1WWXA

Solution structure of the ets-domain of the ets domain transcription factor
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
107
structure length
107
Chain Sequence
GSSGSSGSSHLWEFVRDLLLSPEENCGILEWEDREQGIFRVVKSEALAKMWGQRKKNDRMTYEKLSRALRYYYKTGILERVDRRLVYKFGKNAHGWQEDKLSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of the ETS-domain of the Ets domain transcription factor
rcsb
source organism Homo sapiens
molecule tags Dna binding protein
molecule keywords E74-like factor 5 ESE-2b
total genus 17
structure length 107
sequence length 107
ec nomenclature
pdb deposition date 2005-01-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00178 Ets Ets-domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1wwxA01
1OKRA 1O7FA 4L0YB 4KDPA 3L00A 1JHHA 5CVIA 5BQTA 3LA7A 3I58A 3NRVA 3LSTA 2BGCA 3GFIA 3KEOA 4Q48A 4KMUX 4OMYA 4EJUA 2CQKA 4OIPF 1U5TC 5BMZA 4U0YA 1K7AA 5HOOA 2CWEA 5DD4A 1O3QA 1XSXA 1BIAA 4LG0B 1BN5A 1QZYA 2ZKZA 4KIGA 4EGZA 1PDNC 1J9IA 2IPQX 5F64A 5HVQC 1B59A 3FMRA 4ON0A 5KK1A 1EV7A 1TNTA 4IJAA 4O5VA 2P5LC 3H92A 3ROUA 1G3TA 1I1GA 2OZUA 3DPTA 4N9IA 4M9ZA 2P6TA 3KFWX 5DV5A 3IRRA 2YPRA 3QPHA 2VC0A 5FLXK 3MWMA 2A6HF 3R61A 1ULYA 5L3DA 2UXNA 1XCBA 1Z6RA 4BHCA 3EQLF 3J81Z 3RJPA 1KU7A 4JBAA 3QP6A 2AXLA 2H94A 5L3CA 4AIHA 2DPUA 4G7OF 1Z05A 2XHKA 3KP4A 1B4AA 1SD5A 1ZGAA 1FWZA 3IL2A 1Z9CA 3L09A 3GXOA 4PGHA 1XCVA 3RPUA 2GA1A 2DI3A 1HQCA 2DTRA 2IW5A 2ZO4A 2ZNYA 3CUOA 1G3YA 4WXCA 2FOKA 4XBFA 4A6DA 1FOKA 4FT8A 3TDUC 1SAXA 5FFXA 5LHHA 3R60A 3KETA 2P8TA 4IHTA 5HLIA 3SXYA 1OR7A 3P7NA 1FBSA 2Q0OA 3B02A 3GO5A 3QPTA 5AONA 3RYPA 4JK1X 2Q8KA 1P2FA 2EA2A 1YO5C 4EJTA 3I5UA 2V1XA 4KICA 1IN8A 3TO6A 1ZAOA 4IVNA 4HDUA 1L0OC 5L3GA 3QU6A 1TW2A 2R3SA 2NRAC 5HDKA 4IRHA 5LGNA 3KP2A 1IXRC 4LLNA 4BAYA 4KIFA 2F5CA 1LQ1A 4LK1F 3EETA 3CUQA 4NHJA 2ZMEA 2FNPA 2O03A 5K5OA 3REOA 4A6EA 4MTDA 3VODA 1V4RA 3KP3A 3FX3A 4YFKF 3WTUC 5HS8A 1IN4A 3ELKA 3WG9A 2JZYA 3WGHA 2GAUA 4UNOA 3DKWA 4PZJA 5LGUA 1MZBA 1TLHB 4HA8A 2P7CB 3J7AO 1KU2A 2HYFA 1HSJA 1TQMA 1PP7U 2LKPA 4EM1A 1HKSA 5ICEA 3K2ZA 3L7WA 1Y0UA 4RGRA 1R1TA 3TDZC 3SHFA 3RKYA 1LB2A 5AIPA 2YSRA 4MEXF 1FYLA 3ZQ7A 1ZRDA 3ECHA 1J0RA 2JSCA 2VBWA 1ZRFA 2VT3A 5D8LB 1IXCA 5LRRA 1JHFA 3RKWA 3MZHA 3MZYA 3F22A 1LEAA 2DU9A 4EJOA 4A0ZA 2BYVE 4L5IA 4OIQF 4NQWA 1UB9A 3E6MA 1D8JA 2QZ8A 3N4MA 2CGPA 4I01A 3JTGA 1XMAA 2EV6A 5ED4A 2HQNA 1ZG1A 2A3SA 5CLSA 3DV8A 4ZZDA 3ECOA 1R22A 3FZVA 2NNNA 5CVVA 3MAJA 4BHBA 2KRFA 2A68F 3V7CA 3J80Z 3COAC 4BXUA 1XB4A 1HW5A 3GW2A 2ZMEB 1GVJA 4S05A 1R7JA 2X4HA 3DPLC 2VBXA 2RDPA 2STWA 2V79A 2M87A 5DCFA 3ABTA 5F6FA 3PQJA 3U1DA 1Q1HA 3GYHX 4OINF 4ENMA 1DPRA 1XSVA 4MQVA 1B9MA 3JSPA 4M9XA 1IAWA 2FMLA 2QBYB 2F5EA 1R00A 1KU3A 2OQGA 5D5UB 4HDVA 1HSTA 2JPCA 2LF8A 3I71A 3PQKA 3G73A 2PLYA 3KEQA 3FHZA 2KIFA 5H6RA 3E6DA 4O3MA 3FF5A 5LRSA 3W6KB 4WXDA 1BBYA 5FB2A 3IKTA 5E8GA 2OBPA 3HOSA 1ZRCA 1MJBA 1D3YA 1NHAA 1F9NA 4LG0A 2HTJA 2DQLA 3F8FA 1K78B 2VN2A 5E17F 3K9TA 2B0LA 4HBLA 5D6FA 4OIOF 4RAZA 4A12A 2XROA 4S04A 5E20A 2P7VB 4I0BA 3IKVA 1YTYA 1B1BA 3E5QA 4U0WA 1BM9A 3RDIA 4LGWA 2H09A 5H6QA 4I09A 3ML6A 1K6OA 4I98B 2QQBA 3K0LA 3BP8A 3FM3A 1TW3A 3RKXA 1K79A 4OU0A 2JRTA 4UVBA 5LLQA 4LJZF 3AAFA 3ABUA 1E17A 4U7DA 4IPAA 1RIOH 2E1NA 1O3TA 2V9VA 5FFZA 1G3WA 2IJLA 1MDMA 5DUKA 4HQEA 2QBYA 1DDNA 5LHIA 2MA3A 4M72A 2QYOA 1YW8A 2K4BA 3KE2A 4RS8A 2H6BA 3MCZA 2EFOA 1QPMA 4ESBA 2QENA 2OD5A 3GWZA 3ZN1A 2F2EA 4L5JA 2ETHA 5A2QZ 4A2UA 1ZARA 4LMYA 2MH9A 2HQRA 4KFCA 2E7WA 4RB2C 3KP7A 1CF7B 4KT5C 3EYYA 1S7AA 2MLGA 4CDGA 2VE8A 2YX4A 1ZYRF 3WODF 1I27A 4Z2YA 2IVMA 2UXXA 3HOTA 3RI4A 2K86A 4WXHA 4AWXB 3R6SA 1XGOA 3L2CA 1FT9A 1SMTA 5FD6A 1WRJA 5TRDA 4AIJA 4M6YA 5CVUA 5JVTA 1BI1A 3FMSA 2JPBA 2PFBA 3Q9VA 2TDXA 5K5RA 1XGNA 2EV0A 2MD5A 2IA2A 2V1DA 4PDKA 3RIRA 1FY7A 3VEPA 2VXZA 5L3BA 4LLGF 5ICCA 3F8CA 1LEBA 5JR3A 2RC4A 1F4KA 1YQAA 3KZYA 1FBUA 2STTA 1T6SA 4U0VA 1LJ9A 1PP8F 4YFNF 1LDJA 1LDDA 3EDPA 3FWEA 3TOAA 3I53A 5DCMB 2OU2A 4HF0A 2A61A 4UHTA 3RYRA 2YR2A 1YS7A 4O6JA 1AWCA 4AD9A 3BY6A 2FMYA 5FLXZ 3BROA 2ZBKA 1O3SA 4RAYA 3BPXA 3M7GA 2L54A 4EJVA 1HW2A 4KA4A 1J5YA 2GZWA 4LFUA 3OV8A 2O3FA 3ZMDA 3KLOA 3CLOA 4ZYHA 1YLFA 2FF4A 5FD5A 4EV0A 3LAJA 4IXAA 2RV8A 1UFMA 1FPQA 4I0AA 4UV8A 2W57A 4PCQA 2M8EA 5ILSA 1YW7A 2BE5F 5ILVA 1V3FA 2OQRA 1T0FA 4M73A 3HRUA 4DNCA 3MQ0A 1CGPA 1H9TA 3I59A 4EVIA 4HW0A 5HDGA 2R7FA 1PUEE 2CFXA 2R7DA 4G7HF 4PGGA 1FP2A 3SQNA 4L9VA 3RTRA 1IUYA 3GUDA 4DQ2A 2ISYA 4HX8A 2FU4A 2G7UA 2Y48A 1G4DA 5EEHA 2E1CA 5TJJA 1KGSA 2KKOA 4G8XA 4M9SA 4WX9A 4Y17A 2FE3A 2AS5F 4MQ9F 1OYYA 4RGSA 3I64A 1RNLA 4UXNA 4Q4ZF 3C1DA 2XV4S 5AIQA 2XAJA 2J5PA 1TTYA 5E8IA 1MDMB 1ON1A 1T38A 1D8KA 1XDSA 2ESNA 3ZMUA 1FSHA 1O3RA 3FM5A 1OMIA 5E1ZB 1OPCA 1H9GA 5ICFA 2LSOA 3ISPA 2HEOA 3WU0A 6PAXA 2FBIA 4RB0A 2DK5A 2GQQA 3P9IA 4UVAA 3F21A 4R8HA 5HS9A 2ELHA 3TGNA 2OA4A 3CUQC 3R0JA 2XKPA 1ZREA 4CHUA 4HLXA 1S3JA 4R79A 4H0EA 3ZMZA 3P9KA 2L01A 4KN7X 4TV7A 2VOPA 4EJWA 4I2OA 1FZPB 4G94A 5D6EA 1B9NA 3JAMZ 5J8FA 2RN7A 3FXRA 4LD5A 2WTEA 4MHGA 2JT1A 1X3UA 4P9UA 3HSEA 5J8CA 2D1HA 2NS0A 1HXDA 1Z7UA 3TQNA 4GYGA 2QLZA 5L3EA 5DDGA 3OOPA 1ZN2A 3WTTC 3S2WA 4AVPA 1REPC 2EFQA 3N97A 3HIFA 2HS5A 1R58A 2VBZA 1KYZA 2G7HA 2NYXA 3CTAA 4L9JA 4FHTA 3GZ5A 3BWGA 5HDNA 4G6QA 4N0BA 4HV5A 2XGXA 2VOOA 1ZG3A 4GGGA 5LEJA 3MEXA 2GIVA 2XAHA 1HKQA 1KQ0A 1TQPA 2H27A 2DFIA 1QNTA 1IZ1A 3WTWC 3DQVC 2FBKA 5DCMA 3DFGA 2CO5A 4XSXF 3WGGA 2ADUA 2EV5A 3EUHA 3HHGA 1HW1A 4UUVA 2ZFWA 4D0PA 3IC7A 1IRFA 2WWYA 3GF2A 2RVCA 2QWWA 2CYYA 4LB5A 4K2EA 2K27A 2P4WA 5EEGA 1R1VA 4MEYF 1KYWA 1EH6A 5LBQA 4GYIA 3Q9SA 2H6CA 4ZYGA 4G9YA 5K5QA 1LDKB 2CSOA 3V7RA 5IT9K 2XIGA 2F5DA 2D1VA 2K02A 2MLKA 1KQ9A 2DPDA 4WF2A 4UV9A 1I1SA 2FRHA 3BJAA 2FEZA 3F8BA 3GVAA 2LF7A 4LLLA 2MBFA 2ESHA 4G7ZF 3WTSC 2ZJ2A 5D4RA 3U9GA 2IA0A 3I0TA 3T5XA 1R36A 4MNUA 3EYIA 4KNYA 4E70A 3WGIA 4KYWA 3E3VA 1ZGJA 1BC8C 1I5ZA 4U88A 1T39A 1U6GA 1WWXA 5D5XB 2V1UA 2NNYA 4EGYA 2PMHA 4LB6B 2VODA 4QWQA 1UCRA 4JQFA 4LK0F 4OMZA 1MGTA 2J5OA 4BYYA 1KA8A 2FQ3A 4P55A 2W24A 3O2PE 5ILUA 3R0AA 1GXQA 1BI0A 4ETSA 4OOIA 3DP7A 1R5GA 3ULQB 2VC1A 4NB5A 4RB3C 1RUNA 1ZG5A 3K1PA 3GFLA 3T1BA 1EH7A 4YIIA 1YIOA 2M5WA 1IXSB 2C6YA 3I4PA 3J81K 4ZYDA 2K4JA 3CO7C 1USTA 2A69F 5LGTA 1W5SA 1U3EM 3GEZA 4BNCA 3M1EA 4XRFA 2HWVA 2EFPA 1Z1DA 5IT3A 4QLCU 5JI6A 3LQRA 3RPQA 2UZKA 2FSWA 4ASNA 1JXSA 1WI9A 5FO5A 4G6DA 1SFUA 1FYKA 2RGVA 2Q2EA 2P5VA 2KJCA 1ZH5A 3E97A 2DW4A 1WQ2A 2RQPA 1RZ4A 1IW7F 5BOXA 1IN6A 3W6JB 3J80K 2PBIA 2GXBA 3V8KA 4P5OA 1JE8A 3ZN0A 4CXFA 5E18F 3QRFF 3C18A 3WE2A 2EFNA 1R5HA 1XGMA 2VBYA 1BIBA 2HTSA 4HX7A 2ZNZA 3HRMA 2XVCA 4L18B 5DEQA 4CYDA 1QO0D 4U7BA 2L02A 3DF8A 1XD7A 4HLYA 2L3DA 2L4MA 2ZCWA 5ERIA 2KIUA 3QP5A 3BDDA 2M1BA 1P4WA 2V6CA 2W84A 2DBBA 2QQAA 4KIBA 3U2RA 3GFMA 1TQIA 4Y13A 3GZ6A 2Y0MA 3P9CA 1JGSA 3ERED 2BV6A 2XUBA 1YS6A 2CW0F 4RGXA 4UVCA 2EB7A 2QUFA 3ZP5A 1HKTA 1P92A 2PG4A 2PJPA 2HOEA 3E5XA 4FX4A 1XGSA 1FC3A 3QAHA 4ENJA 1SD6A 3KCCA 1XDUA 2GWRA 1K78A 4I02A 4ESJA 3E5UA 3LQQA 1W7PA 2F5FA 4F7ZA 1O7LA 1GHCA 2PQ8A 1BJAA 4ESFA 2XKOA 2IA1A 3JW4A 3O3KA 2XASA 3M8FA 3F8MA 3KP6A 1XMKA 5D4SA 3FXQA 1I6XA 4IF4A 4Q5SF 1IF1A 3F6OA 1BI3A 1UHWA 2OZ6A 5DUIA 1W7PB 3HYIA 4YIFA 4XLNF 1W7PD 5JHUA 3T8RA 1USSA 1MKMA 1F5TA 2COMA 2M30A 3HSRA 4YFXF 1FX7A 4MGRA 5BPIA 2PN6A 2Z9OA 1S7OA 3F72A 3V7SA 2VE9A 2NAZA 3F6VA 1O57A 3CJNA 1W4MA 3GX4X 4WCGA 1OYWA 3LFKA 3NQOA 4HV6A 3ZMVA 1MJAA 1J7KA 1ONVA 3O6BB 1HBXG 2YX7A 3JTHA 2QVOA 4HX4A 4MTEA 1S29A 3VOEA 3TO9A 1U5TB 1Z91A 2GA2A 2UWMA 1IN5A 4EMSA 4P9FA 3F3XA 2HZTA 3F8NA 1TBXA 2VONA 4OIRF 1DPUA 3IWFA 1BI2A 4KUMA 3CUQB 4HZFA 4ZH4F 4CO8A 2W25A 1B6AA 2A6EF 3B73A 2IP2A 5DD8A 1CF7A 1SD7A 4XSZF 3HRTA 1KQ8A 4B8XA 5A2QK 3HRSA 1VTNC 5L3FA 2Z3YA 2X0LA 5CVJA 2ISZA 2D2WA 1U8RA 2KIMA 3GLXA 5JFRA 1J2XA 2P6SA 2JTVA 4RGUA 3HTSB 1P4AA 2Z5UA 4IRIA 1S8NA 1QQIA 2HR3A 4IHSA 1R1UA 1DUXC 3VFZA 4AIKA 1J75A 1EH8A 1H0MA 1C0WA 2Z99A 1E2XA 1WKMA 1YW9A 4FX0A 4A5NA 4M74A 3WTXC 5E1WA 1SFEA 5BPDA 4Y15A 4A0YA 4CGZA 1YYVA 3IWZA 3K1NA 4HYEA 2DO7A 1T98A 4A0XA 3H3UA 3QU3A 3V4GA 3HHHA 1ZHFA 2HDCA 2FXAA 2GXGA 1SMYF 1GXPA 1ZLKA 2KJBA 3JAMK 1KU9A 2HKOA 1QZZA 3FXUA 3BPVA 3BJOA 1ON2A 1OYIA 3CO6C 4YG2F 1UHMA 3K69A 1FBQA 3TO7A 4ZZLA 3D0SA 1T2KA 4XLPF 1FYMA 4M6XA 2FA5A 2G9WA 4KN4X 4HQMA 3BJ6A 4HAMA 2XAFA 1XSDA 3CDHA 3DXJF 3I54A 4GO1A 2RNJA 3V8JA 1FSEA 1P4XA 5FGMA 2EK5A 2EFWA 3BZ6A 2HGCA 4N9HA 3WTYC 1YG2A 1STZA 3WU1B 3KZZA 4BHPA 4IRGA 2A07F 4BH9A 3PFIA 2DQRA 1SFXA 2A5YB 4HF1A 4WK8F 1RUOA 2W85A 3L9FA 2O6GE 2HYGD 1D5VA 2Y75A 5LEKA 1U5TA 4A5MA 3KLNA 2YU3A 2O0YA 1BOAA 3M9AA 3NEUA 2O61A 1FLIA 1ODDA 1U78A 2HFHA 1L3LA 2CG4A 2FNAA 5DYMA 3TOBA 4CZZA 5IT9Z 2LDUA 2PI0A 4EM0B 3D5LA 2DAOA 3H3ZA 4BQAA 3QOPA 5BS6A 3LA2A 2DLLA 1DP7P 4L9TA 2EJRA 5H20A 4GXOA 2FBHA 2PEXA 4EQQA 2HKXA 2EWNA 2ZXJA 3SZTA 4L0ZB 3FMQA 2BBYA 4HOBA 3E6CC 4WWCA 5CYVA 2K7LA 4CICA 1FNNA 4L9NA 1G6NA 2ACJA 5D8KB 2XAGA 5K1YA 3SFZA 1W5TA 2IT0A 3C3WA 1QBJA 3G3ZA 1Z6TA 4KMFA 2D45A 1J59A 2WC2A 3LWFA 2RKHA 1LNWA 3HSFA 3WTVC 3LAPA 3DEUA 5D5VB 4R1HA 2PMUA 3TKYA 2L4AA 5KVRA 3SZPA 4B09A 2E7XA 2VT2A 5LHGA 5E1XA 1FP1D 3T0YA 1P6RA 2P5KA 3I59B 3ZMTA 5F1RA 2Z33A 4HF2A 4ENKA 2WV0A 1QGPA 1TNSA 3BOQA 3R4KA 1F1ZA 2O8XA 5ICGA 1IRGA 3WTZA 1XN7A 3K1MA 4M71A 2DT5A 1MD0A 3MFKA 2M45A 1SD4A 1MJ9A 3HUGA 1IN7A 1U2WA 2XRNA 2EA4A 3C7JA 1RI7A 4Q47A 3IRQA 5CJ9A 1WSUA 5HS7A 2QQ9A 3ZPLA 2LNBA 5CVRA 3KP5A 3Q5FA 1LVAA 3V8LA 1R23A 2OAZA 3WE3A 4RB1A 4I7HA 1S6LA 4ENNA 2MH2A 4EM2A 3JSOA 5HLHA 2QM3A 3ZMSA 3IHUA 1BC7C 5HLGA 3E6BA 2MC3A 1AOYA 1ZLJA 3HTUA 5J6XA 1YFHA 4GCVA 2DK8A 1A04A 3LA3A 3M8EA 3VB2A 5D5WB 4ZYEA 3GFJA 2BEOA 2XAQA 3F23A 1G3SA 4P96A 2IRFG 3T8TA
chains in the Genus database with same CATH superfamily
4RM3A 4JOMA 1HF0A 2Y30A 1OKRA 2XPUA 2V6EA 1O7FA 2ZB9A 3GTQJ 2OJED 4AYBA 2AO9A 4L0YB 1QVUA 4KDPA 3L00A 1BR1A 1ETVA 1JHHA 5CVIA 5BQTA 3LA7A 5FKKA 1V5FA 3I58A 4NDLA 3NRVA 3LSTA 2BGCA 3GFIA 4BDZA 3KEOA 2LY2A 4BE1A 3ABMH 4Q48A 1JGGA 1GUUA 4KMUX 1ZK8A 4OMYA 2DOAA 1BJZA 2DJNA 4EJUA 1NK2P 2DT6A 2CQKA 3CJRB 4OIPF 2JA8J 1U5TC 5BMZA 3HOYJ 4U0YA 1K7AA 4UUSA 1MNMC 5IP6A 5HOOA 2CWEA 1LPQA 5DD4A 4AVZA 1BR2A 1OISA 3PSIA 4DW6A 2QSGX 1ETWA 1TL8A 2AXTC 3PUFA 1O3QA 1XSXA 1I39A 1BIAA 3TP3A 3BG9A 4LG0B 1OCCH 1BN5A 2OPTA 3GTJJ 3S1MJ 4A3CJ 5IPAA 2DA4A 1QZYA 2JRMA 2ZKZA 4KIGA 4EGZA 3OYMA 2ECCA 1PDNC 1J9IA 2IPQX 3LSMA 5F64A 5HVQC 1B59A 1HDPA 3FMRA 4ON0A 5KK1A 1EV7A 1TNTA 4IJAA 4O5VA 4XN3A 4CSWA 2BHZA 2M2EA 3H92A 2P5LC 3ROUA 1G3TA 4BXFA 2DA5A 1I1GA 1U9NA 2HPIA 2OZUA 3DPTA 4N9IA 2R7OA 4M9ZA 1T0FC 3TBIA 2P6TA 1ZGWA 3GTMJ 4M3DA 5CKTA 4BBSJ 1DU6A 2F5VA 3KFWX 5DV5A 2MG4A 1D0XA 3IRRA 2Q1ZB 3WG7H 2YPRA 1VNDA 4BUPA 4OAZA 2ZFUA 3QPHA 4XM3A 2DCEA 2VC0A 2NVUB 5FLXK 1F43A 3MWMA 3OYNA 2A6HF 2KFDA 3R61A 1ULYA 4BS9A 3B6CA 1N75A 4ZC3A 1DU0A 5L3DA 2UXNA 1XCBA 1Z6RA 4BHCA 5K7FA 3EQLF 3BTJA 5EG0B 3J81Z 3RJPA 1KU7A 1WJAA 4I76A 2PJRA 4BY1J 4JBAA 3QP6A 2AXLA 2BVMA 3D5SC 2H94A 5L3CA 3BR1A 3A2KA 3OS2A 4AIHA 3SFIA 5IYDJ 2DPUA 1VQPI 2W48A 4G7OF 3FK6A 3OOUA 2IXSA 1D1BA 1X3WB 1Z05A 2L2OA 1XPXA 2XHKA 3KP4A 3L2WA 1H89C 1B4AA 1WH5A 1SD5A 1D1AA 1J09A 1R6RA 1ZGAA 1MIJA 5F08A 1FWZA 2M0CA 2L9RA 3IL2A 1Z9CA 1YX3A 3L09A 3GXOA 4PGHA 1XCVA 3OYEA 1WFXA 1YE9A 3RPUA 2GA1A 4W97A 3QPSA 4M6VA 2DI3A 5K7ZA 1HQCA 2DTRA 2IW5A 1SC7A 2ZO4A 1XMXA 2F4IA 5K7HA 2ZNYA 3CUOA 4UUSB 4E4HA 2EQRA 4F92B 4RA2A 1G3YA 2GOXB 2FOKA 4FE4A 2K85A 4WXCA 2CUFA 4XBFA 1IO2A 1WJEA 1MBEA 4E7KA 4YRVA 3MZ8A 1DGWY 4A6DA 1DQUA 1FOKA 4FT8A 2EIMH 4RLFA 3TDUC 1SAXA 5FFXA 3HZJA 4IHYA 4E7ZA 4YELA 2NVQJ 4PJJA 1V5EA 5LHHA 3R60A 4CZCA 2CV0A 3CDIA 4A3MJ 3KETA 2P8TA 4IHTA 5HLIA 3SXYA 1OR7A 3P7NA 3AG3H 1FBSA 3C2BA 2Q0OA 4J19A 4Z6YA 2EZLA 3M8JA 3B02A 3E0JB 2W7NA 3GO5A 2WB1A 2BW3A 3QPTA 3K6GA 5AONA 3RYPA 5DTDA 4JK1X 2Q8KA 1HDDC 1LFBA 1P2FA 2DOEA 2JVHA 2EA2A 5IP7J 5JLXA 1YO5C 4EJTA 3I5UA 2V1XA 4KICA 1IN8A 3TO6A 1ZAOA 2NS7A 4IVNA 4HDUA 1L0OC 5L3GA 3QU6A 1TW2A 2R3SA 2NRAC 4AC0A 2EZIA 2RQQA 5HDKA 4IRHA 1T8IA 3E1SA 5LGNA 3KP2A 1IXRC 4LLNA 3OL4A 4BAYA 3JRFA 4KIFA 2F5CA 2ZXHA 1LQ1A 4LK1F 5HNFA 3EETA 5FLMJ 2DOFA 3CUQA 3UNGC 4NHJA 2ZMEA 1QHHD 1NK3P 2FNPA 2O03A 3PM1A 1MBGA 2BY0A 4DJAA 5K5OA 5E3OA 2XAUA 3REOA 4A6EA 1M1EB 2CQQA 4PFPA 4BKXA 3FK7A 3VODA 4BL0B 4MTDA 1V4RA 5FJ8J 3KP3A 3FX3A 4YFKF 4A3BJ 3WTUC 2X48A 1IGNA 5HS8A 1IN4A 1K61A 3ELKA 3WG9A 2NVYJ 4OWRB 4XKVA 1Z3YA 5B1AH 3H0DA 4XNFA 2JZYA 3H9GA 3H5AA 2OF7A 1VFCA 1P7JA 1CQTA 3WGHA 2GAUA 3GCMA 4GFBA 4UNOA 2DODA 3QYEA 2JA6J 3PSFA 2X9DA 4B47A 1S9HA 3DKWA 2ZC2A 4KISA 4PZJA 5LGUA 1MZBA 1SVLA 2VPRA 1TLHB 4PJNA 4HA8A 4CCNA 2LTPA 3HKZN 4QIWN 2P7CB 3J7AO 2L0KA 3RCOA 4XRSG 1KU2A 1K83J 1HSJA 2HYFA 1TQMA 2JA2A 4B3AA 1PP7U 2LKPA 4EM1A 1HKSA 5ICEA 1XTAA 3HG9A 3K2ZA 1TWAJ 2NOGA 3VYTB 5BNGA 4JX5A 1Z0XA 4BJ6C 2Z16A 4CH7A 2DXIA 3TP0A 1I3AA 3K4MA 3L7WA 1Y0UA 2R5ZB 4RGRA 1R1TA 3K4CA 3TDZC 2N8GA 3SHFA 3RKYA 4ZTFA 1LB2A 5AIPA 2Z2SB 4BU2A 2YSRA 4MEXF 1JUSA 3DBRB 4E7IA 2CUJA 3DWLE 3S8PA 1FYLA 1D1CA 3ZQ7A 1ZRDA 3ECHA 1J0RA 2JSCA 2VBWA 3A01B 1ZRFA 5GTIC 1UHSA 2VT3A 5D8LB 2MFZA 4XMYA 3HOWJ 1IXCA 2KT0A 5LRRA 1JHFA 4XOTA 3RKWA 3ZR8X 1ETOA 4XL9A 3MZHA 3KZIC 3MZYA 4M3EA 3F22A 1LEAA 2DT7B 2DU9A 3UKGA 4EJOA 2VIXA 4A0ZA 2NVXJ 2BYVE 4L5IA 2IS6A 2KQRA 4OIQF 1MMNA 4NQWA 1UB9A 4BQOA 3SJMA 3E6MA 1EKEA 4MFDA 1D8JA 3ZOBA 3OIOA 2RREA 2BW3B 2QZ8A 3N4MA 3OR2C 2CGPA 2CU7A 4XICA 4EEFG 4BEHA 2XGCA 4ZDOA 4I01A 3JTGA 2LH9A 3LFUA 1XMAA 2EV6A 2F48A 5ED4A 2R7VA 1U9OA 2HQNA 1BOBA 1VZ0A 2I8DA 1ZG1A 2A3SA 3RQ4A 1T56A 4CUGA 5CLSA 3DV8A 4ZZDA 1TT5B 3ECOA 2XSJC 1R22A 3FZVA 2NNNA 1W5CC 5CVVA 1NG6A 3MAJA 4BHBA 2KRFA 2X6WA 3J7AY 2A68F 3V7CA 3J80Z 3COAC 4BXUA 1XB4A 1HW5A 2FUG2 3GW2A 1ETYA 2XGDA 1GVJA 2ZMEB 4S05A 1R7JA 2X4HA 4EATA 3DPLC 4DIQA 3FHNA 2VBXA 2LK2A 1RRJA 1FIPA 2RDPA 4KITB 2DTZA 2Q2EB 2VXDA 2STWA 2V79A 2M87A 3HC7A 5DCFA 3ABTA 5F6FA 3K4BA 3PQJA 3U1DA 1Q1HA 4S0HB 2FJ1A 3GYHX 4OINF 1MMAA 4ENMA 1DPRA 1XSVA 3S15J 4MQVA 1B9MA 3JSPA 4NUBA 4G6TB 1JKPC 1XG1A 2MD0A 3T8TA 4BE0A 4CCMA 4M9XA 2VUMJ 1IAWA 1HA8A 2FMLA 2QBYB 2F5EA 3PIOF 3CCVI 3IAS2 4FCYA 3OYGA 1R00A 2E1MC 1KU3A 2OQGA 5D5UB 2QKMB 5F04A 4HDVA 1IG7A 1HSTA 2VLAA 2WY7Q 1MNDA 5F1JA 2JPCA 2LF8A 3I71A 3PQKA 3G73A 2PLYA 4JYKA 3FISA 3KEQA 3Q0VA 3FHZA 2KIFA 1SVOA 5H6RA 3E6DA 5GADJ 3PO3J 2LKSA 2VQHA 4O3MA 1FOXA 3FF5A 5LRSA 2BZTA 3W6KB 4WXDA 4HNTA 1BBYA 3LSKA 5FB2A 1LE8B 3OL3A 3BC8A 3IKTA 4D7MA 5E8GA 2OBPA 2DMPA 1MMSA 5EEAA 3HOSA 1ZRCA 3KYDB 3BR0A 2XF5A 2R5YB 1MJBA 3L2QA 3G1OA 4NNJA 1D3YA 1G59A 1NHAA 4F52A 2BXYA 1O4XA 3D1NI 2FD5A 3M4OJ 1N25A 1F9NA 4LG0A 2HTJA 4QPQA 5EYRA 2KPMA 3HGGA 4JP0A 5J1UA 2VJJA 2M8GX 2X51A 2DQLA 3F8FA 1K78B 3I4MJ 2VN2A 3OSFA 5E17F 2E1OA 3K9TA 3S2HJ 2B0LA 4HBLA 5D6FA 5HNHA 4OIOF 4RAZA 4A12A 4BGDA 2XROA 2QSFX 4S04A 2XB0X 3OMYA 5E20A 2P7VB 4I0BA 3NWSA 4PFOA 3IKVA 1YTYA 1B1BA 3E5QA 3IV5A 4U0WA 1BM9A 3FKIJ 4C3IJ 3ASOH 5CQEA 4IX7A 3RDIA 4LGWA 2K5CA 4A3DJ 2H09A 2CMPA 5FROA 3RQIA 3HJEA 5H6QA 4I09A 4XKCA 3ML6A 5HLTA 1K6OA 4M3BA 4I98B 3LSRA 2BVLA 3HM5A 2JSPA 1UAAA 2KZVA 2QQBA 3VDXA 3K0LA 4HG2A 3BP8A 2Y9YA 3CQZJ 3FM3A 2R7ZJ 1JJ8C 3S3MA 3QPLA 2GIZA 2HZDA 1IUFA 1TW3A 3RKXA 3WHCA 1MSFC 3K2AA 1K79A 4OU0A 2JRTA 4UVBA 2MABA 5LLQA 5KCMA 3RKQA 2EZHA 4B43A 3BG5A 1PYVA 4N4OB 3OS0A 2ZXWH 4LJZF 4XONA 4ZDPA 3AAFA 2QKLB 4C2MJ 2X1EA 3ABUA 1E17A 2TCTA 4U7DA 4IPAA 2A5WA 1RIOH 2E1NA 3MKWB 2LRDA 1PUFA 2V9VA 5F0CA 1O3TA 4AU7A 5FFZA 4F55A 3A03A 2CS3A 2JA7J 3OY9A 1G3WA 2MC4A 3Q0UA 2IJLA 1MDMA 5DUKA 2ME6A 4HQEA 2L7KA 2QBYA 1IDYA 1DDNA 2Y0SN 5LHIA 2MA3A 4M72A 2QYOA 5GPCA 1YW8A 2K4BA 2VJIA 1R4MB 5FKOA 4KT6A 3KE2A 1S72I 1H8AC 5HODA 1UZCA 3S14J 4RS8A 2H6BA 3MCZA 2EFOA 1QPMA 4ZYAA 3S32A 2DMUA 2QENA 4ESBA 2OD5A 3CLQA 3GWZA 3ZN1A 2F2EA 4L5JA 3OR1C 2ETHA 5A2QZ 1S5LC 4A2UA 3OYBA 1ZARA 3DLAA 4LMYA 4V2GA 1VQ9I 3S1NJ 3LL7A 5LD2C 2MH9A 3HOVJ 2HQRA 4KFCA 1MBHA 2OTLI 1HOMA 2E7WA 4RB2C 3KP7A 1CF7B 3RZDJ 3S3NA 4KT5C 3C2GA 3EYYA 2VPLA 3PUBA 2O8KA 1S7AA 2MLGA 4CDGA 2VE8A 3BTIA 1AHDP 1ZKGA 2PJRB 2ICWG 2YX4A 3FXOA 1TWGJ 1RR8C 1ZYRF 3ZCOA 3WODF 1I27A 4Z2YA 3H3VK 3ZQLA 1JUPA 1V5GA 2IVMA 2UXXA 4A3GJ 3A4CA 3HOTA 2G0EA 3RI4A 1T08B 2K86A 4WXHA 4AWXB 3R6SA 4BEHB 1XGOA 1YJ9I 3L2CA 1LVKA 3DBLB 1FT9A 1SMTA 2LFBA 3FIWA 5FD6A 1WRJA 5TRDA 2HVRA 4AIJA 4M6YA 5CVUA 5JVTA 2CQ7A 1BI1A 2KDOA 2XF6A 3FMSA 4XRMA 2JPBA 2PFBA 3Q9VA 2TDXA 5K5RA 2E1MB 2IS4A 2K9SA 2IAIA 2JQ7A 3DPUA 1XGNA 4CCKA 2EV0A 2MD5A 2IA2A 2V1DA 4PDKA 1VQ6I 3RIRA 2I10A 1FY7A 3VWBA 3VEPA 2VXZA 5L3BA 3LSHA 2KZGA 3JRCA 1Y1WJ 4LLGF 3BZKA 5ICCA 2W82A 2HOAA 3F8CA 1LEBA 5JR3A 2O5RA 1GVDA 2RC4A 2E5NA 1F4KA 1YQAA 1JT0A 1IRZA 3KZYA 3W6VA 5DM6F 1G2HA 2M4KA 1FBUA 2STTA 1MBFA 1SAUA 2VKHA 1T6SA 1APLC 2L5QA 5GAGJ 1G8XA 1LJ9A 4U0VA 1PP8F 4YFNF 2JA5J 1LDJA 3CJQB 1LDDA 1X4OA 3EDPA 3HGYA 3FWEA 3TOAA 3I53A 5DCMB 2OU2A 4HF0A 2KP6A 2A61A 3MMYB 4UHTA 5KAFC 1A36A 3H0GJ 3RYRA 4A69C 2YR2A 1YS7A 4O6JA 1AWCA 4YEJA 2ZJRF 4AD9A 4BBRJ 3L1PA 3BY6A 4A3LJ 2DMQA 1TP4A 2FMYA 5FLXZ 3BROA 2ZBKA 1O3SA 3FBNB 3BTCA 4RAYA 3DKXA 3BPXA 5GPAA 3M7GA 2L54A 4EJVA 1YJNI 2PMZN 1HW2A 2HXIA 4KA4A 1VQ4I 1J5YA 2GZWA 4LFUA 3OV8A 1MBKA 5JVGF 4XR6A 3KYLA 2O3FA 3ZMDA 2Y69H 3KLOA 3CLOA 4ZYHA 3HB9A 3NWTA 2E60A 1YLFA 1Y1VJ 2FF4A 2UV1A 5C3EJ 5IYCJ 1ENHA 1Q1VA 5FD5A 4EV0A 1OLTA 2H1LA 3KYCB 5EGOB 3EPZA 3LAJA 4IXAA 3W3CA 2RV8A 1E3OC 1UFMA 1FPQA 4I0AA 4UV8A 2W57A 4PCQA 5JLWA 1YI2I 2M8EA 5ILSA 1MMGA 4E7SA 2W1OA 1YW7A 2R7TA 4MLOA 5IOYA 2BE5F 5ILVA 4DGWB 1V3FA 2OQRA 1T0FA 4M73A 4GRIA 3BT9A 3HRUA 4DNCA 3MQ0A 3ABLH 1CGPA 4IQJA 1H9TA 1IV6A 1BA5A 2R0QC 1JTYA 2E34A 3I59A 4EVIA 1X19A 3DLLF 4HW0A 5HDGA 1R71A 3DU5A 2R7FA 1PUEE 1NH3A 2CFXA 1SFKA 2R7DA 3DU6A 4G7HF 4N4NB 2IGNA 3BQYA 4PGGA 4RM2A 4IEJA 3A02A 1FP2A 1WI3A 3SDBA 3PIPF 3SQNA 3BCAA 4L9VA 3RTRA 4ABZA 1IUYA 2GBYA 3GUDA 3CCMI 3J7ZI 4DQ2A 1IDZA 2ISYA 4HX8A 4PJLA 5J47A 3NARA 3VYRB 2FU4A 2G7UA 2XPVA 2Y48A 3E7LA 1AU7A 3CCLI 3VPRA 1G4DA 5EEHA 5C44J 2E1CA 5TJJA 5EGOA 5J40A 1KGSA 2KKOA 1K4TA 4G8XA 3RPUD 3OYFA 4M9SA 1VQLI 4WX9A 2VKDA 1JKRC 3HPHA 4Y17A 3A01A 1SVMA 1ZR2A 2FE3A 3M3YJ 3ZRGA 2AS5F 4MQ9F 1OYYA 4RGSA 3I64A 3ONQA 2JUCA 1MH4A 1RNLA 2F4OB 3CMYA 4IHVA 3K4JA 4UXNA 4Q4ZF 3JRAA 3C1DA 2R7SA 3CP8A 1WJ5A 1E0EA 2XV4S 3SYTA 3QWLA 4PSXA 1MSEC 5AIQA 1A35A 2VJ5A 1JT6A 2XAJA 1RPWA 1Z7LA 3SEZA 3LOCA 2J5PA 2CW8A 2QCOA 1OJLA 1IC8A 1A5JA 1TTYA 2VQCA 1QA6A 4KJZA 1ORKA 2E2HJ 1KZHA 5E8IA 3AL0B 1MDMB 1ON1A 1WZ2A 1T38A 1WCMJ 3U21A 2E71A 2EIJH 1D8KA 1XDSA 2ESNA 3ZMUA 1B8IA 4NC6A 1ETQA 1FSHA 1O3RA 3OSGA 1YRNA 3FM5A 4B3XA 1OMIA 5E1ZB 2ZXIA 4MO7A 2R5YA 1OPCA 3RZOJ 1H9GA 5ICFA 2LSOA 3ISPA 3DEWA 3CCUI 2HEOA 3WU0A 6PAXA 2FBIA 4RB0A 2DK5A 2GQQA 3P9IA 4UVAA 3DTIA 2V1NA 3HBLA 4RMNA 3F21A 4R8HA 5HS9A 2ELHA 3LNQA 3PNTA 1RKTA 3TGNA 1KONA 2OA4A 3B6AA 4C3JJ 3CUQC 3R0JA 2XKPA 1R5ID 3MKYB 2R5ZA 1ZREA 4CHUA 4HLXA 4XK4A 1DP3A 2JWTA 4ZTJA 1S3JA 4R79A 2XDVA 4D7NA 4H0EA 3HDDA 3ZMZA 3P9KA 3CD6I 4DYRA 2L01A 3OYJA 4KN7X 1X2MA 4TV7A 3G6EI 2VOPA 4EJWA 4I2OA 1FZPB 4G94A 5D6EA 4BDYA 1B9NA 3FKJA 3JAMZ 5J8FA 2RN7A 3FXRA 4LD5A 4BJ5C 2ECBA 2WTEA 4MHGA 3IH3A 2JT1A 1X3UA 3K70D 4P9UA 3HSEA 5J8CA 1B72A 2YU9J 3L2VA 2D1HA 4F93B 2NS0A 1HXDA 3C2HA 2CH0A 1Z7UA 3TQNA 2ZJPF 1VQNI 4GYGA 1OCRH 2QLZA 2X1DA 3CF2A 5L3EA 3V42A 3H9QA 5DDGA 3GTGJ 3OOPA 1ZN2A 3WTTC 3QODA 3S2WA 4AVPA 1REPC 2CV2A 2EFQA 4XKWA 4HSRA 3N97A 1X1AA 3HIFA 2HS5A 1R58A 2VBZA 1KYZA 2G7HA 2NYXA 3CTAA 4DBRA 4L9JA 4FHTA 2VKVA 3GZ5A 3BWGA 2XC7A 1VQ7I 2L7ZA 5FRMA 5HDNA 4G6QA 2DFHA 4N0BA 4HV5A 2XGXA 2VOOA 2CUZA 4DBQA 1ZG3A 4GGGA 5GAEJ 5LEJA 1FOWA 3MEXA 1R49A 2GIVA 2XAHA 4L5EA 1FTZA 1HKQA 1KQ0A 4F3QA 1TQPA 2XSDC 2H27A 2DFIA 1QNTA 4I99C 1IZ1A 3WTWC 3DQVC 3HUGB 2FBKA 2DDBA 2QF7A 5DCMA 3DFGA 1R9TJ 2CO5A 4MFEA 2MSYA 1GV5A 1RETA 4XSXF 3WGGA 3JRGA 3BG3A 3DEEA 2ADUA 5C4JJ 2EV5A 3EUHA 3HHGA 4OAYA 2LLKA 1HW1A 2E2IJ 4ITVA 4UUVA 2HVQA 2ZFWA 4D0PA 3IC7A 1IRFA 3QQAA 2WWYA 3AG1H 3GF2A 2RVCA 1X1PA 2BY3A 2QWWA 2CYYA 4ANJA 4LB5A 4LG3A 4K2EA 1BR4A 2K27A 2P4WA 5EEGA 1R1VA 4MEYF 1KYWA 1T33A 1EH6A 1MH3A 5LBQA 1Z21A 5E3LA 4GYIA 3TW7A 4Y52J 3Q9SA 1WJFA 2H6CA 4FE7A 4ZYGA 2DA6A 4G9YA 2R92J 2OCCH 3BR5A 2WAEA 3LSJA 4E6KG 5EDNA 5J4YA 4FTHA 1UMQA 1WPKA 1WHUA 5K5QA 3MD2A 1LDKB 2CSOA 3PFYA 1FMVA 1RR7A 3V7RA 5IT9K 2XIGA 4BE2A 1YHQI 5IP9J 2F5DA 1ETXA 2D1VA 1WVRA 3LSIA 1QHGA 1TT0A 2K02A 4D5FA 2MLKA 2JN6A 4F91B 1KQ9A 1WJDA 2DPDA 4WF2A 4DZJA 4UV9A 4BXXJ 1I1SA 2FRHA 3BJAA 3H9JA 3VYUB 3VSLA 2FEZA 3F8BA 3GVAA 3WU2C 2LF7A 3JRDA 4LLLA 3CC7I 3ZQFA 2LMDA 4BQQA 4IHXA 2F4MB 2MBFA 3GTKJ 2ESHA 2R7WA 4G7ZF 3WTSC 1U8BA 2ZJ2A 5D4RA 3EUHC 3U9GA 2IA0A 1JKQC 3I0TA 3MKLA 2YS9A 3T5XA 1R36A 1V54H 1XX5A 4MNUA 4HEA2 3EYIA 4KNYA 4DYQA 2L9NA 4E70A 3WGIA 4KYWA 4BY7J 4FQGA 3E3VA 1ZGJA 2WAQA 1I5ZA 4U88A 1BC8C 1T39A 1U6GA 1WWXA 5D5XB 1GT0C 2V1UA 1VQ8I 2NNYA 3CC2I 3GZNB 4EGYA 2R93J 1SFOJ 1JJ6C 4AYBN 2R7XA 2ID3A 2PMHA 4LB6B 2PMZA 2HNHA 5F0FA 2VODA 4QWQA 1UCRA 2LC2A 2H1KA 4XKBA 3OS1A 4JQFA 4LK0F 4OMZA 1MGTA 2J5OA 3N05A 1FEXA 4BYYA 1KA8A 2EPFA 2FQ3A 2FOWA 4P55A 2W24A 3JCUC 3O2PE 5ILUA 2KHMA 2CV1A 4XN0A 3R0AA 4RAGA 1GXQA 1BI0A 2L7FP 4ETSA 4OOIA 1TWCJ 3DP7A 2WV1A 1OCOH 2K9LA 1R5GA 1W0TA 3ULQB 4II2A 2VC1A 2IBDA 4NB5A 4RB3C 3S16J 1K4SA 4HNUA 1JKOC 1ZG5A 3K1PA 2X1CA 3GFLA 5IOZA 1RUNA 1TWHJ 4PJ0C 3T1BA 1HCRA 2CQNA 1EH7A 4YIIA 1YIOA 2M5WA 3BR2A 1IXSB 2E2JJ 2C6YA 3JR9A 3I4PA 3J81K 4ZYDA 2DA1A 2K4JA 3CO7C 3HKZA 1H88C 1X4PA 1USTA 2A69F 2L7MP 1W5SA 5LGTA 3S2DJ 1U3EM 3GEZA 4BNCA 3GBGA 2EILH 2E19A 3TMOA 1A6QA 2JJ7A 2B7EA 3M1EA 3G4SI 2GM4A 4XRFA 2MW8A 2HWVA 4NC7A 2WBMA 2EFPA 1Z1DA 5IT3A 3OYDA 4QLCU 5JI6A 5TISC 2XRLA 2E35A 3L2UA 4II3A 3LQRA 3RPQA 2HQ5A 1UG0A 2UZKA 2WY8Q 2AQEA 2FSWA 4ASNA 3AL0C 1VF9A 3S1RJ 4JX6A 1JXSA 1WI9A 2E36A 3KPHA 5FO5A 5GP9A 2IS1A 2M9HA 4G6DA 3A1YA 4A3IJ 1B72B 2W4SA 1SFUA 1FYKA 2RGVA 3S3OA 2Q2EA 2EIKH 2P5VA 3ASNH 2KJCA 2O7OA 1ZH5A 3E97A 1OR7C 3BR6A 2DW4A 1WQ2A 1Z67A 2RQPA 3IH4A 4AUXA 4BJTA 1RZ4A 2KISA 2X6OA 1MMDA 3A0BC 1IW7F 3F9KA 5BOXA 5F0HA 2COBA 1IN6A 3W6JB 3KIOA 2QEXI 3BLYA 3J80K 2PBIA 3X2QH 1W0UA 2GXBA 3V8KA 4P5OA 3MKZA 4DOZA 4XOPA 4V2FA 1JE8A 5M5XJ 2DYRH 3ZN0A 3DBHB 4CXFA 3AKZA 5GAHJ 5E18F 2XB5A 3QRFF 3C18A 3WE2A 2EFNA 1R5HA 1XGMA 2P0WA 4NC8A 2VBYA 3OYCA 4PK4A 3QOEA 4CCLA 2WB1N 1BIBA 2HTSA 4HX7A 1AKHB 3AFHA 2ZNZA 3HRMA 2DDAA 2XVCA 4L18B 3JREA 5DEQA 4CYDA 1QO0D 4U7BA 2M7AA 1Y39A 4RAFA 2L02A 3DF8A 1YITI 1XD7A 4HLYA 2L3DA 5CQGA 2L4MA 3FXMA 2ZCWA 2KRHA 4CYCA 3OIPA 2Y31A 5ERIA 2KIUA 3A0HC 3QP5A 2LG4A 3BDDA 1EJ9A 2R4GA 2M1BA 1P4WA 3OWTA 2V6CA 2HDDA 2W84A 1IV8A 2DBBA 3CCQI 3SEQA 2M0MA 2VKEA 2QQAA 5EG0A 3OYAA 4RDUA 4KIBA 3U2RA 3K4KA 5M5WJ 3HPGA 3GFMA 4UUTA 4M3FA 2VJ4A 5J1RA 1TQIA 1Z3XA 4Y13A 3M07A 5EZGA 1TC3C 1N78A 3GZ6A 1IRXA 1OCTC 3TW6A 2I5UA 4XLCA 3CCEI 2JUGA 2Y0MA 3P9CA 3GTOJ 1JGSA 3ERED 2BV6A 2E5ZA 2XUBA 3FXJA 3VYSB 2KLOA 1YS6A 1BL0A 2CW0F 4RGXA 4UVCA 1Y8RB 2AQFA 2EB7A 2DJIA 2QUFA 3ZP5A 1HKTA 1P92A 2PG4A 2PJPA 2HOEA 3E5XA 4PSWA 5FKNA 4IZZA 2HOSA 4FX4A 1QVTA 1XGSA 4FASD 1FC3A 3CMMA 3QAHA 4ENJA 1SD6A 3KCCA 4A3JJ 3HOUJ 1JUMA 1XDUA 2GWRA 5J1YA 3ZQHA 1K78A 3CCRI 1PJRA 4I02A 4B4CA 3BQZA 3ERMA 4ESJA 3E5UA 3LQQA 4RLQA 1Y8QB 4QTRA 1W7PA 2F5FA 3BG7A 3TEDA 4F7ZA 3H36A 3RSNA 4AM3A 1O7LA 2V4JC 1GHCA 2WAQN 2NOJB 2IGOA 2PQ8A 1BJAA 2DA3A 4ESFA 2XKOA 2IA1A 3JW4A 3O3KA 2XASA 3M8FA 2JVGA 3F8MA 3KP6A 3PJRA 1XMKA 5D4SA 4XRSA 1XS9A 4U87A 3FXQA 4NBQA 1ACIA 1I6XA 1DGRM 1I50J 3FDYA 2DN0A 1X58A 4IF4A 3O8HA 1JTXA 4Q5SF 2K40A 1IF1A 3F6OA 2LVSA 1UHWA 1BI3A 2OZ6A 2LBFA 3W2VA 5DUIA 1W7PB 1PUFB 3HYIA 1X2NA 2DMNA 4YIFA 3I3LA 4XLHA 4XLNF 1W7PD 5JHUA 3T8RA 3W2AA 1USSA 1MKMA 2EINH 1F5TA 2COMA 4JX4A 2M30A 3HSRA 4YFXF 3ZGKA 2LBFB 1FX7A 4MGRA 5BPIA 2VASA 2PN6A 5B3SH 2Z9OA 1S7OA 2DYSH 4PUSA 3F72A 4CCOA 4IOCF 5DM7F 3V7SA 4CA0A 2VE9A 2NAZA 3F6VA 2ZSIB 1O57A 4A3FJ 3CJNA 4XLFA 1W4MA 2NXNB 4B48A 4V19K 3GX4X 4WCGA 1OYWA 3LFKA 3NQOA 2A6TA 4A3EJ 2K9NA 3JRHA 2OV7A 5KNLA 4HV6A 5M3FJ 3ZMVA 1MJAA 1J7KA 3K10A 1ONVA 1LFUP 2ME0A 3O6BB 1HBXG 2GXAA 1A6IA 3QYFA 2D5VA 2FQ4A 1I3QJ 2OUMA 1TWFJ 2QQ8A 2YX7A 3JTHA 4HPQA 1YIJI 2QVOA 3DTEA 4HX4A 4MTEA 1S29A 3VOEA 3TO9A 4C9YA 2HYJA 1U5TB 3CCSI 1Z91A 2HQAA 2GA2A 2UWMA 1IN5A 2EZKA 4EMSA 4P9FA 2WAFA 3F3XA 1RKWA 2HZTA 1YOVB 2F6CA 1ETKA 2V7FA 3F8NA 1TBXA 2VONA 4OIRF 1DPUA 3IWFA 1BI2A 4UY8I 3CESA 4KUMA 2VQGA 3CUQB 4HZFA 4ZH4F 4CO8A 4IHWA 2W25A 1B6AA 4D9JA 2A6EF 2DA7A 2ELKA 3B73A 3ZQQA 2IP2A 5DD8A 4C30A 1T95A 4A3KJ 1CF7A 3BZCA 2L9VA 1SD7A 4XSZF 3HRTA 1KQ8A 4RBOA 3OYHA 2X6YA 2JK3A 3K4NA 4B8XA 5A2QK 3EUAA 3HRSA 4E7HA 1VTNC 5L3FA 1X1BA 3PL8A 2Z3YA 4XIDA 2X0LA 5CVJA 1FIAA 2ISZA 2D2WA 1U8RA 2KIMA 3GLXA 5JFRA 2KRCA 4XORA 1J2XA 5GTHC 2P6SA 3CMEI 2CFOA 3LMMA 1W36C 2JTVA 4RGUA 1E3HA 2R7QA 5IYBJ 3HTSB 4Y7NJ 9ANTA 2IS2A 1P4AA 2Z5UA 4IRIA 1ZELA 4LITA 2HI3A 3BG6A 1S8NA 1QQIA 4LIUA 2CJJA 2HR3A 5M5YJ 4IHSA 1R1UA 2OTJI 1YJWI 1DUXC 3W2WA 3VFZA 2CRGA 4HSTA 4AIKA 1YRNB 1WJCA 1J75A 1EH8A 2ELJA 5TGTA 3VSKA 1V55H 1H0MA 1C0WA 2Z99A 2BY2A 2VI6A 1E2XA 1WKMA 1YW9A 4D1QA 4FX0A 2K3FA 4A5NA 2BY1A 2K3PA 2KMUA 4M74A 1P9QC 3FBIB 4GDFA 4UB6C 3WTXC 3BR3A 5E1WA 3ZQIA 1SFEA 5BPDA 4Y15A 3PO2J 5E79C 4A0YA 2LD5A 1SEUA 4CGZA 2QGUA 2IGKA 1YYVA 3O8GA 3IWZA 1X1DA 3K1NA 1D0YA 4HYEA 3JRIA 3IUOA 2DO7A 1T98A 3PNVA 2EH3A 4A0XA 2GLOA 2XGEA 3H3UA 3QU3A 3D5RC 3KX2A 2KDZA 3PNYA 2H8RA 2ZSHB 5FRNA 3H5NA 3V4GA 2DFFA 3L2RA 4CYCB 1U0JA 3HHHA 3SZGA 1ZHFA 2HDCA 2W00A 2FXAA 5EZHA 2GXGA 3CZ6A 1SMYF 1GXPA 1ZLKA 3CF5F 3I9V2 2KJBA 3CCJI 2R7UA 1XC5A 1KU9A 3AG4H 5KHDA 3JAMK 3IP4B 2HKOA 1ZQ3P 1EF4A 4QSHA 1QZZA 3FXUA 3BPVA 2LOOA 1SANA 3BJOA 1ON2A 1OYIA 3CO6C 4M3GA 2VB6A 5J4VA 3G2BA 4Y4RA 4H4KC 1UHMA 3K69A 4YG2F 4FISA 1FBQA 2H8WA 3TO7A 4ZZLA 2BOLA 1ZTRA 4IO9F 3D0SA 2V26A 1OQYA 1T2KA 4IKFA 2HU9A 4XLPF 2BHYA 4HNVA 1FYMA 4M6XA 2FA5A 2O9LA 2G9WA 1ERDA 2ID6A 4YIRX 4KN4X 4HQMA 3H1CA 3KEYA 3BJ6A 4HAMA 3GMEA 2BXZA 2IEKA 4QPOA 1Y56A 2XAFA 4DZPA 1XSDA 3CDHA 4ZDLA 1E3PA 1MW7A 3DXJF 3DKYA 3I54A 4MIMA 4C3HJ 2XF7A 2RNJA 4GO1A 3V8JA 3S93A 2P81A 1FSEA 1P4XA 5FGMA 2EK5A 2EFWA 3BZ6A 1FMWA 2HGCA 4N9HA 3WTYC 1Y0NA 1YG2A 1STZA 2K9QA 2X85A 2Y0SA 2QA4I 1Y6IA 3CMAI 1N77A 3WU1B 3KZZA 4BHPA 1FOYA 4IRGA 5FKMA 2MYSA 2A07F 3OYLA 1HLVA 1LUJB 2VL8A 4BH9A 3PFIA 3HL2A 4IQ4A 2DQRA 1LE8A 1SFXA 5CPRB 4UB8C 3P5JA 2A5YB 2R7RA 1VQ5I 4HF1A 2UUZA 4WK8F 3DCFA 2B63J 2CW7A 2W85A 1RUOA 5DS9A 1D0ZA 4X1EA 4CCJA 3L9FA 2O6GE 2HYGD 1UJ8A 2Y75A 1D5VA 5LEKA 1U5TA 4A5MA 2JMWA 3KLNA 2YU3A 2O0YA 1BOAA 3M9AA 3NEUA 2O61A 1FLIA 1ODDA 2M7BA 2DA2A 1U78A 2HFHA 1VQMI 1L3LA 2CG4A 2HVSA 3QYBA 2FNAA 5DYMA 4X0GA 3TOBA 4CZZA 1W1WE 5IT9Z 1EA3A 1X1CA 2CQXA 2GOMA 1AKHA 3CC4I 2LDUA 3LSGA 2PI0A 4EM0B 3D5LA 1VQOI 2DAOA 4AIDA 3H3ZA 4FETA 4BQAA 5B1BH 1TZLA 1OFCX 2EBIA 5KAIC 1RC9A 3QOPA 3GLLA 1LKXA 2LP0A 3LA2A 2DLLA 5BS6A 1DP7P 4L9TA 4J00A 2M4GA 2EJRA 1LFPA 1S7EA 3FXKA 4GXOA 2FBHA 4W1UA 5H20A 2LYCA 2PEXA 3OYIA 4I6ZA 1B8IB 4EQQA 2HKXA 5FKLA 2EWNA 2ZXJA 3SZTA 4L0ZB 3FMQA 2BBYA 4HOBA 2V9KA 3F0CA 5E3NA 2B9SA 2RNGA 3E6CC 3CP2A 4WWCA 5CYVA 2K7LA 3AG2H 4X6AJ 4C2TA 3HOZJ 1MNEA 4CICA 1A31A 5EJCA 2LREA 5E3MA 3J7YJ 1FNNA 4L9NA 1G6NA 2ACJA 3NAUA 5D8KB 4LIVA 2WADA 2XAGA 5K1YA 3SFZA 1W5TA 2IT0A 1D5YA 3C3WA 1QRYA 1UG2A 3ABKH 2HDWA 1QBJA 1VI0A 5B5EC 3G3ZA 1Z6TA 2WA0A 3LSPA 1WJBA 3CJTB 1RESA 3CDLA 4KMFA 2D45A 1J59A 2WC2A 3LWFA 2IGMA 3G71I 2RKHA 1P7IA 1LNWA 3HSFA 3Q0WA 3WTVC 4J01A 3LAPA 1GDTA 3GTPJ 2M34A 3CCYA 3DEUA 5M3MJ 5D5VB 4R1HA 2PMUA 3TKYA 2L4AA 2XPWA 3K7AJ 5KVRA 4ZJZA 3JRBA 3SZPA 2KL4A 2LR8A 4DYCA 4B09A 2E7XA 2VT2A 1MBJA 5LHGA 5E1XA 1FP1D 3T0YA 1P6RA 2P5KA 3U1KA 3OIQA 2L9SA 1OCPA 5FLVA 1I6HJ 1NG7A 3I59B 3ZMTA 5F1RA 2Z33A 4HF2A 4ENKA 2WV0A 1FTTA 3H5RA 4LOCA 2PX9A 2Z1DA 3DTKA 1HC8A 4XLEA 1QGPA 3ZXSA 3ZQCA 3TL4X 2KIQA 1TNSA 3BOQA 1NTCA 3R4KA 3I56I 3S17J 3BTLA 4A93J 1F1ZA 1FJLA 2K9MA 3GTLJ 2O8XA 3K4LA 5ICGA 1K6YA 1GLNA 1X3ZB 1IRGA 3OYKA 3FXLA 3WTZA 4B44A 1XN7A 4Y33A 3K1MA 4M71A 3I4NJ 3ZQGA 1JI8A 2DT5A 4NQWB 5IY5H 2OCEA 1MD0A 3MFKA 1AA7A 2M45A 1POGA 3M1CA 1SD4A 3WHBA 1MJ9A 3HUGA 4B1RA 4E7LA 1IN7A 2LKXA 3S1QJ 1U2WA 2XRNA 2EA4A 3C7JA 2LY9A 4D5CA 1UELB 1RI7A 4Q47A 4IL6C 5F27A 3EUKL 3G1MA 3IRQA 5CJ9A 1WSUA 5C4XJ 2X6XA 5HS7A 1VQKI 2Y9ZA 4E7JA 5B66C 1R4NB 1F36A 2QQ9A 2YUSA 4Y3OA 2HPMA 3ZPLA 3HOXJ 2LNBA 2MGQA 3H35A 3UR3C 5CVRA 3KP5A 3K70C 3I55I 3Q5FA 1LVAA 3V8LA 5LFAA 1R23A 2OAZA 3WE3A 2OC6A 4RB1A 4I7HA 4P1WA 2TRTA 5H2FC 1S6LA 4ENNA 1WGXA 2MH2A 1YX5A 4EM2A 2QSHX 1WH7A 1QZEA 2VQLA 2V9PA 3JSOA 1IJWC 1QU3A 2CUEA 2HOTA 5HLHA 2QM3A 2M3AA 3ZMSA 1ZR4A 5EF6A 3IHUA 1BC7C 2ZJQF 2LY1A 5HLGA 3E6BA 4G12A 3HXLA 2MC3A 3G1LA 3SDGA 1GV2A 4BACA 1AOYA 1ZLJA 4HRIA 3HTUA 5J6XA 1YFHA 1BW5A 2HXOA 4GCVA 2DK8A 4C2UA 1A04A 3LA3A 4PJMA 2DMTA 2A05A 3M8EA 3VB2A 1OCZH 3IH2A 5J3LA 1QPIA 1BW6A 5D5WB 2DFEA 4ZYEA 2Y2ZA 3GFJA 1ITYA 2BEOA 3IAM2 3Q3SA 4IOAF 4BQNA 3HEFA 1W36D 2XAQA 3BCBA 3F23A 2NS8A 2RAEA 5JHFA 3MVPA 1G3SA 2ZMEC 4XLAA 4P96A 3MN2A 2FX0A 2AHQA 3ESWB 2IRFG 2NVTJ 4XQFA 1Z77A 1PVEA
chains in the Genus database with same CATH topology
1OKRA 1O7FA 4L0YB 4KDPA 3L00A 1JHHA 5CVIA 5BQTA 3LA7A 3I58A 3NRVA 3LSTA 2BGCA 3GFIA 3KEOA 4Q48A 4KMUX 4OMYA 4EJUA 2CQKA 4OIPF 1U5TC 5BMZA 4U0YA 1K7AA 5HOOA 2CWEA 5DD4A 1O3QA 1XSXA 1BIAA 4LG0B 1BN5A 1QZYA 2ZKZA 4KIGA 4EGZA 1PDNC 1J9IA 2IPQX 5F64A 5HVQC 1B59A 3FMRA 4ON0A 5KK1A 1EV7A 1TNTA 4IJAA 4O5VA 2P5LC 3H92A 3ROUA 1G3TA 1I1GA 2OZUA 3DPTA 4N9IA 4M9ZA 2P6TA 3KFWX 5DV5A 3IRRA 2YPRA 3QPHA 2VC0A 5FLXK 3MWMA 2A6HF 3R61A 1ULYA 5L3DA 2UXNA 1XCBA 1Z6RA 4BHCA 3EQLF 3J81Z 3RJPA 1KU7A 4JBAA 3QP6A 2AXLA 2H94A 5L3CA 4AIHA 2DPUA 4G7OF 1Z05A 2XHKA 3KP4A 1B4AA 1SD5A 1ZGAA 1FWZA 3IL2A 1Z9CA 3L09A 3GXOA 4PGHA 1XCVA 3RPUA 2GA1A 2DI3A 1HQCA 2DTRA 2IW5A 2ZO4A 2ZNYA 3CUOA 1G3YA 4WXCA 2FOKA 4XBFA 4A6DA 1FOKA 4FT8A 3TDUC 1SAXA 5FFXA 5LHHA 3R60A 3KETA 2P8TA 4IHTA 5HLIA 3SXYA 1OR7A 3P7NA 1FBSA 2Q0OA 3B02A 3GO5A 3QPTA 5AONA 3RYPA 4JK1X 2Q8KA 1P2FA 2EA2A 1YO5C 4EJTA 3I5UA 2V1XA 4KICA 1IN8A 3TO6A 1ZAOA 4IVNA 4HDUA 1L0OC 5L3GA 3QU6A 1TW2A 2R3SA 2NRAC 5HDKA 4IRHA 5LGNA 3KP2A 1IXRC 4LLNA 4BAYA 4KIFA 2F5CA 1LQ1A 4LK1F 3EETA 3CUQA 4NHJA 2ZMEA 2FNPA 2O03A 5K5OA 3REOA 4A6EA 4MTDA 3VODA 1V4RA 3KP3A 3FX3A 4YFKF 3WTUC 5HS8A 1IN4A 3ELKA 3WG9A 2JZYA 3WGHA 2GAUA 4UNOA 3DKWA 4PZJA 5LGUA 1MZBA 1TLHB 4HA8A 2P7CB 3J7AO 1KU2A 2HYFA 1HSJA 1TQMA 1PP7U 2LKPA 4EM1A 1HKSA 5ICEA 3K2ZA 3L7WA 1Y0UA 4RGRA 1R1TA 3TDZC 3SHFA 3RKYA 1LB2A 5AIPA 2YSRA 4MEXF 1FYLA 3ZQ7A 1ZRDA 3ECHA 1J0RA 2JSCA 2VBWA 1ZRFA 2VT3A 5D8LB 1IXCA 5LRRA 1JHFA 3RKWA 3MZHA 3MZYA 3F22A 1LEAA 2DU9A 4EJOA 4A0ZA 2BYVE 4L5IA 4OIQF 4NQWA 1UB9A 3E6MA 1D8JA 2QZ8A 3N4MA 2CGPA 4I01A 3JTGA 1XMAA 2EV6A 5ED4A 2HQNA 1ZG1A 2A3SA 5CLSA 3DV8A 4ZZDA 3ECOA 1R22A 3FZVA 2NNNA 5CVVA 3MAJA 4BHBA 2KRFA 2A68F 3V7CA 3J80Z 3COAC 4BXUA 1XB4A 1HW5A 3GW2A 2ZMEB 1GVJA 4S05A 1R7JA 2X4HA 3DPLC 2VBXA 2RDPA 2STWA 2V79A 2M87A 5DCFA 3ABTA 5F6FA 3PQJA 3U1DA 1Q1HA 3GYHX 4OINF 4ENMA 1DPRA 1XSVA 4MQVA 1B9MA 3JSPA 4M9XA 1IAWA 2FMLA 2QBYB 2F5EA 1R00A 1KU3A 2OQGA 5D5UB 4HDVA 1HSTA 2JPCA 2LF8A 3I71A 3PQKA 3G73A 2PLYA 3KEQA 3FHZA 2KIFA 5H6RA 3E6DA 4O3MA 3FF5A 5LRSA 3W6KB 4WXDA 1BBYA 5FB2A 3IKTA 5E8GA 2OBPA 3HOSA 1ZRCA 1MJBA 1D3YA 1NHAA 1F9NA 4LG0A 2HTJA 2DQLA 3F8FA 1K78B 2VN2A 5E17F 3K9TA 2B0LA 4HBLA 5D6FA 4OIOF 4RAZA 4A12A 2XROA 4S04A 5E20A 2P7VB 4I0BA 3IKVA 1YTYA 1B1BA 3E5QA 4U0WA 1BM9A 3RDIA 4LGWA 2H09A 5H6QA 4I09A 3ML6A 1K6OA 4I98B 2QQBA 3K0LA 3BP8A 3FM3A 1TW3A 3RKXA 1K79A 4OU0A 2JRTA 4UVBA 5LLQA 4LJZF 3AAFA 3ABUA 1E17A 4U7DA 4IPAA 1RIOH 2E1NA 1O3TA 2V9VA 5FFZA 1G3WA 2IJLA 1MDMA 5DUKA 4HQEA 2QBYA 1DDNA 5LHIA 2MA3A 4M72A 2QYOA 1YW8A 2K4BA 3KE2A 4RS8A 2H6BA 3MCZA 2EFOA 1QPMA 4ESBA 2QENA 2OD5A 3GWZA 3ZN1A 2F2EA 4L5JA 2ETHA 5A2QZ 4A2UA 1ZARA 4LMYA 2MH9A 2HQRA 4KFCA 2E7WA 4RB2C 3KP7A 1CF7B 4KT5C 3EYYA 1S7AA 2MLGA 4CDGA 2VE8A 2YX4A 1ZYRF 3WODF 1I27A 4Z2YA 2IVMA 2UXXA 3HOTA 3RI4A 2K86A 4WXHA 4AWXB 3R6SA 1XGOA 3L2CA 1FT9A 1SMTA 5FD6A 1WRJA 5TRDA 4AIJA 4M6YA 5CVUA 5JVTA 1BI1A 3FMSA 2JPBA 2PFBA 3Q9VA 2TDXA 5K5RA 1XGNA 2EV0A 2MD5A 2IA2A 2V1DA 4PDKA 3RIRA 1FY7A 3VEPA 2VXZA 5L3BA 4LLGF 5ICCA 3F8CA 1LEBA 5JR3A 2RC4A 1F4KA 1YQAA 3KZYA 1FBUA 2STTA 1T6SA 4U0VA 1LJ9A 1PP8F 4YFNF 1LDJA 1LDDA 3EDPA 3FWEA 3TOAA 3I53A 5DCMB 2OU2A 4HF0A 2A61A 4UHTA 3RYRA 2YR2A 1YS7A 4O6JA 1AWCA 4AD9A 3BY6A 2FMYA 5FLXZ 3BROA 2ZBKA 1O3SA 4RAYA 3BPXA 3M7GA 2L54A 4EJVA 1HW2A 4KA4A 1J5YA 2GZWA 4LFUA 3OV8A 2O3FA 3ZMDA 3KLOA 3CLOA 4ZYHA 1YLFA 2FF4A 5FD5A 4EV0A 3LAJA 4IXAA 2RV8A 1UFMA 1FPQA 4I0AA 4UV8A 2W57A 4PCQA 2M8EA 5ILSA 1YW7A 2BE5F 5ILVA 1V3FA 2OQRA 1T0FA 4M73A 3HRUA 4DNCA 3MQ0A 1CGPA 1H9TA 3I59A 4EVIA 4HW0A 5HDGA 2R7FA 1PUEE 2CFXA 2R7DA 4G7HF 4PGGA 1FP2A 3SQNA 4L9VA 3RTRA 1IUYA 3GUDA 4DQ2A 2ISYA 4HX8A 2FU4A 2G7UA 2Y48A 1G4DA 5EEHA 2E1CA 5TJJA 1KGSA 2KKOA 4G8XA 4M9SA 4WX9A 4Y17A 2FE3A 2AS5F 4MQ9F 1OYYA 4RGSA 3I64A 1RNLA 4UXNA 4Q4ZF 3C1DA 2XV4S 5AIQA 2XAJA 2J5PA 1TTYA 5E8IA 1MDMB 1ON1A 1T38A 1D8KA 1XDSA 2ESNA 3ZMUA 1FSHA 1O3RA 3FM5A 1OMIA 5E1ZB 1OPCA 1H9GA 5ICFA 2LSOA 3ISPA 2HEOA 3WU0A 6PAXA 2FBIA 4RB0A 2DK5A 2GQQA 3P9IA 4UVAA 3F21A 4R8HA 5HS9A 2ELHA 3TGNA 2OA4A 3CUQC 3R0JA 2XKPA 1ZREA 4CHUA 4HLXA 1S3JA 4R79A 4H0EA 3ZMZA 3P9KA 2L01A 4KN7X 4TV7A 2VOPA 4EJWA 4I2OA 1FZPB 4G94A 5D6EA 1B9NA 3JAMZ 5J8FA 2RN7A 3FXRA 4LD5A 2WTEA 4MHGA 2JT1A 1X3UA 4P9UA 3HSEA 5J8CA 2D1HA 2NS0A 1HXDA 1Z7UA 3TQNA 4GYGA 2QLZA 5L3EA 5DDGA 3OOPA 1ZN2A 3WTTC 3S2WA 4AVPA 1REPC 2EFQA 3N97A 3HIFA 2HS5A 1R58A 2VBZA 1KYZA 2G7HA 2NYXA 3CTAA 4L9JA 4FHTA 3GZ5A 3BWGA 5HDNA 4G6QA 4N0BA 4HV5A 2XGXA 2VOOA 1ZG3A 4GGGA 5LEJA 3MEXA 2GIVA 2XAHA 1HKQA 1KQ0A 1TQPA 2H27A 2DFIA 1QNTA 1IZ1A 3WTWC 3DQVC 2FBKA 5DCMA 3DFGA 2CO5A 4XSXF 3WGGA 2ADUA 2EV5A 3EUHA 3HHGA 1HW1A 4UUVA 2ZFWA 4D0PA 3IC7A 1IRFA 2WWYA 3GF2A 2RVCA 2QWWA 2CYYA 4LB5A 4K2EA 2K27A 2P4WA 5EEGA 1R1VA 4MEYF 1KYWA 1EH6A 5LBQA 4GYIA 3Q9SA 2H6CA 4ZYGA 4G9YA 5K5QA 1LDKB 2CSOA 3V7RA 5IT9K 2XIGA 2F5DA 2D1VA 2K02A 2MLKA 1KQ9A 2DPDA 4WF2A 4UV9A 1I1SA 2FRHA 3BJAA 2FEZA 3F8BA 3GVAA 2LF7A 4LLLA 2MBFA 2ESHA 4G7ZF 3WTSC 2ZJ2A 5D4RA 3U9GA 2IA0A 3I0TA 3T5XA 1R36A 4MNUA 3EYIA 4KNYA 4E70A 3WGIA 4KYWA 3E3VA 1ZGJA 1BC8C 1I5ZA 4U88A 1T39A 1U6GA 1WWXA 5D5XB 2V1UA 2NNYA 4EGYA 2PMHA 4LB6B 2VODA 4QWQA 1UCRA 4JQFA 4LK0F 4OMZA 1MGTA 2J5OA 4BYYA 1KA8A 2FQ3A 4P55A 2W24A 3O2PE 5ILUA 3R0AA 1GXQA 1BI0A 4ETSA 4OOIA 3DP7A 1R5GA 3ULQB 2VC1A 4NB5A 4RB3C 1RUNA 1ZG5A 3K1PA 3GFLA 3T1BA 1EH7A 4YIIA 1YIOA 2M5WA 1IXSB 2C6YA 3I4PA 3J81K 4ZYDA 2K4JA 3CO7C 1USTA 2A69F 5LGTA 1W5SA 1U3EM 3GEZA 4BNCA 3M1EA 4XRFA 2HWVA 2EFPA 1Z1DA 5IT3A 4QLCU 5JI6A 3LQRA 3RPQA 2UZKA 2FSWA 4ASNA 1JXSA 1WI9A 5FO5A 4G6DA 1SFUA 1FYKA 2RGVA 2Q2EA 2P5VA 2KJCA 1ZH5A 3E97A 2DW4A 1WQ2A 2RQPA 1RZ4A 1IW7F 5BOXA 1IN6A 3W6JB 3J80K 2PBIA 2GXBA 3V8KA 4P5OA 1JE8A 3ZN0A 4CXFA 5E18F 3QRFF 3C18A 3WE2A 2EFNA 1R5HA 1XGMA 2VBYA 1BIBA 2HTSA 4HX7A 2ZNZA 3HRMA 2XVCA 4L18B 5DEQA 4CYDA 1QO0D 4U7BA 2L02A 3DF8A 1XD7A 4HLYA 2L3DA 2L4MA 2ZCWA 5ERIA 2KIUA 3QP5A 3BDDA 2M1BA 1P4WA 2V6CA 2W84A 2DBBA 2QQAA 4KIBA 3U2RA 3GFMA 1TQIA 4Y13A 3GZ6A 2Y0MA 3P9CA 1JGSA 3ERED 2BV6A 2XUBA 1YS6A 2CW0F 4RGXA 4UVCA 2EB7A 2QUFA 3ZP5A 1HKTA 1P92A 2PG4A 2PJPA 2HOEA 3E5XA 4FX4A 1XGSA 1FC3A 3QAHA 4ENJA 1SD6A 3KCCA 1XDUA 2GWRA 1K78A 4I02A 4ESJA 3E5UA 3LQQA 1W7PA 2F5FA 4F7ZA 1O7LA 1GHCA 2PQ8A 1BJAA 4ESFA 2XKOA 2IA1A 3JW4A 3O3KA 2XASA 3M8FA 3F8MA 3KP6A 1XMKA 5D4SA 3FXQA 1I6XA 4IF4A 4Q5SF 1IF1A 3F6OA 1BI3A 1UHWA 2OZ6A 5DUIA 1W7PB 3HYIA 4YIFA 4XLNF 1W7PD 5JHUA 3T8RA 1USSA 1MKMA 1F5TA 2COMA 2M30A 3HSRA 4YFXF 1FX7A 4MGRA 5BPIA 2PN6A 2Z9OA 1S7OA 3F72A 3V7SA 2VE9A 2NAZA 3F6VA 1O57A 3CJNA 1W4MA 3GX4X 4WCGA 1OYWA 3LFKA 3NQOA 4HV6A 3ZMVA 1MJAA 1J7KA 1ONVA 3O6BB 1HBXG 2YX7A 3JTHA 2QVOA 4HX4A 4MTEA 1S29A 3VOEA 3TO9A 1U5TB 1Z91A 2GA2A 2UWMA 1IN5A 4EMSA 4P9FA 3F3XA 2HZTA 3F8NA 1TBXA 2VONA 4OIRF 1DPUA 3IWFA 1BI2A 4KUMA 3CUQB 4HZFA 4ZH4F 4CO8A 2W25A 1B6AA 2A6EF 3B73A 2IP2A 5DD8A 1CF7A 1SD7A 4XSZF 3HRTA 1KQ8A 4B8XA 5A2QK 3HRSA 1VTNC 5L3FA 2Z3YA 2X0LA 5CVJA 2ISZA 2D2WA 1U8RA 2KIMA 3GLXA 5JFRA 1J2XA 2P6SA 2JTVA 4RGUA 3HTSB 1P4AA 2Z5UA 4IRIA 1S8NA 1QQIA 2HR3A 4IHSA 1R1UA 1DUXC 3VFZA 4AIKA 1J75A 1EH8A 1H0MA 1C0WA 2Z99A 1E2XA 1WKMA 1YW9A 4FX0A 4A5NA 4M74A 3WTXC 5E1WA 1SFEA 5BPDA 4Y15A 4A0YA 4CGZA 1YYVA 3IWZA 3K1NA 4HYEA 2DO7A 1T98A 4A0XA 3H3UA 3QU3A 3V4GA 3HHHA 1ZHFA 2HDCA 2FXAA 2GXGA 1SMYF 1GXPA 1ZLKA 2KJBA 3JAMK 1KU9A 2HKOA 1QZZA 3FXUA 3BPVA 3BJOA 1ON2A 1OYIA 3CO6C 4YG2F 1UHMA 3K69A 1FBQA 3TO7A 4ZZLA 3D0SA 1T2KA 4XLPF 1FYMA 4M6XA 2FA5A 2G9WA 4KN4X 4HQMA 3BJ6A 4HAMA 2XAFA 1XSDA 3CDHA 3DXJF 3I54A 4GO1A 2RNJA 3V8JA 1FSEA 1P4XA 5FGMA 2EK5A 2EFWA 3BZ6A 2HGCA 4N9HA 3WTYC 1YG2A 1STZA 3WU1B 3KZZA 4BHPA 4IRGA 2A07F 4BH9A 3PFIA 2DQRA 1SFXA 2A5YB 4HF1A 4WK8F 1RUOA 2W85A 3L9FA 2O6GE 2HYGD 1D5VA 2Y75A 5LEKA 1U5TA 4A5MA 3KLNA 2YU3A 2O0YA 1BOAA 3M9AA 3NEUA 2O61A 1FLIA 1ODDA 1U78A 2HFHA 1L3LA 2CG4A 2FNAA 5DYMA 3TOBA 4CZZA 5IT9Z 2LDUA 2PI0A 4EM0B 3D5LA 2DAOA 3H3ZA 4BQAA 3QOPA 5BS6A 3LA2A 2DLLA 1DP7P 4L9TA 2EJRA 5H20A 4GXOA 2FBHA 2PEXA 4EQQA 2HKXA 2EWNA 2ZXJA 3SZTA 4L0ZB 3FMQA 2BBYA 4HOBA 3E6CC 4WWCA 5CYVA 2K7LA 4CICA 1FNNA 4L9NA 1G6NA 2ACJA 5D8KB 2XAGA 5K1YA 3SFZA 1W5TA 2IT0A 3C3WA 1QBJA 3G3ZA 1Z6TA 4KMFA 2D45A 1J59A 2WC2A 3LWFA 2RKHA 1LNWA 3HSFA 3WTVC 3LAPA 3DEUA 5D5VB 4R1HA 2PMUA 3TKYA 2L4AA 5KVRA 3SZPA 4B09A 2E7XA 2VT2A 5LHGA 5E1XA 1FP1D 3T0YA 1P6RA 2P5KA 3I59B 3ZMTA 5F1RA 2Z33A 4HF2A 4ENKA 2WV0A 1QGPA 1TNSA 3BOQA 3R4KA 1F1ZA 2O8XA 5ICGA 1IRGA 3WTZA 1XN7A 3K1MA 4M71A 2DT5A 1MD0A 3MFKA 2M45A 1SD4A 1MJ9A 3HUGA 1IN7A 1U2WA 2XRNA 2EA4A 3C7JA 1RI7A 4Q47A 3IRQA 5CJ9A 1WSUA 5HS7A 2QQ9A 3ZPLA 2LNBA 5CVRA 3KP5A 3Q5FA 1LVAA 3V8LA 1R23A 2OAZA 3WE3A 4RB1A 4I7HA 1S6LA 4ENNA 2MH2A 4EM2A 3JSOA 5HLHA 2QM3A 3ZMSA 3IHUA 1BC7C 5HLGA 3E6BA 2MC3A 1AOYA 1ZLJA 3HTUA 5J6XA 1YFHA 4GCVA 2DK8A 1A04A 3LA3A 3M8EA 3VB2A 5D5WB 4ZYEA 3GFJA 2BEOA 2XAQA 3F23A 1G3SA 4P96A 2IRFG 3T8TA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1OKR A;  1O7F A;  4L0Y B;  4KDP A;  3L00 A;  1JHH A;  5CVI A;  5BQT A;  3LA7 A;  3I58 A;  3NRV A;  3LST A;  2BGC A;  3GFI A;  3KEO A;  4Q48 A;  4KMU X;  4OMY A;  4EJU A;  2CQK A;  4OIP F;  1U5T C;  5BMZ A;  4U0Y A;  1K7A A;  5HOO A;  2CWE A;  5DD4 A;  1O3Q A;  1XSX A;  1BIA A;  4LG0 B;  1BN5 A;  1QZY A;  2ZKZ A;  4KIG A;  4EGZ A;  1PDN C;  1J9I A;  2IPQ X;  5F64 A;  5HVQ C;  1B59 A;  3FMR A;  4ON0 A;  5KK1 A;  1EV7 A;  1TNT A;  4IJA A;  4O5V A;  2P5L C;  3H92 A;  3ROU A;  1G3T A;  1I1G A;  2OZU A;  3DPT A;  4N9I A;  4M9Z A;  2P6T A;  3KFW X;  5DV5 A;  3IRR A;  2YPR A;  3QPH A;  2VC0 A;  5FLX K;  3MWM A;  2A6H F;  3R61 A;  1ULY A;  5L3D A;  2UXN A;  1XCB A;  1Z6R A;  4BHC A;  3EQL F;  3J81 Z;  3RJP A;  1KU7 A;  4JBA A;  3QP6 A;  2AXL A;  2H94 A;  5L3C A;  4AIH A;  2DPU A;  4G7O F;  1Z05 A;  2XHK A;  3KP4 A;  1B4A A;  1SD5 A;  1ZGA A;  1FWZ A;  3IL2 A;  1Z9C A;  3L09 A;  3GXO A;  4PGH A;  1XCV A;  3RPU A;  2GA1 A;  2DI3 A;  1HQC A;  2DTR A;  2IW5 A;  2ZO4 A;  2ZNY A;  3CUO A;  1G3Y A;  4WXC A;  2FOK A;  4XBF A;  4A6D A;  1FOK A;  4FT8 A;  3TDU C;  1SAX A;  5FFX A;  5LHH A;  3R60 A;  3KET A;  2P8T A;  4IHT A;  5HLI A;  3SXY A;  1OR7 A;  3P7N A;  1FBS A;  2Q0O A;  3B02 A;  3GO5 A;  3QPT A;  5AON A;  3RYP A;  4JK1 X;  2Q8K A;  1P2F A;  2EA2 A;  1YO5 C;  4EJT A;  3I5U A;  2V1X A;  4KIC A;  1IN8 A;  3TO6 A;  1ZAO A;  4IVN A;  4HDU A;  1L0O C;  5L3G A;  3QU6 A;  1TW2 A;  2R3S A;  2NRA C;  5HDK A;  4IRH A;  5LGN A;  3KP2 A;  1IXR C;  4LLN A;  4BAY A;  4KIF A;  2F5C A;  1LQ1 A;  4LK1 F;  3EET A;  3CUQ A;  4NHJ A;  2ZME A;  2FNP A;  2O03 A;  5K5O A;  3REO A;  4A6E A;  4MTD A;  3VOD A;  1V4R A;  3KP3 A;  3FX3 A;  4YFK F;  3WTU C;  5HS8 A;  1IN4 A;  3ELK A;  3WG9 A;  2JZY A;  3WGH A;  2GAU A;  4UNO A;  3DKW A;  4PZJ A;  5LGU A;  1MZB A;  1TLH B;  4HA8 A;  2P7C B;  3J7A O;  1KU2 A;  2HYF A;  1HSJ A;  1TQM A;  1PP7 U;  2LKP A;  4EM1 A;  1HKS A;  5ICE A;  3K2Z A;  3L7W A;  1Y0U A;  4RGR A;  1R1T A;  3TDZ C;  3SHF A;  3RKY A;  1LB2 A;  5AIP A;  2YSR A;  4MEX F;  1FYL A;  3ZQ7 A;  1ZRD A;  3ECH A;  1J0R A;  2JSC A;  2VBW A;  1ZRF A;  2VT3 A;  5D8L B;  1IXC A;  5LRR A;  1JHF A;  3RKW A;  3MZH A;  3MZY A;  3F22 A;  1LEA A;  2DU9 A;  4EJO A;  4A0Z A;  2BYV E;  4L5I A;  4OIQ F;  4NQW A;  1UB9 A;  3E6M A;  1D8J A;  2QZ8 A;  3N4M A;  2CGP A;  4I01 A;  3JTG A;  1XMA A;  2EV6 A;  5ED4 A;  2HQN A;  1ZG1 A;  2A3S A;  5CLS A;  3DV8 A;  4ZZD A;  3ECO A;  1R22 A;  3FZV A;  2NNN A;  5CVV A;  3MAJ A;  4BHB A;  2KRF A;  2A68 F;  3V7C A;  3J80 Z;  3COA C;  4BXU A;  1XB4 A;  1HW5 A;  3GW2 A;  2ZME B;  1GVJ A;  4S05 A;  1R7J A;  2X4H A;  3DPL C;  2VBX A;  2RDP A;  2STW A;  2V79 A;  2M87 A;  5DCF A;  3ABT A;  5F6F A;  3PQJ A;  3U1D A;  1Q1H A;  3GYH X;  4OIN F;  4ENM A;  1DPR A;  1XSV A;  4MQV A;  1B9M A;  3JSP A;  4M9X A;  1IAW A;  2FML A;  2QBY B;  2F5E A;  1R00 A;  1KU3 A;  2OQG A;  5D5U B;  4HDV A;  1HST A;  2JPC A;  2LF8 A;  3I71 A;  3PQK A;  3G73 A;  2PLY A;  3KEQ A;  3FHZ A;  2KIF A;  5H6R A;  3E6D A;  4O3M A;  3FF5 A;  5LRS A;  3W6K B;  4WXD A;  1BBY A;  5FB2 A;  3IKT A;  5E8G A;  2OBP A;  3HOS A;  1ZRC A;  1MJB A;  1D3Y A;  1NHA A;  1F9N A;  4LG0 A;  2HTJ A;  2DQL A;  3F8F A;  1K78 B;  2VN2 A;  5E17 F;  3K9T A;  2B0L A;  4HBL A;  5D6F A;  4OIO F;  4RAZ A;  4A12 A;  2XRO A;  4S04 A;  5E20 A;  2P7V B;  4I0B A;  3IKV A;  1YTY A;  1B1B A;  3E5Q A;  4U0W A;  1BM9 A;  3RDI A;  4LGW A;  2H09 A;  5H6Q A;  4I09 A;  3ML6 A;  1K6O A;  4I98 B;  2QQB A;  3K0L A;  3BP8 A;  3FM3 A;  1TW3 A;  3RKX A;  1K79 A;  4OU0 A;  2JRT A;  4UVB A;  5LLQ A;  4LJZ F;  3AAF A;  3ABU A;  1E17 A;  4U7D A;  4IPA A;  1RIO H;  2E1N A;  1O3T A;  2V9V A;  5FFZ A;  1G3W A;  2IJL A;  1MDM A;  5DUK A;  4HQE A;  2QBY A;  1DDN A;  5LHI A;  2MA3 A;  4M72 A;  2QYO A;  1YW8 A;  2K4B A;  3KE2 A;  4RS8 A;  2H6B A;  3MCZ A;  2EFO A;  1QPM A;  4ESB A;  2QEN A;  2OD5 A;  3GWZ A;  3ZN1 A;  2F2E A;  4L5J A;  2ETH A;  5A2Q Z;  4A2U A;  1ZAR A;  4LMY A;  2MH9 A;  2HQR A;  4KFC A;  2E7W A;  4RB2 C;  3KP7 A;  1CF7 B;  4KT5 C;  3EYY A;  1S7A A;  2MLG A;  4CDG A;  2VE8 A;  2YX4 A;  1ZYR F;  3WOD F;  1I27 A;  4Z2Y A;  2IVM A;  2UXX A;  3HOT A;  3RI4 A;  2K86 A;  4WXH A;  4AWX B;  3R6S A;  1XGO A;  3L2C A;  1FT9 A;  1SMT A;  5FD6 A;  1WRJ A;  5TRD A;  4AIJ A;  4M6Y A;  5CVU A;  5JVT A;  1BI1 A;  3FMS A;  2JPB A;  2PFB A;  3Q9V A;  2TDX A;  5K5R A;  1XGN A;  2EV0 A;  2MD5 A;  2IA2 A;  2V1D A;  4PDK A;  3RIR A;  1FY7 A;  3VEP A;  2VXZ A;  5L3B A;  4LLG F;  5ICC A;  3F8C A;  1LEB A;  5JR3 A;  2RC4 A;  1F4K A;  1YQA A;  3KZY A;  1FBU A;  2STT A;  1T6S A;  4U0V A;  1LJ9 A;  1PP8 F;  4YFN F;  1LDJ A;  1LDD A;  3EDP A;  3FWE A;  3TOA A;  3I53 A;  5DCM B;  2OU2 A;  4HF0 A;  2A61 A;  4UHT A;  3RYR A;  2YR2 A;  1YS7 A;  4O6J A;  1AWC A;  4AD9 A;  3BY6 A;  2FMY A;  5FLX Z;  3BRO A;  2ZBK A;  1O3S A;  4RAY A;  3BPX A;  3M7G A;  2L54 A;  4EJV A;  1HW2 A;  4KA4 A;  1J5Y A;  2GZW A;  4LFU A;  3OV8 A;  2O3F A;  3ZMD A;  3KLO A;  3CLO A;  4ZYH A;  1YLF A;  2FF4 A;  5FD5 A;  4EV0 A;  3LAJ A;  4IXA A;  2RV8 A;  1UFM A;  1FPQ A;  4I0A A;  4UV8 A;  2W57 A;  4PCQ A;  2M8E A;  5ILS A;  1YW7 A;  2BE5 F;  5ILV A;  1V3F A;  2OQR A;  1T0F A;  4M73 A;  3HRU A;  4DNC A;  3MQ0 A;  1CGP A;  1H9T A;  3I59 A;  4EVI A;  4HW0 A;  5HDG A;  2R7F A;  1PUE E;  2CFX A;  2R7D A;  4G7H F;  4PGG A;  1FP2 A;  3SQN A;  4L9V A;  3RTR A;  1IUY A;  3GUD A;  4DQ2 A;  2ISY A;  4HX8 A;  2FU4 A;  2G7U A;  2Y48 A;  1G4D A;  5EEH A;  2E1C A;  5TJJ A;  1KGS A;  2KKO A;  4G8X A;  4M9S A;  4WX9 A;  4Y17 A;  2FE3 A;  2AS5 F;  4MQ9 F;  1OYY A;  4RGS A;  3I64 A;  1RNL A;  4UXN A;  4Q4Z F;  3C1D A;  2XV4 S;  5AIQ A;  2XAJ A;  2J5P A;  1TTY A;  5E8I A;  1MDM B;  1ON1 A;  1T38 A;  1D8K A;  1XDS A;  2ESN A;  3ZMU A;  1FSH A;  1O3R A;  3FM5 A;  1OMI A;  5E1Z B;  1OPC A;  1H9G A;  5ICF A;  2LSO A;  3ISP A;  2HEO A;  3WU0 A;  6PAX A;  2FBI A;  4RB0 A;  2DK5 A;  2GQQ A;  3P9I A;  4UVA A;  3F21 A;  4R8H A;  5HS9 A;  2ELH A;  3TGN A;  2OA4 A;  3CUQ C;  3R0J A;  2XKP A;  1ZRE A;  4CHU A;  4HLX A;  1S3J A;  4R79 A;  4H0E A;  3ZMZ A;  3P9K A;  2L01 A;  4KN7 X;  4TV7 A;  2VOP A;  4EJW A;  4I2O A;  1FZP B;  4G94 A;  5D6E A;  1B9N A;  3JAM Z;  5J8F A;  2RN7 A;  3FXR A;  4LD5 A;  2WTE A;  4MHG A;  2JT1 A;  1X3U A;  4P9U A;  3HSE A;  5J8C A;  2D1H A;  2NS0 A;  1HXD A;  1Z7U A;  3TQN A;  4GYG A;  2QLZ A;  5L3E A;  5DDG A;  3OOP A;  1ZN2 A;  3WTT C;  3S2W A;  4AVP A;  1REP C;  2EFQ A;  3N97 A;  3HIF A;  2HS5 A;  1R58 A;  2VBZ A;  1KYZ A;  2G7H A;  2NYX A;  3CTA A;  4L9J A;  4FHT A;  3GZ5 A;  3BWG A;  5HDN A;  4G6Q A;  4N0B A;  4HV5 A;  2XGX A;  2VOO A;  1ZG3 A;  4GGG A;  5LEJ A;  3MEX A;  2GIV A;  2XAH A;  1HKQ A;  1KQ0 A;  1TQP A;  2H27 A;  2DFI A;  1QNT A;  1IZ1 A;  3WTW C;  3DQV C;  2FBK A;  5DCM A;  3DFG A;  2CO5 A;  4XSX F;  3WGG A;  2ADU A;  2EV5 A;  3EUH A;  3HHG A;  1HW1 A;  4UUV A;  2ZFW A;  4D0P A;  3IC7 A;  1IRF A;  2WWY A;  3GF2 A;  2RVC A;  2QWW A;  2CYY A;  4LB5 A;  4K2E A;  2K27 A;  2P4W A;  5EEG A;  1R1V A;  4MEY F;  1KYW A;  1EH6 A;  5LBQ A;  4GYI A;  3Q9S A;  2H6C A;  4ZYG A;  4G9Y A;  5K5Q A;  1LDK B;  2CSO A;  3V7R A;  5IT9 K;  2XIG A;  2F5D A;  2D1V A;  2K02 A;  2MLK A;  1KQ9 A;  2DPD A;  4WF2 A;  4UV9 A;  1I1S A;  2FRH A;  3BJA A;  2FEZ A;  3F8B A;  3GVA A;  2LF7 A;  4LLL A;  2MBF A;  2ESH A;  4G7Z F;  3WTS C;  2ZJ2 A;  5D4R A;  3U9G A;  2IA0 A;  3I0T A;  3T5X A;  1R36 A;  4MNU A;  3EYI A;  4KNY A;  4E70 A;  3WGI A;  4KYW A;  3E3V A;  1ZGJ A;  1BC8 C;  1I5Z A;  4U88 A;  1T39 A;  1U6G A;  1WWX A;  5D5X B;  2V1U A;  2NNY A;  4EGY A;  2PMH A;  4LB6 B;  2VOD A;  4QWQ A;  1UCR A;  4JQF A;  4LK0 F;  4OMZ A;  1MGT A;  2J5O A;  4BYY A;  1KA8 A;  2FQ3 A;  4P55 A;  2W24 A;  3O2P E;  5ILU A;  3R0A A;  1GXQ A;  1BI0 A;  4ETS A;  4OOI A;  3DP7 A;  1R5G A;  3ULQ B;  2VC1 A;  4NB5 A;  4RB3 C;  1RUN A;  1ZG5 A;  3K1P A;  3GFL A;  3T1B A;  1EH7 A;  4YII A;  1YIO A;  2M5W A;  1IXS B;  2C6Y A;  3I4P A;  3J81 K;  4ZYD A;  2K4J A;  3CO7 C;  1UST A;  2A69 F;  5LGT A;  1W5S A;  1U3E M;  3GEZ A;  4BNC A;  3M1E A;  4XRF A;  2HWV A;  2EFP A;  1Z1D A;  5IT3 A;  4QLC U;  5JI6 A;  3LQR A;  3RPQ A;  2UZK A;  2FSW A;  4ASN A;  1JXS A;  1WI9 A;  5FO5 A;  4G6D A;  1SFU A;  1FYK A;  2RGV A;  2Q2E A;  2P5V A;  2KJC A;  1ZH5 A;  3E97 A;  2DW4 A;  1WQ2 A;  2RQP A;  1RZ4 A;  1IW7 F;  5BOX A;  1IN6 A;  3W6J B;  3J80 K;  2PBI A;  2GXB A;  3V8K A;  4P5O A;  1JE8 A;  3ZN0 A;  4CXF A;  5E18 F;  3QRF F;  3C18 A;  3WE2 A;  2EFN A;  1R5H A;  1XGM A;  2VBY A;  1BIB A;  2HTS A;  4HX7 A;  2ZNZ A;  3HRM A;  2XVC A;  4L18 B;  5DEQ A;  4CYD A;  1QO0 D;  4U7B A;  2L02 A;  3DF8 A;  1XD7 A;  4HLY A;  2L3D A;  2L4M A;  2ZCW A;  5ERI A;  2KIU A;  3QP5 A;  3BDD A;  2M1B A;  1P4W A;  2V6C A;  2W84 A;  2DBB A;  2QQA A;  4KIB A;  3U2R A;  3GFM A;  1TQI A;  4Y13 A;  3GZ6 A;  2Y0M A;  3P9C A;  1JGS A;  3ERE D;  2BV6 A;  2XUB A;  1YS6 A;  2CW0 F;  4RGX A;  4UVC A;  2EB7 A;  2QUF A;  3ZP5 A;  1HKT A;  1P92 A;  2PG4 A;  2PJP A;  2HOE A;  3E5X A;  4FX4 A;  1XGS A;  1FC3 A;  3QAH A;  4ENJ A;  1SD6 A;  3KCC A;  1XDU A;  2GWR A;  1K78 A;  4I02 A;  4ESJ A;  3E5U A;  3LQQ A;  1W7P A;  2F5F A;  4F7Z A;  1O7L A;  1GHC A;  2PQ8 A;  1BJA A;  4ESF A;  2XKO A;  2IA1 A;  3JW4 A;  3O3K A;  2XAS A;  3M8F A;  3F8M A;  3KP6 A;  1XMK A;  5D4S A;  3FXQ A;  1I6X A;  4IF4 A;  4Q5S F;  1IF1 A;  3F6O A;  1BI3 A;  1UHW A;  2OZ6 A;  5DUI A;  1W7P B;  3HYI A;  4YIF A;  4XLN F;  1W7P D;  5JHU A;  3T8R A;  1USS A;  1MKM A;  1F5T A;  2COM A;  2M30 A;  3HSR A;  4YFX F;  1FX7 A;  4MGR A;  5BPI A;  2PN6 A;  2Z9O A;  1S7O A;  3F72 A;  3V7S A;  2VE9 A;  2NAZ A;  3F6V A;  1O57 A;  3CJN A;  1W4M A;  3GX4 X;  4WCG A;  1OYW A;  3LFK A;  3NQO A;  4HV6 A;  3ZMV A;  1MJA A;  1J7K A;  1ONV A;  3O6B B;  1HBX G;  2YX7 A;  3JTH A;  2QVO A;  4HX4 A;  4MTE A;  1S29 A;  3VOE A;  3TO9 A;  1U5T B;  1Z91 A;  2GA2 A;  2UWM A;  1IN5 A;  4EMS A;  4P9F A;  3F3X A;  2HZT A;  3F8N A;  1TBX A;  2VON A;  4OIR F;  1DPU A;  3IWF A;  1BI2 A;  4KUM A;  3CUQ B;  4HZF A;  4ZH4 F;  4CO8 A;  2W25 A;  1B6A A;  2A6E F;  3B73 A;  2IP2 A;  5DD8 A;  1CF7 A;  1SD7 A;  4XSZ F;  3HRT A;  1KQ8 A;  4B8X A;  5A2Q K;  3HRS A;  1VTN C;  5L3F A;  2Z3Y A;  2X0L A;  5CVJ A;  2ISZ A;  2D2W A;  1U8R A;  2KIM A;  3GLX A;  5JFR A;  1J2X A;  2P6S A;  2JTV A;  4RGU A;  3HTS B;  1P4A A;  2Z5U A;  4IRI A;  1S8N A;  1QQI A;  2HR3 A;  4IHS A;  1R1U A;  1DUX C;  3VFZ A;  4AIK A;  1J75 A;  1EH8 A;  1H0M A;  1C0W A;  2Z99 A;  1E2X A;  1WKM A;  1YW9 A;  4FX0 A;  4A5N A;  4M74 A;  3WTX C;  5E1W A;  1SFE A;  5BPD A;  4Y15 A;  4A0Y A;  4CGZ A;  1YYV A;  3IWZ A;  3K1N A;  4HYE A;  2DO7 A;  1T98 A;  4A0X A;  3H3U A;  3QU3 A;  3V4G A;  3HHH A;  1ZHF A;  2HDC A;  2FXA A;  2GXG A;  1SMY F;  1GXP A;  1ZLK A;  2KJB A;  3JAM K;  1KU9 A;  2HKO A;  1QZZ A;  3FXU A;  3BPV A;  3BJO A;  1ON2 A;  1OYI A;  3CO6 C;  4YG2 F;  1UHM A;  3K69 A;  1FBQ A;  3TO7 A;  4ZZL A;  3D0S A;  1T2K A;  4XLP F;  1FYM A;  4M6X A;  2FA5 A;  2G9W A;  4KN4 X;  4HQM A;  3BJ6 A;  4HAM A;  2XAF A;  1XSD A;  3CDH A;  3DXJ F;  3I54 A;  4GO1 A;  2RNJ A;  3V8J A;  1FSE A;  1P4X A;  5FGM A;  2EK5 A;  2EFW A;  3BZ6 A;  2HGC A;  4N9H A;  3WTY C;  1YG2 A;  1STZ A;  3WU1 B;  3KZZ A;  4BHP A;  4IRG A;  2A07 F;  4BH9 A;  3PFI A;  2DQR A;  1SFX A;  2A5Y B;  4HF1 A;  4WK8 F;  1RUO A;  2W85 A;  3L9F A;  2O6G E;  2HYG D;  1D5V A;  2Y75 A;  5LEK A;  1U5T A;  4A5M A;  3KLN A;  2YU3 A;  2O0Y A;  1BOA A;  3M9A A;  3NEU A;  2O61 A;  1FLI A;  1ODD A;  1U78 A;  2HFH A;  1L3L A;  2CG4 A;  2FNA A;  5DYM A;  3TOB A;  4CZZ A;  5IT9 Z;  2LDU A;  2PI0 A;  4EM0 B;  3D5L A;  2DAO A;  3H3Z A;  4BQA A;  3QOP A;  5BS6 A;  3LA2 A;  2DLL A;  1DP7 P;  4L9T A;  2EJR A;  5H20 A;  4GXO A;  2FBH A;  2PEX A;  4EQQ A;  2HKX A;  2EWN A;  2ZXJ A;  3SZT A;  4L0Z B;  3FMQ A;  2BBY A;  4HOB A;  3E6C C;  4WWC A;  5CYV A;  2K7L A;  4CIC A;  1FNN A;  4L9N A;  1G6N A;  2ACJ A;  5D8K B;  2XAG A;  5K1Y A;  3SFZ A;  1W5T A;  2IT0 A;  3C3W A;  1QBJ A;  3G3Z A;  1Z6T A;  4KMF A;  2D45 A;  1J59 A;  2WC2 A;  3LWF A;  2RKH A;  1LNW A;  3HSF A;  3WTV C;  3LAP A;  3DEU A;  5D5V B;  4R1H A;  2PMU A;  3TKY A;  2L4A A;  5KVR A;  3SZP A;  4B09 A;  2E7X A;  2VT2 A;  5LHG A;  5E1X A;  1FP1 D;  3T0Y A;  1P6R A;  2P5K A;  3I59 B;  3ZMT A;  5F1R A;  2Z33 A;  4HF2 A;  4ENK A;  2WV0 A;  1QGP A;  1TNS A;  3BOQ A;  3R4K A;  1F1Z A;  2O8X A;  5ICG A;  1IRG A;  3WTZ A;  1XN7 A;  3K1M A;  4M71 A;  2DT5 A;  1MD0 A;  3MFK A;  2M45 A;  1SD4 A;  1MJ9 A;  3HUG A;  1IN7 A;  1U2W A;  2XRN A;  2EA4 A;  3C7J A;  1RI7 A;  4Q47 A;  3IRQ A;  5CJ9 A;  1WSU A;  5HS7 A;  2QQ9 A;  3ZPL A;  2LNB A;  5CVR A;  3KP5 A;  3Q5F A;  1LVA A;  3V8L A;  1R23 A;  2OAZ A;  3WE3 A;  4RB1 A;  4I7H A;  1S6L A;  4ENN A;  2MH2 A;  4EM2 A;  3JSO A;  5HLH A;  2QM3 A;  3ZMS A;  3IHU A;  1BC7 C;  5HLG A;  3E6B A;  2MC3 A;  1AOY A;  1ZLJ A;  3HTU A;  5J6X A;  1YFH A;  4GCV A;  2DK8 A;  1A04 A;  3LA3 A;  3M8E A;  3VB2 A;  5D5W B;  4ZYE A;  3GFJ A;  2BEO A;  2XAQ A;  3F23 A;  1G3S A;  4P96 A;  2IRF G;  3T8T A; 
#chains in the Genus database with same CATH topology
 4RM3 A;  4JOM A;  1HF0 A;  2Y30 A;  1OKR A;  2XPU A;  2V6E A;  1O7F A;  2ZB9 A;  3GTQ J;  2OJE D;  4AYB A;  2AO9 A;  4L0Y B;  1QVU A;  4KDP A;  3L00 A;  1BR1 A;  1ETV A;  1JHH A;  5CVI A;  5BQT A;  3LA7 A;  5FKK A;  1V5F A;  3I58 A;  4NDL A;  3NRV A;  3LST A;  2BGC A;  3GFI A;  4BDZ A;  3KEO A;  2LY2 A;  4BE1 A;  3ABM H;  4Q48 A;  1JGG A;  1GUU A;  4KMU X;  1ZK8 A;  4OMY A;  2DOA A;  1BJZ A;  2DJN A;  4EJU A;  1NK2 P;  2DT6 A;  2CQK A;  3CJR B;  4OIP F;  2JA8 J;  1U5T C;  5BMZ A;  3HOY J;  4U0Y A;  1K7A A;  4UUS A;  1MNM C;  5IP6 A;  5HOO A;  2CWE A;  1LPQ A;  5DD4 A;  4AVZ A;  1BR2 A;  1OIS A;  3PSI A;  4DW6 A;  2QSG X;  1ETW A;  1TL8 A;  2AXT C;  3PUF A;  1O3Q A;  1XSX A;  1I39 A;  1BIA A;  3TP3 A;  3BG9 A;  4LG0 B;  1OCC H;  1BN5 A;  2OPT A;  3GTJ J;  3S1M J;  4A3C J;  5IPA A;  2DA4 A;  1QZY A;  2JRM A;  2ZKZ A;  4KIG A;  4EGZ A;  3OYM A;  2ECC A;  1PDN C;  1J9I A;  2IPQ X;  3LSM A;  5F64 A;  5HVQ C;  1B59 A;  1HDP A;  3FMR A;  4ON0 A;  5KK1 A;  1EV7 A;  1TNT A;  4IJA A;  4O5V A;  4XN3 A;  4CSW A;  2BHZ A;  2M2E A;  3H92 A;  2P5L C;  3ROU A;  1G3T A;  4BXF A;  2DA5 A;  1I1G A;  1U9N A;  2HPI A;  2OZU A;  3DPT A;  4N9I A;  2R7O A;  4M9Z A;  1T0F C;  3TBI A;  2P6T A;  1ZGW A;  3GTM J;  4M3D A;  5CKT A;  4BBS J;  1DU6 A;  2F5V A;  3KFW X;  5DV5 A;  2MG4 A;  1D0X A;  3IRR A;  2Q1Z B;  3WG7 H;  2YPR A;  1VND A;  4BUP A;  4OAZ A;  2ZFU A;  3QPH A;  4XM3 A;  2DCE A;  2VC0 A;  2NVU B;  5FLX K;  1F43 A;  3MWM A;  3OYN A;  2A6H F;  2KFD A;  3R61 A;  1ULY A;  4BS9 A;  3B6C A;  1N75 A;  4ZC3 A;  1DU0 A;  5L3D A;  2UXN A;  1XCB A;  1Z6R A;  4BHC A;  5K7F A;  3EQL F;  3BTJ A;  5EG0 B;  3J81 Z;  3RJP A;  1KU7 A;  1WJA A;  4I76 A;  2PJR A;  4BY1 J;  4JBA A;  3QP6 A;  2AXL A;  2BVM A;  3D5S C;  2H94 A;  5L3C A;  3BR1 A;  3A2K A;  3OS2 A;  4AIH A;  3SFI A;  5IYD J;  2DPU A;  1VQP I;  2W48 A;  4G7O F;  3FK6 A;  3OOU A;  2IXS A;  1D1B A;  1X3W B;  1Z05 A;  2L2O A;  1XPX A;  2XHK A;  3KP4 A;  3L2W A;  1H89 C;  1B4A A;  1WH5 A;  1SD5 A;  1D1A A;  1J09 A;  1R6R A;  1ZGA A;  1MIJ A;  5F08 A;  1FWZ A;  2M0C A;  2L9R A;  3IL2 A;  1Z9C A;  1YX3 A;  3L09 A;  3GXO A;  4PGH A;  1XCV A;  3OYE A;  1WFX A;  1YE9 A;  3RPU A;  2GA1 A;  4W97 A;  3QPS A;  4M6V A;  2DI3 A;  5K7Z A;  1HQC A;  2DTR A;  2IW5 A;  1SC7 A;  2ZO4 A;  1XMX A;  2F4I A;  5K7H A;  2ZNY A;  3CUO A;  4UUS B;  4E4H A;  2EQR A;  4F92 B;  4RA2 A;  1G3Y A;  2GOX B;  2FOK A;  4FE4 A;  2K85 A;  4WXC A;  2CUF A;  4XBF A;  1IO2 A;  1WJE A;  1MBE A;  4E7K A;  4YRV A;  3MZ8 A;  1DGW Y;  4A6D A;  1DQU A;  1FOK A;  4FT8 A;  2EIM H;  4RLF A;  3TDU C;  1SAX A;  5FFX A;  3HZJ A;  4IHY A;  4E7Z A;  4YEL A;  2NVQ J;  4PJJ A;  1V5E A;  5LHH A;  3R60 A;  4CZC A;  2CV0 A;  3CDI A;  4A3M J;  3KET A;  2P8T A;  4IHT A;  5HLI A;  3SXY A;  1OR7 A;  3P7N A;  3AG3 H;  1FBS A;  3C2B A;  2Q0O A;  4J19 A;  4Z6Y A;  2EZL A;  3M8J A;  3B02 A;  3E0J B;  2W7N A;  3GO5 A;  2WB1 A;  2BW3 A;  3QPT A;  3K6G A;  5AON A;  3RYP A;  5DTD A;  4JK1 X;  2Q8K A;  1HDD C;  1LFB A;  1P2F A;  2DOE A;  2JVH A;  2EA2 A;  5IP7 J;  5JLX A;  1YO5 C;  4EJT A;  3I5U A;  2V1X A;  4KIC A;  1IN8 A;  3TO6 A;  1ZAO A;  2NS7 A;  4IVN A;  4HDU A;  1L0O C;  5L3G A;  3QU6 A;  1TW2 A;  2R3S A;  2NRA C;  4AC0 A;  2EZI A;  2RQQ A;  5HDK A;  4IRH A;  1T8I A;  3E1S A;  5LGN A;  3KP2 A;  1IXR C;  4LLN A;  3OL4 A;  4BAY A;  3JRF A;  4KIF A;  2F5C A;  2ZXH A;  1LQ1 A;  4LK1 F;  5HNF A;  3EET A;  5FLM J;  2DOF A;  3CUQ A;  3UNG C;  4NHJ A;  2ZME A;  1QHH D;  1NK3 P;  2FNP A;  2O03 A;  3PM1 A;  1MBG A;  2BY0 A;  4DJA A;  5K5O A;  5E3O A;  2XAU A;  3REO A;  4A6E A;  1M1E B;  2CQQ A;  4PFP A;  4BKX A;  3FK7 A;  3VOD A;  4BL0 B;  4MTD A;  1V4R A;  5FJ8 J;  3KP3 A;  3FX3 A;  4YFK F;  4A3B J;  3WTU C;  2X48 A;  1IGN A;  5HS8 A;  1IN4 A;  1K61 A;  3ELK A;  3WG9 A;  2NVY J;  4OWR B;  4XKV A;  1Z3Y A;  5B1A H;  3H0D A;  4XNF A;  2JZY A;  3H9G A;  3H5A A;  2OF7 A;  1VFC A;  1P7J A;  1CQT A;  3WGH A;  2GAU A;  3GCM A;  4GFB A;  4UNO A;  2DOD A;  3QYE A;  2JA6 J;  3PSF A;  2X9D A;  4B47 A;  1S9H A;  3DKW A;  2ZC2 A;  4KIS A;  4PZJ A;  5LGU A;  1MZB A;  1SVL A;  2VPR A;  1TLH B;  4PJN A;  4HA8 A;  4CCN A;  2LTP A;  3HKZ N;  4QIW N;  2P7C B;  3J7A O;  2L0K A;  3RCO A;  4XRS G;  1KU2 A;  1K83 J;  1HSJ A;  2HYF A;  1TQM A;  2JA2 A;  4B3A A;  1PP7 U;  2LKP A;  4EM1 A;  1HKS A;  5ICE A;  1XTA A;  3HG9 A;  3K2Z A;  1TWA J;  2NOG A;  3VYT B;  5BNG A;  4JX5 A;  1Z0X A;  4BJ6 C;  2Z16 A;  4CH7 A;  2DXI A;  3TP0 A;  1I3A A;  3K4M A;  3L7W A;  1Y0U A;  2R5Z B;  4RGR A;  1R1T A;  3K4C A;  3TDZ C;  2N8G A;  3SHF A;  3RKY A;  4ZTF A;  1LB2 A;  5AIP A;  2Z2S B;  4BU2 A;  2YSR A;  4MEX F;  1JUS A;  3DBR B;  4E7I A;  2CUJ A;  3DWL E;  3S8P A;  1FYL A;  1D1C A;  3ZQ7 A;  1ZRD A;  3ECH A;  1J0R A;  2JSC A;  2VBW A;  3A01 B;  1ZRF A;  5GTI C;  1UHS A;  2VT3 A;  5D8L B;  2MFZ A;  4XMY A;  3HOW J;  1IXC A;  2KT0 A;  5LRR A;  1JHF A;  4XOT A;  3RKW A;  3ZR8 X;  1ETO A;  4XL9 A;  3MZH A;  3KZI C;  3MZY A;  4M3E A;  3F22 A;  1LEA A;  2DT7 B;  2DU9 A;  3UKG A;  4EJO A;  2VIX A;  4A0Z A;  2NVX J;  2BYV E;  4L5I A;  2IS6 A;  2KQR A;  4OIQ F;  1MMN A;  4NQW A;  1UB9 A;  4BQO A;  3SJM A;  3E6M A;  1EKE A;  4MFD A;  1D8J A;  3ZOB A;  3OIO A;  2RRE A;  2BW3 B;  2QZ8 A;  3N4M A;  3OR2 C;  2CGP A;  2CU7 A;  4XIC A;  4EEF G;  4BEH A;  2XGC A;  4ZDO A;  4I01 A;  3JTG A;  2LH9 A;  3LFU A;  1XMA A;  2EV6 A;  2F48 A;  5ED4 A;  2R7V A;  1U9O A;  2HQN A;  1BOB A;  1VZ0 A;  2I8D A;  1ZG1 A;  2A3S A;  3RQ4 A;  1T56 A;  4CUG A;  5CLS A;  3DV8 A;  4ZZD A;  1TT5 B;  3ECO A;  2XSJ C;  1R22 A;  3FZV A;  2NNN A;  1W5C C;  5CVV A;  1NG6 A;  3MAJ A;  4BHB A;  2KRF A;  2X6W A;  3J7A Y;  2A68 F;  3V7C A;  3J80 Z;  3COA C;  4BXU A;  1XB4 A;  1HW5 A;  2FUG 2;  3GW2 A;  1ETY A;  2XGD A;  1GVJ A;  2ZME B;  4S05 A;  1R7J A;  2X4H A;  4EAT A;  3DPL C;  4DIQ A;  3FHN A;  2VBX A;  2LK2 A;  1RRJ A;  1FIP A;  2RDP A;  4KIT B;  2DTZ A;  2Q2E B;  2VXD A;  2STW A;  2V79 A;  2M87 A;  3HC7 A;  5DCF A;  3ABT A;  5F6F A;  3K4B A;  3PQJ A;  3U1D A;  1Q1H A;  4S0H B;  2FJ1 A;  3GYH X;  4OIN F;  1MMA A;  4ENM A;  1DPR A;  1XSV A;  3S15 J;  4MQV A;  1B9M A;  3JSP A;  4NUB A;  4G6T B;  1JKP C;  1XG1 A;  2MD0 A;  3T8T A;  4BE0 A;  4CCM A;  4M9X A;  2VUM J;  1IAW A;  1HA8 A;  2FML A;  2QBY B;  2F5E A;  3PIO F;  3CCV I;  3IAS 2;  4FCY A;  3OYG A;  1R00 A;  2E1M C;  1KU3 A;  2OQG A;  5D5U B;  2QKM B;  5F04 A;  4HDV A;  1IG7 A;  1HST A;  2VLA A;  2WY7 Q;  1MND A;  5F1J A;  2JPC A;  2LF8 A;  3I71 A;  3PQK A;  3G73 A;  2PLY A;  4JYK A;  3FIS A;  3KEQ A;  3Q0V A;  3FHZ A;  2KIF A;  1SVO A;  5H6R A;  3E6D A;  5GAD J;  3PO3 J;  2LKS A;  2VQH A;  4O3M A;  1FOX A;  3FF5 A;  5LRS A;  2BZT A;  3W6K B;  4WXD A;  4HNT A;  1BBY A;  3LSK A;  5FB2 A;  1LE8 B;  3OL3 A;  3BC8 A;  3IKT A;  4D7M A;  5E8G A;  2OBP A;  2DMP A;  1MMS A;  5EEA A;  3HOS A;  1ZRC A;  3KYD B;  3BR0 A;  2XF5 A;  2R5Y B;  1MJB A;  3L2Q A;  3G1O A;  4NNJ A;  1D3Y A;  1G59 A;  1NHA A;  4F52 A;  2BXY A;  1O4X A;  3D1N I;  2FD5 A;  3M4O J;  1N25 A;  1F9N A;  4LG0 A;  2HTJ A;  4QPQ A;  5EYR A;  2KPM A;  3HGG A;  4JP0 A;  5J1U A;  2VJJ A;  2M8G X;  2X51 A;  2DQL A;  3F8F A;  1K78 B;  3I4M J;  2VN2 A;  3OSF A;  5E17 F;  2E1O A;  3K9T A;  3S2H J;  2B0L A;  4HBL A;  5D6F A;  5HNH A;  4OIO F;  4RAZ A;  4A12 A;  4BGD A;  2XRO A;  2QSF X;  4S04 A;  2XB0 X;  3OMY A;  5E20 A;  2P7V B;  4I0B A;  3NWS A;  4PFO A;  3IKV A;  1YTY A;  1B1B A;  3E5Q A;  3IV5 A;  4U0W A;  1BM9 A;  3FKI J;  4C3I J;  3ASO H;  5CQE A;  4IX7 A;  3RDI A;  4LGW A;  2K5C A;  4A3D J;  2H09 A;  2CMP A;  5FRO A;  3RQI A;  3HJE A;  5H6Q A;  4I09 A;  4XKC A;  3ML6 A;  5HLT A;  1K6O A;  4M3B A;  4I98 B;  3LSR A;  2BVL A;  3HM5 A;  2JSP A;  1UAA A;  2KZV A;  2QQB A;  3VDX A;  3K0L A;  4HG2 A;  3BP8 A;  2Y9Y A;  3CQZ J;  3FM3 A;  2R7Z J;  1JJ8 C;  3S3M A;  3QPL A;  2GIZ A;  2HZD A;  1IUF A;  1TW3 A;  3RKX A;  3WHC A;  1MSF C;  3K2A A;  1K79 A;  4OU0 A;  2JRT A;  4UVB A;  2MAB A;  5LLQ A;  5KCM A;  3RKQ A;  2EZH A;  4B43 A;  3BG5 A;  1PYV A;  4N4O B;  3OS0 A;  2ZXW H;  4LJZ F;  4XON A;  4ZDP A;  3AAF A;  2QKL B;  4C2M J;  2X1E A;  3ABU A;  1E17 A;  2TCT A;  4U7D A;  4IPA A;  2A5W A;  1RIO H;  2E1N A;  3MKW B;  2LRD A;  1PUF A;  2V9V A;  5F0C A;  1O3T A;  4AU7 A;  5FFZ A;  4F55 A;  3A03 A;  2CS3 A;  2JA7 J;  3OY9 A;  1G3W A;  2MC4 A;  3Q0U A;  2IJL A;  1MDM A;  5DUK A;  2ME6 A;  4HQE A;  2L7K A;  2QBY A;  1IDY A;  1DDN A;  2Y0S N;  5LHI A;  2MA3 A;  4M72 A;  2QYO A;  5GPC A;  1YW8 A;  2K4B A;  2VJI A;  1R4M B;  5FKO A;  4KT6 A;  3KE2 A;  1S72 I;  1H8A C;  5HOD A;  1UZC A;  3S14 J;  4RS8 A;  2H6B A;  3MCZ A;  2EFO A;  1QPM A;  4ZYA A;  3S32 A;  2DMU A;  2QEN A;  4ESB A;  2OD5 A;  3CLQ A;  3GWZ A;  3ZN1 A;  2F2E A;  4L5J A;  3OR1 C;  2ETH A;  5A2Q Z;  1S5L C;  4A2U A;  3OYB A;  1ZAR A;  3DLA A;  4LMY A;  4V2G A;  1VQ9 I;  3S1N J;  3LL7 A;  5LD2 C;  2MH9 A;  3HOV J;  2HQR A;  4KFC A;  1MBH A;  2OTL I;  1HOM A;  2E7W A;  4RB2 C;  3KP7 A;  1CF7 B;  3RZD J;  3S3N A;  4KT5 C;  3C2G A;  3EYY A;  2VPL A;  3PUB A;  2O8K A;  1S7A A;  2MLG A;  4CDG A;  2VE8 A;  3BTI A;  1AHD P;  1ZKG A;  2PJR B;  2ICW G;  2YX4 A;  3FXO A;  1TWG J;  1RR8 C;  1ZYR F;  3ZCO A;  3WOD F;  1I27 A;  4Z2Y A;  3H3V K;  3ZQL A;  1JUP A;  1V5G A;  2IVM A;  2UXX A;  4A3G J;  3A4C A;  3HOT A;  2G0E A;  3RI4 A;  1T08 B;  2K86 A;  4WXH A;  4AWX B;  3R6S A;  4BEH B;  1XGO A;  1YJ9 I;  3L2C A;  1LVK A;  3DBL B;  1FT9 A;  1SMT A;  2LFB A;  3FIW A;  5FD6 A;  1WRJ A;  5TRD A;  2HVR A;  4AIJ A;  4M6Y A;  5CVU A;  5JVT A;  2CQ7 A;  1BI1 A;  2KDO A;  2XF6 A;  3FMS A;  4XRM A;  2JPB A;  2PFB A;  3Q9V A;  2TDX A;  5K5R A;  2E1M B;  2IS4 A;  2K9S A;  2IAI A;  2JQ7 A;  3DPU A;  1XGN A;  4CCK A;  2EV0 A;  2MD5 A;  2IA2 A;  2V1D A;  4PDK A;  1VQ6 I;  3RIR A;  2I10 A;  1FY7 A;  3VWB A;  3VEP A;  2VXZ A;  5L3B A;  3LSH A;  2KZG A;  3JRC A;  1Y1W J;  4LLG F;  3BZK A;  5ICC A;  2W82 A;  2HOA A;  3F8C A;  1LEB A;  5JR3 A;  2O5R A;  1GVD A;  2RC4 A;  2E5N A;  1F4K A;  1YQA A;  1JT0 A;  1IRZ A;  3KZY A;  3W6V A;  5DM6 F;  1G2H A;  2M4K A;  1FBU A;  2STT A;  1MBF A;  1SAU A;  2VKH A;  1T6S A;  1APL C;  2L5Q A;  5GAG J;  1G8X A;  1LJ9 A;  4U0V A;  1PP8 F;  4YFN F;  2JA5 J;  1LDJ A;  3CJQ B;  1LDD A;  1X4O A;  3EDP A;  3HGY A;  3FWE A;  3TOA A;  3I53 A;  5DCM B;  2OU2 A;  4HF0 A;  2KP6 A;  2A61 A;  3MMY B;  4UHT A;  5KAF C;  1A36 A;  3H0G J;  3RYR A;  4A69 C;  2YR2 A;  1YS7 A;  4O6J A;  1AWC A;  4YEJ A;  2ZJR F;  4AD9 A;  4BBR J;  3L1P A;  3BY6 A;  4A3L J;  2DMQ A;  1TP4 A;  2FMY A;  5FLX Z;  3BRO A;  2ZBK A;  1O3S A;  3FBN B;  3BTC A;  4RAY A;  3DKX A;  3BPX A;  5GPA A;  3M7G A;  2L54 A;  4EJV A;  1YJN I;  2PMZ N;  1HW2 A;  2HXI A;  4KA4 A;  1VQ4 I;  1J5Y A;  2GZW A;  4LFU A;  3OV8 A;  1MBK A;  5JVG F;  4XR6 A;  3KYL A;  2O3F A;  3ZMD A;  2Y69 H;  3KLO A;  3CLO A;  4ZYH A;  3HB9 A;  3NWT A;  2E60 A;  1YLF A;  1Y1V J;  2FF4 A;  2UV1 A;  5C3E J;  5IYC J;  1ENH A;  1Q1V A;  5FD5 A;  4EV0 A;  1OLT A;  2H1L A;  3KYC B;  5EGO B;  3EPZ A;  3LAJ A;  4IXA A;  3W3C A;  2RV8 A;  1E3O C;  1UFM A;  1FPQ A;  4I0A A;  4UV8 A;  2W57 A;  4PCQ A;  5JLW A;  1YI2 I;  2M8E A;  5ILS A;  1MMG A;  4E7S A;  2W1O A;  1YW7 A;  2R7T A;  4MLO A;  5IOY A;  2BE5 F;  5ILV A;  4DGW B;  1V3F A;  2OQR A;  1T0F A;  4M73 A;  4GRI A;  3BT9 A;  3HRU A;  4DNC A;  3MQ0 A;  3ABL H;  1CGP A;  4IQJ A;  1H9T A;  1IV6 A;  1BA5 A;  2R0Q C;  1JTY A;  2E34 A;  3I59 A;  4EVI A;  1X19 A;  3DLL F;  4HW0 A;  5HDG A;  1R71 A;  3DU5 A;  2R7F A;  1PUE E;  1NH3 A;  2CFX A;  1SFK A;  2R7D A;  3DU6 A;  4G7H F;  4N4N B;  2IGN A;  3BQY A;  4PGG A;  4RM2 A;  4IEJ A;  3A02 A;  1FP2 A;  1WI3 A;  3SDB A;  3PIP F;  3SQN A;  3BCA A;  4L9V A;  3RTR A;  4ABZ A;  1IUY A;  2GBY A;  3GUD A;  3CCM I;  3J7Z I;  4DQ2 A;  1IDZ A;  2ISY A;  4HX8 A;  4PJL A;  5J47 A;  3NAR A;  3VYR B;  2FU4 A;  2G7U A;  2XPV A;  2Y48 A;  3E7L A;  1AU7 A;  3CCL I;  3VPR A;  1G4D A;  5EEH A;  5C44 J;  2E1C A;  5TJJ A;  5EGO A;  5J40 A;  1KGS A;  2KKO A;  1K4T A;  4G8X A;  3RPU D;  3OYF A;  4M9S A;  1VQL I;  4WX9 A;  2VKD A;  1JKR C;  3HPH A;  4Y17 A;  3A01 A;  1SVM A;  1ZR2 A;  2FE3 A;  3M3Y J;  3ZRG A;  2AS5 F;  4MQ9 F;  1OYY A;  4RGS A;  3I64 A;  3ONQ A;  2JUC A;  1MH4 A;  1RNL A;  2F4O B;  3CMY A;  4IHV A;  3K4J A;  4UXN A;  4Q4Z F;  3JRA A;  3C1D A;  2R7S A;  3CP8 A;  1WJ5 A;  1E0E A;  2XV4 S;  3SYT A;  3QWL A;  4PSX A;  1MSE C;  5AIQ A;  1A35 A;  2VJ5 A;  1JT6 A;  2XAJ A;  1RPW A;  1Z7L A;  3SEZ A;  3LOC A;  2J5P A;  2CW8 A;  2QCO A;  1OJL A;  1IC8 A;  1A5J A;  1TTY A;  2VQC A;  1QA6 A;  4KJZ A;  1ORK A;  2E2H J;  1KZH A;  5E8I A;  3AL0 B;  1MDM B;  1ON1 A;  1WZ2 A;  1T38 A;  1WCM J;  3U21 A;  2E71 A;  2EIJ H;  1D8K A;  1XDS A;  2ESN A;  3ZMU A;  1B8I A;  4NC6 A;  1ETQ A;  1FSH A;  1O3R A;  3OSG A;  1YRN A;  3FM5 A;  4B3X A;  1OMI A;  5E1Z B;  2ZXI A;  4MO7 A;  2R5Y A;  1OPC A;  3RZO J;  1H9G A;  5ICF A;  2LSO A;  3ISP A;  3DEW A;  3CCU I;  2HEO A;  3WU0 A;  6PAX A;  2FBI A;  4RB0 A;  2DK5 A;  2GQQ A;  3P9I A;  4UVA A;  3DTI A;  2V1N A;  3HBL A;  4RMN A;  3F21 A;  4R8H A;  5HS9 A;  2ELH A;  3LNQ A;  3PNT A;  1RKT A;  3TGN A;  1KON A;  2OA4 A;  3B6A A;  4C3J J;  3CUQ C;  3R0J A;  2XKP A;  1R5I D;  3MKY B;  2R5Z A;  1ZRE A;  4CHU A;  4HLX A;  4XK4 A;  1DP3 A;  2JWT A;  4ZTJ A;  1S3J A;  4R79 A;  2XDV A;  4D7N A;  4H0E A;  3HDD A;  3ZMZ A;  3P9K A;  3CD6 I;  4DYR A;  2L01 A;  3OYJ A;  4KN7 X;  1X2M A;  4TV7 A;  3G6E I;  2VOP A;  4EJW A;  4I2O A;  1FZP B;  4G94 A;  5D6E A;  4BDY A;  1B9N A;  3FKJ A;  3JAM Z;  5J8F A;  2RN7 A;  3FXR A;  4LD5 A;  4BJ5 C;  2ECB A;  2WTE A;  4MHG A;  3IH3 A;  2JT1 A;  1X3U A;  3K70 D;  4P9U A;  3HSE A;  5J8C A;  1B72 A;  2YU9 J;  3L2V A;  2D1H A;  4F93 B;  2NS0 A;  1HXD A;  3C2H A;  2CH0 A;  1Z7U A;  3TQN A;  2ZJP F;  1VQN I;  4GYG A;  1OCR H;  2QLZ A;  2X1D A;  3CF2 A;  5L3E A;  3V42 A;  3H9Q A;  5DDG A;  3GTG J;  3OOP A;  1ZN2 A;  3WTT C;  3QOD A;  3S2W A;  4AVP A;  1REP C;  2CV2 A;  2EFQ A;  4XKW A;  4HSR A;  3N97 A;  1X1A A;  3HIF A;  2HS5 A;  1R58 A;  2VBZ A;  1KYZ A;  2G7H A;  2NYX A;  3CTA A;  4DBR A;  4L9J A;  4FHT A;  2VKV A;  3GZ5 A;  3BWG A;  2XC7 A;  1VQ7 I;  2L7Z A;  5FRM A;  5HDN A;  4G6Q A;  2DFH A;  4N0B A;  4HV5 A;  2XGX A;  2VOO A;  2CUZ A;  4DBQ A;  1ZG3 A;  4GGG A;  5GAE J;  5LEJ A;  1FOW A;  3MEX A;  1R49 A;  2GIV A;  2XAH A;  4L5E A;  1FTZ A;  1HKQ A;  1KQ0 A;  4F3Q A;  1TQP A;  2XSD C;  2H27 A;  2DFI A;  1QNT A;  4I99 C;  1IZ1 A;  3WTW C;  3DQV C;  3HUG B;  2FBK A;  2DDB A;  2QF7 A;  5DCM A;  3DFG A;  1R9T J;  2CO5 A;  4MFE A;  2MSY A;  1GV5 A;  1RET A;  4XSX F;  3WGG A;  3JRG A;  3BG3 A;  3DEE A;  2ADU A;  5C4J J;  2EV5 A;  3EUH A;  3HHG A;  4OAY A;  2LLK A;  1HW1 A;  2E2I J;  4ITV A;  4UUV A;  2HVQ A;  2ZFW A;  4D0P A;  3IC7 A;  1IRF A;  3QQA A;  2WWY A;  3AG1 H;  3GF2 A;  2RVC A;  1X1P A;  2BY3 A;  2QWW A;  2CYY A;  4ANJ A;  4LB5 A;  4LG3 A;  4K2E A;  1BR4 A;  2K27 A;  2P4W A;  5EEG A;  1R1V A;  4MEY F;  1KYW A;  1T33 A;  1EH6 A;  1MH3 A;  5LBQ A;  1Z21 A;  5E3L A;  4GYI A;  3TW7 A;  4Y52 J;  3Q9S A;  1WJF A;  2H6C A;  4FE7 A;  4ZYG A;  2DA6 A;  4G9Y A;  2R92 J;  2OCC H;  3BR5 A;  2WAE A;  3LSJ A;  4E6K G;  5EDN A;  5J4Y A;  4FTH A;  1UMQ A;  1WPK A;  1WHU A;  5K5Q A;  3MD2 A;  1LDK B;  2CSO A;  3PFY A;  1FMV A;  1RR7 A;  3V7R A;  5IT9 K;  2XIG A;  4BE2 A;  1YHQ I;  5IP9 J;  2F5D A;  1ETX A;  2D1V A;  1WVR A;  3LSI A;  1QHG A;  1TT0 A;  2K02 A;  4D5F A;  2MLK A;  2JN6 A;  4F91 B;  1KQ9 A;  1WJD A;  2DPD A;  4WF2 A;  4DZJ A;  4UV9 A;  4BXX J;  1I1S A;  2FRH A;  3BJA A;  3H9J A;  3VYU B;  3VSL A;  2FEZ A;  3F8B A;  3GVA A;  3WU2 C;  2LF7 A;  3JRD A;  4LLL A;  3CC7 I;  3ZQF A;  2LMD A;  4BQQ A;  4IHX A;  2F4M B;  2MBF A;  3GTK J;  2ESH A;  2R7W A;  4G7Z F;  3WTS C;  1U8B A;  2ZJ2 A;  5D4R A;  3EUH C;  3U9G A;  2IA0 A;  1JKQ C;  3I0T A;  3MKL A;  2YS9 A;  3T5X A;  1R36 A;  1V54 H;  1XX5 A;  4MNU A;  4HEA 2;  3EYI A;  4KNY A;  4DYQ A;  2L9N A;  4E70 A;  3WGI A;  4KYW A;  4BY7 J;  4FQG A;  3E3V A;  1ZGJ A;  2WAQ A;  1I5Z A;  4U88 A;  1BC8 C;  1T39 A;  1U6G A;  1WWX A;  5D5X B;  1GT0 C;  2V1U A;  1VQ8 I;  2NNY A;  3CC2 I;  3GZN B;  4EGY A;  2R93 J;  1SFO J;  1JJ6 C;  4AYB N;  2R7X A;  2ID3 A;  2PMH A;  4LB6 B;  2PMZ A;  2HNH A;  5F0F A;  2VOD A;  4QWQ A;  1UCR A;  2LC2 A;  2H1K A;  4XKB A;  3OS1 A;  4JQF A;  4LK0 F;  4OMZ A;  1MGT A;  2J5O A;  3N05 A;  1FEX A;  4BYY A;  1KA8 A;  2EPF A;  2FQ3 A;  2FOW A;  4P55 A;  2W24 A;  3JCU C;  3O2P E;  5ILU A;  2KHM A;  2CV1 A;  4XN0 A;  3R0A A;  4RAG A;  1GXQ A;  1BI0 A;  2L7F P;  4ETS A;  4OOI A;  1TWC J;  3DP7 A;  2WV1 A;  1OCO H;  2K9L A;  1R5G A;  1W0T A;  3ULQ B;  4II2 A;  2VC1 A;  2IBD A;  4NB5 A;  4RB3 C;  3S16 J;  1K4S A;  4HNU A;  1JKO C;  1ZG5 A;  3K1P A;  2X1C A;  3GFL A;  5IOZ A;  1RUN A;  1TWH J;  4PJ0 C;  3T1B A;  1HCR A;  2CQN A;  1EH7 A;  4YII A;  1YIO A;  2M5W A;  3BR2 A;  1IXS B;  2E2J J;  2C6Y A;  3JR9 A;  3I4P A;  3J81 K;  4ZYD A;  2DA1 A;  2K4J A;  3CO7 C;  3HKZ A;  1H88 C;  1X4P A;  1UST A;  2A69 F;  2L7M P;  1W5S A;  5LGT A;  3S2D J;  1U3E M;  3GEZ A;  4BNC A;  3GBG A;  2EIL H;  2E19 A;  3TMO A;  1A6Q A;  2JJ7 A;  2B7E A;  3M1E A;  3G4S I;  2GM4 A;  4XRF A;  2MW8 A;  2HWV A;  4NC7 A;  2WBM A;  2EFP A;  1Z1D A;  5IT3 A;  3OYD A;  4QLC U;  5JI6 A;  5TIS C;  2XRL A;  2E35 A;  3L2U A;  4II3 A;  3LQR A;  3RPQ A;  2HQ5 A;  1UG0 A;  2UZK A;  2WY8 Q;  2AQE A;  2FSW A;  4ASN A;  3AL0 C;  1VF9 A;  3S1R J;  4JX6 A;  1JXS A;  1WI9 A;  2E36 A;  3KPH A;  5FO5 A;  5GP9 A;  2IS1 A;  2M9H A;  4G6D A;  3A1Y A;  4A3I J;  1B72 B;  2W4S A;  1SFU A;  1FYK A;  2RGV A;  3S3O A;  2Q2E A;  2EIK H;  2P5V A;  3ASN H;  2KJC A;  2O7O A;  1ZH5 A;  3E97 A;  1OR7 C;  3BR6 A;  2DW4 A;  1WQ2 A;  1Z67 A;  2RQP A;  3IH4 A;  4AUX A;  4BJT A;  1RZ4 A;  2KIS A;  2X6O A;  1MMD A;  3A0B C;  1IW7 F;  3F9K A;  5BOX A;  5F0H A;  2COB A;  1IN6 A;  3W6J B;  3KIO A;  2QEX I;  3BLY A;  3J80 K;  2PBI A;  3X2Q H;  1W0U A;  2GXB A;  3V8K A;  4P5O A;  3MKZ A;  4DOZ A;  4XOP A;  4V2F A;  1JE8 A;  5M5X J;  2DYR H;  3ZN0 A;  3DBH B;  4CXF A;  3AKZ A;  5GAH J;  5E18 F;  2XB5 A;  3QRF F;  3C18 A;  3WE2 A;  2EFN A;  1R5H A;  1XGM A;  2P0W A;  4NC8 A;  2VBY A;  3OYC A;  4PK4 A;  3QOE A;  4CCL A;  2WB1 N;  1BIB A;  2HTS A;  4HX7 A;  1AKH B;  3AFH A;  2ZNZ A;  3HRM A;  2DDA A;  2XVC A;  4L18 B;  3JRE A;  5DEQ A;  4CYD A;  1QO0 D;  4U7B A;  2M7A A;  1Y39 A;  4RAF A;  2L02 A;  3DF8 A;  1YIT I;  1XD7 A;  4HLY A;  2L3D A;  5CQG A;  2L4M A;  3FXM A;  2ZCW A;  2KRH A;  4CYC A;  3OIP A;  2Y31 A;  5ERI A;  2KIU A;  3A0H C;  3QP5 A;  2LG4 A;  3BDD A;  1EJ9 A;  2R4G A;  2M1B A;  1P4W A;  3OWT A;  2V6C A;  2HDD A;  2W84 A;  1IV8 A;  2DBB A;  3CCQ I;  3SEQ A;  2M0M A;  2VKE A;  2QQA A;  5EG0 A;  3OYA A;  4RDU A;  4KIB A;  3U2R A;  3K4K A;  5M5W J;  3HPG A;  3GFM A;  4UUT A;  4M3F A;  2VJ4 A;  5J1R A;  1TQI A;  1Z3X A;  4Y13 A;  3M07 A;  5EZG A;  1TC3 C;  1N78 A;  3GZ6 A;  1IRX A;  1OCT C;  3TW6 A;  2I5U A;  4XLC A;  3CCE I;  2JUG A;  2Y0M A;  3P9C A;  3GTO J;  1JGS A;  3ERE D;  2BV6 A;  2E5Z A;  2XUB A;  3FXJ A;  3VYS B;  2KLO A;  1YS6 A;  1BL0 A;  2CW0 F;  4RGX A;  4UVC A;  1Y8R B;  2AQF A;  2EB7 A;  2DJI A;  2QUF A;  3ZP5 A;  1HKT A;  1P92 A;  2PG4 A;  2PJP A;  2HOE A;  3E5X A;  4PSW A;  5FKN A;  4IZZ A;  2HOS A;  4FX4 A;  1QVT A;  1XGS A;  4FAS D;  1FC3 A;  3CMM A;  3QAH A;  4ENJ A;  1SD6 A;  3KCC A;  4A3J J;  3HOU J;  1JUM A;  1XDU A;  2GWR A;  5J1Y A;  3ZQH A;  1K78 A;  3CCR I;  1PJR A;  4I02 A;  4B4C A;  3BQZ A;  3ERM A;  4ESJ A;  3E5U A;  3LQQ A;  4RLQ A;  1Y8Q B;  4QTR A;  1W7P A;  2F5F A;  3BG7 A;  3TED A;  4F7Z A;  3H36 A;  3RSN A;  4AM3 A;  1O7L A;  2V4J C;  1GHC A;  2WAQ N;  2NOJ B;  2IGO A;  2PQ8 A;  1BJA A;  2DA3 A;  4ESF A;  2XKO A;  2IA1 A;  3JW4 A;  3O3K A;  2XAS A;  3M8F A;  2JVG A;  3F8M A;  3KP6 A;  3PJR A;  1XMK A;  5D4S A;  4XRS A;  1XS9 A;  4U87 A;  3FXQ A;  4NBQ A;  1ACI A;  1I6X A;  1DGR M;  1I50 J;  3FDY A;  2DN0 A;  1X58 A;  4IF4 A;  3O8H A;  1JTX A;  4Q5S F;  2K40 A;  1IF1 A;  3F6O A;  2LVS A;  1UHW A;  1BI3 A;  2OZ6 A;  2LBF A;  3W2V A;  5DUI A;  1W7P B;  1PUF B;  3HYI A;  1X2N A;  2DMN A;  4YIF A;  3I3L A;  4XLH A;  4XLN F;  1W7P D;  5JHU A;  3T8R A;  3W2A A;  1USS A;  1MKM A;  2EIN H;  1F5T A;  2COM A;  4JX4 A;  2M30 A;  3HSR A;  4YFX F;  3ZGK A;  2LBF B;  1FX7 A;  4MGR A;  5BPI A;  2VAS A;  2PN6 A;  5B3S H;  2Z9O A;  1S7O A;  2DYS H;  4PUS A;  3F72 A;  4CCO A;  4IOC F;  5DM7 F;  3V7S A;  4CA0 A;  2VE9 A;  2NAZ A;  3F6V A;  2ZSI B;  1O57 A;  4A3F J;  3CJN A;  4XLF A;  1W4M A;  2NXN B;  4B48 A;  4V19 K;  3GX4 X;  4WCG A;  1OYW A;  3LFK A;  3NQO A;  2A6T A;  4A3E J;  2K9N A;  3JRH A;  2OV7 A;  5KNL A;  4HV6 A;  5M3F J;  3ZMV A;  1MJA A;  1J7K A;  3K10 A;  1ONV A;  1LFU P;  2ME0 A;  3O6B B;  1HBX G;  2GXA A;  1A6I A;  3QYF A;  2D5V A;  2FQ4 A;  1I3Q J;  2OUM A;  1TWF J;  2QQ8 A;  2YX7 A;  3JTH A;  4HPQ A;  1YIJ I;  2QVO A;  3DTE A;  4HX4 A;  4MTE A;  1S29 A;  3VOE A;  3TO9 A;  4C9Y A;  2HYJ A;  1U5T B;  3CCS I;  1Z91 A;  2HQA A;  2GA2 A;  2UWM A;  1IN5 A;  2EZK A;  4EMS A;  4P9F A;  2WAF A;  3F3X A;  1RKW A;  2HZT A;  1YOV B;  2F6C A;  1ETK A;  2V7F A;  3F8N A;  1TBX A;  2VON A;  4OIR F;  1DPU A;  3IWF A;  1BI2 A;  4UY8 I;  3CES A;  4KUM A;  2VQG A;  3CUQ B;  4HZF A;  4ZH4 F;  4CO8 A;  4IHW A;  2W25 A;  1B6A A;  4D9J A;  2A6E F;  2DA7 A;  2ELK A;  3B73 A;  3ZQQ A;  2IP2 A;  5DD8 A;  4C30 A;  1T95 A;  4A3K J;  1CF7 A;  3BZC A;  2L9V A;  1SD7 A;  4XSZ F;  3HRT A;  1KQ8 A;  4RBO A;  3OYH A;  2X6Y A;  2JK3 A;  3K4N A;  4B8X A;  5A2Q K;  3EUA A;  3HRS A;  4E7H A;  1VTN C;  5L3F A;  1X1B A;  3PL8 A;  2Z3Y A;  4XID A;  2X0L A;  5CVJ A;  1FIA A;  2ISZ A;  2D2W A;  1U8R A;  2KIM A;  3GLX A;  5JFR A;  2KRC A;  4XOR A;  1J2X A;  5GTH C;  2P6S A;  3CME I;  2CFO A;  3LMM A;  1W36 C;  2JTV A;  4RGU A;  1E3H A;  2R7Q A;  5IYB J;  3HTS B;  4Y7N J;  9ANT A;  2IS2 A;  1P4A A;  2Z5U A;  4IRI A;  1ZEL A;  4LIT A;  2HI3 A;  3BG6 A;  1S8N A;  1QQI A;  4LIU A;  2CJJ A;  2HR3 A;  5M5Y J;  4IHS A;  1R1U A;  2OTJ I;  1YJW I;  1DUX C;  3W2W A;  3VFZ A;  2CRG A;  4HST A;  4AIK A;  1YRN B;  1WJC A;  1J75 A;  1EH8 A;  2ELJ A;  5TGT A;  3VSK A;  1V55 H;  1H0M A;  1C0W A;  2Z99 A;  2BY2 A;  2VI6 A;  1E2X A;  1WKM A;  1YW9 A;  4D1Q A;  4FX0 A;  2K3F A;  4A5N A;  2BY1 A;  2K3P A;  2KMU A;  4M74 A;  1P9Q C;  3FBI B;  4GDF A;  4UB6 C;  3WTX C;  3BR3 A;  5E1W A;  3ZQI A;  1SFE A;  5BPD A;  4Y15 A;  3PO2 J;  5E79 C;  4A0Y A;  2LD5 A;  1SEU A;  4CGZ A;  2QGU A;  2IGK A;  1YYV A;  3O8G A;  3IWZ A;  1X1D A;  3K1N A;  1D0Y A;  4HYE A;  3JRI A;  3IUO A;  2DO7 A;  1T98 A;  3PNV A;  2EH3 A;  4A0X A;  2GLO A;  2XGE A;  3H3U A;  3QU3 A;  3D5R C;  3KX2 A;  2KDZ A;  3PNY A;  2H8R A;  2ZSH B;  5FRN A;  3H5N A;  3V4G A;  2DFF A;  3L2R A;  4CYC B;  1U0J A;  3HHH A;  3SZG A;  1ZHF A;  2HDC A;  2W00 A;  2FXA A;  5EZH A;  2GXG A;  3CZ6 A;  1SMY F;  1GXP A;  1ZLK A;  3CF5 F;  3I9V 2;  2KJB A;  3CCJ I;  2R7U A;  1XC5 A;  1KU9 A;  3AG4 H;  5KHD A;  3JAM K;  3IP4 B;  2HKO A;  1ZQ3 P;  1EF4 A;  4QSH A;  1QZZ A;  3FXU A;  3BPV A;  2LOO A;  1SAN A;  3BJO A;  1ON2 A;  1OYI A;  3CO6 C;  4M3G A;  2VB6 A;  5J4V A;  3G2B A;  4Y4R A;  4H4K C;  1UHM A;  3K69 A;  4YG2 F;  4FIS A;  1FBQ A;  2H8W A;  3TO7 A;  4ZZL A;  2BOL A;  1ZTR A;  4IO9 F;  3D0S A;  2V26 A;  1OQY A;  1T2K A;  4IKF A;  2HU9 A;  4XLP F;  2BHY A;  4HNV A;  1FYM A;  4M6X A;  2FA5 A;  2O9L A;  2G9W A;  1ERD A;  2ID6 A;  4YIR X;  4KN4 X;  4HQM A;  3H1C A;  3KEY A;  3BJ6 A;  4HAM A;  3GME A;  2BXZ A;  2IEK A;  4QPO A;  1Y56 A;  2XAF A;  4DZP A;  1XSD A;  3CDH A;  4ZDL A;  1E3P A;  1MW7 A;  3DXJ F;  3DKY A;  3I54 A;  4MIM A;  4C3H J;  2XF7 A;  2RNJ A;  4GO1 A;  3V8J A;  3S93 A;  2P81 A;  1FSE A;  1P4X A;  5FGM A;  2EK5 A;  2EFW A;  3BZ6 A;  1FMW A;  2HGC A;  4N9H A;  3WTY C;  1Y0N A;  1YG2 A;  1STZ A;  2K9Q A;  2X85 A;  2Y0S A;  2QA4 I;  1Y6I A;  3CMA I;  1N77 A;  3WU1 B;  3KZZ A;  4BHP A;  1FOY A;  4IRG A;  5FKM A;  2MYS A;  2A07 F;  3OYL A;  1HLV A;  1LUJ B;  2VL8 A;  4BH9 A;  3PFI A;  3HL2 A;  4IQ4 A;  2DQR A;  1LE8 A;  1SFX A;  5CPR B;  4UB8 C;  3P5J A;  2A5Y B;  2R7R A;  1VQ5 I;  4HF1 A;  2UUZ A;  4WK8 F;  3DCF A;  2B63 J;  2CW7 A;  2W85 A;  1RUO A;  5DS9 A;  1D0Z A;  4X1E A;  4CCJ A;  3L9F A;  2O6G E;  2HYG D;  1UJ8 A;  2Y75 A;  1D5V A;  5LEK A;  1U5T A;  4A5M A;  2JMW A;  3KLN A;  2YU3 A;  2O0Y A;  1BOA A;  3M9A A;  3NEU A;  2O61 A;  1FLI A;  1ODD A;  2M7B A;  2DA2 A;  1U78 A;  2HFH A;  1VQM I;  1L3L A;  2CG4 A;  2HVS A;  3QYB A;  2FNA A;  5DYM A;  4X0G A;  3TOB A;  4CZZ A;  1W1W E;  5IT9 Z;  1EA3 A;  1X1C A;  2CQX A;  2GOM A;  1AKH A;  3CC4 I;  2LDU A;  3LSG A;  2PI0 A;  4EM0 B;  3D5L A;  1VQO I;  2DAO A;  4AID A;  3H3Z A;  4FET A;  4BQA A;  5B1B H;  1TZL A;  1OFC X;  2EBI A;  5KAI C;  1RC9 A;  3QOP A;  3GLL A;  1LKX A;  2LP0 A;  3LA2 A;  2DLL A;  5BS6 A;  1DP7 P;  4L9T A;  4J00 A;  2M4G A;  2EJR A;  1LFP A;  1S7E A;  3FXK A;  4GXO A;  2FBH A;  4W1U A;  5H20 A;  2LYC A;  2PEX A;  3OYI A;  4I6Z A;  1B8I B;  4EQQ A;  2HKX A;  5FKL A;  2EWN A;  2ZXJ A;  3SZT A;  4L0Z B;  3FMQ A;  2BBY A;  4HOB A;  2V9K A;  3F0C A;  5E3N A;  2B9S A;  2RNG A;  3E6C C;  3CP2 A;  4WWC A;  5CYV A;  2K7L A;  3AG2 H;  4X6A J;  4C2T A;  3HOZ J;  1MNE A;  4CIC A;  1A31 A;  5EJC A;  2LRE A;  5E3M A;  3J7Y J;  1FNN A;  4L9N A;  1G6N A;  2ACJ A;  3NAU A;  5D8K B;  4LIV A;  2WAD A;  2XAG A;  5K1Y A;  3SFZ A;  1W5T A;  2IT0 A;  1D5Y A;  3C3W A;  1QRY A;  1UG2 A;  3ABK H;  2HDW A;  1QBJ A;  1VI0 A;  5B5E C;  3G3Z A;  1Z6T A;  2WA0 A;  3LSP A;  1WJB A;  3CJT B;  1RES A;  3CDL A;  4KMF A;  2D45 A;  1J59 A;  2WC2 A;  3LWF A;  2IGM A;  3G71 I;  2RKH A;  1P7I A;  1LNW A;  3HSF A;  3Q0W A;  3WTV C;  4J01 A;  3LAP A;  1GDT A;  3GTP J;  2M34 A;  3CCY A;  3DEU A;  5M3M J;  5D5V B;  4R1H A;  2PMU A;  3TKY A;  2L4A A;  2XPW A;  3K7A J;  5KVR A;  4ZJZ A;  3JRB A;  3SZP A;  2KL4 A;  2LR8 A;  4DYC A;  4B09 A;  2E7X A;  2VT2 A;  1MBJ A;  5LHG A;  5E1X A;  1FP1 D;  3T0Y A;  1P6R A;  2P5K A;  3U1K A;  3OIQ A;  2L9S A;  1OCP A;  5FLV A;  1I6H J;  1NG7 A;  3I59 B;  3ZMT A;  5F1R A;  2Z33 A;  4HF2 A;  4ENK A;  2WV0 A;  1FTT A;  3H5R A;  4LOC A;  2PX9 A;  2Z1D A;  3DTK A;  1HC8 A;  4XLE A;  1QGP A;  3ZXS A;  3ZQC A;  3TL4 X;  2KIQ A;  1TNS A;  3BOQ A;  1NTC A;  3R4K A;  3I56 I;  3S17 J;  3BTL A;  4A93 J;  1F1Z A;  1FJL A;  2K9M A;  3GTL J;  2O8X A;  3K4L A;  5ICG A;  1K6Y A;  1GLN A;  1X3Z B;  1IRG A;  3OYK A;  3FXL A;  3WTZ A;  4B44 A;  1XN7 A;  4Y33 A;  3K1M A;  4M71 A;  3I4N J;  3ZQG A;  1JI8 A;  2DT5 A;  4NQW B;  5IY5 H;  2OCE A;  1MD0 A;  3MFK A;  1AA7 A;  2M45 A;  1POG A;  3M1C A;  1SD4 A;  3WHB A;  1MJ9 A;  3HUG A;  4B1R A;  4E7L A;  1IN7 A;  2LKX A;  3S1Q J;  1U2W A;  2XRN A;  2EA4 A;  3C7J A;  2LY9 A;  4D5C A;  1UEL B;  1RI7 A;  4Q47 A;  4IL6 C;  5F27 A;  3EUK L;  3G1M A;  3IRQ A;  5CJ9 A;  1WSU A;  5C4X J;  2X6X A;  5HS7 A;  1VQK I;  2Y9Z A;  4E7J A;  5B66 C;  1R4N B;  1F36 A;  2QQ9 A;  2YUS A;  4Y3O A;  2HPM A;  3ZPL A;  3HOX J;  2LNB A;  2MGQ A;  3H35 A;  3UR3 C;  5CVR A;  3KP5 A;  3K70 C;  3I55 I;  3Q5F A;  1LVA A;  3V8L A;  5LFA A;  1R23 A;  2OAZ A;  3WE3 A;  2OC6 A;  4RB1 A;  4I7H A;  4P1W A;  2TRT A;  5H2F C;  1S6L A;  4ENN A;  1WGX A;  2MH2 A;  1YX5 A;  4EM2 A;  2QSH X;  1WH7 A;  1QZE A;  2VQL A;  2V9P A;  3JSO A;  1IJW C;  1QU3 A;  2CUE A;  2HOT A;  5HLH A;  2QM3 A;  2M3A A;  3ZMS A;  1ZR4 A;  5EF6 A;  3IHU A;  1BC7 C;  2ZJQ F;  2LY1 A;  5HLG A;  3E6B A;  4G12 A;  3HXL A;  2MC3 A;  3G1L A;  3SDG A;  1GV2 A;  4BAC A;  1AOY A;  1ZLJ A;  4HRI A;  3HTU A;  5J6X A;  1YFH A;  1BW5 A;  2HXO A;  4GCV A;  2DK8 A;  4C2U A;  1A04 A;  3LA3 A;  4PJM A;  2DMT A;  2A05 A;  3M8E A;  3VB2 A;  1OCZ H;  3IH2 A;  5J3L A;  1QPI A;  1BW6 A;  5D5W B;  2DFE A;  4ZYE A;  2Y2Z A;  3GFJ A;  1ITY A;  2BEO A;  3IAM 2;  3Q3S A;  4IOA F;  4BQN A;  3HEF A;  1W36 D;  2XAQ A;  3BCB A;  3F23 A;  2NS8 A;  2RAE A;  5JHF A;  3MVP A;  1G3S A;  2ZME C;  4XLA A;  4P96 A;  3MN2 A;  2FX0 A;  2AHQ A;  3ESW B;  2IRF G;  2NVT J;  4XQF A;  1Z77 A;  1PVE A; 
#chains in the Genus database with same CATH homology
 1OKR A;  1O7F A;  4L0Y B;  4KDP A;  3L00 A;  1JHH A;  5CVI A;  5BQT A;  3LA7 A;  3I58 A;  3NRV A;  3LST A;  2BGC A;  3GFI A;  3KEO A;  4Q48 A;  4KMU X;  4OMY A;  4EJU A;  2CQK A;  4OIP F;  1U5T C;  5BMZ A;  4U0Y A;  1K7A A;  5HOO A;  2CWE A;  5DD4 A;  1O3Q A;  1XSX A;  1BIA A;  4LG0 B;  1BN5 A;  1QZY A;  2ZKZ A;  4KIG A;  4EGZ A;  1PDN C;  1J9I A;  2IPQ X;  5F64 A;  5HVQ C;  1B59 A;  3FMR A;  4ON0 A;  5KK1 A;  1EV7 A;  1TNT A;  4IJA A;  4O5V A;  2P5L C;  3H92 A;  3ROU A;  1G3T A;  1I1G A;  2OZU A;  3DPT A;  4N9I A;  4M9Z A;  2P6T A;  3KFW X;  5DV5 A;  3IRR A;  2YPR A;  3QPH A;  2VC0 A;  5FLX K;  3MWM A;  2A6H F;  3R61 A;  1ULY A;  5L3D A;  2UXN A;  1XCB A;  1Z6R A;  4BHC A;  3EQL F;  3J81 Z;  3RJP A;  1KU7 A;  4JBA A;  3QP6 A;  2AXL A;  2H94 A;  5L3C A;  4AIH A;  2DPU A;  4G7O F;  1Z05 A;  2XHK A;  3KP4 A;  1B4A A;  1SD5 A;  1ZGA A;  1FWZ A;  3IL2 A;  1Z9C A;  3L09 A;  3GXO A;  4PGH A;  1XCV A;  3RPU A;  2GA1 A;  2DI3 A;  1HQC A;  2DTR A;  2IW5 A;  2ZO4 A;  2ZNY A;  3CUO A;  1G3Y A;  4WXC A;  2FOK A;  4XBF A;  4A6D A;  1FOK A;  4FT8 A;  3TDU C;  1SAX A;  5FFX A;  5LHH A;  3R60 A;  3KET A;  2P8T A;  4IHT A;  5HLI A;  3SXY A;  1OR7 A;  3P7N A;  1FBS A;  2Q0O A;  3B02 A;  3GO5 A;  3QPT A;  5AON A;  3RYP A;  4JK1 X;  2Q8K A;  1P2F A;  2EA2 A;  1YO5 C;  4EJT A;  3I5U A;  2V1X A;  4KIC A;  1IN8 A;  3TO6 A;  1ZAO A;  4IVN A;  4HDU A;  1L0O C;  5L3G A;  3QU6 A;  1TW2 A;  2R3S A;  2NRA C;  5HDK A;  4IRH A;  5LGN A;  3KP2 A;  1IXR C;  4LLN A;  4BAY A;  4KIF A;  2F5C A;  1LQ1 A;  4LK1 F;  3EET A;  3CUQ A;  4NHJ A;  2ZME A;  2FNP A;  2O03 A;  5K5O A;  3REO A;  4A6E A;  4MTD A;  3VOD A;  1V4R A;  3KP3 A;  3FX3 A;  4YFK F;  3WTU C;  5HS8 A;  1IN4 A;  3ELK A;  3WG9 A;  2JZY A;  3WGH A;  2GAU A;  4UNO A;  3DKW A;  4PZJ A;  5LGU A;  1MZB A;  1TLH B;  4HA8 A;  2P7C B;  3J7A O;  1KU2 A;  2HYF A;  1HSJ A;  1TQM A;  1PP7 U;  2LKP A;  4EM1 A;  1HKS A;  5ICE A;  3K2Z A;  3L7W A;  1Y0U A;  4RGR A;  1R1T A;  3TDZ C;  3SHF A;  3RKY A;  1LB2 A;  5AIP A;  2YSR A;  4MEX F;  1FYL A;  3ZQ7 A;  1ZRD A;  3ECH A;  1J0R A;  2JSC A;  2VBW A;  1ZRF A;  2VT3 A;  5D8L B;  1IXC A;  5LRR A;  1JHF A;  3RKW A;  3MZH A;  3MZY A;  3F22 A;  1LEA A;  2DU9 A;  4EJO A;  4A0Z A;  2BYV E;  4L5I A;  4OIQ F;  4NQW A;  1UB9 A;  3E6M A;  1D8J A;  2QZ8 A;  3N4M A;  2CGP A;  4I01 A;  3JTG A;  1XMA A;  2EV6 A;  5ED4 A;  2HQN A;  1ZG1 A;  2A3S A;  5CLS A;  3DV8 A;  4ZZD A;  3ECO A;  1R22 A;  3FZV A;  2NNN A;  5CVV A;  3MAJ A;  4BHB A;  2KRF A;  2A68 F;  3V7C A;  3J80 Z;  3COA C;  4BXU A;  1XB4 A;  1HW5 A;  3GW2 A;  2ZME B;  1GVJ A;  4S05 A;  1R7J A;  2X4H A;  3DPL C;  2VBX A;  2RDP A;  2STW A;  2V79 A;  2M87 A;  5DCF A;  3ABT A;  5F6F A;  3PQJ A;  3U1D A;  1Q1H A;  3GYH X;  4OIN F;  4ENM A;  1DPR A;  1XSV A;  4MQV A;  1B9M A;  3JSP A;  4M9X A;  1IAW A;  2FML A;  2QBY B;  2F5E A;  1R00 A;  1KU3 A;  2OQG A;  5D5U B;  4HDV A;  1HST A;  2JPC A;  2LF8 A;  3I71 A;  3PQK A;  3G73 A;  2PLY A;  3KEQ A;  3FHZ A;  2KIF A;  5H6R A;  3E6D A;  4O3M A;  3FF5 A;  5LRS A;  3W6K B;  4WXD A;  1BBY A;  5FB2 A;  3IKT A;  5E8G A;  2OBP A;  3HOS A;  1ZRC A;  1MJB A;  1D3Y A;  1NHA A;  1F9N A;  4LG0 A;  2HTJ A;  2DQL A;  3F8F A;  1K78 B;  2VN2 A;  5E17 F;  3K9T A;  2B0L A;  4HBL A;  5D6F A;  4OIO F;  4RAZ A;  4A12 A;  2XRO A;  4S04 A;  5E20 A;  2P7V B;  4I0B A;  3IKV A;  1YTY A;  1B1B A;  3E5Q A;  4U0W A;  1BM9 A;  3RDI A;  4LGW A;  2H09 A;  5H6Q A;  4I09 A;  3ML6 A;  1K6O A;  4I98 B;  2QQB A;  3K0L A;  3BP8 A;  3FM3 A;  1TW3 A;  3RKX A;  1K79 A;  4OU0 A;  2JRT A;  4UVB A;  5LLQ A;  4LJZ F;  3AAF A;  3ABU A;  1E17 A;  4U7D A;  4IPA A;  1RIO H;  2E1N A;  1O3T A;  2V9V A;  5FFZ A;  1G3W A;  2IJL A;  1MDM A;  5DUK A;  4HQE A;  2QBY A;  1DDN A;  5LHI A;  2MA3 A;  4M72 A;  2QYO A;  1YW8 A;  2K4B A;  3KE2 A;  4RS8 A;  2H6B A;  3MCZ A;  2EFO A;  1QPM A;  4ESB A;  2QEN A;  2OD5 A;  3GWZ A;  3ZN1 A;  2F2E A;  4L5J A;  2ETH A;  5A2Q Z;  4A2U A;  1ZAR A;  4LMY A;  2MH9 A;  2HQR A;  4KFC A;  2E7W A;  4RB2 C;  3KP7 A;  1CF7 B;  4KT5 C;  3EYY A;  1S7A A;  2MLG A;  4CDG A;  2VE8 A;  2YX4 A;  1ZYR F;  3WOD F;  1I27 A;  4Z2Y A;  2IVM A;  2UXX A;  3HOT A;  3RI4 A;  2K86 A;  4WXH A;  4AWX B;  3R6S A;  1XGO A;  3L2C A;  1FT9 A;  1SMT A;  5FD6 A;  1WRJ A;  5TRD A;  4AIJ A;  4M6Y A;  5CVU A;  5JVT A;  1BI1 A;  3FMS A;  2JPB A;  2PFB A;  3Q9V A;  2TDX A;  5K5R A;  1XGN A;  2EV0 A;  2MD5 A;  2IA2 A;  2V1D A;  4PDK A;  3RIR A;  1FY7 A;  3VEP A;  2VXZ A;  5L3B A;  4LLG F;  5ICC A;  3F8C A;  1LEB A;  5JR3 A;  2RC4 A;  1F4K A;  1YQA A;  3KZY A;  1FBU A;  2STT A;  1T6S A;  4U0V A;  1LJ9 A;  1PP8 F;  4YFN F;  1LDJ A;  1LDD A;  3EDP A;  3FWE A;  3TOA A;  3I53 A;  5DCM B;  2OU2 A;  4HF0 A;  2A61 A;  4UHT A;  3RYR A;  2YR2 A;  1YS7 A;  4O6J A;  1AWC A;  4AD9 A;  3BY6 A;  2FMY A;  5FLX Z;  3BRO A;  2ZBK A;  1O3S A;  4RAY A;  3BPX A;  3M7G A;  2L54 A;  4EJV A;  1HW2 A;  4KA4 A;  1J5Y A;  2GZW A;  4LFU A;  3OV8 A;  2O3F A;  3ZMD A;  3KLO A;  3CLO A;  4ZYH A;  1YLF A;  2FF4 A;  5FD5 A;  4EV0 A;  3LAJ A;  4IXA A;  2RV8 A;  1UFM A;  1FPQ A;  4I0A A;  4UV8 A;  2W57 A;  4PCQ A;  2M8E A;  5ILS A;  1YW7 A;  2BE5 F;  5ILV A;  1V3F A;  2OQR A;  1T0F A;  4M73 A;  3HRU A;  4DNC A;  3MQ0 A;  1CGP A;  1H9T A;  3I59 A;  4EVI A;  4HW0 A;  5HDG A;  2R7F A;  1PUE E;  2CFX A;  2R7D A;  4G7H F;  4PGG A;  1FP2 A;  3SQN A;  4L9V A;  3RTR A;  1IUY A;  3GUD A;  4DQ2 A;  2ISY A;  4HX8 A;  2FU4 A;  2G7U A;  2Y48 A;  1G4D A;  5EEH A;  2E1C A;  5TJJ A;  1KGS A;  2KKO A;  4G8X A;  4M9S A;  4WX9 A;  4Y17 A;  2FE3 A;  2AS5 F;  4MQ9 F;  1OYY A;  4RGS A;  3I64 A;  1RNL A;  4UXN A;  4Q4Z F;  3C1D A;  2XV4 S;  5AIQ A;  2XAJ A;  2J5P A;  1TTY A;  5E8I A;  1MDM B;  1ON1 A;  1T38 A;  1D8K A;  1XDS A;  2ESN A;  3ZMU A;  1FSH A;  1O3R A;  3FM5 A;  1OMI A;  5E1Z B;  1OPC A;  1H9G A;  5ICF A;  2LSO A;  3ISP A;  2HEO A;  3WU0 A;  6PAX A;  2FBI A;  4RB0 A;  2DK5 A;  2GQQ A;  3P9I A;  4UVA A;  3F21 A;  4R8H A;  5HS9 A;  2ELH A;  3TGN A;  2OA4 A;  3CUQ C;  3R0J A;  2XKP A;  1ZRE A;  4CHU A;  4HLX A;  1S3J A;  4R79 A;  4H0E A;  3ZMZ A;  3P9K A;  2L01 A;  4KN7 X;  4TV7 A;  2VOP A;  4EJW A;  4I2O A;  1FZP B;  4G94 A;  5D6E A;  1B9N A;  3JAM Z;  5J8F A;  2RN7 A;  3FXR A;  4LD5 A;  2WTE A;  4MHG A;  2JT1 A;  1X3U A;  4P9U A;  3HSE A;  5J8C A;  2D1H A;  2NS0 A;  1HXD A;  1Z7U A;  3TQN A;  4GYG A;  2QLZ A;  5L3E A;  5DDG A;  3OOP A;  1ZN2 A;  3WTT C;  3S2W A;  4AVP A;  1REP C;  2EFQ A;  3N97 A;  3HIF A;  2HS5 A;  1R58 A;  2VBZ A;  1KYZ A;  2G7H A;  2NYX A;  3CTA A;  4L9J A;  4FHT A;  3GZ5 A;  3BWG A;  5HDN A;  4G6Q A;  4N0B A;  4HV5 A;  2XGX A;  2VOO A;  1ZG3 A;  4GGG A;  5LEJ A;  3MEX A;  2GIV A;  2XAH A;  1HKQ A;  1KQ0 A;  1TQP A;  2H27 A;  2DFI A;  1QNT A;  1IZ1 A;  3WTW C;  3DQV C;  2FBK A;  5DCM A;  3DFG A;  2CO5 A;  4XSX F;  3WGG A;  2ADU A;  2EV5 A;  3EUH A;  3HHG A;  1HW1 A;  4UUV A;  2ZFW A;  4D0P A;  3IC7 A;  1IRF A;  2WWY A;  3GF2 A;  2RVC A;  2QWW A;  2CYY A;  4LB5 A;  4K2E A;  2K27 A;  2P4W A;  5EEG A;  1R1V A;  4MEY F;  1KYW A;  1EH6 A;  5LBQ A;  4GYI A;  3Q9S A;  2H6C A;  4ZYG A;  4G9Y A;  5K5Q A;  1LDK B;  2CSO A;  3V7R A;  5IT9 K;  2XIG A;  2F5D A;  2D1V A;  2K02 A;  2MLK A;  1KQ9 A;  2DPD A;  4WF2 A;  4UV9 A;  1I1S A;  2FRH A;  3BJA A;  2FEZ A;  3F8B A;  3GVA A;  2LF7 A;  4LLL A;  2MBF A;  2ESH A;  4G7Z F;  3WTS C;  2ZJ2 A;  5D4R A;  3U9G A;  2IA0 A;  3I0T A;  3T5X A;  1R36 A;  4MNU A;  3EYI A;  4KNY A;  4E70 A;  3WGI A;  4KYW A;  3E3V A;  1ZGJ A;  1BC8 C;  1I5Z A;  4U88 A;  1T39 A;  1U6G A;  1WWX A;  5D5X B;  2V1U A;  2NNY A;  4EGY A;  2PMH A;  4LB6 B;  2VOD A;  4QWQ A;  1UCR A;  4JQF A;  4LK0 F;  4OMZ A;  1MGT A;  2J5O A;  4BYY A;  1KA8 A;  2FQ3 A;  4P55 A;  2W24 A;  3O2P E;  5ILU A;  3R0A A;  1GXQ A;  1BI0 A;  4ETS A;  4OOI A;  3DP7 A;  1R5G A;  3ULQ B;  2VC1 A;  4NB5 A;  4RB3 C;  1RUN A;  1ZG5 A;  3K1P A;  3GFL A;  3T1B A;  1EH7 A;  4YII A;  1YIO A;  2M5W A;  1IXS B;  2C6Y A;  3I4P A;  3J81 K;  4ZYD A;  2K4J A;  3CO7 C;  1UST A;  2A69 F;  5LGT A;  1W5S A;  1U3E M;  3GEZ A;  4BNC A;  3M1E A;  4XRF A;  2HWV A;  2EFP A;  1Z1D A;  5IT3 A;  4QLC U;  5JI6 A;  3LQR A;  3RPQ A;  2UZK A;  2FSW A;  4ASN A;  1JXS A;  1WI9 A;  5FO5 A;  4G6D A;  1SFU A;  1FYK A;  2RGV A;  2Q2E A;  2P5V A;  2KJC A;  1ZH5 A;  3E97 A;  2DW4 A;  1WQ2 A;  2RQP A;  1RZ4 A;  1IW7 F;  5BOX A;  1IN6 A;  3W6J B;  3J80 K;  2PBI A;  2GXB A;  3V8K A;  4P5O A;  1JE8 A;  3ZN0 A;  4CXF A;  5E18 F;  3QRF F;  3C18 A;  3WE2 A;  2EFN A;  1R5H A;  1XGM A;  2VBY A;  1BIB A;  2HTS A;  4HX7 A;  2ZNZ A;  3HRM A;  2XVC A;  4L18 B;  5DEQ A;  4CYD A;  1QO0 D;  4U7B A;  2L02 A;  3DF8 A;  1XD7 A;  4HLY A;  2L3D A;  2L4M A;  2ZCW A;  5ERI A;  2KIU A;  3QP5 A;  3BDD A;  2M1B A;  1P4W A;  2V6C A;  2W84 A;  2DBB A;  2QQA A;  4KIB A;  3U2R A;  3GFM A;  1TQI A;  4Y13 A;  3GZ6 A;  2Y0M A;  3P9C A;  1JGS A;  3ERE D;  2BV6 A;  2XUB A;  1YS6 A;  2CW0 F;  4RGX A;  4UVC A;  2EB7 A;  2QUF A;  3ZP5 A;  1HKT A;  1P92 A;  2PG4 A;  2PJP A;  2HOE A;  3E5X A;  4FX4 A;  1XGS A;  1FC3 A;  3QAH A;  4ENJ A;  1SD6 A;  3KCC A;  1XDU A;  2GWR A;  1K78 A;  4I02 A;  4ESJ A;  3E5U A;  3LQQ A;  1W7P A;  2F5F A;  4F7Z A;  1O7L A;  1GHC A;  2PQ8 A;  1BJA A;  4ESF A;  2XKO A;  2IA1 A;  3JW4 A;  3O3K A;  2XAS A;  3M8F A;  3F8M A;  3KP6 A;  1XMK A;  5D4S A;  3FXQ A;  1I6X A;  4IF4 A;  4Q5S F;  1IF1 A;  3F6O A;  1BI3 A;  1UHW A;  2OZ6 A;  5DUI A;  1W7P B;  3HYI A;  4YIF A;  4XLN F;  1W7P D;  5JHU A;  3T8R A;  1USS A;  1MKM A;  1F5T A;  2COM A;  2M30 A;  3HSR A;  4YFX F;  1FX7 A;  4MGR A;  5BPI A;  2PN6 A;  2Z9O A;  1S7O A;  3F72 A;  3V7S A;  2VE9 A;  2NAZ A;  3F6V A;  1O57 A;  3CJN A;  1W4M A;  3GX4 X;  4WCG A;  1OYW A;  3LFK A;  3NQO A;  4HV6 A;  3ZMV A;  1MJA A;  1J7K A;  1ONV A;  3O6B B;  1HBX G;  2YX7 A;  3JTH A;  2QVO A;  4HX4 A;  4MTE A;  1S29 A;  3VOE A;  3TO9 A;  1U5T B;  1Z91 A;  2GA2 A;  2UWM A;  1IN5 A;  4EMS A;  4P9F A;  3F3X A;  2HZT A;  3F8N A;  1TBX A;  2VON A;  4OIR F;  1DPU A;  3IWF A;  1BI2 A;  4KUM A;  3CUQ B;  4HZF A;  4ZH4 F;  4CO8 A;  2W25 A;  1B6A A;  2A6E F;  3B73 A;  2IP2 A;  5DD8 A;  1CF7 A;  1SD7 A;  4XSZ F;  3HRT A;  1KQ8 A;  4B8X A;  5A2Q K;  3HRS A;  1VTN C;  5L3F A;  2Z3Y A;  2X0L A;  5CVJ A;  2ISZ A;  2D2W A;  1U8R A;  2KIM A;  3GLX A;  5JFR A;  1J2X A;  2P6S A;  2JTV A;  4RGU A;  3HTS B;  1P4A A;  2Z5U A;  4IRI A;  1S8N A;  1QQI A;  2HR3 A;  4IHS A;  1R1U A;  1DUX C;  3VFZ A;  4AIK A;  1J75 A;  1EH8 A;  1H0M A;  1C0W A;  2Z99 A;  1E2X A;  1WKM A;  1YW9 A;  4FX0 A;  4A5N A;  4M74 A;  3WTX C;  5E1W A;  1SFE A;  5BPD A;  4Y15 A;  4A0Y A;  4CGZ A;  1YYV A;  3IWZ A;  3K1N A;  4HYE A;  2DO7 A;  1T98 A;  4A0X A;  3H3U A;  3QU3 A;  3V4G A;  3HHH A;  1ZHF A;  2HDC A;  2FXA A;  2GXG A;  1SMY F;  1GXP A;  1ZLK A;  2KJB A;  3JAM K;  1KU9 A;  2HKO A;  1QZZ A;  3FXU A;  3BPV A;  3BJO A;  1ON2 A;  1OYI A;  3CO6 C;  4YG2 F;  1UHM A;  3K69 A;  1FBQ A;  3TO7 A;  4ZZL A;  3D0S A;  1T2K A;  4XLP F;  1FYM A;  4M6X A;  2FA5 A;  2G9W A;  4KN4 X;  4HQM A;  3BJ6 A;  4HAM A;  2XAF A;  1XSD A;  3CDH A;  3DXJ F;  3I54 A;  4GO1 A;  2RNJ A;  3V8J A;  1FSE A;  1P4X A;  5FGM A;  2EK5 A;  2EFW A;  3BZ6 A;  2HGC A;  4N9H A;  3WTY C;  1YG2 A;  1STZ A;  3WU1 B;  3KZZ A;  4BHP A;  4IRG A;  2A07 F;  4BH9 A;  3PFI A;  2DQR A;  1SFX A;  2A5Y B;  4HF1 A;  4WK8 F;  1RUO A;  2W85 A;  3L9F A;  2O6G E;  2HYG D;  1D5V A;  2Y75 A;  5LEK A;  1U5T A;  4A5M A;  3KLN A;  2YU3 A;  2O0Y A;  1BOA A;  3M9A A;  3NEU A;  2O61 A;  1FLI A;  1ODD A;  1U78 A;  2HFH A;  1L3L A;  2CG4 A;  2FNA A;  5DYM A;  3TOB A;  4CZZ A;  5IT9 Z;  2LDU A;  2PI0 A;  4EM0 B;  3D5L A;  2DAO A;  3H3Z A;  4BQA A;  3QOP A;  5BS6 A;  3LA2 A;  2DLL A;  1DP7 P;  4L9T A;  2EJR A;  5H20 A;  4GXO A;  2FBH A;  2PEX A;  4EQQ A;  2HKX A;  2EWN A;  2ZXJ A;  3SZT A;  4L0Z B;  3FMQ A;  2BBY A;  4HOB A;  3E6C C;  4WWC A;  5CYV A;  2K7L A;  4CIC A;  1FNN A;  4L9N A;  1G6N A;  2ACJ A;  5D8K B;  2XAG A;  5K1Y A;  3SFZ A;  1W5T A;  2IT0 A;  3C3W A;  1QBJ A;  3G3Z A;  1Z6T A;  4KMF A;  2D45 A;  1J59 A;  2WC2 A;  3LWF A;  2RKH A;  1LNW A;  3HSF A;  3WTV C;  3LAP A;  3DEU A;  5D5V B;  4R1H A;  2PMU A;  3TKY A;  2L4A A;  5KVR A;  3SZP A;  4B09 A;  2E7X A;  2VT2 A;  5LHG A;  5E1X A;  1FP1 D;  3T0Y A;  1P6R A;  2P5K A;  3I59 B;  3ZMT A;  5F1R A;  2Z33 A;  4HF2 A;  4ENK A;  2WV0 A;  1QGP A;  1TNS A;  3BOQ A;  3R4K A;  1F1Z A;  2O8X A;  5ICG A;  1IRG A;  3WTZ A;  1XN7 A;  3K1M A;  4M71 A;  2DT5 A;  1MD0 A;  3MFK A;  2M45 A;  1SD4 A;  1MJ9 A;  3HUG A;  1IN7 A;  1U2W A;  2XRN A;  2EA4 A;  3C7J A;  1RI7 A;  4Q47 A;  3IRQ A;  5CJ9 A;  1WSU A;  5HS7 A;  2QQ9 A;  3ZPL A;  2LNB A;  5CVR A;  3KP5 A;  3Q5F A;  1LVA A;  3V8L A;  1R23 A;  2OAZ A;  3WE3 A;  4RB1 A;  4I7H A;  1S6L A;  4ENN A;  2MH2 A;  4EM2 A;  3JSO A;  5HLH A;  2QM3 A;  3ZMS A;  3IHU A;  1BC7 C;  5HLG A;  3E6B A;  2MC3 A;  1AOY A;  1ZLJ A;  3HTU A;  5J6X A;  1YFH A;  4GCV A;  2DK8 A;  1A04 A;  3LA3 A;  3M8E A;  3VB2 A;  5D5W B;  4ZYE A;  3GFJ A;  2BEO A;  2XAQ A;  3F23 A;  1G3S A;  4P96 A;  2IRF G;  3T8T A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...