1WWRA

Crystal structure of trna adenosine deaminase tada from aquifex aeolicus
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
154
structure length
154
Chain Sequence
GSHMGKEYFLKVALREAKRAFEKGEVPVGAIIVKEGEIISKAHNSVEELKDPTAHAEMLAIKEACRRLNTKYLEGCELYVTLEPCIMCSYALVLSRIEKVIFSALDKKHGGVVSVFNILDEPTLNHRVKWEYYPLEEASELLSEFFKKLRNNII
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of tRNA Adenosine Deaminase (TadA) from Aquifex aeolicus
pubmed doi rcsb
source organism Aquifex aeolicus
molecule tags Hydrolase
molecule keywords tRNA adenosine deaminase TadA
total genus 54
structure length 154
sequence length 154
chains with identical sequence B, C, D
ec nomenclature ec 3.5.4.33: tRNA(adenine(34)) deaminase.
pdb deposition date 2005-01-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00383 dCMP_cyt_deam_1 Cytidine and deoxycytidylate deaminase zinc-binding region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.140.10 Alpha Beta 3-Layer(aba) Sandwich Cytidine Deaminase; domain 2 Cytidine Deaminase, domain 2 1wwrA00
2KCQA 1P6OA 2FR6A 4ZD5A 2KKSA 2PW9A 1UWZA 4LC5A 4K1RA 1UX1A 3R2NA 5C2OA 3IJFX 4LCPA 2ZNVA 4I43B 4OCLB 3OJ6A 4P9DA 2A8NA 4NQLA 4OWPB 5GAOA 4WIFA 4LD2A 3DH1A 1R5XA 2QLCA 4JXEA 1RB7A 2W4LA 2HVWA 1JTKA 2Z3IA 4O8XB 2OG4A 2B3ZA 4ZFRA 4F7OA 1R5TA 4LCNA 2Z3GA 4OCLA 4QFTA 3G8QA 2OBCA 4ZD4A 2G84A 2O3KA 1WKQA 4E0QA 3EX8A 4OWPA 1UAQA 2NYTA 1Z3AA 2O96A 2P87A 3OCQA 3ZPGA 5DCAJ 4O8XA 4G3MA 4BGDC 2HVVA 4MSQA 1CTUA 1ZABA 4O8YA 4ILGC 3ZPCA 4P9CA 3E1UA 1WN5A 1AF2A 3RZVA 4MS7A 4EG2A 4MSDA 4P9EA 4D10F 4LD4A 1CTTA 2P8RA 4OCMA 2G6VA 2B3JA 1MQ0A 2NX8A 1YSDA 4F3WA 4O8YB 1ALNA 2Z3HA 3ZEFB 4KITC 2D30A 4HRWA 3MPZA 1YSBA 5M52C 2FR5A 2D5NA 5M59B 1OI0A 4OCNB 1OX7A 4ZFTA 5CW6A 1WN6A 2O7PA 2RPZA 3SBGA 4OCMB 2Z3JA 1UX0A 4WIGA 4PQTA 4MSMA 3RZUA 2ZNRA 3B8FA 1TIYA 2HXVA 1WWRA 4OCNA 4HRQA 4MSJA 2O95A 3DMOA 1VQ2A 4LCOA
chains in the Genus database with same CATH superfamily
2KCQA 1P6OA 2IU0A 2FR6A 4ZD5A 4EHIA 2KKSA 2PW9A 1UWZA 4LC5A 4K1RA 1UX1A 3R2NA 5C2OA 3IJFX 4LCPA 2ZNVA 4I43B 4OCLB 3OJ6A 4P9DA 2A8NA 4NQLA 4OWPB 5GAOA 4WIFA 1PL0A 4LD2A 4J6EA 3DH1A 1R5XA 2QLCA 1VK9A 1RB7A 2W4LA 4JXEA 2HVWA 1JTKA 2Z3IA 4O8XB 2OG4A 2B3ZA 4ZFRA 4F7OA 1R5TA 1OZ0A 2Z3GA 4LCNA 4OCLA 4QFTA 3G8QA 2OBCA 4ZD4A 2G84A 2O3KA 1WKQA 4E0QA 3EX8A 4OWPA 1UAQA 2NYTA 1Z3AA 2O96A 2P87A 3OCQA 3ZPGA 5DCAJ 4O8XA 4G3MA 4BGDC 2HVVA 1G8MA 4MSQA 1CTUA 2B1IA 1ZABA 4O8YA 4ILGC 3ZPCA 4P9CA 3E1UA 1THZA 1PKXA 1WN5A 1AF2A 3RZVA 2IU3A 4MS7A 3BH1A 4EG2A 4MSDA 4P9EA 4D10F 4LD4A 1CTTA 2P8RA 4OCMA 2B1GA 2G6VA 2B3JA 1MQ0A 1M9NA 4GGMX 2NX8A 1YSDA 4F3WA 4O8YB 1ALNA 2Z3HA 3ZEFB 4KITC 2D30A 1YSBA 3MPZA 4HRWA 5M52C 2FR5A 2D5NA 3VX8A 5M59B 1OI0A 4OCNB 1OX7A 4ZFTA 5CW6A 1WN6A 2O7PA 1ZCZA 2RPZA 4A1OA 3SBGA 4OCMB 2Z3JA 1UX0A 4WIGA 3ZZMA 1P4RA 4PQTA 4MSMA 3RZUA 2ZNRA 3B8FA 1TIYA 2HXVA 1WWRA 4OCNA 4HRQA 4MSJA 2O95A 3DMOA 1VQ2A 4LCOA
chains in the Genus database with same CATH topology
2KCQA 1P6OA 2FR6A 4ZD5A 2KKSA 2PW9A 1UWZA 4LC5A 4K1RA 1UX1A 3R2NA 5C2OA 3IJFX 4LCPA 2ZNVA 4I43B 4OCLB 3OJ6A 4P9DA 2A8NA 4NQLA 4OWPB 5GAOA 4WIFA 4LD2A 3DH1A 1R5XA 2QLCA 4JXEA 1RB7A 2W4LA 2HVWA 1JTKA 2Z3IA 4O8XB 2OG4A 2B3ZA 4ZFRA 4F7OA 1R5TA 4LCNA 2Z3GA 4OCLA 4QFTA 3G8QA 2OBCA 4ZD4A 2G84A 2O3KA 1WKQA 4E0QA 3EX8A 4OWPA 1UAQA 2NYTA 1Z3AA 2O96A 2P87A 3OCQA 3ZPGA 5DCAJ 4O8XA 4G3MA 4BGDC 2HVVA 4MSQA 1CTUA 1ZABA 4O8YA 4ILGC 3ZPCA 4P9CA 3E1UA 1WN5A 1AF2A 3RZVA 4MS7A 4EG2A 4MSDA 4P9EA 4D10F 4LD4A 1CTTA 2P8RA 4OCMA 2G6VA 2B3JA 1MQ0A 2NX8A 1YSDA 4F3WA 4O8YB 1ALNA 2Z3HA 3ZEFB 4KITC 2D30A 4HRWA 3MPZA 1YSBA 5M52C 2FR5A 2D5NA 5M59B 1OI0A 4OCNB 1OX7A 4ZFTA 5CW6A 1WN6A 2O7PA 2RPZA 3SBGA 4OCMB 2Z3JA 1UX0A 4WIGA 4PQTA 4MSMA 3RZUA 2ZNRA 3B8FA 1TIYA 2HXVA 1WWRA 4OCNA 4HRQA 4MSJA 2O95A 3DMOA 1VQ2A 4LCOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KCQ A;  1P6O A;  2FR6 A;  4ZD5 A;  2KKS A;  2PW9 A;  1UWZ A;  4LC5 A;  4K1R A;  1UX1 A;  3R2N A;  5C2O A;  3IJF X;  4LCP A;  2ZNV A;  4I43 B;  4OCL B;  3OJ6 A;  4P9D A;  2A8N A;  4NQL A;  4OWP B;  5GAO A;  4WIF A;  4LD2 A;  3DH1 A;  1R5X A;  2QLC A;  4JXE A;  1RB7 A;  2W4L A;  2HVW A;  1JTK A;  2Z3I A;  4O8X B;  2OG4 A;  2B3Z A;  4ZFR A;  4F7O A;  1R5T A;  4LCN A;  2Z3G A;  4OCL A;  4QFT A;  3G8Q A;  2OBC A;  4ZD4 A;  2G84 A;  2O3K A;  1WKQ A;  4E0Q A;  3EX8 A;  4OWP A;  1UAQ A;  2NYT A;  1Z3A A;  2O96 A;  2P87 A;  3OCQ A;  3ZPG A;  5DCA J;  4O8X A;  4G3M A;  4BGD C;  2HVV A;  4MSQ A;  1CTU A;  1ZAB A;  4O8Y A;  4ILG C;  3ZPC A;  4P9C A;  3E1U A;  1WN5 A;  1AF2 A;  3RZV A;  4MS7 A;  4EG2 A;  4MSD A;  4P9E A;  4D10 F;  4LD4 A;  1CTT A;  2P8R A;  4OCM A;  2G6V A;  2B3J A;  1MQ0 A;  2NX8 A;  1YSD A;  4F3W A;  4O8Y B;  1ALN A;  2Z3H A;  3ZEF B;  4KIT C;  2D30 A;  4HRW A;  3MPZ A;  1YSB A;  5M52 C;  2FR5 A;  2D5N A;  5M59 B;  1OI0 A;  4OCN B;  1OX7 A;  4ZFT A;  5CW6 A;  1WN6 A;  2O7P A;  2RPZ A;  3SBG A;  4OCM B;  2Z3J A;  1UX0 A;  4WIG A;  4PQT A;  4MSM A;  3RZU A;  2ZNR A;  3B8F A;  1TIY A;  2HXV A;  1WWR A;  4OCN A;  4HRQ A;  4MSJ A;  2O95 A;  3DMO A;  1VQ2 A;  4LCO A; 
#chains in the Genus database with same CATH topology
 2KCQ A;  1P6O A;  2IU0 A;  2FR6 A;  4ZD5 A;  4EHI A;  2KKS A;  2PW9 A;  1UWZ A;  4LC5 A;  4K1R A;  1UX1 A;  3R2N A;  5C2O A;  3IJF X;  4LCP A;  2ZNV A;  4I43 B;  4OCL B;  3OJ6 A;  4P9D A;  2A8N A;  4NQL A;  4OWP B;  5GAO A;  4WIF A;  1PL0 A;  4LD2 A;  4J6E A;  3DH1 A;  1R5X A;  2QLC A;  1VK9 A;  1RB7 A;  2W4L A;  4JXE A;  2HVW A;  1JTK A;  2Z3I A;  4O8X B;  2OG4 A;  2B3Z A;  4ZFR A;  4F7O A;  1R5T A;  1OZ0 A;  2Z3G A;  4LCN A;  4OCL A;  4QFT A;  3G8Q A;  2OBC A;  4ZD4 A;  2G84 A;  2O3K A;  1WKQ A;  4E0Q A;  3EX8 A;  4OWP A;  1UAQ A;  2NYT A;  1Z3A A;  2O96 A;  2P87 A;  3OCQ A;  3ZPG A;  5DCA J;  4O8X A;  4G3M A;  4BGD C;  2HVV A;  1G8M A;  4MSQ A;  1CTU A;  2B1I A;  1ZAB A;  4O8Y A;  4ILG C;  3ZPC A;  4P9C A;  3E1U A;  1THZ A;  1PKX A;  1WN5 A;  1AF2 A;  3RZV A;  2IU3 A;  4MS7 A;  3BH1 A;  4EG2 A;  4MSD A;  4P9E A;  4D10 F;  4LD4 A;  1CTT A;  2P8R A;  4OCM A;  2B1G A;  2G6V A;  2B3J A;  1MQ0 A;  1M9N A;  4GGM X;  2NX8 A;  1YSD A;  4F3W A;  4O8Y B;  1ALN A;  2Z3H A;  3ZEF B;  4KIT C;  2D30 A;  1YSB A;  3MPZ A;  4HRW A;  5M52 C;  2FR5 A;  2D5N A;  3VX8 A;  5M59 B;  1OI0 A;  4OCN B;  1OX7 A;  4ZFT A;  5CW6 A;  1WN6 A;  2O7P A;  1ZCZ A;  2RPZ A;  4A1O A;  3SBG A;  4OCM B;  2Z3J A;  1UX0 A;  4WIG A;  3ZZM A;  1P4R A;  4PQT A;  4MSM A;  3RZU A;  2ZNR A;  3B8F A;  1TIY A;  2HXV A;  1WWR A;  4OCN A;  4HRQ A;  4MSJ A;  2O95 A;  3DMO A;  1VQ2 A;  4LCO A; 
#chains in the Genus database with same CATH homology
 2KCQ A;  1P6O A;  2FR6 A;  4ZD5 A;  2KKS A;  2PW9 A;  1UWZ A;  4LC5 A;  4K1R A;  1UX1 A;  3R2N A;  5C2O A;  3IJF X;  4LCP A;  2ZNV A;  4I43 B;  4OCL B;  3OJ6 A;  4P9D A;  2A8N A;  4NQL A;  4OWP B;  5GAO A;  4WIF A;  4LD2 A;  3DH1 A;  1R5X A;  2QLC A;  4JXE A;  1RB7 A;  2W4L A;  2HVW A;  1JTK A;  2Z3I A;  4O8X B;  2OG4 A;  2B3Z A;  4ZFR A;  4F7O A;  1R5T A;  4LCN A;  2Z3G A;  4OCL A;  4QFT A;  3G8Q A;  2OBC A;  4ZD4 A;  2G84 A;  2O3K A;  1WKQ A;  4E0Q A;  3EX8 A;  4OWP A;  1UAQ A;  2NYT A;  1Z3A A;  2O96 A;  2P87 A;  3OCQ A;  3ZPG A;  5DCA J;  4O8X A;  4G3M A;  4BGD C;  2HVV A;  4MSQ A;  1CTU A;  1ZAB A;  4O8Y A;  4ILG C;  3ZPC A;  4P9C A;  3E1U A;  1WN5 A;  1AF2 A;  3RZV A;  4MS7 A;  4EG2 A;  4MSD A;  4P9E A;  4D10 F;  4LD4 A;  1CTT A;  2P8R A;  4OCM A;  2G6V A;  2B3J A;  1MQ0 A;  2NX8 A;  1YSD A;  4F3W A;  4O8Y B;  1ALN A;  2Z3H A;  3ZEF B;  4KIT C;  2D30 A;  4HRW A;  3MPZ A;  1YSB A;  5M52 C;  2FR5 A;  2D5N A;  5M59 B;  1OI0 A;  4OCN B;  1OX7 A;  4ZFT A;  5CW6 A;  1WN6 A;  2O7P A;  2RPZ A;  3SBG A;  4OCM B;  2Z3J A;  1UX0 A;  4WIG A;  4PQT A;  4MSM A;  3RZU A;  2ZNR A;  3B8F A;  1TIY A;  2HXV A;  1WWR A;  4OCN A;  4HRQ A;  4MSJ A;  2O95 A;  3DMO A;  1VQ2 A;  4LCO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...