZ6 A;  1I3A A;  5H6Q A;  2WTE A;  3GF2 A;  2Q0O A;  4J01 A;  1OR7 A;  1KYZ A;  2EFN A;  1G3Y A;  3KZY A;  1XCV A;  2FXA A;  4JX5 A;  1U6G A;  2M87 A;  1JTY A;  1NG6 A;  1G6N A;  2E34 A;  2QCO A;  2CFO A;  2BEO A;  3Q0W A;  2R7Q A;  1OYY A;  4MGR A;  1FNN A;  4OIQ F;  1WJB A;  3HRU A; 
#chains in the Genus database with same CATH homology
 2VZN A;  2DDB A;  1XX5 A;  2CQ7 A;  3U3U C;  4IFA A;  1WVR A;  3Q2R A;  3U3L C;  5JYS A;  3Q2U A;  4P27 A;  4D53 A;  1SMB A;  4NUO A;  2EPF A;  2GIZ A;  4TPV A;  3NT8 A;  1CFE A;  4AIW A;  4H0A A;  2A05 A;  3S6V A;  4NUK A;  5ETE A;  3S6S A;  3MZ8 A;  2DDA A;  4NUN A;  3U3N C;  1RC9 A;  3S6U A;  4G2U A;  4NUI A;  4LY5 A;  1XTA A;  1QNX A;  1U53 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...