1WVRA

Crystal structure of a crisp family ca-channel blocker derived from snake venom
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
221
structure length
221
Chain Sequence
b'NVDFDSESPRKPEIQNEIIDLHNSLRRSVNPTASNMLKMEWYPEAAANAERWAYRCIESHSSRDSRVIGGIKCGENIYMATYPAKWTDIIHAWHGEYKDFKYGVGAVPSDAVIGHYTQIVWYKSYRAGCAAAYCPSSKYSYFYVCQYCPAGNIIGKTATPYKSGPPCGDCPSDCDNGLCTNPCTRENEFTNCDSLVQKSSCQDNYMKSKCPASCFCQNKII'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Triflin
publication title Crystal structure of a CRISP family Ca2+ -channel blocker derived from snake venom.
pubmed doi rcsb
molecule tags Toxin
total genus 62
structure length 221
sequence length 221
ec nomenclature
pdb deposition date 2004-12-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00188 CAP Cysteine-rich secretory protein family
A PF08562 Crisp Crisp
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.740 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Crisp domain 1wvrA02
3.40.33.10 Alpha Beta 3-Layer(aba) Sandwich Pathogenesis-related Protein p14a CAP 1wvrA01
4D53A 1XTAA 1QNXA 3Q2UA 4NUNA 3Q2RA 2CQ7A 1WVRA 4NUKA 1XX5A 2DDBA 4NUOA 1U53A 2VZNA 3NT8A 4AIWA 3MZ8A 3U3UC 4TPVA 2DDAA 4IFAA 3S6VA 4H0AA 2EPFA 4P27A 2A05A 5ETEA 1RC9A 3S6SA 1CFEA 1SMBA 5JYSA 2GIZA 3U3LC 4NUIA 4LY5A 3U3NC 4G2UA 3S6UA
chains in the Genus database with same CATH superfamily
3M1CA 2Z5UA 2ZXIA 4BNCA 4XOTA 4U7DA 4CCOA 4G12A 1PJRA 3JCUC 2QVOA 1MW7A 2OC6A 4Z2YA 1X3UA 2OQRA 4KMFA 1ZHFA 2YU3A 3PO2J 5LRSA 5KAFC 3J7AO 2IP2A 4LOCA 3T8TA 3E1SA 4EJOA 2VN2A 4A3DJ 2FA5A 4UXNA 3TDZC 1YRNA 4AWXB 2XF7A 3MKLA 2L9NA 3K7AJ 2EIMH 1FP1D 4L5JA 1XN7A 3HB9A 4Y15A 2XAGA 4CXFA 2W25A 3S3OA 4RA2A 3BCAA 2A68F 1G3WA 1WI9A 4UVCA 4I7HA 2HVQA 2EK5A 2UUZA 1K4SA 3OYJA 1KGSA 1DGWY 1MKMA 2DK5A 2DQLA 3BG9A 1ETKA 3ZOBA 3GBGA 3B6AA 5BMZA 4YFNF 3BWGA 2E1NA 1ULYA 4A3JJ 1JKQC 4P27A 4RAZA 3DEWA 1LPQA 2CUEA 2PBIA 4LLNA 2L0KA 3HBLA 3QPTA 1ETXA 4PFPA 2D1HA 3TKYA 3DBRB 3H5NA 5BOXA 2KP6A 2Q2EA 3HPGA 2H09A 3PNYA 2KMUA 4JX6A 4A0ZA 1UZCA 2KRFA 5J6XA 2HKOA 3ZR8X 3SQNA 4CYDA 4WK8F 3HOSA 4CCMA 3W3CA 4PSXA 3ROUA 1YO5C 4NDLA 3E3VA 2L54A 2JRMA 3RKXA 5DYMA 3LAPA 1O7LA 1ZARA 2F6CA 2ZJRF 5DM6F 4LLGF 3E6MA 4GFBA 1PDNC 2KIFA 2DPUA 2IBDA 3K0LA 3KEOA 3O3KA 1NG6A 3F8BA 1G8XA 4BHCA 4W1UA 3IUOA 1JE8A 3BT9A 4E7SA 3SDGA 3Q0WA 2E2HJ 3H36A 3KLNA 2P7VB 3CCYA 4QPQA 5CPRB 2COBA 3I59A 3E5UA 3MZ8A 5D4SA 4BU2A 5LLQA 2Y30A 4Q4ZF 3S6VA 4RLFA 1T0FC 4ZJZA 3B73A 4M3BA 3O8GA 3DTEA 5J40A 1X4OA 4JX4A 4E7LA 2KJCA 4U88A 3G4SI 1OCOH 2DOFA 4GXOA 4CCNA 4CYCB 3FXLA 1DUXC 4IHVA 4DNCA 2KQRA 3V8LA 4J19A 4D9JA 4MTDA 2DQRA 2ZNZA 3R0JA 1DPRA 2OD5A 2XGCA 1NG7A 3WTYC 5IYBJ 3BTLA 1WPKA 1XGSA 3PFYA 3L2VA 2OF7A 4TPVA 5E79C 3F6OA 1KZHA 4H0AA 4L18B 5FLMJ 3GTQJ 2VIXA 2OUMA 2HDCA 4IZZA 2K9NA 1J59A 2PJRB 2MD5A 3TO6A 1FBSA 1DU0A 3GXOA 2CS3A 3LFUA 3R6SA 4AD9A 4RB2C 2OV7A 2ESNA 3RPUA 1XMAA 1R49A 2GLOA 2CQ7A 2PMZN 2M34A 2CFOA 2KRHA 2VQCA 4LB6B 1Z7UA 2QUFA 2R5ZA 5E8GA 3ZXSA 3MEXA 3CUQB 4HNTA 4O6JA 3HSEA 2ZFUA 2K27A 5ILUA 3VWBA 2WC2A 2H27A 1J75A 1YLFA 4U0VA 1X1BA 3S2HJ 2NVYJ 1YQAA 3OS1A 3PSIA 2R7RA 2E60A 3DF8A 3S2DJ 4XLNF 3OWTA 4OMYA 2ZMEC 3L2CA 3AL0B 1R71A 5C44J 3JREA 1GVDA 3NWTA 1JTXA 3MVPA 3DKWA 4WX9A 1XDSA 1FWZA 1X19A 4N0BA 1D1AA 3M1EA 5EEHA 4UV9A 3HC7A 4O5VA 1MSEC 1TQIA 1Q1HA 2N8GA 2PQ8A 3EDPA 4M9ZA 4HF2A 2DDAA 2MLGA 2DT6A 4M9XA 2EIJH 3MZYA 3DLLF 1Z91A 2FQ3A 5F0FA 5DM7F 2LK2A 1T2KA 2NVXJ 3R0AA 1W4MA 3FDYA 3M4OJ 9ANTA 2HOSA 3SFZA 4EM2A 1HKTA 3QOPA 1FJLA 1R5HA 2HZTA 5IY5H 2FBKA 3RJPA 3VEPA 1PUFB 3HRMA 1LDDA 1OQYA 2GXBA 4RBOA 4HX4A 4UUSA 4HOBA 2BW3A 2GIVA 4PUSA 3M8FA 3JRAA 3FKJA 5KHDA 5CQEA 3HTUA 3HIFA 5DS9A 2PMHA 1O3RA 1XSXA 3F8MA 3A1YA 1SFOJ 1IV8A 3U3LC 2XUBA 2BHYA 5IT9Z 2PX9A 2G9WA 1BIAA 1TLHB 2ELJA 3OR1C 4MLOA 4RGUA 5TGTA 2HQAA 5D6EA 1VQOI 1R9TJ 2XGXA 2GA2A 2R7QA 3LA3A 1WJDA 3OYEA 1T0FA 4Q5SF 1HF0A 3G1MA 1LEAA 1QRYA 5HLHA 4P9FA 1MZBA 2DMQA 4FE4A 3CTAA 1XD7A 1TT5B 2DYSH 5D8LB 5AIPA 5DTDA 2B63J 4N4NB 2CV0A 4LG3A 4XNFA 1W5SA 2M4KA 3GLLA 2CW0F 3C2HA 1MMGA 1LDKB 3OL4A 4HG2A 4KIBA 1D0YA 1IDYA 2JN6A 3IC7A 1L0OC 3ECHA 4AYBA 3PJRA 2CMPA 5FLVA 1S5LC 4HQMA 3T5XA 4IX7A 3BDDA 4FCYA 2XIGA 2VC0A 4PJ0C 3OYDA 5GTHC 3ZPLA 1VQ4I 5KK1A 2VKVA 2CU7A 3DTIA 3MMYB 2CGPA 1IZ1A 3RQ4A 4HAMA 1FPQA 3FBIB 4MQVA 1SFKA 1J5YA 1O7FA 2XF6A 4XLHA 1B59A 1Q1VA 1HQCA 4C3HJ 2VODA 5LGTA 1FBQA 5H2FC 3SEZA 3KP7A 3CCRI 3UNGC 2IA0A 4L0YB 1U3EM 4UB8C 1IXCA 2I8DA 2PN6A 3LWFA 2HXIA 2QSGX 1LE8B 3HHHA 5HDKA 1XMKA 2XV4S 2RV8A 1ETQA 2M8EA 2YPRA 4M71A 1R58A 2LTPA 2LY2A 1QU3A 2CSOA 1UHSA 1W7PB 3W6VA 1FTTA 2QZ8A 4KA4A 2ZB9A 1SANA 3VFZA 3HG9A 5IYCJ 1QNTA 1RETA 3D0SA 1X1DA 5IP6A 2GM4A 2QF7A 1WH7A 2IEKA 5JFRA 1GVJA 3DV8A 5IOYA 4ENNA 1Z9CA 1ON1A 4EM0B 1SVOA 1XX5A 3I54A 2DBBA 4YIIA 4HLXA 2ISZA 4NUOA 3EYIA 3PM1A 2JVGA 2EB7A 1YHQI 5ICFA 1RUOA 5D5UB 3BQYA 5K5OA 1F9NA 3SZGA 1QQIA 3T0YA 3GX4X 2HOAA 3H5AA 4KDPA 4OU0A 3Q5FA 3OOPA 4QSHA 5FD5A 1AA7A 5BPDA 4P1WA 1U8RA 4E6KG 5CVIA 3JR9A 4C3JJ 2BE5F 2VBWA 2RC4A 2LY1A 4QPOA 1GLNA 4BDZA 2DMTA 4V19K 1Y0UA 1MSFC 3DPUA 5LBQA 2A61A 3TO7A 1BC7C 2QKMB 4GYIA 2MLKA 2K3PA 5ETEA 1G6NA 1ON2A 5CLSA 1WCMJ 2XPUA 5EG0B 2XAHA 4FT8A 2E36A 3A01B 4EATA 3TEDA 1APLC 5D5VB 1OYYA 4XOPA 1R1UA 2P7CB 4RGRA 4BJTA 1QA6A 2X1CA 2HVRA 4RM3A 4BBSJ 2CUZA 3JRHA 1DU6A 1M1EB 2KFDA 2BY0A 1D8JA 5A2QK 2XRLA 3FHNA 1KYZA 3HJEA 3K4LA 4UV8A 1WJ5A 2LRDA 5M3FJ 1ZRFA 1F36A 2VT3A 2Q0OA 2D45A 3BG6A 5M3MJ 5EGOA 4RB0A 2J5PA 2HYGD 5FJ8J 3ERED 1G3TA 4II3A 3WGHA 1RI7A 1B72A 2NS8A 3BZKA 5HS9A 2XRNA 3BR3A 2XVCA 3ABLH 2L02A 2RKHA 3ZQCA 2DPDA 5FKNA 2FOKA 3SYTA 4DOZA 3FXMA 3G6EI 1Z7LA 1X1PA 3WE2A 3OMYA 3ML6A 2HGCA 1MJAA 1GV2A 5E20A 5J47A 2E1CA 4HX7A 4LY5A 3WODF 1I39A 1R00A 4WXHA 2JUGA 3C7JA 3BR2A 1W5CC 2WV0A 1IC8A 2M0CA 2E35A 4JP0A 3HOWJ 1ZAOA 3F8NA 5FRMA 1HKSA 2LMDA 4XRSA 2L7MP 3BTIA 2FD5A 3FM3A 2M3AA 4A6DA 3BPXA 2M4GA 2P6TA 4CDGA 4HA8A 3JRGA 1P7JA 2VKDA 1CF7B 3LL7A 2M2EA 2W1OA 1R1VA 4BHBA 3I4MJ 3E0JB 2QSHX 2VJ5A 2ZSHB 1TC3C 1FNNA 3FBNB 3HL2A 4HSRA 2KT0A 1MH3A 3AKZA 4IOCF 2FU4A 1MMSA 5EEGA 2ZBKA 3GTOJ 4A0YA 3A4CA 4UB6C 2O8KA 2WY8Q 4FX4A 2DA1A 3WE3A 3GW2A 4DGWB 1YIOA 1MNMC 3O6BB 2CG4A 1MBGA 3RIRA 2R0QC 1YS7A 1XMXA 1ZG3A 3MQ0A 1VFCA 4D5FA 3GTLJ 4LJZF 3K10A 3PIPF 1U0JA 5ERIA 3AFHA 3DU6A 1ZREA 3IP4B 3KZIC 2Y75A 2EZLA 3LSMA 2FBIA 1YI2I 1T98A 1UHWA 1O3QA 1MMDA 1A6QA 2QGUA 3G1LA 3OYBA 5FKMA 4HRIA 4ENMA 2K3FA 4IL6C 1XCBA 3V7RA 4BJ5C 4ENJA 1K4TA 5FLXK 3QPSA 2KLOA 1U78A 2DDBA 2CJJA 4UVBA 3QP6A 4IFAA 4LGWA 3WTSC 3ZP5A 3S8PA 4AC0A 1BI3A 2R5YA 2VJIA 2MC3A 5B5EC 2Z3YA 2ADUA 2DA7A 3TP0A 3HM5A 1FMWA 4A6EA 2CUJA 3KP2A 1J7KA 5CVVA 3PL8A 1OCCH 2LLKA 1X3ZB 1YX5A 1P2FA 4ENKA 4XBFA 5GPAA 1TWAJ 2OJED 3ECOA 1V4RA 2L01A 3HTSB 3GTPJ 5JHUA 1AU7A 2A05A 5GP9A 2ACJA 2Z2SB 4S05A 1Y56A 3GMEA 3D5LA 5CQGA 4OIPF 3BG3A 4MHGA 1KU3A 2PFBA 1FY7A 5KVRA 4FHTA 4EGZA 2Z33A 1YRNB 2M45A 4FETA 4I98B 3OS0A 2A3SA 4BHPA 3CF2A 1TZLA 5JR3A 3U21A 2QSFX 5E1WA 4E7ZA 4ZTJA 4KIFA 3KYLA 4AIKA 3FXUA 2PLYA 1ITYA 1I3AA 3FZVA 3S3MA 2DTRA 4P5OA 5K7FA 2M0MA 1A04A 3FIWA 4M6XA 2AXTC 3T8RA 5JHFA 4A5NA 3S32A 1SD6A 4G8XA 1OCPA 2V1NA 5C3EJ 4CO8A 4FTHA 3N4MA 3GTKJ 1D3YA 2A5WA 3A02A 4M3DA 3HYIA 1OJLA 5K7ZA 5DUIA 5J1YA 3K1NA 2RREA 3QU6A 2DN0A 1Z6TA 2O5RA 4IRHA 2Q2EB 2MW8A 2RQQA 3LQQA 3W2VA 2ELKA 1S29A 1D5YA 1Z0XA 3Q9VA 1Y8RB 2DYRH 3CLOA 4S0HB 1S72I 3EETA 4I76A 1BW6A 4IHTA 2AQEA 1MBEA 1MNDA 3ISPA 1LNWA 3GO5A 3U3NC 2KRCA 5FO5A 2DJIA 1TW3A 4XR6A 2DAOA 4F7ZA 3LMMA 3GFIA 2FBHA 1MBFA 1QZEA 1U8BA 2QQ9A 3DQVC 1KU9A 2L9VA 2E71A 1WWXA 3LSPA 3L2WA 1D8KA 5ICCA 1K61A 2HQNA 2IXSA 5HODA 3JRCA 3WHCA 3CO7C 4IO9F 2DFHA 4MFEA 2VT2A 2M7AA 1O57A 1UG2A 1WJFA 3GFJA 3ESWB 4AIHA 2HQRA 4XKCA 3F0CA 3BPVA 1Y1WJ 2VKHA 4X0GA 1IXRC 3I53A 3NEUA 2PMZA 4AM3A 5AIQA 2GAUA 2ZC2A 2ELHA 3KP5A 4IPAA 4DQ2A 2H6CA 1S3JA 2K7LA 3KX2A 2MABA 3N05A 4WWCA 5E1XA 3QPHA 5ED4A 4YIRX 3M3YJ 3FF5A 2YUSA 4Y33A 4HNUA 3K2ZA 1AKHA 1B4AA 2FX0A 5HLGA 2JSPA 2OTLI 3A03A 4M74A 3K4BA 3UR3C 1TWHJ 1BJZA 2DMNA 4S04A 4PJMA 1SC7A 5H6QA 2HPIA 2EINH 2L7FP 1A35A 4DJAA 1ZGJA 5BNGA 2KZVA 2QENA 4DZJA 3TBIA 2NS7A 3ZMSA 2QA4I 3PNTA 5GAHJ 4W97A 2OTJI 3S14J 3S1RJ 4TV7A 3EYYA 2O61A 4ZYAA 5C4JJ 4DW6A 4M72A 2P6SA 3DTKA 2V1UA 3QODA 4BXXJ 3CJRB 1TTYA 2HYJA 2KIMA 1S7OA 2DW4A 3LSTA 1OYIA 1K6YA 2JPBA 2R5ZB 4IXAA 2GQQA 2K9SA 1I5ZA 5F08A 2B9SA 3ELKA 3HSFA 3HXLA 4WXCA 1FYLA 2RQPA 2FF4A 3I5UA 1UCRA 3BG5A 4ZDOA 1CGPA 3LSHA 2IJLA 2E19A 5K5QA 1ZH5A 3FWEA 2FQ4A 3CZ6A 2EV0A 1RUNA 2EFPA 2VJ4A 1HW2A 2YS9A 5IPAA 4PJNA 3W2WA 1MGTA 2CQNA 2O03A 3TDUC 1U9NA 4NBQA 4Y52J 2JZYA 4A3IJ 3GFLA 3IH2A 1AWCA 3Q3SA 3HUGA 3S6UA 3ABKH 1IUYA 3DWLE 2AXLA 3KP6A 5TJJA 5FD6A 3PUBA 3H3ZA 3M9AA 1K7AA 2LKSA 3J80K 4KFCA 4M6YA 2OZUA 4Y4RA 2E1MB 2WAEA 3CUQC 4L5IA 1XC5A 4BBRJ 4HPQA 3IWFA 5F1JA 3BR5A 3QYEA 5ICEA 3CCVI 3JAMK 3HPHA 2BV6A 2XAJA 1MDMB 3H1CA 4E70A 2KDZA 3VYRB 3SXYA 1B1BA 3VSKA 2GIZA 4UUSB 4GRIA 4YELA 2BW3B 3RPQA 2H1KA 2JA2A 4D0PA 3AL0C 2H8RA 3KE2A 1XPXA 4XSZF 2BXYA 3G71I 1O4XA 1MJBA 5L3EA 5FFZA 2UV1A 1A5JA 1J2XA 1IF1A 3PNVA 3I55I 3OSFA 1Z77A 3K1MA 3ABMH 1TW2A 3NT8A 1R23A 2WBMA 2DA3A 1ZRCA 3H92A 2YR2A 3CCMI 5KNLA 4XLAA 4RLQA 4UUVA 1CFEA 4A93J 1D0XA 2M87A 4KITB 4PFOA 1X3WB 1IXSB 2DTZA 3GZNB 4ESFA 4ZH4F 2Z9OA 2HZDA 5FKOA 2M7BA 2CQXA 2HKXA 1VQKI 4Q47A 1YW8A 4L0ZB 4N4OB 4E7IA 3KZYA 3BROA 1YW9A 1TT0A 2VE9A 1OR7C 3I4NJ 1OCZH 2HDWA 2Q1ZB 1KQ0A 4UUTA 2E2IJ 2EV6A 4ZZLA 3K4MA 1A31A 1XGNA 4A3GJ 1HW1A 1USSA 4ON0A 2CW7A 4G7HF 1RC9A 1W1WE 4M3FA 5CVUA 4HQEA 3MWMA 4U0WA 4NUIA 3KP4A 1I1GA 2WY7Q 4EEFG 4A3CJ 2GOMA 1K6OA 4LK1F 2BY2A 3M07A 2F5FA 3OY9A 5E3MA 1E2XA 1SVLA 2FJ1A 3P9IA 4DYRA 1XTAA 1KONA 2ICWG 3I0TA 3S93A 2HWVA 3VYUB 4A3LJ 2WB1N 3LAJA 1VTNC 1W7PD 4A3BJ 1G2HA 2VE8A 1YJ9I 3SFIA 3WTUC 1T39A 1OFCX 3CCLI 1U5TB 1JTYA 4A12A 2IS2A 3IAM2 4GCVA 3LSGA 4C2UA 1FLIA 3QU3A 1HSJA 2TCTA 2MG4A 3QWLA 2LVSA 1XS9A 4QTRA 3VOEA 2X0LA 3FKIJ 5HOOA 3RKYA 1FTZA 3I9V2 1BOBA 1PUEE 2DT5A 3J81K 1Z05A 2IGOA 2HXOA 3HGGA 1R36A 4BACA 3HOZJ 3F3XA 1IAWA 4BAYA 3CMMA 2CO5A 2W85A 2AS5F 1IJWC 4MTEA 3GTGJ 4CCJA 3OYGA 4DIQA 1IG7A 1E0EA 1BI2A 2F5DA 1BM9A 2W4SA 4I0AA 3ASNH 2LBFA 3ZMVA 3H9JA 1B9MA 4FE7A 3CO6C 1ZR4A 3C2BA 3FHZA 1TQPA 5B66C 2GZWA 3RCOA 2R7OA 1VQNI 4OIOF 2EIKH 2MH9A 4PSWA 1Y39A 4HBLA 1X58A 1FT9A 1LFPA 4BQAA 2L9SA 2HFHA 2LF7A 3IHUA 3ZN1A 3OL3A 3S1QJ 2NRAC 3PQKA 4FISA 2F5CA 2OU2A 1G3SA 3KYCB 1ZELA 5B1BH 1Z6RA 4QWQA 2PEXA 2ISYA 4XN0A 1IN4A 3CMAI 3U1KA 2LSOA 3T1BA 2D5VA 3BR1A 3VYTB 1LKXA 2GXAA 2X1EA 5EJCA 2R4GA 4MO7A 5HLTA 2EH3A 3GFMA 3ZMUA 2V26A 2HVSA 1ETVA 2ZMEA 1P4XA 2VC1A 4B3XA 5LGNA 2XSDC 1VI0A 3OYLA 3ZRGA 1P7IA 2W82A 4R1HA 1BR4A 4MIMA 3C1DA 4M9SA 4WF2A 4ZC3A 1D1BA 2RNJA 1VQLI 5B3SH 2K40A 1SVMA 2M1BA 2L4AA 5L3GA 1FZPB 1JT6A 4X1EA 4WCGA 3F8CA 3DU5A 2L7ZA 4EM1A 4YFXF 4XM3A 3GVAA 2FUG2 2BGCA 4LITA 1SFXA 2V9VA 1ZYRF 2XKPA 3ZGKA 5EGOB 3K4JA 3G3ZA 4NUKA 2QKLB 1IGNA 2O3FA 4NQWB 2XGDA 1FYMA 3ZMDA 4BXFA 5LFAA 1WSUA 1B72B 1QPIA 3L00A 4G7OF 1BI1A 4FQGA 1XB4A 4DYQA 4EQQA 1IV6A 2OAZA 2L3DA 2I10A 1O3SA 4KMUX 2WA0A 1YW7A 3Q0VA 3CC7I 1A6IA 4ZYEA 4BGDA 1X1CA 1I3QJ 3F72A 3L9FA 2X51A 4IOAF 4BUPA 3CCEI 4I99C 3V7SA 2K9MA 2STWA 2VZNA 1GDTA 4EV0A 1MNEA 1T56A 1IN6A 1LVKA 2LKPA 3FXJA 3FXQA 4YFKF 3WTWC 2DMUA 4LLLA 5IT3A 3F21A 2YX4A 2DO7A 3O8HA 2A6TA 3K6GA 4BEHB 4HLYA 4G6QA 3U2RA 3P9KA 1YYVA 4G94A 2B0LA 1UG0A 1GXQA 1L3LA 1GT0C 4JOMA 1WJCA 2L5QA 2ECCA 3EUHC 4J01A 4H4KC 1WVRA 2EZIA 2V79A 4XMYA 3K4KA 1MJ9A 4U87A 3KEQA 1R22A 3BOQA 4Y3OA 4C9YA 3JRFA 5J8CA 3D5RC 3LQRA 4Y17A 2V1XA 1ZQ3P 4N9IA 2D2WA 3H9GA 4LMYA 3ULQB 4HEA2 1IW7F 4MEXF 3G1OA 1P6RA 2NVTJ 4R8HA 2E7WA 1I27A 2DT7B 1SD5A 5EEAA 5DCFA 3SHFA 2HDDA 2R3SA 1FOWA 2ZJPF 1ZRDA 5DEQA 1FSEA 3OIPA 4F52A 4BE1A 2V9KA 3WU1B 3DEEA 4QLCU 3FXOA 2D1VA 2BY1A 4EJTA 1E17A 2IS6A 4PK4A 1KU2A 1NH3A 3WGIA 4F93B 1W0TA 1BW5A 2VL8A 1U2WA 2IA2A 2EBIA 4A5MA 2GWRA 2EPFA 2JWTA 2P5KA 2G7UA 4X6AJ 2ME6A 2TRTA 2HTJA 3WU2C 4NHJA 4MQ9F 5JYSA 2KIQA 2DU9A 2KIUA 3EPZA 2AQFA 4AIJA 2JPCA 4B3AA 2VBZA 1VQ7I 1YG2A 2YX7A 1I6HJ 2ZO4A 4UVAA 2XAUA 5CVJA 3OIOA 1ETYA 3BJAA 2XHKA 2R5YB 4U7BA 2EA4A 1N77A 2QBYA 1MMAA 1TNSA 2EZKA 1WJEA 3ERMA 2DODA 2EJRA 3IH3A 4B8XA 3E6CC 4A0XA 2VOOA 1MBJA 2NNYA 3RDIA 2EA2A 2W24A 2ZXJA 4BL0B 3IWZA 4U0YA 2KJBA 4L9NA 2VXDA 3WTVC 1HDPA 1T8IA 2VBYA 4BKXA 4E7JA 2VI6A 4PCQA 3DLAA 5IYDJ 4L9JA 4GYGA 2CYYA 4E7HA 2IAIA 4HF1A 2LYCA 2ZJ2A 5E8IA 1UHMA 3HKZN 3I58A 2X6OA 4RS8A 2IPQX 2PG4A 1QO0D 4LG0A 1HA8A 3QYBA 2H6BA 4ETSA 2VOPA 4RB1A 3DFGA 1QHHD 4KICA 1TWGJ 3H0DA 3R4KA 2XAQA 3H35A 2MH2A 4BDYA 4ESJA 2LC2A 4IHYA 3E5QA 2RAEA 3BZ6A 5IOZA 4RAGA 4XL9A 5IP7J 2JA8J 2BVLA 1VQPI 5KCMA 2R7UA 4G2UA 2XPWA 3WTXC 3Q0UA 4EGYA 2JK3A 3HZJA 3W6JB 2CV1A 4I02A 3IRRA 1G3YA 3CF5F 5K5RA 5L3CA 2X4HA 2R7XA 2LD5A 1T6SA 1FSHA 4HDVA 1YX3A 1R6RA 2K9QA 1K79A 1HSTA 2NYXA 4HZFA 3MFKA 3ASOH 1F5TA 3DXJF 5DD4A 2OBPA 2HPMA 2L4MA 3C3WA 4M3EA 4PDKA 1QVTA 2ZSIB 3LSKA 5F64A 1E3OC 2BXZA 2VASA 3GF2A 2DOAA 4OAZA 2HQ5A 4RAYA 3PQJA 1G4DA 1V5FA 2AO9A 3D5SC 4XIDA 4EVIA 4LB5A 1LVAA 1WJAA 3KIOA 1QZZA 5K1YA 3RZOJ 4CH7A 1XGMA 1DP7P 1F4KA 2VLAA 3JRIA 1TP4A 5TISC 2VBXA 2MA3A 5FB2A 3K4CA 1VQ9I 1K78A 3HGYA 3IAS2 3CC2I 2R7DA 3B6CA 4P96A 4I01A 5B1AH 4O3MA 3J7AY 4OWRB 5JVTA 1SMTA 1H8AC 4II2A 2GBYA 4CA0A 4P9UA 3WU0A 4R79A 1YS6A 5A2QZ 5D8KB 2F48A 3CMEI 1FIAA 3I71A 4XICA 1QBJA 5ICGA 2VQGA 4A3EJ 4GO1A 2HNHA 3D1NI 2VQHA 2O8XA 4I6ZA 3IH4A 3A0BC 1GHCA 1S8NA 1LB2A 4FASD 1BN5A 3TW7A 2LNBA 4XRSG 5LHIA 1UB9A 5F0HA 1XGOA 1R1TA 5FGMA 3OR2C 5EZGA 3WGGA 2MD0A 1T38A 3HSRA 1JUMA 2A5YB 2WADA 1OLTA 1YFHA 4F92B 4ZDPA 3RPUD 1AKHB 1HDDC 1Y8QB 3RTRA 1AOYA 2NXNB 4IHXA 2E7XA 1RR8C 3QAHA 4MFDA 1H9TA 2L2OA 3I64A 5HS8A 4ABZA 5D5WB 2IA1A 2V6CA 4BS9A 3BR0A 1P9QC 3LFKA 4PJLA 3BCBA 2QWWA 1BI0A 4HSTA 4MNUA 2MBFA 1SD7A 3OV8A 1HOMA 4JBAA 4RM2A 3FMQA 1USTA 2X6XA 3ZN0A 2CRGA 3LNQA 1JHFA 1WH5A 3AG1H 2DXIA 2VKEA 1JKPC 1EH8A 1JKRC 4CCLA 5J4YA 4IRIA 3QPLA 4HV5A 4K2EA 3M8EA 3P7NA 3SZPA 3VPRA 3NQOA 3FISA 3NARA 1FOYA 2DI3A 5DD8A 4MGRA 2LREA 4CZZA 5DV5A 4UY8I 3QYFA 1LDJA 4A3KJ 5FKKA 4L9VA 5LEKA 3V8KA 1IN8A 3KPHA 4G7ZF 2Y2ZA 1Z21A 2KISA 2QQAA 3BJ6A 3I59B 4G9YA 3FXKA 5JLXA 5HNFA 1B8IA 2ETHA 5J1RA 2IRFG 2CW8A 3HRTA 2VPLA 4OAYA 4EJVA 1H89C 4XLEA 3CCQI 3HUGB 3OYFA 1WZ2A 3BR6A 3U9GA 4WXDA 1HC8A 2X6YA 4BE0A 4E7KA 2P5VA 2I5UA 3WTTC 5DCMA 3MKWB 3SEQA 1QZYA 2KKOA 2RGVA 1LFBA 3CDLA 4HYEA 5L3BA 4BQNA 5FLXZ 1SAXA 1D0ZA 1WI3A 1SEUA 4BE2A 3TOBA 5LGUA 3K9TA 4LFUA 5CJ9A 2COMA 2OZ6A 4KYWA 3S2WA 1X2NA 5FFXA 4XORA 2W48A 3PFIA 1T08B 1OPCA 1RKTA 2DMPA 1IRFA 5FRNA 1WQ2A 3L1PA 1YJWI 1V54H 5EYRA 5HDGA 2W84A 1S6LA 5LHGA 1I6XA 3IKTA 1IDZA 3ZMTA 3RI4A 2ZXHA 1HW5A 3PUFA 5IT9K 3GTJJ 4Z6YA 3BJOA 2Y69H 4IRGA 4BY7J 2F4OB 2Y48A 2WB1A 2R7ZJ 3MD2A 3HOUJ 4ZYHA 2IT0A 3O2PE 2HEOA 1RNLA 3GLXA 1ZLJA 2E1MC 3E6BA 3ONQA 2JT1A 5D6FA 1K83J 1UJ8A 3H9QA 1TL8A 1DGRM 2DJNA 2EILH 3A0HC 1W36D 1N75A 3IL2A 1J09A 3TQNA 3L7WA 2RVCA 2V6EA 1T95A 2UXXA 3JSPA 3IKVA 3S6SA 1N25A 3GTMJ 4KT5C 3S1NJ 3W2AA 5E18F 2KDOA 5E3LA 4BJ6C 3EUKL 3R61A 1DQUA 3CP8A 2E2JJ 4Q48A 1MD0A 3Q2RA 2IGMA 3F23A 3AG3H 3VDXA 3K1PA 1BL0A 2BHZA 1ETOA 1OISA 3G2BA 2HS5A 3BTJA 1J9IA 3DPLC 4F3QA 4IKFA 4NC8A 4XKWA 3U1DA 2EQRA 5FKLA 3WG7H 2FXAA 2BYVE 2XGEA 4AUXA 1SMBA 3VYSB 1ZKGA 1U9OA 3ZQHA 2XB5A 3FXRA 1S7EA 1PP7U 4D53A 2PI0A 3HRUA 4M3GA 4XLFA 2KPMA 2L9RA 4PGHA 2LY9A 2V7FA 2O9LA 3DKYA 3M8JA 1JKOC 1N78A 5H20A 4A3FJ 5IP9J 3BQZA 1P92A 4ZTFA 1OMIA 4RMNA 1BBYA 4AU7A 2IVMA 2A07F 2NOGA 4AVZA 4XK4A 3TO9A 1WRJA 2VPRA 3REOA 4NC7A 4HF0A 1H88C 1OCRH 3CJNA 1W36C 2TDXA 1GV5A 1CQTA 1W5TA 3IRQA 3ABTA 3OS2A 4Y13A 4C30A 1FX7A 1DP3A 2LBFB 3S15J 1TNTA 2IGNA 5J4VA 3VODA 3ZQLA 1QPMA 1U5TC 4B44A 3QOEA 2NVQJ 1ZGWA 2HYFA 2WTEA 4KJZA 3FMSA 4ANJA 4CCKA 2IS4A 3C2GA 1J0RA 2XDVA 1RKWA 2JJ7A 1SD4A 2R7VA 3AAFA 1IO2A 1I1SA 1LJ9A 4IQJA 4IHSA 1ENHA 4XN3A 2VXZA 1D5VA 1UAAA 1YITI 2HU9A 3JRDA 4Y7NJ 2KHMA 1Z3XA 1FMVA 2RDPA 2JA7J 2DA5A 2K5CA 2CFXA 2EFWA 1ETWA 1KU7A 2XAFA 4HDUA 2WAQA 1YJNI 1ODDA 2LOOA 4D5CA 3NWSA 5L3DA 1U6GA 1X2MA 5LRRA 4CYCA 2LG4A 2FSWA 4BQOA 2ZCWA 4CSWA 2OA4A 1VQ6I 5F6FA 2LKXA 4YEJA 1OCTC 4ITVA 3WHBA 3DEUA 2EV5A 2ZMEB 4LIVA 4F55A 3GUDA 1EH7A 1W0UA 2P4WA 1RR7A 3ZQGA 1MDMA 1B9NA 1RIOH 3H5RA 3NAUA 3OOUA 2HI3A 1TQMA 1D1CA 2PJRA 1E3PA 2B7EA 4J00A 4B43A 1UELB 3EQLF 3VB2A 4OMZA 2JTVA 2JMWA 3MZHA 1BC8C 3FK6A 1JT0A 1UFMA 3FX3A 3ZQQA 1BR1A 5L3FA 3KLOA 4DBRA 3TOAA 5J3LA 1EJ9A 2Y9YA 4XSXF 5ILSA 3RSNA 1F1ZA 2QQ8A 3CUQA 3KYDB 4G6DA 4UNOA 1C0WA 1ZLKA 2DA4A 3CMYA 4ZDLA 1KQ9A 3KZZA 2EWNA 4NB5A 3E5XA 3OIQA 4LK0F 2EZHA 4F91B 2OCCH 4IQ4A 1VQMI 4IEJA 4AVPA 3QRFF 2OPTA 3K4NA 2JQ7A 4GDFA 1BA5A 2XF5A 3KEYA 2LP0A 2DOEA 1IRGA 1ZGAA 2XPVA 3VSLA 1TWCJ 1PP8F 5FROA 1R4NB 1JGGA 2Z16A 2W00A 3OYAA 1ZG5A 1JJ8C 1NTCA 1KQ8A 3V4GA 2QYOA 1ZTRA 2XB0X 2BY3A 1EF4A 5LD2C 3CQZJ 1KYWA 4B09A 1BR2A 5E17F 3J80Z 3OYCA 3AG4H 2BOLA 4E4HA 3Q2UA 3ABUA 3I4PA 3RKQA 5ILVA 3K70D 5C4XJ 2FEZA 3JAMZ 3GZ6A 3L09A 2R7SA 2E5NA 3E97A 3GZ5A 5GADJ 5JI6A 1GXPA 4C2TA 2IW5A 1PUFA 2H1LA 4M6VA 5KAIC 1NK2P 3IV5A 3CCUI 2UWMA 1OR7A 1U5TA 3L2QA 2GA1A 2X48A 1HLVA 5EZHA 1S7AA 1YIJI 4N9HA 4B47A 5D4RA 1REPC 4A3MJ 3CC4I 4DYCA 3HOVJ 1R5GA 4UHTA 3TP3A 3KP3A 2XC7A 5E3NA 2Z99A 4XLPF 1S9HA 3MKZA 5DUKA 1RESA 5F1RA 2WAQN 5BS6A 3HRSA 1ACIA 3LSRA 3S17J 5M5WJ 5HVQC 3I56I 2JRTA 5DDGA 4CHUA 2PMUA 1PYVA 2HOTA 4OIQF 1F43A 4P55A 1LQ1A 2O6GE 3DPTA 2LF8A 2LR8A 2NOJB 1IRXA 1HXDA 2X1DA 3BG7A 4ASNA 5J1UA 2YSRA 1MBHA 3CJQB 1O3TA 1X1AA 2A6EF 4IF4A 5F0CA 3HKZA 2QCOA 2Y0SA 5M5YJ 1QNXA 1IN7A 5F27A 3OSGA 2O0YA 2ID3A 4KN7X 1XDUA 1V55H 2JSCA 1NHAA 2NS0A 4XRMA 4KIGA 3ZQFA 5E3OA 2MFZA 4AIWA 2P5LC 3SDBA 3RKWA 3P5JA 2FNAA 5CYVA 3TW6A 2BZTA 1JHHA 2Z1DA 1Z3YA 3CUOA 3V8JA 1XCVA 3PO3J 2VUMJ 2BVMA 4IVNA 2JUCA 1MIJA 3FMRA 1LFUP 3K70C 1X4PA 2QM3A 4PZJA 2WAFA 1EH6A 4LD5A 4V2GA 1JJ6C 2QBYB 5HS7A 1XSVA 3DCFA 3DKXA 1KA8A 3OYNA 2HOEA 4GGGA 2FOWA 2DFFA 2WWYA 1RRJA 3TMOA 4YRVA 3A2KA 2X85A 1ZK8A 2NVUB 1FP2A 2K86A 5JLWA 3LA2A 2EFOA 1OYWA 2ZJQF 4BQQA 2YU9J 4KISA 4LG0B 5AONA 4AYBN 2DA2A 2H8WA 2UXNA 1LE8A 4XONA 1BOAA 4B4CA 3JTHA 2JA5J 3JW4A 3J81Z 2ID6A 3DBHB 2XSJC 1P4WA 2F4MB 3P9CA 1VQ5I 2P0WA 4BY1J 1I50J 1V3FA 2CQKA 1W7PA 1ORKA 2R7WA 3LSIA 3GWZA 3MN2A 2X6WA 3MKYB 3BC8A 5M5XJ 5CVRA 2ME0A 3OYKA 3J7YJ 4DZPA 5HNHA 1RPWA 4D1QA 2M5WA 4M73A 3CLQA 2PJPA 3GEZA 4RB3C 1FIPA 2QEXI 1TBXA 4NQWA 4L9TA 3LA7A 3CJTB 5HLIA 3WTZA 1WKMA 2KL4A 2HTSA 1MMNA 3H0GJ 1OKRA 4CICA 1MBKA 1ZN2A 2A69F 1FOKA 2F2EA 2ZFWA 1QHGA 3BP8A 2V9PA 4EMSA 3KFWX 5K7HA 2F5VA 1P4AA 4CZCA 2EFQA 1YE9A 2QLZA 4HW0A 2DK8A 1JGSA 1AHDP 2FMYA 5GTIC 2VJJA 4HV6A 4CUGA 2W57A 5HDNA 2FRHA 2FE3A 2G0EA 2XROA 3BZCA 1Y6IA 3G73A 4B1RA 2WV1A 1G59A 5E1ZB 4I0BA 3ZQ7A 1QVUA 1E3HA 2E5ZA 3RZDJ 1NK3P 2KZGA 2FMLA 3DP7A 2Y31A 3ZQIA 2K02A 3JRBA 3S16J 4KT6A 5TRDA 2R7TA 1R5ID 1IRZA 2E34A 3MCZA 5D5XB 3AG2H 3BLYA 4BH9A 2A6HF 4NUNA 4BEHA 1K78B 2Y0SN 5EDNA 5EG0A 1HCRA 1STZA 5H6RA 4NNJA 2XASA 3A01A 1LEBA 3CCJI 1IN5A 2F5EA 2ZXWH 3KCCA 4LIUA 3RQIA 3WG9A 2JA6J 3U3UC 1BIBA 4OOIA 1XSDA 1Y1VJ 1QGPA 4NC6A 3HOXJ 2CV2A 3S3NA 2DLLA 1WJBA 4OIRF 3E6DA 3HEFA 1A36A 2R92J 5LEJA 3B02A 1SFEA 1WFXA 2MC4A 2LDUA 1ONVA 1R4MB 4ZZDA 3BY6A 2K85A 4L5EA 3OYHA 1SFUA 1YTYA 3H3VK 4RAFA 2LH9A 3RYPA 3TL4X 5F04A 2GOXB 1DDNA 4B48A 4YG2F 1FC3A 2P81A 4BYYA 4JYKA 3M7GA 2Y9ZA 3E7LA 1FOXA 4JX5A 5LHHA 4I09A 4YIFA 4I2OA 3R60A 2H94A 4NUBA 1GUUA 2DCEA 3QP5A 1ERDA 4ESBA 2R93J 4XQFA 3N97A 3F8FA 5GAEJ 3LOCA 2RN7A 3L2UA 2E1OA 3EUHA 4D7MA 3PIOF 5GAGJ 2ECBA 4RGXA 2IS1A 2CH0A 2DFIA 1FEXA 4C2MJ 3HHGA 5J8FA 3GYHX 3CCSI 1Z67A 2NNNA 1MH4A 5CKTA 2ESHA 3FM5A 4PGGA 5BQTA 1BJAA 1XG1A 3CESA 2C6YA 3CD6I 3K69A 3MAJA 2G7HA 1H0MA 1WHUA 4JQFA 1HKQA 1R7JA 2M9HA 3EUAA 3LSJA 3L2RA 4IJAA 4KUMA 2NAZA 2OCEA 5JVGF 3HDDA 3QQAA 3PSFA 3UKGA 5BPIA 4CGZA 1U53A 4OINF 3HOYJ 3SZTA 2EFNA 1ZR2A 2CWEA 3OYMA 1WGXA 3CP2A 2MYSA 1EKEA 1JUPA 4XKVA 1Y0NA 2AHQA 3SJMA 2MSYA 3BTCA 4EJUA 3KETA 3GCMA 3J7ZI 2FNPA 4JK1X 4HX8A 4DBQA 2O7OA 2STTA 3X2QH 3W6KB 1YOVB 2K4BA 4QIWN 5GPCA 2GXGA 3I3LA 2X9DA 1FYKA 3ZMZA 4IHWA 1CF7A 4A2UA 2ZKZA 3RYRA 2P8TA 1JXSA 2HR3A 1RZ4A 3Q9SA 1IUFA 1TWFJ 4H0EA 1JI8A 3TGNA 1B6AA 2JVHA 1B8IB 2BBYA 1UMQA 1VF9A 2M30A 4EJWA 4XKBA 2Q8KA 3C18A 1EV7A 2CQQA 3FK7A 4RGSA 2V4JC 2XKOA 2K4JA 2W7NA 2VQLA 1JUSA 2K9LA 2QQBA 3NRVA 2DFEA 4XRFA 4AIDA 1VNDA 3DBLB 5DCMB 1EA3A 3F22A 1V5GA 2DA6A 3V42A 3JSOA 1VQ8I 4FX0A 1LUJB 2F4IA 4KNYA 1DPUA 2IGKA 2ZNYA 4KN4X 1PVEA 3HOTA 3COAC 3H3UA 2VONA 6PAXA 2OQGA 1SMYF 2Y0MA 2BEOA 4V2FA 4G6TB 2LFBA 3ZCOA 2M8GX 2L7KA 2VB6A 5EF6A 1ZG1A 4MEYF 3JTGA 4PJJA 2RNGA 4C3IJ 3S1MJ 1SAUA 2MGQA 2R7FA 4BXUA 1POGA 3K2AA 2CUFA 1V5EA 1Z1DA 4D7NA 3F9KA 3V7CA 4RDUA 4XLCA 3OYIA 2J5OA 3CDIA 1VZ0A 1H9GA 4HNVA 1HBXG 3F6VA 4ZYGA 2UZKA 4ZYDA 3CDHA 4A69C 1T33A 1FBUA 2V1DA
chains in the Genus database with same CATH topology
4D53A 1XTAA 1QNXA 3Q2UA 4NUNA 3Q2RA 2CQ7A 1WVRA 4NUKA 1XX5A 2DDBA 4NUOA 1U53A 2VZNA 3NT8A 4AIWA 3MZ8A 3U3UC 4TPVA 2DDAA 4IFAA 3S6VA 4H0AA 2EPFA 4P27A 2A05A 5ETEA 1RC9A 3S6SA 1CFEA 1SMBA 5JYSA 2GIZA 3U3LC 4NUIA 4LY5A 3U3NC 4G2UA 3S6UA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4D53 A;  1XTA A;  1QNX A;  3Q2U A;  4NUN A;  3Q2R A;  2CQ7 A;  1WVR A;  4NUK A;  1XX5 A;  2DDB A;  4NUO A;  1U53 A;  2VZN A;  3NT8 A;  4AIW A;  3MZ8 A;  3U3U C;  4TPV A;  2DDA A;  4IFA A;  3S6V A;  4H0A A;  2EPF A;  4P27 A;  2A05 A;  5ETE A;  1RC9 A;  3S6S A;  1CFE A;  1SMB A;  5JYS A;  2GIZ A;  3U3L C;  4NUI A;  4LY5 A;  3U3N C;  4G2U A;  3S6U A; 
#chains in the Genus database with same CATH topology
 3M1C A;  2Z5U A;  2ZXI A;  4BNC A;  4XOT A;  4U7D A;  4CCO A;  4G12 A;  1PJR A;  3JCU C;  2QVO A;  1MW7 A;  2OC6 A;  4Z2Y A;  1X3U A;  2OQR A;  4KMF A;  1ZHF A;  2YU3 A;  3PO2 J;  5LRS A;  5KAF C;  3J7A O;  2IP2 A;  4LOC A;  3T8T A;  3E1S A;  4EJO A;  2VN2 A;  4A3D J;  2FA5 A;  4UXN A;  3TDZ C;  1YRN A;  4AWX B;  2XF7 A;  3MKL A;  2L9N A;  3K7A J;  2EIM H;  1FP1 D;  4L5J A;  1XN7 A;  3HB9 A;  4Y15 A;  2XAG A;  4CXF A;  2W25 A;  3S3O A;  4RA2 A;  3BCA A;  2A68 F;  1G3W A;  1WI9 A;  4UVC A;  4I7H A;  2HVQ A;  2EK5 A;  2UUZ A;  1K4S A;  3OYJ A;  1KGS A;  1DGW Y;  1MKM A;  2DK5 A;  2DQL A;  3BG9 A;  1ETK A;  3ZOB A;  3GBG A;  3B6A A;  5BMZ A;  4YFN F;  3BWG A;  2E1N A;  1ULY A;  4A3J J;  1JKQ C;  4P27 A;  4RAZ A;  3DEW A;  1LPQ A;  2CUE A;  2PBI A;  4LLN A;  2L0K A;  3HBL A;  3QPT A;  1ETX A;  4PFP A;  2D1H A;  3TKY A;  3DBR B;  3H5N A;  5BOX A;  2KP6 A;  2Q2E A;  3HPG A;  2H09 A;  3PNY A;  2KMU A;  4JX6 A;  4A0Z A;  1UZC A;  2KRF A;  5J6X A;  2HKO A;  3ZR8 X;  3SQN A;  4CYD A;  4WK8 F;  3HOS A;  4CCM A;  3W3C A;  4PSX A;  3ROU A;  1YO5 C;  4NDL A;  3E3V A;  2L54 A;  2JRM A;  3RKX A;  5DYM A;  3LAP A;  1O7L A;  1ZAR A;  2F6C A;  2ZJR F;  5DM6 F;  4LLG F;  3E6M A;  4GFB A;  1PDN C;  2KIF A;  2DPU A;  2IBD A;  3K0L A;  3KEO A;  3O3K A;  1NG6 A;  3F8B A;  1G8X A;  4BHC A;  4W1U A;  3IUO A;  1JE8 A;  3BT9 A;  4E7S A;  3SDG A;  3Q0W A;  2E2H J;  3H36 A;  3KLN A;  2P7V B;  3CCY A;  4QPQ A;  5CPR B;  2COB A;  3I59 A;  3E5U A;  3MZ8 A;  5D4S A;  4BU2 A;  5LLQ A;  2Y30 A;  4Q4Z F;  3S6V A;  4RLF A;  1T0F C;  4ZJZ A;  3B73 A;  4M3B A;  3O8G A;  3DTE A;  5J40 A;  1X4O A;  4JX4 A;  4E7L A;  2KJC A;  4U88 A;  3G4S I;  1OCO H;  2DOF A;  4GXO A;  4CCN A;  4CYC B;  3FXL A;  1DUX C;  4IHV A;  4DNC A;  2KQR A;  3V8L A;  4J19 A;  4D9J A;  4MTD A;  2DQR A;  2ZNZ A;  3R0J A;  1DPR A;  2OD5 A;  2XGC A;  1NG7 A;  3WTY C;  5IYB J;  3BTL A;  1WPK A;  1XGS A;  3PFY A;  3L2V A;  2OF7 A;  4TPV A;  5E79 C;  3F6O A;  1KZH A;  4H0A A;  4L18 B;  5FLM J;  3GTQ J;  2VIX A;  2OUM A;  2HDC A;  4IZZ A;  2K9N A;  1J59 A;  2PJR B;  2MD5 A;  3TO6 A;  1FBS A;  1DU0 A;  3GXO A;  2CS3 A;  3LFU A;  3R6S A;  4AD9 A;  4RB2 C;  2OV7 A;  2ESN A;  3RPU A;  1XMA A;  1R49 A;  2GLO A;  2CQ7 A;  2PMZ N;  2M34 A;  2CFO A;  2KRH A;  2VQC A;  4LB6 B;  1Z7U A;  2QUF A;  2R5Z A;  5E8G A;  3ZXS A;  3MEX A;  3CUQ B;  4HNT A;  4O6J A;  3HSE A;  2ZFU A;  2K27 A;  5ILU A;  3VWB A;  2WC2 A;  2H27 A;  1J75 A;  1YLF A;  4U0V A;  1X1B A;  3S2H J;  2NVY J;  1YQA A;  3OS1 A;  3PSI A;  2R7R A;  2E60 A;  3DF8 A;  3S2D J;  4XLN F;  3OWT A;  4OMY A;  2ZME C;  3L2C A;  3AL0 B;  1R71 A;  5C44 J;  3JRE A;  1GVD A;  3NWT A;  1JTX A;  3MVP A;  3DKW A;  4WX9 A;  1XDS A;  1FWZ A;  1X19 A;  4N0B A;  1D1A A;  3M1E A;  5EEH A;  4UV9 A;  3HC7 A;  4O5V A;  1MSE C;  1TQI A;  1Q1H A;  2N8G A;  2PQ8 A;  3EDP A;  4M9Z A;  4HF2 A;  2DDA A;  2MLG A;  2DT6 A;  4M9X A;  2EIJ H;  3MZY A;  3DLL F;  1Z91 A;  2FQ3 A;  5F0F A;  5DM7 F;  2LK2 A;  1T2K A;  2NVX J;  3R0A A;  1W4M A;  3FDY A;  3M4O J;  9ANT A;  2HOS A;  3SFZ A;  4EM2 A;  1HKT A;  3QOP A;  1FJL A;  1R5H A;  2HZT A;  5IY5 H;  2FBK A;  3RJP A;  3VEP A;  1PUF B;  3HRM A;  1LDD A;  1OQY A;  2GXB A;  4RBO A;  4HX4 A;  4UUS A;  4HOB A;  2BW3 A;  2GIV A;  4PUS A;  3M8F A;  3JRA A;  3FKJ A;  5KHD A;  5CQE A;  3HTU A;  3HIF A;  5DS9 A;  2PMH A;  1O3R A;  1XSX A;  3F8M A;  3A1Y A;  1SFO J;  1IV8 A;  3U3L C;  2XUB A;  2BHY A;  5IT9 Z;  2PX9 A;  2G9W A;  1BIA A;  1TLH B;  2ELJ A;  3OR1 C;  4MLO A;  4RGU A;  5TGT A;  2HQA A;  5D6E A;  1VQO I;  1R9T J;  2XGX A;  2GA2 A;  2R7Q A;  3LA3 A;  1WJD A;  3OYE A;  1T0F A;  4Q5S F;  1HF0 A;  3G1M A;  1LEA A;  1QRY A;  5HLH A;  4P9F A;  1MZB A;  2DMQ A;  4FE4 A;  3CTA A;  1XD7 A;  1TT5 B;  2DYS H;  5D8L B;  5AIP A;  5DTD A;  2B63 J;  4N4N B;  2CV0 A;  4LG3 A;  4XNF A;  1W5S A;  2M4K A;  3GLL A;  2CW0 F;  3C2H A;  1MMG A;  1LDK B;  3OL4 A;  4HG2 A;  4KIB A;  1D0Y A;  1IDY A;  2JN6 A;  3IC7 A;  1L0O C;  3ECH A;  4AYB A;  3PJR A;  2CMP A;  5FLV A;  1S5L C;  4HQM A;  3T5X A;  4IX7 A;  3BDD A;  4FCY A;  2XIG A;  2VC0 A;  4PJ0 C;  3OYD A;  5GTH C;  3ZPL A;  1VQ4 I;  5KK1 A;  2VKV A;  2CU7 A;  3DTI A;  3MMY B;  2CGP A;  1IZ1 A;  3RQ4 A;  4HAM A;  1FPQ A;  3FBI B;  4MQV A;  1SFK A;  1J5Y A;  1O7F A;  2XF6 A;  4XLH A;  1B59 A;  1Q1V A;  1HQC A;  4C3H J;  2VOD A;  5LGT A;  1FBQ A;  5H2F C;  3SEZ A;  3KP7 A;  3CCR I;  3UNG C;  2IA0 A;  4L0Y B;  1U3E M;  4UB8 C;  1IXC A;  2I8D A;  2PN6 A;  3LWF A;  2HXI A;  2QSG X;  1LE8 B;  3HHH A;  5HDK A;  1XMK A;  2XV4 S;  2RV8 A;  1ETQ A;  2M8E A;  2YPR A;  4M71 A;  1R58 A;  2LTP A;  2LY2 A;  1QU3 A;  2CSO A;  1UHS A;  1W7P B;  3W6V A;  1FTT A;  2QZ8 A;  4KA4 A;  2ZB9 A;  1SAN A;  3VFZ A;  3HG9 A;  5IYC J;  1QNT A;  1RET A;  3D0S A;  1X1D A;  5IP6 A;  2GM4 A;  2QF7 A;  1WH7 A;  2IEK A;  5JFR A;  1GVJ A;  3DV8 A;  5IOY A;  4ENN A;  1Z9C A;  1ON1 A;  4EM0 B;  1SVO A;  1XX5 A;  3I54 A;  2DBB A;  4YII A;  4HLX A;  2ISZ A;  4NUO A;  3EYI A;  3PM1 A;  2JVG A;  2EB7 A;  1YHQ I;  5ICF A;  1RUO A;  5D5U B;  3BQY A;  5K5O A;  1F9N A;  3SZG A;  1QQI A;  3T0Y A;  3GX4 X;  2HOA A;  3H5A A;  4KDP A;  4OU0 A;  3Q5F A;  3OOP A;  4QSH A;  5FD5 A;  1AA7 A;  5BPD A;  4P1W A;  1U8R A;  4E6K G;  5CVI A;  3JR9 A;  4C3J J;  2BE5 F;  2VBW A;  2RC4 A;  2LY1 A;  4QPO A;  1GLN A;  4BDZ A;  2DMT A;  4V19 K;  1Y0U A;  1MSF C;  3DPU A;  5LBQ A;  2A61 A;  3TO7 A;  1BC7 C;  2QKM B;  4GYI A;  2MLK A;  2K3P A;  5ETE A;  1G6N A;  1ON2 A;  5CLS A;  1WCM J;  2XPU A;  5EG0 B;  2XAH A;  4FT8 A;  2E36 A;  3A01 B;  4EAT A;  3TED A;  1APL C;  5D5V B;  1OYY A;  4XOP A;  1R1U A;  2P7C B;  4RGR A;  4BJT A;  1QA6 A;  2X1C A;  2HVR A;  4RM3 A;  4BBS J;  2CUZ A;  3JRH A;  1DU6 A;  1M1E B;  2KFD A;  2BY0 A;  1D8J A;  5A2Q K;  2XRL A;  3FHN A;  1KYZ A;  3HJE A;  3K4L A;  4UV8 A;  1WJ5 A;  2LRD A;  5M3F J;  1ZRF A;  1F36 A;  2VT3 A;  2Q0O A;  2D45 A;  3BG6 A;  5M3M J;  5EGO A;  4RB0 A;  2J5P A;  2HYG D;  5FJ8 J;  3ERE D;  1G3T A;  4II3 A;  3WGH A;  1RI7 A;  1B72 A;  2NS8 A;  3BZK A;  5HS9 A;  2XRN A;  3BR3 A;  2XVC A;  3ABL H;  2L02 A;  2RKH A;  3ZQC A;  2DPD A;  5FKN A;  2FOK A;  3SYT A;  4DOZ A;  3FXM A;  3G6E I;  1Z7L A;  1X1P A;  3WE2 A;  3OMY A;  3ML6 A;  2HGC A;  1MJA A;  1GV2 A;  5E20 A;  5J47 A;  2E1C A;  4HX7 A;  4LY5 A;  3WOD F;  1I39 A;  1R00 A;  4WXH A;  2JUG A;  3C7J A;  3BR2 A;  1W5C C;  2WV0 A;  1IC8 A;  2M0C A;  2E35 A;  4JP0 A;  3HOW J;  1ZAO A;  3F8N A;  5FRM A;  1HKS A;  2LMD A;  4XRS A;  2L7M P;  3BTI A;  2FD5 A;  3FM3 A;  2M3A A;  4A6D A;  3BPX A;  2M4G A;  2P6T A;  4CDG A;  4HA8 A;  3JRG A;  1P7J A;  2VKD A;  1CF7 B;  3LL7 A;  2M2E A;  2W1O A;  1R1V A;  4BHB A;  3I4M J;  3E0J B;  2QSH X;  2VJ5 A;  2ZSH B;  1TC3 C;  1FNN A;  3FBN B;  3HL2 A;  4HSR A;  2KT0 A;  1MH3 A;  3AKZ A;  4IOC F;  2FU4 A;  1MMS A;  5EEG A;  2ZBK A;  3GTO J;  4A0Y A;  3A4C A;  4UB6 C;  2O8K A;  2WY8 Q;  4FX4 A;  2DA1 A;  3WE3 A;  3GW2 A;  4DGW B;  1YIO A;  1MNM C;  3O6B B;  2CG4 A;  1MBG A;  3RIR A;  2R0Q C;  1YS7 A;  1XMX A;  1ZG3 A;  3MQ0 A;  1VFC A;  4D5F A;  3GTL J;  4LJZ F;  3K10 A;  3PIP F;  1U0J A;  5ERI A;  3AFH A;  3DU6 A;  1ZRE A;  3IP4 B;  3KZI C;  2Y75 A;  2EZL A;  3LSM A;  2FBI A;  1YI2 I;  1T98 A;  1UHW A;  1O3Q A;  1MMD A;  1A6Q A;  2QGU A;  3G1L A;  3OYB A;  5FKM A;  4HRI A;  4ENM A;  2K3F A;  4IL6 C;  1XCB A;  3V7R A;  4BJ5 C;  4ENJ A;  1K4T A;  5FLX K;  3QPS A;  2KLO A;  1U78 A;  2DDB A;  2CJJ A;  4UVB A;  3QP6 A;  4IFA A;  4LGW A;  3WTS C;  3ZP5 A;  3S8P A;  4AC0 A;  1BI3 A;  2R5Y A;  2VJI A;  2MC3 A;  5B5E C;  2Z3Y A;  2ADU A;  2DA7 A;  3TP0 A;  3HM5 A;  1FMW A;  4A6E A;  2CUJ A;  3KP2 A;  1J7K A;  5CVV A;  3PL8 A;  1OCC H;  2LLK A;  1X3Z B;  1YX5 A;  1P2F A;  4ENK A;  4XBF A;  5GPA A;  1TWA J;  2OJE D;  3ECO A;  1V4R A;  2L01 A;  3HTS B;  3GTP J;  5JHU A;  1AU7 A;  2A05 A;  5GP9 A;  2ACJ A;  2Z2S B;  4S05 A;  1Y56 A;  3GME A;  3D5L A;  5CQG A;  4OIP F;  3BG3 A;  4MHG A;  1KU3 A;  2PFB A;  1FY7 A;  5KVR A;  4FHT A;  4EGZ A;  2Z33 A;  1YRN B;  2M45 A;  4FET A;  4I98 B;  3OS0 A;  2A3S A;  4BHP A;  3CF2 A;  1TZL A;  5JR3 A;  3U21 A;  2QSF X;  5E1W A;  4E7Z A;  4ZTJ A;  4KIF A;  3KYL A;  4AIK A;  3FXU A;  2PLY A;  1ITY A;  1I3A A;  3FZV A;  3S3M A;  2DTR A;  4P5O A;  5K7F A;  2M0M A;  1A04 A;  3FIW A;  4M6X A;  2AXT C;  3T8R A;  5JHF A;  4A5N A;  3S32 A;  1SD6 A;  4G8X A;  1OCP A;  2V1N A;  5C3E J;  4CO8 A;  4FTH A;  3N4M A;  3GTK J;  1D3Y A;  2A5W A;  3A02 A;  4M3D A;  3HYI A;  1OJL A;  5K7Z A;  5DUI A;  5J1Y A;  3K1N A;  2RRE A;  3QU6 A;  2DN0 A;  1Z6T A;  2O5R A;  4IRH A;  2Q2E B;  2MW8 A;  2RQQ A;  3LQQ A;  3W2V A;  2ELK A;  1S29 A;  1D5Y A;  1Z0X A;  3Q9V A;  1Y8R B;  2DYR H;  3CLO A;  4S0H B;  1S72 I;  3EET A;  4I76 A;  1BW6 A;  4IHT A;  2AQE A;  1MBE A;  1MND A;  3ISP A;  1LNW A;  3GO5 A;  3U3N C;  2KRC A;  5FO5 A;  2DJI A;  1TW3 A;  4XR6 A;  2DAO A;  4F7Z A;  3LMM A;  3GFI A;  2FBH A;  1MBF A;  1QZE A;  1U8B A;  2QQ9 A;  3DQV C;  1KU9 A;  2L9V A;  2E71 A;  1WWX A;  3LSP A;  3L2W A;  1D8K A;  5ICC A;  1K61 A;  2HQN A;  2IXS A;  5HOD A;  3JRC A;  3WHC A;  3CO7 C;  4IO9 F;  2DFH A;  4MFE A;  2VT2 A;  2M7A A;  1O57 A;  1UG2 A;  1WJF A;  3GFJ A;  3ESW B;  4AIH A;  2HQR A;  4XKC A;  3F0C A;  3BPV A;  1Y1W J;  2VKH A;  4X0G A;  1IXR C;  3I53 A;  3NEU A;  2PMZ A;  4AM3 A;  5AIQ A;  2GAU A;  2ZC2 A;  2ELH A;  3KP5 A;  4IPA A;  4DQ2 A;  2H6C A;  1S3J A;  2K7L A;  3KX2 A;  2MAB A;  3N05 A;  4WWC A;  5E1X A;  3QPH A;  5ED4 A;  4YIR X;  3M3Y J;  3FF5 A;  2YUS A;  4Y33 A;  4HNU A;  3K2Z A;  1AKH A;  1B4A A;  2FX0 A;  5HLG A;  2JSP A;  2OTL I;  3A03 A;  4M74 A;  3K4B A;  3UR3 C;  1TWH J;  1BJZ A;  2DMN A;  4S04 A;  4PJM A;  1SC7 A;  5H6Q A;  2HPI A;  2EIN H;  2L7F P;  1A35 A;  4DJA A;  1ZGJ A;  5BNG A;  2KZV A;  2QEN A;  4DZJ A;  3TBI A;  2NS7 A;  3ZMS A;  2QA4 I;  3PNT A;  5GAH J;  4W97 A;  2OTJ I;  3S14 J;  3S1R J;  4TV7 A;  3EYY A;  2O61 A;  4ZYA A;  5C4J J;  4DW6 A;  4M72 A;  2P6S A;  3DTK A;  2V1U A;  3QOD A;  4BXX J;  3CJR B;  1TTY A;  2HYJ A;  2KIM A;  1S7O A;  2DW4 A;  3LST A;  1OYI A;  1K6Y A;  2JPB A;  2R5Z B;  4IXA A;  2GQQ A;  2K9S A;  1I5Z A;  5F08 A;  2B9S A;  3ELK A;  3HSF A;  3HXL A;  4WXC A;  1FYL A;  2RQP A;  2FF4 A;  3I5U A;  1UCR A;  3BG5 A;  4ZDO A;  1CGP A;  3LSH A;  2IJL A;  2E19 A;  5K5Q A;  1ZH5 A;  3FWE A;  2FQ4 A;  3CZ6 A;  2EV0 A;  1RUN A;  2EFP A;  2VJ4 A;  1HW2 A;  2YS9 A;  5IPA A;  4PJN A;  3W2W A;  1MGT A;  2CQN A;  2O03 A;  3TDU C;  1U9N A;  4NBQ A;  4Y52 J;  2JZY A;  4A3I J;  3GFL A;  3IH2 A;  1AWC A;  3Q3S A;  3HUG A;  3S6U A;  3ABK H;  1IUY A;  3DWL E;  2AXL A;  3KP6 A;  5TJJ A;  5FD6 A;  3PUB A;  3H3Z A;  3M9A A;  1K7A A;  2LKS A;  3J80 K;  4KFC A;  4M6Y A;  2OZU A;  4Y4R A;  2E1M B;  2WAE A;  3CUQ C;  4L5I A;  1XC5 A;  4BBR J;  4HPQ A;  3IWF A;  5F1J A;  3BR5 A;  3QYE A;  5ICE A;  3CCV I;  3JAM K;  3HPH A;  2BV6 A;  2XAJ A;  1MDM B;  3H1C A;  4E70 A;  2KDZ A;  3VYR B;  3SXY A;  1B1B A;  3VSK A;  2GIZ A;  4UUS B;  4GRI A;  4YEL A;  2BW3 B;  3RPQ A;  2H1K A;  2JA2 A;  4D0P A;  3AL0 C;  2H8R A;  3KE2 A;  1XPX A;  4XSZ F;  2BXY A;  3G71 I;  1O4X A;  1MJB A;  5L3E A;  5FFZ A;  2UV1 A;  1A5J A;  1J2X A;  1IF1 A;  3PNV A;  3I55 I;  3OSF A;  1Z77 A;  3K1M A;  3ABM H;  1TW2 A;  3NT8 A;  1R23 A;  2WBM A;  2DA3 A;  1ZRC A;  3H92 A;  2YR2 A;  3CCM I;  5KNL A;  4XLA A;  4RLQ A;  4UUV A;  1CFE A;  4A93 J;  1D0X A;  2M87 A;  4KIT B;  4PFO A;  1X3W B;  1IXS B;  2DTZ A;  3GZN B;  4ESF A;  4ZH4 F;  2Z9O A;  2HZD A;  5FKO A;  2M7B A;  2CQX A;  2HKX A;  1VQK I;  4Q47 A;  1YW8 A;  4L0Z B;  4N4O B;  4E7I A;  3KZY A;  3BRO A;  1YW9 A;  1TT0 A;  2VE9 A;  1OR7 C;  3I4N J;  1OCZ H;  2HDW A;  2Q1Z B;  1KQ0 A;  4UUT A;  2E2I J;  2EV6 A;  4ZZL A;  3K4M A;  1A31 A;  1XGN A;  4A3G J;  1HW1 A;  1USS A;  4ON0 A;  2CW7 A;  4G7H F;  1RC9 A;  1W1W E;  4M3F A;  5CVU A;  4HQE A;  3MWM A;  4U0W A;  4NUI A;  3KP4 A;  1I1G A;  2WY7 Q;  4EEF G;  4A3C J;  2GOM A;  1K6O A;  4LK1 F;  2BY2 A;  3M07 A;  2F5F A;  3OY9 A;  5E3M A;  1E2X A;  1SVL A;  2FJ1 A;  3P9I A;  4DYR A;  1XTA A;  1KON A;  2ICW G;  3I0T A;  3S93 A;  2HWV A;  3VYU B;  4A3L J;  2WB1 N;  3LAJ A;  1VTN C;  1W7P D;  4A3B J;  1G2H A;  2VE8 A;  1YJ9 I;  3SFI A;  3WTU C;  1T39 A;  1OFC X;  3CCL I;  1U5T B;  1JTY A;  4A12 A;  2IS2 A;  3IAM 2;  4GCV A;  3LSG A;  4C2U A;  1FLI A;  3QU3 A;  1HSJ A;  2TCT A;  2MG4 A;  3QWL A;  2LVS A;  1XS9 A;  4QTR A;  3VOE A;  2X0L A;  3FKI J;  5HOO A;  3RKY A;  1FTZ A;  3I9V 2;  1BOB A;  1PUE E;  2DT5 A;  3J81 K;  1Z05 A;  2IGO A;  2HXO A;  3HGG A;  1R36 A;  4BAC A;  3HOZ J;  3F3X A;  1IAW A;  4BAY A;  3CMM A;  2CO5 A;  2W85 A;  2AS5 F;  1IJW C;  4MTE A;  3GTG J;  4CCJ A;  3OYG A;  4DIQ A;  1IG7 A;  1E0E A;  1BI2 A;  2F5D A;  1BM9 A;  2W4S A;  4I0A A;  3ASN H;  2LBF A;  3ZMV A;  3H9J A;  1B9M A;  4FE7 A;  3CO6 C;  1ZR4 A;  3C2B A;  3FHZ A;  1TQP A;  5B66 C;  2GZW A;  3RCO A;  2R7O A;  1VQN I;  4OIO F;  2EIK H;  2MH9 A;  4PSW A;  1Y39 A;  4HBL A;  1X58 A;  1FT9 A;  1LFP A;  4BQA A;  2L9S A;  2HFH A;  2LF7 A;  3IHU A;  3ZN1 A;  3OL3 A;  3S1Q J;  2NRA C;  3PQK A;  4FIS A;  2F5C A;  2OU2 A;  1G3S A;  3KYC B;  1ZEL A;  5B1B H;  1Z6R A;  4QWQ A;  2PEX A;  2ISY A;  4XN0 A;  1IN4 A;  3CMA I;  3U1K A;  2LSO A;  3T1B A;  2D5V A;  3BR1 A;  3VYT B;  1LKX A;  2GXA A;  2X1E A;  5EJC A;  2R4G A;  4MO7 A;  5HLT A;  2EH3 A;  3GFM A;  3ZMU A;  2V26 A;  2HVS A;  1ETV A;  2ZME A;  1P4X A;  2VC1 A;  4B3X A;  5LGN A;  2XSD C;  1VI0 A;  3OYL A;  3ZRG A;  1P7I A;  2W82 A;  4R1H A;  1BR4 A;  4MIM A;  3C1D A;  4M9S A;  4WF2 A;  4ZC3 A;  1D1B A;  2RNJ A;  1VQL I;  5B3S H;  2K40 A;  1SVM A;  2M1B A;  2L4A A;  5L3G A;  1FZP B;  1JT6 A;  4X1E A;  4WCG A;  3F8C A;  3DU5 A;  2L7Z A;  4EM1 A;  4YFX F;  4XM3 A;  3GVA A;  2FUG 2;  2BGC A;  4LIT A;  1SFX A;  2V9V A;  1ZYR F;  2XKP A;  3ZGK A;  5EGO B;  3K4J A;  3G3Z A;  4NUK A;  2QKL B;  1IGN A;  2O3F A;  4NQW B;  2XGD A;  1FYM A;  3ZMD A;  4BXF A;  5LFA A;  1WSU A;  1B72 B;  1QPI A;  3L00 A;  4G7O F;  1BI1 A;  4FQG A;  1XB4 A;  4DYQ A;  4EQQ A;  1IV6 A;  2OAZ A;  2L3D A;  2I10 A;  1O3S A;  4KMU X;  2WA0 A;  1YW7 A;  3Q0V A;  3CC7 I;  1A6I A;  4ZYE A;  4BGD A;  1X1C A;  1I3Q J;  3F72 A;  3L9F A;  2X51 A;  4IOA F;  4BUP A;  3CCE I;  4I99 C;  3V7S A;  2K9M A;  2STW A;  2VZN A;  1GDT A;  4EV0 A;  1MNE A;  1T56 A;  1IN6 A;  1LVK A;  2LKP A;  3FXJ A;  3FXQ A;  4YFK F;  3WTW C;  2DMU A;  4LLL A;  5IT3 A;  3F21 A;  2YX4 A;  2DO7 A;  3O8H A;  2A6T A;  3K6G A;  4BEH B;  4HLY A;  4G6Q A;  3U2R A;  3P9K A;  1YYV A;  4G94 A;  2B0L A;  1UG0 A;  1GXQ A;  1L3L A;  1GT0 C;  4JOM A;  1WJC A;  2L5Q A;  2ECC A;  3EUH C;  4J01 A;  4H4K C;  1WVR A;  2EZI A;  2V79 A;  4XMY A;  3K4K A;  1MJ9 A;  4U87 A;  3KEQ A;  1R22 A;  3BOQ A;  4Y3O A;  4C9Y A;  3JRF A;  5J8C A;  3D5R C;  3LQR A;  4Y17 A;  2V1X A;  1ZQ3 P;  4N9I A;  2D2W A;  3H9G A;  4LMY A;  3ULQ B;  4HEA 2;  1IW7 F;  4MEX F;  3G1O A;  1P6R A;  2NVT J;  4R8H A;  2E7W A;  1I27 A;  2DT7 B;  1SD5 A;  5EEA A;  5DCF A;  3SHF A;  2HDD A;  2R3S A;  1FOW A;  2ZJP F;  1ZRD A;  5DEQ A;  1FSE A;  3OIP A;  4F52 A;  4BE1 A;  2V9K A;  3WU1 B;  3DEE A;  4QLC U;  3FXO A;  2D1V A;  2BY1 A;  4EJT A;  1E17 A;  2IS6 A;  4PK4 A;  1KU2 A;  1NH3 A;  3WGI A;  4F93 B;  1W0T A;  1BW5 A;  2VL8 A;  1U2W A;  2IA2 A;  2EBI A;  4A5M A;  2GWR A;  2EPF A;  2JWT A;  2P5K A;  2G7U A;  4X6A J;  2ME6 A;  2TRT A;  2HTJ A;  3WU2 C;  4NHJ A;  4MQ9 F;  5JYS A;  2KIQ A;  2DU9 A;  2KIU A;  3EPZ A;  2AQF A;  4AIJ A;  2JPC A;  4B3A A;  2VBZ A;  1VQ7 I;  1YG2 A;  2YX7 A;  1I6H J;  2ZO4 A;  4UVA A;  2XAU A;  5CVJ A;  3OIO A;  1ETY A;  3BJA A;  2XHK A;  2R5Y B;  4U7B A;  2EA4 A;  1N77 A;  2QBY A;  1MMA A;  1TNS A;  2EZK A;  1WJE A;  3ERM A;  2DOD A;  2EJR A;  3IH3 A;  4B8X A;  3E6C C;  4A0X A;  2VOO A;  1MBJ A;  2NNY A;  3RDI A;  2EA2 A;  2W24 A;  2ZXJ A;  4BL0 B;  3IWZ A;  4U0Y A;  2KJB A;  4L9N A;  2VXD A;  3WTV C;  1HDP A;  1T8I A;  2VBY A;  4BKX A;  4E7J A;  2VI6 A;  4PCQ A;  3DLA A;  5IYD J;  4L9J A;  4GYG A;  2CYY A;  4E7H A;  2IAI A;  4HF1 A;  2LYC A;  2ZJ2 A;  5E8I A;  1UHM A;  3HKZ N;  3I58 A;  2X6O A;  4RS8 A;  2IPQ X;  2PG4 A;  1QO0 D;  4LG0 A;  1HA8 A;  3QYB A;  2H6B A;  4ETS A;  2VOP A;  4RB1 A;  3DFG A;  1QHH D;  4KIC A;  1TWG J;  3H0D A;  3R4K A;  2XAQ A;  3H35 A;  2MH2 A;  4BDY A;  4ESJ A;  2LC2 A;  4IHY A;  3E5Q A;  2RAE A;  3BZ6 A;  5IOZ A;  4RAG A;  4XL9 A;  5IP7 J;  2JA8 J;  2BVL A;  1VQP I;  5KCM A;  2R7U A;  4G2U A;  2XPW A;  3WTX C;  3Q0U A;  4EGY A;  2JK3 A;  3HZJ A;  3W6J B;  2CV1 A;  4I02 A;  3IRR A;  1G3Y A;  3CF5 F;  5K5R A;  5L3C A;  2X4H A;  2R7X A;  2LD5 A;  1T6S A;  1FSH A;  4HDV A;  1YX3 A;  1R6R A;  2K9Q A;  1K79 A;  1HST A;  2NYX A;  4HZF A;  3MFK A;  3ASO H;  1F5T A;  3DXJ F;  5DD4 A;  2OBP A;  2HPM A;  2L4M A;  3C3W A;  4M3E A;  4PDK A;  1QVT A;  2ZSI B;  3LSK A;  5F64 A;  1E3O C;  2BXZ A;  2VAS A;  3GF2 A;  2DOA A;  4OAZ A;  2HQ5 A;  4RAY A;  3PQJ A;  1G4D A;  1V5F A;  2AO9 A;  3D5S C;  4XID A;  4EVI A;  4LB5 A;  1LVA A;  1WJA A;  3KIO A;  1QZZ A;  5K1Y A;  3RZO J;  4CH7 A;  1XGM A;  1DP7 P;  1F4K A;  2VLA A;  3JRI A;  1TP4 A;  5TIS C;  2VBX A;  2MA3 A;  5FB2 A;  3K4C A;  1VQ9 I;  1K78 A;  3HGY A;  3IAS 2;  3CC2 I;  2R7D A;  3B6C A;  4P96 A;  4I01 A;  5B1A H;  4O3M A;  3J7A Y;  4OWR B;  5JVT A;  1SMT A;  1H8A C;  4II2 A;  2GBY A;  4CA0 A;  4P9U A;  3WU0 A;  4R79 A;  1YS6 A;  5A2Q Z;  5D8K B;  2F48 A;  3CME I;  1FIA A;  3I71 A;  4XIC A;  1QBJ A;  5ICG A;  2VQG A;  4A3E J;  4GO1 A;  2HNH A;  3D1N I;  2VQH A;  2O8X A;  4I6Z A;  3IH4 A;  3A0B C;  1GHC A;  1S8N A;  1LB2 A;  4FAS D;  1BN5 A;  3TW7 A;  2LNB A;  4XRS G;  5LHI A;  1UB9 A;  5F0H A;  1XGO A;  1R1T A;  5FGM A;  3OR2 C;  5EZG A;  3WGG A;  2MD0 A;  1T38 A;  3HSR A;  1JUM A;  2A5Y B;  2WAD A;  1OLT A;  1YFH A;  4F92 B;  4ZDP A;  3RPU D;  1AKH B;  1HDD C;  1Y8Q B;  3RTR A;  1AOY A;  2NXN B;  4IHX A;  2E7X A;  1RR8 C;  3QAH A;  4MFD A;  1H9T A;  2L2O A;  3I64 A;  5HS8 A;  4ABZ A;  5D5W B;  2IA1 A;  2V6C A;  4BS9 A;  3BR0 A;  1P9Q C;  3LFK A;  4PJL A;  3BCB A;  2QWW A;  1BI0 A;  4HST A;  4MNU A;  2MBF A;  1SD7 A;  3OV8 A;  1HOM A;  4JBA A;  4RM2 A;  3FMQ A;  1UST A;  2X6X A;  3ZN0 A;  2CRG A;  3LNQ A;  1JHF A;  1WH5 A;  3AG1 H;  2DXI A;  2VKE A;  1JKP C;  1EH8 A;  1JKR C;  4CCL A;  5J4Y A;  4IRI A;  3QPL A;  4HV5 A;  4K2E A;  3M8E A;  3P7N A;  3SZP A;  3VPR A;  3NQO A;  3FIS A;  3NAR A;  1FOY A;  2DI3 A;  5DD8 A;  4MGR A;  2LRE A;  4CZZ A;  5DV5 A;  4UY8 I;  3QYF A;  1LDJ A;  4A3K J;  5FKK A;  4L9V A;  5LEK A;  3V8K A;  1IN8 A;  3KPH A;  4G7Z F;  2Y2Z A;  1Z21 A;  2KIS A;  2QQA A;  3BJ6 A;  3I59 B;  4G9Y A;  3FXK A;  5JLX A;  5HNF A;  1B8I A;  2ETH A;  5J1R A;  2IRF G;  2CW8 A;  3HRT A;  2VPL A;  4OAY A;  4EJV A;  1H89 C;  4XLE A;  3CCQ I;  3HUG B;  3OYF A;  1WZ2 A;  3BR6 A;  3U9G A;  4WXD A;  1HC8 A;  2X6Y A;  4BE0 A;  4E7K A;  2P5V A;  2I5U A;  3WTT C;  5DCM A;  3MKW B;  3SEQ A;  1QZY A;  2KKO A;  2RGV A;  1LFB A;  3CDL A;  4HYE A;  5L3B A;  4BQN A;  5FLX Z;  1SAX A;  1D0Z A;  1WI3 A;  1SEU A;  4BE2 A;  3TOB A;  5LGU A;  3K9T A;  4LFU A;  5CJ9 A;  2COM A;  2OZ6 A;  4KYW A;  3S2W A;  1X2N A;  5FFX A;  4XOR A;  2W48 A;  3PFI A;  1T08 B;  1OPC A;  1RKT A;  2DMP A;  1IRF A;  5FRN A;  1WQ2 A;  3L1P A;  1YJW I;  1V54 H;  5EYR A;  5HDG A;  2W84 A;  1S6L A;  5LHG A;  1I6X A;  3IKT A;  1IDZ A;  3ZMT A;  3RI4 A;  2ZXH A;  1HW5 A;  3PUF A;  5IT9 K;  3GTJ J;  4Z6Y A;  3BJO A;  2Y69 H;  4IRG A;  4BY7 J;  2F4O B;  2Y48 A;  2WB1 A;  2R7Z J;  3MD2 A;  3HOU J;  4ZYH A;  2IT0 A;  3O2P E;  2HEO A;  1RNL A;  3GLX A;  1ZLJ A;  2E1M C;  3E6B A;  3ONQ A;  2JT1 A;  5D6F A;  1K83 J;  1UJ8 A;  3H9Q A;  1TL8 A;  1DGR M;  2DJN A;  2EIL H;  3A0H C;  1W36 D;  1N75 A;  3IL2 A;  1J09 A;  3TQN A;  3L7W A;  2RVC A;  2V6E A;  1T95 A;  2UXX A;  3JSP A;  3IKV A;  3S6S A;  1N25 A;  3GTM J;  4KT5 C;  3S1N J;  3W2A A;  5E18 F;  2KDO A;  5E3L A;  4BJ6 C;  3EUK L;  3R61 A;  1DQU A;  3CP8 A;  2E2J J;  4Q48 A;  1MD0 A;  3Q2R A;  2IGM A;  3F23 A;  3AG3 H;  3VDX A;  3K1P A;  1BL0 A;  2BHZ A;  1ETO A;  1OIS A;  3G2B A;  2HS5 A;  3BTJ A;  1J9I A;  3DPL C;  4F3Q A;  4IKF A;  4NC8 A;  4XKW A;  3U1D A;  2EQR A;  5FKL A;  3WG7 H;  2FXA A;  2BYV E;  2XGE A;  4AUX A;  1SMB A;  3VYS B;  1ZKG A;  1U9O A;  3ZQH A;  2XB5 A;  3FXR A;  1S7E A;  1PP7 U;  4D53 A;  2PI0 A;  3HRU A;  4M3G A;  4XLF A;  2KPM A;  2L9R A;  4PGH A;  2LY9 A;  2V7F A;  2O9L A;  3DKY A;  3M8J A;  1JKO C;  1N78 A;  5H20 A;  4A3F J;  5IP9 J;  3BQZ A;  1P92 A;  4ZTF A;  1OMI A;  4RMN A;  1BBY A;  4AU7 A;  2IVM A;  2A07 F;  2NOG A;  4AVZ A;  4XK4 A;  3TO9 A;  1WRJ A;  2VPR A;  3REO A;  4NC7 A;  4HF0 A;  1H88 C;  1OCR H;  3CJN A;  1W36 C;  2TDX A;  1GV5 A;  1CQT A;  1W5T A;  3IRQ A;  3ABT A;  3OS2 A;  4Y13 A;  4C30 A;  1FX7 A;  1DP3 A;  2LBF B;  3S15 J;  1TNT A;  2IGN A;  5J4V A;  3VOD A;  3ZQL A;  1QPM A;  1U5T C;  4B44 A;  3QOE A;  2NVQ J;  1ZGW A;  2HYF A;  2WTE A;  4KJZ A;  3FMS A;  4ANJ A;  4CCK A;  2IS4 A;  3C2G A;  1J0R A;  2XDV A;  1RKW A;  2JJ7 A;  1SD4 A;  2R7V A;  3AAF A;  1IO2 A;  1I1S A;  1LJ9 A;  4IQJ A;  4IHS A;  1ENH A;  4XN3 A;  2VXZ A;  1D5V A;  1UAA A;  1YIT I;  2HU9 A;  3JRD A;  4Y7N J;  2KHM A;  1Z3X A;  1FMV A;  2RDP A;  2JA7 J;  2DA5 A;  2K5C A;  2CFX A;  2EFW A;  1ETW A;  1KU7 A;  2XAF A;  4HDU A;  2WAQ A;  1YJN I;  1ODD A;  2LOO A;  4D5C A;  3NWS A;  5L3D A;  1U6G A;  1X2M A;  5LRR A;  4CYC A;  2LG4 A;  2FSW A;  4BQO A;  2ZCW A;  4CSW A;  2OA4 A;  1VQ6 I;  5F6F A;  2LKX A;  4YEJ A;  1OCT C;  4ITV A;  3WHB A;  3DEU A;  2EV5 A;  2ZME B;  4LIV A;  4F55 A;  3GUD A;  1EH7 A;  1W0U A;  2P4W A;  1RR7 A;  3ZQG A;  1MDM A;  1B9N A;  1RIO H;  3H5R A;  3NAU A;  3OOU A;  2HI3 A;  1TQM A;  1D1C A;  2PJR A;  1E3P A;  2B7E A;  4J00 A;  4B43 A;  1UEL B;  3EQL F;  3VB2 A;  4OMZ A;  2JTV A;  2JMW A;  3MZH A;  1BC8 C;  3FK6 A;  1JT0 A;  1UFM A;  3FX3 A;  3ZQQ A;  1BR1 A;  5L3F A;  3KLO A;  4DBR A;  3TOA A;  5J3L A;  1EJ9 A;  2Y9Y A;  4XSX F;  5ILS A;  3RSN A;  1F1Z A;  2QQ8 A;  3CUQ A;  3KYD B;  4G6D A;  4UNO A;  1C0W A;  1ZLK A;  2DA4 A;  3CMY A;  4ZDL A;  1KQ9 A;  3KZZ A;  2EWN A;  4NB5 A;  3E5X A;  3OIQ A;  4LK0 F;  2EZH A;  4F91 B;  2OCC H;  4IQ4 A;  1VQM I;  4IEJ A;  4AVP A;  3QRF F;  2OPT A;  3K4N A;  2JQ7 A;  4GDF A;  1BA5 A;  2XF5 A;  3KEY A;  2LP0 A;  2DOE A;  1IRG A;  1ZGA A;  2XPV A;  3VSL A;  1TWC J;  1PP8 F;  5FRO A;  1R4N B;  1JGG A;  2Z16 A;  2W00 A;  3OYA A;  1ZG5 A;  1JJ8 C;  1NTC A;  1KQ8 A;  3V4G A;  2QYO A;  1ZTR A;  2XB0 X;  2BY3 A;  1EF4 A;  5LD2 C;  3CQZ J;  1KYW A;  4B09 A;  1BR2 A;  5E17 F;  3J80 Z;  3OYC A;  3AG4 H;  2BOL A;  4E4H A;  3Q2U A;  3ABU A;  3I4P A;  3RKQ A;  5ILV A;  3K70 D;  5C4X J;  2FEZ A;  3JAM Z;  3GZ6 A;  3L09 A;  2R7S A;  2E5N A;  3E97 A;  3GZ5 A;  5GAD J;  5JI6 A;  1GXP A;  4C2T A;  2IW5 A;  1PUF A;  2H1L A;  4M6V A;  5KAI C;  1NK2 P;  3IV5 A;  3CCU I;  2UWM A;  1OR7 A;  1U5T A;  3L2Q A;  2GA1 A;  2X48 A;  1HLV A;  5EZH A;  1S7A A;  1YIJ I;  4N9H A;  4B47 A;  5D4R A;  1REP C;  4A3M J;  3CC4 I;  4DYC A;  3HOV J;  1R5G A;  4UHT A;  3TP3 A;  3KP3 A;  2XC7 A;  5E3N A;  2Z99 A;  4XLP F;  1S9H A;  3MKZ A;  5DUK A;  1RES A;  5F1R A;  2WAQ N;  5BS6 A;  3HRS A;  1ACI A;  3LSR A;  3S17 J;  5M5W J;  5HVQ C;  3I56 I;  2JRT A;  5DDG A;  4CHU A;  2PMU A;  1PYV A;  2HOT A;  4OIQ F;  1F43 A;  4P55 A;  1LQ1 A;  2O6G E;  3DPT A;  2LF8 A;  2LR8 A;  2NOJ B;  1IRX A;  1HXD A;  2X1D A;  3BG7 A;  4ASN A;  5J1U A;  2YSR A;  1MBH A;  3CJQ B;  1O3T A;  1X1A A;  2A6E F;  4IF4 A;  5F0C A;  3HKZ A;  2QCO A;  2Y0S A;  5M5Y J;  1QNX A;  1IN7 A;  5F27 A;  3OSG A;  2O0Y A;  2ID3 A;  4KN7 X;  1XDU A;  1V55 H;  2JSC A;  1NHA A;  2NS0 A;  4XRM A;  4KIG A;  3ZQF A;  5E3O A;  2MFZ A;  4AIW A;  2P5L C;  3SDB A;  3RKW A;  3P5J A;  2FNA A;  5CYV A;  3TW6 A;  2BZT A;  1JHH A;  2Z1D A;  1Z3Y A;  3CUO A;  3V8J A;  1XCV A;  3PO3 J;  2VUM J;  2BVM A;  4IVN A;  2JUC A;  1MIJ A;  3FMR A;  1LFU P;  3K70 C;  1X4P A;  2QM3 A;  4PZJ A;  2WAF A;  1EH6 A;  4LD5 A;  4V2G A;  1JJ6 C;  2QBY B;  5HS7 A;  1XSV A;  3DCF A;  3DKX A;  1KA8 A;  3OYN A;  2HOE A;  4GGG A;  2FOW A;  2DFF A;  2WWY A;  1RRJ A;  3TMO A;  4YRV A;  3A2K A;  2X85 A;  1ZK8 A;  2NVU B;  1FP2 A;  2K86 A;  5JLW A;  3LA2 A;  2EFO A;  1OYW A;  2ZJQ F;  4BQQ A;  2YU9 J;  4KIS A;  4LG0 B;  5AON A;  4AYB N;  2DA2 A;  2H8W A;  2UXN A;  1LE8 A;  4XON A;  1BOA A;  4B4C A;  3JTH A;  2JA5 J;  3JW4 A;  3J81 Z;  2ID6 A;  3DBH B;  2XSJ C;  1P4W A;  2F4M B;  3P9C A;  1VQ5 I;  2P0W A;  4BY1 J;  1I50 J;  1V3F A;  2CQK A;  1W7P A;  1ORK A;  2R7W A;  3LSI A;  3GWZ A;  3MN2 A;  2X6W A;  3MKY B;  3BC8 A;  5M5X J;  5CVR A;  2ME0 A;  3OYK A;  3J7Y J;  4DZP A;  5HNH A;  1RPW A;  4D1Q A;  2M5W A;  4M73 A;  3CLQ A;  2PJP A;  3GEZ A;  4RB3 C;  1FIP A;  2QEX I;  1TBX A;  4NQW A;  4L9T A;  3LA7 A;  3CJT B;  5HLI A;  3WTZ A;  1WKM A;  2KL4 A;  2HTS A;  1MMN A;  3H0G J;  1OKR A;  4CIC A;  1MBK A;  1ZN2 A;  2A69 F;  1FOK A;  2F2E A;  2ZFW A;  1QHG A;  3BP8 A;  2V9P A;  4EMS A;  3KFW X;  5K7H A;  2F5V A;  1P4A A;  4CZC A;  2EFQ A;  1YE9 A;  2QLZ A;  4HW0 A;  2DK8 A;  1JGS A;  1AHD P;  2FMY A;  5GTI C;  2VJJ A;  4HV6 A;  4CUG A;  2W57 A;  5HDN A;  2FRH A;  2FE3 A;  2G0E A;  2XRO A;  3BZC A;  1Y6I A;  3G73 A;  4B1R A;  2WV1 A;  1G59 A;  5E1Z B;  4I0B A;  3ZQ7 A;  1QVU A;  1E3H A;  2E5Z A;  3RZD J;  1NK3 P;  2KZG A;  2FML A;  3DP7 A;  2Y31 A;  3ZQI A;  2K02 A;  3JRB A;  3S16 J;  4KT6 A;  5TRD A;  2R7T A;  1R5I D;  1IRZ A;  2E34 A;  3MCZ A;  5D5X B;  3AG2 H;  3BLY A;  4BH9 A;  2A6H F;  4NUN A;  4BEH A;  1K78 B;  2Y0S N;  5EDN A;  5EG0 A;  1HCR A;  1STZ A;  5H6R A;  4NNJ A;  2XAS A;  3A01 A;  1LEB A;  3CCJ I;  1IN5 A;  2F5E A;  2ZXW H;  3KCC A;  4LIU A;  3RQI A;  3WG9 A;  2JA6 J;  3U3U C;  1BIB A;  4OOI A;  1XSD A;  1Y1V J;  1QGP A;  4NC6 A;  3HOX J;  2CV2 A;  3S3N A;  2DLL A;  1WJB A;  4OIR F;  3E6D A;  3HEF A;  1A36 A;  2R92 J;  5LEJ A;  3B02 A;  1SFE A;  1WFX A;  2MC4 A;  2LDU A;  1ONV A;  1R4M B;  4ZZD A;  3BY6 A;  2K85 A;  4L5E A;  3OYH A;  1SFU A;  1YTY A;  3H3V K;  4RAF A;  2LH9 A;  3RYP A;  3TL4 X;  5F04 A;  2GOX B;  1DDN A;  4B48 A;  4YG2 F;  1FC3 A;  2P81 A;  4BYY A;  4JYK A;  3M7G A;  2Y9Z A;  3E7L A;  1FOX A;  4JX5 A;  5LHH A;  4I09 A;  4YIF A;  4I2O A;  3R60 A;  2H94 A;  4NUB A;  1GUU A;  2DCE A;  3QP5 A;  1ERD A;  4ESB A;  2R93 J;  4XQF A;  3N97 A;  3F8F A;  5GAE J;  3LOC A;  2RN7 A;  3L2U A;  2E1O A;  3EUH A;  4D7M A;  3PIO F;  5GAG J;  2ECB A;  4RGX A;  2IS1 A;  2CH0 A;  2DFI A;  1FEX A;  4C2M J;  3HHG A;  5J8F A;  3GYH X;  3CCS I;  1Z67 A;  2NNN A;  1MH4 A;  5CKT A;  2ESH A;  3FM5 A;  4PGG A;  5BQT A;  1BJA A;  1XG1 A;  3CES A;  2C6Y A;  3CD6 I;  3K69 A;  3MAJ A;  2G7H A;  1H0M A;  1WHU A;  4JQF A;  1HKQ A;  1R7J A;  2M9H A;  3EUA A;  3LSJ A;  3L2R A;  4IJA A;  4KUM A;  2NAZ A;  2OCE A;  5JVG F;  3HDD A;  3QQA A;  3PSF A;  3UKG A;  5BPI A;  4CGZ A;  1U53 A;  4OIN F;  3HOY J;  3SZT A;  2EFN A;  1ZR2 A;  2CWE A;  3OYM A;  1WGX A;  3CP2 A;  2MYS A;  1EKE A;  1JUP A;  4XKV A;  1Y0N A;  2AHQ A;  3SJM A;  2MSY A;  3BTC A;  4EJU A;  3KET A;  3GCM A;  3J7Z I;  2FNP A;  4JK1 X;  4HX8 A;  4DBQ A;  2O7O A;  2STT A;  3X2Q H;  3W6K B;  1YOV B;  2K4B A;  4QIW N;  5GPC A;  2GXG A;  3I3L A;  2X9D A;  1FYK A;  3ZMZ A;  4IHW A;  1CF7 A;  4A2U A;  2ZKZ A;  3RYR A;  2P8T A;  1JXS A;  2HR3 A;  1RZ4 A;  3Q9S A;  1IUF A;  1TWF J;  4H0E A;  1JI8 A;  3TGN A;  1B6A A;  2JVH A;  1B8I B;  2BBY A;  1UMQ A;  1VF9 A;  2M30 A;  4EJW A;  4XKB A;  2Q8K A;  3C18 A;  1EV7 A;  2CQQ A;  3FK7 A;  4RGS A;  2V4J C;  2XKO A;  2K4J A;  2W7N A;  2VQL A;  1JUS A;  2K9L A;  2QQB A;  3NRV A;  2DFE A;  4XRF A;  4AID A;  1VND A;  3DBL B;  5DCM B;  1EA3 A;  3F22 A;  1V5G A;  2DA6 A;  3V42 A;  3JSO A;  1VQ8 I;  4FX0 A;  1LUJ B;  2F4I A;  4KNY A;  1DPU A;  2IGK A;  2ZNY A;  4KN4 X;  1PVE A;  3HOT A;  3COA C;  3H3U A;  2VON A;  6PAX A;  2OQG A;  1SMY F;  2Y0M A;  2BEO A;  4V2F A;  4G6T B;  2LFB A;  3ZCO A;  2M8G X;  2L7K A;  2VB6 A;  5EF6 A;  1ZG1 A;  4MEY F;  3JTG A;  4PJJ A;  2RNG A;  4C3I J;  3S1M J;  1SAU A;  2MGQ A;  2R7F A;  4BXU A;  1POG A;  3K2A A;  2CUF A;  1V5E A;  1Z1D A;  4D7N A;  3F9K A;  3V7C A;  4RDU A;  4XLC A;  3OYI A;  2J5O A;  3CDI A;  1VZ0 A;  1H9G A;  4HNV A;  1HBX G;  3F6V A;  4ZYG A;  2UZK A;  4ZYD A;  3CDH A;  4A69 C;  1T33 A;  1FBU A;  2V1D A; 
#chains in the Genus database with same CATH homology
 4D53 A;  1XTA A;  1QNX A;  3Q2U A;  4NUN A;  3Q2R A;  2CQ7 A;  1WVR A;  4NUK A;  1XX5 A;  2DDB A;  4NUO A;  1U53 A;  2VZN A;  3NT8 A;  4AIW A;  3MZ8 A;  3U3U C;  4TPV A;  2DDA A;  4IFA A;  3S6V A;  4H0A A;  2EPF A;  4P27 A;  2A05 A;  5ETE A;  1RC9 A;  3S6S A;  1CFE A;  1SMB A;  5JYS A;  2GIZ A;  3U3L C;  4NUI A;  4LY5 A;  3U3N C;  4G2U A;  3S6U A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...