1WWXA

Solution structure of the ets-domain of the ets domain transcription factor
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
107
structure length
107
Chain Sequence
GSSGSSGSSHLWEFVRDLLLSPEENCGILEWEDREQGIFRVVKSEALAKMWGQRKKNDRMTYEKLSRALRYYYKTGILERVDRRLVYKFGKNAHGWQEDKLSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of the ETS-domain of the Ets domain transcription factor
rcsb
source organism Homo sapiens
molecule tags Dna binding protein
molecule keywords E74-like factor 5 ESE-2b
total genus 17
structure length 107
sequence length 107
ec nomenclature
pdb deposition date 2005-01-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00178 Ets Ets-domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1wwxA01
4RB2C 2HEOA 3BJAA 1IAWA 4IPAA 5JVTA 2OD5A 3KCCA 3KLNA 3R4KA 4M9XA 4HAMA 4AVPA 2IRFG 1Z1DA 5IT3A 4GYIA 1IN8A 1K78B 3KP6A 1HBXG 1YS6A 4WK8F 2V9VA 3REOA 1FSHA 2STWA 3MQ0A 1Z6TA 2LKPA 4UHTA 2UXXA 5IT9K 2P7VB 5DUIA 1GHCA 3C1DA 2FBHA 1W7PB 2PG4A 1QBJA 3KLOA 2P5LC 3HYIA 1XGNA 1R36A 1R1TA 1IF1A 4IRGA 1XSVA 3HUGA 1YQAA 3QP5A 2EFWA 2XVCA 3KE2A 2OZ6A 2QVOA 1ZAOA 1MJ9A 2A61A 2L01A 4HX4A 1SD6A 1BC7C 3JAMK 4HLXA 3N97A 1TQMA 3RKXA 1IUYA 5JHUA 2HFHA 4UUVA 3FWEA 2GIVA 3T1BA 4BHCA 4OMZA 1A04A 4LLNA 3E5QA 2CSOA 4GCVA 4U88A 2MLKA 4EM2A 4CHUA 3T8TA 3IC7A 3HRUA 2L4MA 4KN4X 2H94A 5LGTA 1U2WA 1ZREA 3VB2A 3ZPLA 3QOPA 1XD7A 4LK0F 2ESHA 2CW0F 4EJOA 1I1SA 2FU4A 3K69A 4ENNA 2DI3A 5D6EA 3TKYA 5L3BA 1IXCA 3KETA 2DT5A 2P6SA 1DUXC 4Q5SF 2DFIA 1QZYA 3CDHA 4CDGA 4LLGF 3Q9VA 3KP7A 3E6CC 1O3RA 1MD0A 5JI6A 1KGSA 4BH9A 2OQGA 1ZH5A 3FX3A 3HHGA 2JZYA 2OA4A 2XV4S 2E1CA 1FYLA 5KVRA 2XKOA 2VT2A 1SD5A 2IT0A 2QBYB 1O57A 2MLGA 2HOEA 2F5EA 5LBQA 1TBXA 3T0YA 2XAQA 5CVVA 3GF2A 4M73A 3E6MA 1JHFA 2ZNYA 3WTSC 1BM9A 3QAHA 2O03A 3MAJA 4BYYA 3V4GA 5ICFA 4IJAA 3DQVC 5H6QA 1YLFA 1ZRCA 1USSA 1FYKA 4L9NA 3WTWC 4HX7A 3Q9SA 2QLZA 3GFMA 1LDJA 4GYGA 3I0TA 3R0AA 1YW7A 2M1BA 1UCRA 2D1VA 2V1DA 5E1ZB 3R60A 2A3SA 4N9IA 3KP5A 2HS5A 3LFKA 2OAZA 2W84A 4HA8A 5HDGA 4HDUA 4JBAA 3QRFF 4FHTA 3LQRA 5D5WB 3IWZA 4AWXB 3V8KA 4WX9A 4LGWA 2EV0A 5L3FA 1KU9A 2XAFA 2C6YA 5AIQA 2DPUA 2IA0A 5DCFA 1BN5A 5D4RA 2STTA 5BS6A 4M72A 2RNJA 2MH2A 3F8FA 2YSRA 2EV5A 3GZ5A 5D5UB 3E6DA 5CVIA 4MEYF 1B9MA 3HTUA 3K2ZA 3WTXC 3BJOA 2EJRA 2Q8KA 3CUOA 3SFZA 2X0LA 5TJJA 5E8GA 2D2WA 1RIOH 4O5VA 1ZLKA 3E97A 3LWFA 1UHMA 3V7RA 4A5MA 4L18B 3N4MA 1I6XA 1J0RA 1IN6A 1LB2A 1E17A 3COAC 2KRFA 4EJTA 4ESJA 3G73A 1ZLJA 5DD4A 4XSXF 2IA2A 1H9TA 3IWFA 1RUOA 2XASA 3HRSA 1PUEE 1F4KA 1KU3A 2RKHA 4UVBA 4HW0A 1HXDA 2CGPA 5KK1A 1KU7A 1LVAA 4LJZF 1HKTA 3GLXA 4LB5A 2RDPA 2FEZA 2XUBA 2M5WA 2GA2A 4RB1A 4HOBA 1AOYA 2RGVA 3DF8A 5LEJA 1WKMA 4JQFA 3I71A 2H6CA 4EV0A 3BOQA 4U7BA 1I27A 2DLLA 2PMHA 3ECHA 1LNWA 2L54A 5BPDA 5FFXA 3M8FA 1CF7A 2Z5UA 2VN2A 4RS8A 1XGOA 2ACJA 2GXGA 1EH8A 1FP2A 2FOKA 3D0SA 4S04A 1D3YA 5ICGA 1DPUA 3MZHA 3WTVC 2JT1A 2G7UA 3KP2A 1FBSA 4PDKA 3I4PA 3V8JA 3KP4A 1BBYA 2EA2A 4YFNF 3W6JB 2PLYA 3TOAA 1K78A 4U0YA 2VBZA 1XGSA 4HLYA 3U9GA 3LAPA 5LHHA 1FBQA 4L0YB 2ZXJA 3WGHA 3JTGA 2EA4A 1P92A 2DQRA 1J59A 3GX4X 2XROA 2HKXA 2DQLA 2WWYA 2F5DA 1J7KA 3BPXA 1TQIA 2AXLA 1DDNA 5D8LB 4PGGA 1W7PD 1YS7A 4BQAA 2XIGA 3RYPA 4IHSA 1R23A 3DP7A 4RAZA 2P8TA 2JPCA 2LSOA 2VOOA 4LG0A 4XRFA 3SZTA 2GWRA 1KA8A 3K0LA 3ABUA 2COMA 1PDNC 3H92A 4L9JA 1ON1A 1O3QA 2IJLA 3RKWA 4CZZA 3HSRA 4LG0B 4P9UA 2PBIA 3L2CA 4ZYHA 3EUHA 2V1UA 4M71A 1FYMA 3LQQA 1QGPA 1XB4A 5BPIA 2XAHA 2Z99A 2BYVE 3VEPA 3EETA 1T98A 3EQLF 1XSXA 4HX8A 1LJ9A 4LLLA 4G9YA 2K27A 1J9IA 2VT3A 4KIFA 4OOIA 4OIOF 1SD4A 5FD6A 1LDKB 4AIJA 2YX4A 1ZGAA 3LA3A 3GFLA 2P4WA 3Q5FA 2IPQX 1OYWA 3TDUC 3SHFA 5ILUA 1XMKA 3WTUC 3K1NA 4ON0A 4I7HA 6PAXA 1IN7A 2CWEA 2PI0A 3EYIA 3IHUA 1G6NA 2MBFA 3BROA 5HS7A 3SXYA 4IF4A 1W7PA 3GEZA 4P96A 2YX7A 2CG4A 2GZWA 2BE5F 2DK8A 1TW3A 3DV8A 2CO5A 4I02A 5LLQA 1L0OC 3HIFA 2Z33A 1S8NA 1D8JA 1XMAA 2UZKA 3P7NA 4N9HA 3ZMDA 2CYYA 3FXRA 3TO7A 5ED4A 3FXQA 5H20A 2O3FA 4Z2YA 3J81Z 1W5SA 3DEUA 4PGHA 1FWZA 1JXSA 3F23A 2Y48A 5ICEA 2DW4A 3DPLC 4I01A 3ZMTA 2KKOA 4Q47A 1SAXA 3HHHA 4OIRF 3I58A 5LEKA 3VFZA 4RAYA 1U78A 1LEBA 3F6VA 1V4RA 1IW7F 2P7CB 2W57A 2G7HA 2FRHA 1R5HA 3LA2A 4EVIA 3M8EA 4Q4ZF 1ODDA 5E18F 2KJBA 2FNPA 3I59A 3V8LA 5LHGA 2UWMA 4H0EA 1UFMA 3GW2A 2ZMEA 2D1HA 4HV6A 3AAFA 1RNLA 3IRRA 4RB0A 4XLPF 4EM0B 5HS9A 4EMSA 2IW5A 3K1MA 2H6BA 1TNTA 2OBPA 2Y75A 3I5UA 2FXAA 5D5VB 3JTHA 5EEGA 3FM5A 1W4MA 3WU0A 1T2KA 1RZ4A 5ILVA 2MA3A 1MDMA 3ULQB 5EEHA 4LD5A 1P4AA 3QU3A 2NNYA 3DXJF 2QZ8A 1JHHA 5HLHA 1XCVA 2VXZA 2D45A 2TDXA 3E6BA 3WTZA 3JW4A 5L3EA 3WGIA 4NHJA 3P9KA 4EQQA 1T0FA 3J81K 1H9GA 2O61A 3IKVA 1HKSA 2K86A 2GQQA 1P6RA 2EFPA 2NYXA 1STZA 1WRJA 3L7WA 3E5UA 2V79A 2LF8A 4FX0A 1HSJA 4A0ZA 4UV9A 2DBBA 5BMZA 1DPRA 4ASNA 3LAJA 2F5FA 2PN6A 5E8IA 4G8XA 2A68F 2XAGA 1K79A 4KT5C 3C18A 1MKMA 3I59B 2P5VA 3ZN0A 5CLSA 3KZZA 1ZRFA 4CXFA 2FNAA 1BI1A 2W25A 1OPCA 1G3YA 2Y0MA 4M9ZA 4NQWA 5F1RA 4KIBA 4EM1A 1S3JA 1IN5A 2VONA 4OIQF 1TW2A 4KDPA 2IP2A 3TO9A 1T38A 3KEOA 3IKTA 4UVAA 3P9IA 3DFGA 1YG2A 2JPBA 4XLNF 2NAZA 3VOEA 3J80Z 3WTYC 2OU2A 5FFZA 4U0VA 2W85A 3JSPA 1J2XA 3D5LA 4UV8A 5HS8A 3F6OA 1FNNA 4S05A 1S6LA 2P6TA 3GFIA 3GO5A 5HDNA 3L09A 2WV0A 1R1UA 4I98B 4ETSA 3V7CA 2NRAC 1UB9A 4A0XA 3ECOA 2X4HA 3R0JA 4O6JA 2IVMA 2R7FA 1XN7A 1U5TA 1S7AA 5DDGA 4F7ZA 4ENKA 1I1GA 3J80K 1ZG1A 2HDCA 4OINF 1FSEA 1FY7A 5E17F 1G3WA 1F9NA 3WTTC 3PFIA 4K2EA 3ZP5A 1D5VA 4HF0A 3RPUA 2Z9OA 5LGNA 4Y15A 4RGXA 1HW5A 4DQ2A 3FM3A 3FMSA 4U0WA 5DEQA 3MCZA 1B6AA 4M6YA 1QO0D 4L9TA 1YFHA 2KIMA 3T8RA 2FBIA 1ZARA 4YFKF 2W24A 5CJ9A 5D5XB 3BP8A 2DO7A 2VBWA 1BI2A 3CLOA 3IRQA 5J8CA 3F22A 1OKRA 2FMYA 4OU0A 3V7SA 2XHKA 2A07F 2QM3A 4EJUA 2O8XA 5BOXA 1S7OA 5DCMA 1SFUA 1B1BA 2HQNA 3MFKA 1SFXA 1BIAA 2FSWA 2VBYA 3KFWX 5J6XA 4WXDA 4BAYA 1WWXA 1FC3A 5D8KB 1YTYA 1K6OA 4TV7A 2ZBKA 4ZYEA 4EGYA 2ELHA 3GXOA 5DCMB 3WGGA 2GA1A 4G7OF 2M30A 2VC1A 5JR3A 3H3ZA 1ONVA 2HTSA 2JRTA 2HGCA 4AIHA 3DKWA 3I64A 2EV6A 2O6GE 1XSDA 1SFEA 1X3UA 2EWNA 4HQMA 5LRRA 1KU2A 3I54A 4ZYGA 1P2FA 4A6EA 1VTNC 5L3DA 3B02A 1HSTA 4HBLA 5L3GA 4E70A 4IRIA 2R3SA 3TOBA 2DU9A 4ZH4F 2OQRA 2WTEA 2LF7A 4RGRA 1YO5C 2PFBA 3HSEA 3CUQA 2PMUA 1R00A 3C7JA 4P5OA 4UVCA 1XDUA 1PP7U 4L0ZB 2HYFA 4MHGA 4ESBA 1MDMB 1NHAA 1B4AA 1U8RA 2A6EF 2EB7A 1TLHB 1FX7A 4R1HA 4RGSA 3FF5A 1OR7A 1XDSA 3G3ZA 2ZNZA 1QQIA 4P9FA 2A6HF 2A5YB 3ML6A 4HQEA 3CO6C 4WF2A 4BNCA 5AIPA 1KQ9A 3RJPA 4AIKA 3S2WA 1KYWA 3F3XA 2ZKZA 3QP6A 5D4SA 3ZMVA 4HF1A 3CO7C 2F5CA 1CF7B 3QU6A 2FQ3A 5LRSA 1O3TA 2ADUA 4KFCA 4G6QA 1MJBA 1FZPB 3BPVA 1IN4A 1OYYA 3WODF 1F5TA 2CFXA 2Z3YA 4AD9A 4EGZA 4HYEA 1IRFA 1BOAA 2BGCA 1FOKA 2G9WA 4RGUA 4MEXF 1XCBA 1BI0A 1ZGJA 3B73A 5A2QZ 2MC3A 1HW2A 5CVUA 5HLGA 5A2QK 2QQ9A 1Z6RA 1W5TA 2RQPA 1O3SA 4LK1F 4MNUA 4OMYA 3E3VA 2F2EA 3CJNA 3U1DA 3BWGA 2ZCWA 2H27A 1HW1A 2EFQA 3ERED 3ZN1A 3CTAA 3RDIA 1D8KA 4CGZA 3FZVA 3RKYA 1BJAA 1L3LA 3ZMUA 3OV8A 2DPDA 2ETHA 5K5QA 1DP7P 1BIBA 4MQVA 2YPRA 4G7ZF 1EH7A 5F64A 4WXHA 2ZFWA 4PCQA 3BJ6A 4PZJA 1Z05A 3SZPA 3R6SA 1KQ8A 1EV7A 1YIOA 1J75A 3O2PE 3QPTA 1HKQA 4KN7X 3RI4A 3QPHA 5DD8A 3GUDA 5FLXZ 1TTYA 2ZJ2A 3GVAA 4LFUA 4Q48A 1FLIA 4QLCU 1R5GA 2E7WA 2ZO4A 2XGXA 4I2OA 1SMTA 2B0LA 3K9TA 4I09A 3O3KA 2FE3A 4A0YA 2J5OA 1F1ZA 1ZYRF 3T5XA 4A6DA 4L5IA 3L9FA 1MZBA 1G4DA 5E20A 1ZHFA 4KMFA 5FLXK 2Q2EA 2RC4A 1C0WA 1MJAA 2LDUA 2MH9A 4B8XA 3M1EA 1ZG5A 1LEAA 2WC2A 2EFOA 5FB2A 1T6SA 2HQRA 2Q0OA 1SMYF 1YYVA 1LQ1A 3FXUA 3M9AA 3ABTA 5L3CA 5FO5A 1KQ0A 3MEXA 4ZZDA 4CYDA 1U5TC 3HRTA 2FF4A 3GYHX 1R1VA 2RVCA 4L9VA 5CVJA 5E1XA 1YW9A 3MWMA 3NQOA 2DAOA 1I5ZA 3HOSA 3FHZA 2GXBA 1BC8C 2LNBA 2BEOA 2A69F 4ENJA 1OMIA 4FT8A 5FGMA 3TDZC 3VODA 3RTRA 4ZYDA 2QENA 3WE2A 4EJVA 2E1NA 1FT9A 3WG9A 2FBKA 2JSCA 4OIPF 3PQKA 2KIFA 2J5PA 1SD7A 2RV8A 2ESNA 3NRVA 5LGUA 3ZQ7A 1B9NA 4LMYA 1IRGA 4QWQA 4KMUX 1O7LA 4ESFA 4WCGA 3MZYA 4G94A 2DK5A 4L5JA 4A12A 3F8CA 4HZFA 1AWCA 1ZG3A 5DV5A 1FPQA 3HSFA 1KYZA 4R8HA 4B09A 2XRNA 3ZMSA 3OOPA 3HTSB 2VODA 1LDDA 4ENMA 4KICA 3BY6A 2BV6A 1ULYA 2HZTA 2XKPA 4I0BA 2HR3A 1S29A 1O7FA 5IT9Z 1U5TB 4LB6B 2KIUA 1V3FA 1Y0UA 5E1WA 1GVJA 3GFJA 1WSUA 5K1YA 2K02A 5LHIA 5H6RA 1REPC 2YU3A 3F72A 4MTDA 4KA4A 1XGMA 3ELKA 3L00A 1TQPA 3TGNA 4G6DA 3H3UA 3P9CA 4IXAA 3LA7A 4HDVA 5ERIA 4FX4A 3F8MA 5K5OA 3I53A 4G7HF 2FA5A 4MGRA 1R7JA 3TO6A 1B59A 2AS5F 2KJCA 3FMRA 4M9SA 2VE9A 1WI9A 3RYRA 1OYIA 1J5YA 2ISZA 1IXRC 4MQ9F 2MD5A 3SQNA 3RPQA 3WE3A 1JE8A 4KIGA 4M6XA 1P4WA 4ZZLA 5ICCA 4IRHA 4GGGA 2ISYA 5BQTA 4XSZF 1PP8F 2IA1A 2V1XA 3NEUA 2L4AA 1H0MA 3PQJA 2VOPA 2JTVA 1P4XA 2M87A 1Q1HA 3U2RA 4IVNA 1MGTA 2M8EA 2YR2A 1USTA 4R79A 4NB5A 4YIIA 2ZMEB 3F8NA 5HOOA 4RB3C 3IL2A 3GWZA 1YW8A 4GXOA 2DTRA 1JGSA 3FMQA 2L3DA 4BHPA 1RI7A 5F6FA 2QQBA 2HTJA 5DUKA 4O3MA 4HV5A 4WWCA 1CGPA 2L02A 3GZ6A 3JAMZ 4CO8A 2EK5A 2K7LA 1R22A 4CICA 4MTEA 3TQNA 3DPTA 3KEQA 1GXQA 3KP3A 2O0YA 2RN7A 4U7DA 4P55A 3ZMZA 1E2XA 3CUQC 4KYWA 1FBUA 5FD5A 2FMLA 5TRDA 5HDKA 2OZUA 2P5KA 5HVQC 1ON2A 5ILSA 4A2UA 4UNOA 4YG2F 1QPMA 3RIRA 5JFRA 4UXNA 1U6GA 4N0BA 2GAUA 3R61A 5D6FA 2VBXA 4JK1X 4Y13A 2PJPA 1Z7UA 4I0AA 3EDPA 2K4JA 1IZ1A 1G3SA 4XBFA 2CQKA 2M45A 2PQ8A 2QQAA 2QYOA 1K7AA 1HQCA 2NNNA 3HRMA 4BHBA 3F21A 3W6KB 4D0PA 3WU1B 4KUMA 5AONA 4DNCA 2V6CA 1QZZA 1TNSA 3K1PA 2K4BA 2HWVA 2PEXA 2QWWA 1EH6A 4HF2A 3ISPA 2HYGD 3M7GA 1ZRDA 1U3EM 2XAJA 4Y17A 1R58A 4IHTA 5DYMA 3E5XA 4YIFA 4YFXF 3CUQB 1BI3A 2QUFA 2E7XA 4EJWA 3KZYA 1Z9CA 5HLIA 3EYYA 4KNYA 3F8BA 5CYVA 2VC0A 2R7DA 1IXSB 5CVRA 5J8FA 1T39A 3JSOA 4A5NA 1Z91A 3C3WA 1WQ2A 3HOTA 1RUNA 5K5RA 2VE8A 4M74A 3LSTA 3BDDA 4BXUA 1ZN2A 2H09A 3J7AO 2EFNA 3BZ6A 3ROUA 2NS0A 2BBYA 1FP1D 1UHWA 4WXCA 2HKOA 1QNTA 2QBYA 3O6BB 1G3TA 1GXPA 2UXNA 4GO1A
chains in the Genus database with same CATH superfamily
2IBDA 2AHQA 2GOMA 4RB2C 2HEOA 5J47A 3BJAA 1IAWA 4IPAA 5JVTA 3FXOA 2OD5A 3KCCA 2LBFB 2QA4I 3KLNA 3R4KA 4M9XA 2E71A 4HSRA 2CUJA 2Y0SA 4XKWA 1Q1VA 4F92B 4XQFA 4HAMA 1ETYA 2VI6A 4AVPA 5F04A 4G12A 2K9LA 1NK2P 2EBIA 2IRFG 1Z1DA 5IT3A 4GYIA 3I9V2 1IN8A 5H2FC 2ID6A 1K78B 3KP6A 5E3NA 1HBXG 1YS6A 2E1OA 4WK8F 2V9VA 1AA7A 3REOA 1FSHA 2STWA 3MQ0A 1Z6TA 2LKPA 4UHTA 3MZ8A 2VJ4A 2BVLA 5FKKA 3L2VA 2UXXA 2XDVA 4DBQA 5IT9K 2P7VB 5DUIA 1GHCA 3CJTB 3S1QJ 1S5LC 4KITB 3CC4I 3C1DA 2DA4A 2NVTJ 2FBHA 3KYLA 1W7PB 4E7ZA 2PG4A 1QBJA 4XOTA 3M07A 3ZCOA 2RREA 2VQCA 3KLOA 2P5LC 3HYIA 3VSKA 1XGNA 1R36A 1R1TA 2E60A 3MMYB 1IF1A 3BR0A 1W36C 2JVGA 4IRGA 1XSVA 3HUGA 3OYKA 1YQAA 3QP5A 2EFWA 2XVCA 3KE2A 2OZ6A 3BC8A 4UB6C 2NOJB 2QVOA 1JJ6C 1ZAOA 1MJ9A 4JX5A 2A61A 4DBRA 3ZOBA 2L01A 1T95A 4HX4A 4BQNA 1SD6A 3DBLB 4B48A 4BJ5C 1BC7C 3JAMK 2L7KA 2VPLA 4HLXA 2XB5A 1ZKGA 3N97A 1TQMA 3RKXA 2K3FA 1IUYA 5JHUA 2E2IJ 2HFHA 3HB9A 4UUVA 3FWEA 2VB6A 2R7SA 2GIVA 3T1BA 3ASNH 4OMZA 4BHCA 2KISA 1A04A 4LLNA 3E5QA 1MBJA 4V2FA 1JUSA 2CSOA 2VQGA 4GCVA 4U88A 2OJED 2MLKA 2OCCH 4EM2A 2LKXA 1FMVA 4CHUA 4IOAF 3OSGA 2UV1A 3BZCA 3IC7A 4MIMA 3T8TA 3HRUA 3OS2A 2DFEA 1V55H 1IDYA 2L4MA 3HBLA 4KN4X 2H94A 2E5ZA 1U2WA 5LGTA 2XB0X 1ZREA 3VB2A 1JUPA 2NS8A 3QOPA 2DA1A 3CC2I 3ZPLA 1XD7A 1N78A 4LK0F 1QPIA 5FKMA 2WAQA 2ESHA 3BG9A 2CW0F 3HOWJ 1APLC 3SFIA 4EJOA 2FU4A 3K69A 1I1SA 4RA2A 2DI3A 3BR2A 4ENNA 5D6EA 2ZB9A 3TKYA 5L3BA 2MW8A 1IXCA 2VL8A 3KETA 3BR6A 4A3GJ 1X1DA 2DT5A 3OYLA 5K7FA 3A03A 3S15J 2P6SA 1DUXC 4Q5SF 2DFIA 4D7MA 1QZYA 2W7NA 3CDHA 3PUBA 3H5RA 4CDGA 4LLGF 3Q9VA 3KP7A 3AL0C 3E6CC 3OYMA 3BZKA 4BACA 1O3RA 3OYNA 1MD0A 3CCVI 4RLQA 5JI6A 1I50J 1D0XA 1KGSA 4BH9A 4F3QA 2OQGA 1H89C 1ZH5A 2R7ZJ 3J7AY 3PO3J 1ZQ3P 2Z2SB 4YRVA 4YELA 4HEA2 3FX3A 3S32A 3PSFA 4M3DA 3HHGA 2JZYA 2OA4A 2TCTA 2XV4S 2E1CA 1FYLA 5KVRA 2CQ7A 2XKOA 3B6AA 2VT2A 2KIQA 4FE4A 1OFCX 1SD5A 2CQNA 3MKLA 5GP9A 2IT0A 1FOYA 2QBYB 1JUMA 1O57A 2MLGA 2K9QA 2HNHA 2HOEA 3ABKH 3CF5F 4UUTA 3RPUD 2F5EA 5LBQA 5JLWA 1TBXA 1Y8QB 2XAQA 3K4JA 2UUZA 5CVVA 3T0YA 4BE2A 3GF2A 4M73A 3OIQA 3E6MA 1JHFA 2X9DA 2ZNYA 3WTSC 3QQAA 1BM9A 1BL0A 1XS9A 1D0ZA 1G8XA 3QAHA 4Y7NJ 2CQXA 2O03A 2L7MP 3EUAA 3MAJA 1ETQA 4BYYA 1PUFB 2QF7A 4E7JA 3V4GA 2DFFA 5ICFA 4C2MJ 1HDPA 4IJAA 1T0FC 3DQVC 5H6QA 4IHVA 1YLFA 1ZRCA 2L9SA 2DDBA 3IH4A 1USSA 1FYKA 3BR1A 4MFDA 1GLNA 3I3LA 4L9NA 3WTWC 3OYCA 4HX7A 3Q9SA 2QLZA 3GFMA 4FTHA 1LDJA 2KT0A 2F6CA 4GYGA 2DA7A 3I0TA 3R0AA 1YW7A 2DJIA 2M1BA 1UCRA 1LUJB 2M0CA 4LITA 5J4VA 1XMXA 1DU6A 3H36A 2GBYA 3O8GA 1NG6A 2D1VA 2V1DA 5E1ZB 4XLCA 3R60A 2A3SA 4N9IA 4XKVA 3KP5A 2HS5A 4IQ4A 3LFKA 2OAZA 2W84A 1ORKA 2LH9A 4HA8A 5HDGA 4HDUA 2JA6J 1MW7A 4JBAA 3OYGA 3GTLJ 5E3LA 2X6YA 3QRFF 4ITVA 4FHTA 1X3WB 3LQRA 3IWZA 4AWXB 5D5WB 4F55A 3QYEA 3V8KA 2R7XA 2K9MA 5J1YA 4W97A 3RQ4A 2XF5A 4C2UA 4WX9A 2KRCA 3CJRB 4LGWA 4XKCA 5JLXA 2EV0A 5L3FA 4PSXA 1P9QC 1KU9A 2XAFA 2OV7A 2C6YA 5AIQA 2DPUA 2IA0A 5DCFA 1BN5A 5D4RA 2CQQA 2STTA 4C3JJ 3GTMJ 3IH2A 5BS6A 2R0QC 4M72A 2RNJA 2LMDA 2HDDA 4ZTJA 2HVRA 1WH5A 4FETA 5GAGJ 2VQLA 2QQ8A 3HXLA 2CW7A 4RLFA 2MH2A 3GCMA 5C3EJ 3F8FA 2YSRA 3I55I 2EV5A 3GZ5A 4RAGA 3DTIA 3ZQQA 3BLYA 2I10A 5D5UB 1VQKI 3E6DA 5CVIA 4MEYF 3BTCA 1B9MA 3HTUA 3K2ZA 5KHDA 3WTXC 4XRSG 3BJOA 2EJRA 2Q8KA 2G0EA 4JX4A 3CUOA 3SFZA 2QKLB 2X0LA 3S17J 5TJJA 5E8GA 2D2WA 1RIOH 3LMMA 4O5VA 1ZLKA 3E97A 3LWFA 3OYFA 1RC9A 4IZZA 1UHMA 2L7FP 3H0GJ 3UNGC 4DW6A 2CUEA 3V7RA 4A5MA 4L18B 4E7KA 3N4MA 1I6XA 1J0RA 1IN6A 1HDDC 1VQ6I 1LB2A 1E17A 1Z3YA 2DTZA 3COAC 4B4CA 1X19A 3CP8A 4BJ6C 2WV1A 2V9PA 4J19A 1MSFC 1FEXA 4PFPA 2KRFA 4EJTA 4ESJA 3G73A 1ZLJA 1UMQA 5DD4A 3OYIA 3A0BC 3AG2H 4XSXF 2IA2A 1H9TA 4C3IJ 3OSFA 3IWFA 1RUOA 2XASA 1RETA 3HRSA 3VYTB 1PUEE 1F4KA 4A3JJ 2RKHA 1KU3A 4UVBA 3NWSA 1GVDA 2M0MA 4HW0A 1HXDA 2CGPA 5KK1A 2LTPA 1Z21A 1KU7A 3FK7A 1LVAA 4LJZF 3PJRA 2ZMEC 1HKTA 2OPTA 3CQZJ 3GLXA 3H5AA 3SDGA 2ME6A 4LB5A 3ZGKA 2RDPA 2FEZA 2XUBA 3P5JA 1K4TA 3K7AJ 5EDNA 4LOCA 2M5WA 2GA2A 4RB1A 4HOBA 2QSHX 1AOYA 2RGVA 1QU3A 3DPUA 3DF8A 1VQOI 5LEJA 1WKMA 2VXDA 1B72A 4JQFA 3I71A 2H6CA 4EV0A 3BOQA 4U7BA 4PJJA 1I27A 2DLLA 2ECBA 2PMHA 4IX7A 4XRSA 3ECHA 1OCOH 3FIWA 1LNWA 2L54A 3AKZA 5BPDA 5FFXA 2DMUA 3M8FA 2H8RA 1CF7A 4HG2A 2ZXIA 4E7HA 2Z5UA 2VN2A 4RS8A 1XGOA 2ACJA 3H3VK 2GXGA 2LC2A 4M3GA 1EH8A 3PO2J 1FP2A 5C44J 2FOKA 3LSPA 3D0SA 3OYDA 4S04A 1D3YA 2ZC2A 4CCJA 5ICGA 3AFHA 1JJ8C 1Z7LA 1DPUA 4X6AJ 3MZHA 3WTVC 2JT1A 4DYRA 2G7UA 3KP2A 1FBSA 4I99C 4PDKA 3ZQFA 1Z3XA 3K10A 2LR8A 3I4PA 3V8JA 1SC7A 3KP4A 1BBYA 2EA2A 4YFNF 1TP4A 3W6JB 4D1QA 2PLYA 3TOAA 1K78A 4U0YA 2VBZA 3GBGA 1XGSA 2AXTC 4EATA 3ASOH 2EIJH 4HLYA 3FKJA 3U9GA 3LAPA 1QVTA 5LHHA 1FBQA 4L0YB 2ZXJA 3WGHA 3JTGA 1JI8A 2EA4A 5BNGA 1P92A 2DQRA 3CF2A 1BA5A 5E3OA 1J59A 5F0FA 3FXJA 3GX4X 2XROA 3WHBA 2HKXA 1FMWA 2DQLA 3L1PA 2WWYA 2LREA 2F5DA 1J7KA 2Y9YA 3BPXA 1TQIA 2AXLA 1DDNA 2RQQA 2JWTA 5D8LB 1VQMI 1ENHA 4BE0A 4PGGA 1X4OA 2W00A 3CMYA 1W7PD 5M3FJ 1YS7A 2V4JC 3OMYA 4BQAA 3OIOA 2PMZA 4C3HJ 3LSMA 2XIGA 1MNMC 4CCNA 1Z77A 3DLAA 5GAEJ 1DP3A 3RYPA 1MBEA 4ZTFA 4IHSA 3L2UA 3D5RC 1R23A 4Z6YA 1MSEC 1H88C 4FCYA 3DP7A 2BHYA 4RAZA 2P8TA 2JPCA 2LSOA 2VOOA 1OCCH 4LG0A 4XRFA 3DTKA 3SZTA 5CPRB 2BHZA 2XPUA 2M2EA 2GWRA 1KA8A 5EYRA 4XONA 2HXIA 1XC5A 5FRNA 3K0LA 3ABUA 2EZLA 2COMA 1PDNC 4H4KC 1VFCA 2JMWA 3H92A 4NDLA 2DA5A 2LG4A 4HPQA 5K7HA 4L9JA 1ON1A 1A6QA 1O3QA 2IJLA 3RKWA 4IHWA 3CD6I 4CZZA 3HSRA 4LG0B 3K4NA 5B66C 4P9UA 2PBIA 5HNHA 3OR2C 3L2CA 4ZYHA 2IXSA 3EUHA 2V1UA 4M71A 1FYMA 5M5XJ 3LQQA 1QGPA 3M1CA 1XB4A 5BPIA 2XAHA 3CCMI 4NC8A 2QEXI 2VUMJ 1HC8A 2Z99A 3JRHA 3OL3A 2BYVE 4BBRJ 1FIAA 3VEPA 2Y69H 3EETA 1T98A 1GV2A 1TWCJ 1XSXA 3EQLF 3OYBA 4HX8A 2LVSA 1LJ9A 4LLLA 2XGCA 2K27A 3B6CA 4G9YA 1J9IA 2VT3A 4KIFA 3MN2A 4FISA 4OOIA 4AIDA 1YI2I 5C4JJ 1X1BA 4G6TB 4OIOF 1SD4A 5FD6A 1LDKB 4AIJA 2R7OA 4XOPA 2M4GA 3WG7H 3FXMA 2R7VA 1RKTA 2YX4A 1ZGAA 3LA3A 3GFLA 1UZCA 2BY3A 2L5QA 2IPQX 2P4WA 3M8JA 2A6TA 3Q5FA 1LFUP 1NK3P 1OYWA 2XGDA 1KONA 3TDUC 1YJWI 2NVYJ 3SHFA 4XMYA 5ILUA 1XMKA 4A3LJ 3WTUC 1D1BA 4PJMA 3K1NA 4ON0A 4I7HA 6PAXA 2R7RA 1IN7A 5HLTA 4UY8I 2CWEA 2PI0A 2PJRB 1PYVA 2COBA 2V9KA 3AG3H 3EYIA 2BY0A 1G6NA 3IHUA 2MBFA 3BROA 3FXKA 3IV5A 2DXIA 1RR8C 1HOMA 5HS7A 1IJWC 3SXYA 4IF4A 4XN3A 3RZDJ 2MABA 4J00A 3BG3A 2WA0A 1W7PA 2DA2A 3GEZA 5IYDJ 1ZR2A 1UJ8A 4P96A 1YE9A 2YX7A 2I8DA 3GTKJ 2CG4A 2GZWA 2BE5F 2DK8A 4I76A 1TW3A 3DV8A 4IL6C 2CO5A 4I02A 5LLQA 3TEDA 3BQYA 1L0OC 1DQUA 3HIFA 2Z33A 2CV2A 1S8NA 1D8JA 1XMAA 1ACIA 2L2OA 4M3EA 5CQEA 2D5VA 2VJ5A 2H8WA 2UZKA 1MMSA 2V7FA 3P7NA 1E3HA 3A01A 2H1LA 4N9HA 3ZMDA 1ETXA 1I6HJ 2CYYA 2KDOA 3FXRA 3TO7A 5ED4A 3FXQA 4E6KG 5H20A 1MMAA 2NVUB 2M34A 2O3FA 3OIPA 4Z2YA 3J81Z 1W5SA 3DEUA 1N25A 4CCLA 4PGHA 1IV8A 1FWZA 2PX9A 1IRZA 1JXSA 3F23A 2Y48A 5ICEA 2DW4A 3DPLC 4I01A 3ZMTA 2KKOA 4Q47A 1SAXA 3CCLI 3HHHA 4D7NA 4CUGA 1T56A 4OIRF 3I58A 5LEKA 3VFZA 1FTTA 1AKHA 1MBKA 4RAYA 2CV0A 1U78A 1LEBA 3ZXSA 3F6VA 1V4RA 3G6EI 1IW7F 2P7CB 2W57A 1W1WE 1WZ2A 2G7HA 2FRHA 1R5HA 3LA2A 4EVIA 3L2RA 3OY9A 3M8EA 1MNEA 2LYCA 4QTRA 1N77A 3I56I 4Q4ZF 4CCMA 4Y4RA 1OCTC 5FJ8J 3DEEA 5FRMA 3CLQA 4DIQA 1ODDA 1YX5A 2EH3A 3K6GA 5E18F 2KJBA 5FLMJ 2YU9J 1MMNA 1B8IA 5IY5H 3LSIA 3HM5A 2FNPA 3I59A 4GRIA 2QGUA 2KRHA 3V8LA 4A3FJ 3DKYA 5LHGA 2CV1A 2M7AA 2UWMA 1V5GA 3W6VA 4H0EA 1UFMA 3PFYA 3GW2A 1R71A 2ZMEA 2JRMA 2D1HA 4HV6A 1WGXA 2IGNA 1RNLA 3AAFA 3BTLA 3KPHA 4P1WA 4F91B 1TT0A 3IRRA 4IQJA 4RB0A 1X3ZB 1WVRA 4XLPF 1YRNB 4EM0B 5HS9A 5TGTA 2R5ZB 4EMSA 2IW5A 3KIOA 2L7ZA 3K1MA 1JKQC 1NH3A 2FX0A 1TNTA 2H6BA 1PUFA 1IC8A 2OBPA 2Y75A 2ELKA 3I5UA 2FXAA 2DYRH 5D5VB 1X4PA 3JTHA 5EEGA 4QSHA 3FM5A 1W4MA 1OCZH 1ETWA 3WU0A 1T2KA 2IS2A 2KL4A 1RZ4A 4BY7J 5ILVA 2BY1A 3G4SI 2ID3A 2MA3A 1MDMA 3ULQB 2HXOA 2ZJQF 2KMUA 5EEHA 2DOAA 4LD5A 5IPAA 1EF4A 5CQGA 1P4AA 3QU3A 2NNYA 3DXJF 3TP0A 2QZ8A 4PK4A 4AUXA 4JYKA 2EZKA 4EEFG 5M5WJ 1JHHA 3QPSA 5HLHA 1X58A 4A3BJ 1XCVA 2VXZA 4E7IA 4BY1J 2R5ZA 3G1OA 1Y0NA 3SEZA 2D45A 2TDXA 3E6BA 3WTZA 3IUOA 2B7EA 3DEWA 2O5RA 3JW4A 5FROA 5L3EA 3WGIA 2LFBA 5TISC 4NHJA 1MBFA 1I39A 3P9KA 4EQQA 1T0FA 3QODA 3J81K 1H9GA 2NS7A 2IS4A 3ZRGA 2O61A 2JA5J 3IKVA 4HRIA 1HKSA 2DMNA 2K86A 2DMTA 3DBHB 2GQQA 1P6RA 2EFPA 4AYBN 2Z1DA 4FE7A 2NYXA 5FLVA 1STZA 1WRJA 3L7WA 4CYCA 2LY2A 3BQZA 4CCOA 3E5UA 2V79A 1JKPC 2LF8A 4GDFA 4FX0A 2WBMA 1NTCA 1HSJA 4A0ZA 2E2HJ 4UV9A 2DBBA 5BMZA 1DPRA 4ASNA 3LAJA 1K83J 4B3XA 2F5FA 2PN6A 2XGEA 5EF6A 5B3SH 5E8IA 2R5YB 1IDZA 5LD2C 4XNFA 4G8XA 2W1OA 2A68F 2XAGA 1K79A 1WJFA 4KT5C 3C18A 1VQLI 1GT0C 1MKMA 3I59B 1VI0A 4UUSA 4BEHB 2P5VA 2CH0A 4A3DJ 3ZN0A 2DMPA 5CLSA 3KZZA 1ZRFA 2X1DA 4CXFA 2FNAA 1BI1A 2W25A 1EJ9A 1YJ9I 2I5UA 2GM4A 1OPCA 3S8PA 1G3YA 2Y0MA 2RNGA 2DODA 4M9ZA 4NQWA 5F1RA 1TWHJ 3AG4H 4KIBA 1SVLA 2VKHA 1A5JA 5E79C 2YUSA 4EM1A 3S1MJ 1S3JA 1F43A 2L9NA 3G71I 1HLVA 1IN5A 2ZFUA 4PFOA 2VONA 4OIQF 2E19A 2FJ1A 1E0EA 1EA3A 1TW2A 4KDPA 2IP2A 1SVMA 3TO9A 3X2QH 1T38A 3KEOA 3ZQCA 3TW7A 1AKHB 1UG0A 3LSGA 4A69C 5J4YA 2JA8J 3IKTA 4UVAA 3QOEA 2K9SA 4ZDOA 3P9IA 3DFGA 5J3LA 1J09A 1YG2A 2VIXA 2DT7B 2JPBA 3D1NI 1K61A 4XLNF 3HOZJ 3ZQIA 3ZR8X 2NAZA 3VOEA 1XTAA 3CJQB 3J80Z 3WTYC 2OU2A 4XORA 2VJIA 1XX5A 3CMAI 5FFZA 4BBSJ 4U0VA 3AG1H 1TL8A 2W85A 4C30A 3BCBA 3QYBA 4UB8C 2F4MB 2HPIA 2E2JJ 4MLOA 3JSPA 2XSJC 1J2XA 5IYBJ 5DM6F 3D5LA 4UV8A 3HL2A 5HS8A 3GMEA 1G2HA 3F9KA 4BJTA 3A01B 3MKYB 3F6OA 3LNQA 1FNNA 1LFBA 1MH3A 3CDLA 4S05A 1S6LA 3LSRA 3Q0VA 2P6TA 1AHDP 3GFIA 2VASA 2CFOA 3GO5A 4XR6A 3VYRB 5HDNA 3L09A 1XG1A 2WV0A 2O7OA 1R1UA 4I98B 4ETSA 2BXZA 3V7CA 4ZDLA 2AQFA 3HDDA 4B3AA 2KQRA 2NRAC 2CUFA 5B5EC 1UB9A 3W3CA 4A0XA 3ECOA 2X4HA 3R0JA 2CW8A 4O6JA 2IVMA 4IHYA 3S2HJ 2R7FA 3DLLF 1XN7A 1U5TA 1MH4A 1S7AA 5DDGA 4F7ZA 4ENKA 3JRIA 1LE8A 1I1GA 3J80K 1ZG1A 2HDCA 2LOOA 1VQPI 1AU7A 4OINF 2BW3A 1FSEA 1FY7A 1W36D 2F5VA 5E17F 1A35A 1G3WA 1F9NA 4RAFA 2X48A 3WTTC 3PFIA 4K2EA 3ZP5A 2MYSA 4HNUA 4Y3OA 1V5EA 2W48A 1D5VA 4HF0A 3RPUA 3JRDA 2Z9OA 5LGNA 3CMEI 5F08A 4Y15A 1JT6A 4RGXA 1HW5A 4DQ2A 4XIDA 3FM3A 4DYQA 3FMSA 4U0WA 4XN0A 5DEQA 3MCZA 1B6AA 4M6YA 1QO0D 1RRJA 4L9TA 1YFHA 2KIMA 3CESA 1BOBA 3T8RA 2FBIA 5IOYA 1ZARA 3RSNA 4YFKF 3W2WA 2W24A 5CJ9A 2HOTA 5D5XB 1Z67A 1D0YA 3BP8A 4AYBA 3NWTA 2DO7A 2VBWA 1BI2A 2ZJRF 5GTIC 3G2BA 1WJBA 4XKBA 3GTPJ 1VF9A 2FQ4A 3CLOA 5J8CA 3IRQA 4RM3A 2DA6A 3F22A 1OKRA 2FMYA 3L2QA 4OU0A 3GTOJ 3V7SA 1YITI 3SDBA 2XHKA 4RBOA 2A07F 2QM3A 1ETVA 4EJUA 4IEJA 3JRAA 4NUBA 1ERDA 2O8XA 5BOXA 1S7OA 5DCMA 1T08B 3PNVA 2VQHA 3G1MA 3K70C 2EPFA 1SFUA 1B1BA 2HQNA 3MFKA 4BS9A 5IOZA 1SFXA 1BIAA 2FSWA 2VBYA 3KFWX 1JKRC 2OTLI 3VYUB 2LY1A 4J01A 5J6XA 1EKEA 4WXDA 2BVMA 1WWXA 4XM3A 4BAYA 3KYDB 1ZK8A 1FC3A 2IGKA 5D8KB 1YTYA 2BW3B 1K6OA 4PSWA 4TV7A 4OWRB 4HSTA 2ZBKA 4ZYEA 4YIRX 4EGYA 2ELHA 2ELJA 3GXOA 5DCMB 2ZSIB 4RM2A 3WGGA 2L9RA 1WPKA 2GA1A 2XAUA 3W2AA 2VKDA 1R5ID 4G7OF 2M30A 3C2BA 2VC1A 5JR3A 3H3ZA 1TWGJ 1ONVA 1N75A 2HTSA 2JRTA 3SJMA 2FUG2 1LFPA 1MNDA 3OR1C 2LD5A 2HGCA 4AIHA 3GZNB 2DT6A 2R92J 3DKWA 3I64A 2EV6A 3K4KA 2O6GE 1XSDA 1SFEA 1RKWA 2WAQN 2OCEA 4XICA 3PIPF 1X3UA 2EWNA 4HQMA 2R7WA 5LRRA 3S16J 3FBIB 3MVPA 1GV5A 1KU2A 3LFUA 1VQ7I 3I54A 4ZYGA 1P2FA 4A6EA 2BXYA 1VTNC 2Q2EB 4MFEA 4N4NB 2NXNB 5L3DA 3B02A 1HSTA 4HBLA 5L3GA 4E70A 4M3FA 3NARA 2ZSHB 4IRIA 2R3SA 3TOBA 3S3NA 2B9SA 2DU9A 4MO7A 5DS9A 4ZH4F 2OQRA 4L5EA 3UKGA 2WTEA 2LF7A 4LIUA 3C2HA 2EZHA 1FOXA 4RGRA 1YO5C 1A6IA 2HI3A 1IGNA 2PFBA 3HSEA 2NOGA 3CUQA 5EG0A 3S3OA 5E3MA 4A3EJ 3HGYA 2PMUA 1JKOC 1POGA 1R00A 1XPXA 4NBQA 3C7JA 4P5OA 2EQRA 2M4KA 4UVCA 1JTYA 4PJLA 1XDUA 2X51A 1PP7U 4L0ZB 2HYFA 4MHGA 1R4NB 4ESBA 1MDMB 1NHAA 1B4AA 1U8RA 2A6EF 4BXXJ 2XF6A 2EB7A 1TLHB 1FX7A 3LSJA 4R1HA 1UELB 2XPVA 4RGSA 3FF5A 1OR7A 1XDSA 2ICWG 2EZIA 3E1SA 3G3ZA 2ZNZA 1U0JA 3E7LA 3QWLA 1QQIA 3OYHA 4P9FA 2A6HF 2A5YB 3ML6A 2WADA 2M8GX 1W5CC 1OLTA 4ZJZA 4HQEA 3BG6A 4DJAA 3H9JA 4BE1A 1OCRH 2HZDA 1I3AA 3CO6C 1F36A 1V54H 4WF2A 3KYCB 3TL4X 3G1LA 4BNCA 4XLAA 5AIPA 4N4OB 1KQ9A 3RJPA 3LOCA 4AIKA 1QRYA 3A4CA 2X6WA 4XK4A 3S2WA 1KYWA 3F3XA 2ZKZA 4IHXA 4A3CJ 3QP6A 5D4SA 1VQNI 3ZMVA 2CU7A 4HF1A 3CO7C 3HZJA 2GXAA 2K85A 4BQQA 2F5CA 1CF7B 3QU6A 1W0UA 3I4MJ 1BR4A 2FQ3A 5LRSA 1O3TA 2ADUA 4KFCA 4G6QA 2HOSA 3JRFA 1MJBA 3OYJA 1FZPB 2GLOA 3M4OJ 1B72B 3BPVA 3JRGA 1IN4A 5EGOA 3BTJA 1CQTA 1Y6IA 2IS6A 1FTZA 1G59A 1OYYA 3WODF 1F5TA 2M9HA 2CFXA 3OYAA 2Z3YA 5B1AH 1BJZA 4AD9A 4A3IJ 4AVZA 1UHSA 5FKNA 2DYSH 2CRGA 4ZC3A 2Z16A 3M3YJ 3FDYA 2X6OA 4DYCA 4EGZA 4HYEA 1IRFA 4UUSB 1YHQI 1QZEA 3TW6A 2GIZA 4XL9A 5IP7J 1BOAA 2BGCA 1FOKA 2G9WA 1MMDA 3ERMA 4RGUA 4MEXF 1ITYA 1O4XA 1XCBA 1FIPA 1BI0A 1ZGWA 1ZGJA 3GLLA 2KP6A 3S93A 3B73A 4NNJA 2DDAA 5IYCJ 5A2QZ 3HKZA 2MC3A 4PUSA 4JOMA 1SAUA 1HW2A 1FJLA 5CVUA 4DOZA 5HLGA 5A2QK 2JQ7A 5IP6A 5EGOB 2QQ9A 1Z6RA 1W5TA 3DU6A 2RQPA 3S1RJ 1R49A 1KZHA 1O3SA 4BKXA 4CYCB 1K4SA 3FK6A 4LK1F 4MNUA 4F93B 3OS0A 4OMYA 3E3VA 3H5NA 3IP4B 2F2EA 2KZGA 1U9OA 3CJNA 3U1DA 3BWGA 2ZCWA 2LLKA 2H27A 1B8IB 1HW1A 2EFQA 3ERED 4E4HA 2HU9A 3ZN1A 3CTAA 3H9QA 2Y9ZA 3RDIA 1D8KA 4CGZA 3FZVA 3OL4A 2KFDA 2P0WA 3RKYA 2E36A 1BJAA 4A93J 1L3LA 3ZMUA 2W4SA 1WFXA 3PNTA 3OV8A 3ZQGA 2OF7A 1GDTA 2DPDA 2ETHA 1LVKA 5K5QA 3FISA 1DP7P 3VPRA 1BIBA 4MQVA 2YPRA 4G7ZF 1EH7A 2M3AA 3U21A 5F64A 1FOWA 4WXHA 2ZFWA 2F48A 4PCQA 3BJ6A 4PZJA 1Z05A 1VQ5I 5GPCA 3SZPA 2CJJA 3KX2A 3ZQHA 3CMMA 3LSKA 3R6SA 1X2NA 5KNLA 3DCFA 1KQ8A 3MD2A 3FKIJ 2PJRA 1EV7A 2PMZN 1YIOA 1P7IA 1J75A 3O2PE 4B47A 1ZR4A 3QPTA 1HKQA 3J7ZI 4KN7X 3RI4A 2E34A 3QPHA 2E5NA 5DD8A 4C2TA 3GUDA 5FLXZ 1TTYA 1WHUA 3L2WA 1Y1VJ 1E3PA 1JTXA 4RDUA 2ZJ2A 3F0CA 5J40A 3GVAA 4LFUA 4AC0A 4V19K 4Q48A 1FLIA 1A31A 4Y33A 4QLCU 1R5GA 1D1AA 2E7WA 3HOYJ 2GOXB 2QSFX 2ZO4A 1VZ0A 2XGXA 4I2OA 1SMTA 2B0LA 3K9TA 4I09A 1JT0A 3ABLH 3O3KA 2FE3A 2KDZA 4A0YA 2J5OA 1F1ZA 1ZYRF 1ZELA 3T5XA 5HODA 1ZTRA 1YRNA 4A6DA 1BR1A 4L5IA 3L9FA 1MZBA 1G4DA 2X1EA 1ZHFA 2ZXWH 5E20A 4KMFA 5FLXK 3MKZA 2Q2EA 2RC4A 1WJDA 1C0WA 1MJAA 3FXLA 4BXFA 2DJNA 2LDUA 2MH9A 4B8XA 5EEAA 3M1EA 3A0HC 3H1CA 1TWFJ 1ZG5A 1LEAA 3OYEA 3K4BA 3S1NJ 2WC2A 1MMGA 2EFOA 2AO9A 5FB2A 1T6SA 4E7SA 2HQRA 2JA2A 4IKFA 2Q0OA 1X1PA 1SMYF 1YYVA 2L9VA 5IP9J 1LQ1A 3FXUA 3M9AA 3ABTA 2DOFA 3H9GA 5L3CA 2CUZA 3S3MA 5FO5A 1KQ0A 3MEXA 2EIKH 4RMNA 4ZZDA 4CYDA 1WJCA 1U5TC 3QYFA 2YS9A 3HRTA 2FF4A 2IAIA 1Z0XA 3HEFA 2HPMA 3GYHX 1R1VA 2RVCA 3HOVJ 4L9VA 5CVJA 5E1XA 3JRBA 1YW9A 2VJJA 3MWMA 4DGWB 3DWLE 3NQOA 1YJNI 2DAOA 3CDIA 2LP0A 1I5ZA 3JREA 1X1AA 3HOSA 3FHZA 2GXBA 1BC8C 1T33A 3KZIC 2LNBA 4B43A 2BEOA 2L0KA 5C4XJ 4CCKA 4ABZA 2A69F 5GTHC 4ENJA 1OMIA 4FT8A 1S9HA 4CZCA 3K70D 5FGMA 3TDZC 4QIWN 1R6RA 2CMPA 3VODA 2NVXJ 3RTRA 4ZYDA 2F4IA 1QVUA 2QENA 1OISA 1LKXA 4BQOA 4BL0B 3W2VA 3WE2A 2Y30A 4EJVA 1VQ4I 2E1NA 1FT9A 3WG9A 2FBKA 2JSCA 4OIPF 3PQKA 2NVQJ 2DFHA 2KIFA 3V42A 2J5PA 3Q0WA 2R7TA 2LKSA 1A36A 1SD7A 2RV8A 3D5SC 1BW5A 2ESNA 3NRVA 1JGGA 5LGUA 2WB1A 4I6ZA 4Y52J 3JRCA 3ZQ7A 1B9NA 1OJLA 4LMYA 1IRGA 1RESA 1HCRA 1DGWY 4QWQA 3K4MA 2HDWA 4KMUX 1O7LA 2BOLA 4JX6A 4ESFA 2OTJI 4WCGA 3MZYA 4G94A 2DK5A 1U9NA 4L5JA 4A12A 4D9JA 3F8CA 4HZFA 3EPZA 1ZG3A 5DV5A 3SZGA 1AWCA 5EZGA 3WHCA 3CCEI 1FPQA 4XRMA 5F27A 4X1EA 4BDZA 2IGOA 3HSFA 1TWAJ 1UAAA 1KYZA 1SFKA 4R8HA 2B63J 4PJNA 4B09A 2XRNA 3GTGJ 2DN0A 2JUCA 5B1BH 3ZMSA 3OOPA 3HTSB 2VODA 3K4CA 1LDDA 4ENMA 4KICA 3BY6A 2MD0A 2BV6A 3BR3A 1ULYA 2XC7A 2LBFA 2O9LA 2HZTA 3VYSB 2MG4A 2XKPA 2HR3A 1WJ5A 4I0BA 1S29A 2JK3A 1O7FA 5IT9Z 1WJEA 1U5TB 4QPQA 3HUGB 4LB6B 1Y39A 2KIUA 4M3BA 1V3FA 1Y0UA 5E1WA 1GVJA 3GFJA 1WSUA 5KAFC 4BU2A 4CA0A 5K1YA 2F4OB 2HVSA 2K02A 5LHIA 4V2GA 2HVQA 4FASD 2IEKA 2E1MB 2K40A 5H6RA 2KLOA 1YOVB 2EILH 2X85A 1REPC 2YU3A 3F72A 4NC6A 3BT9A 4KJZA 4MTDA 1YX3A 1PJRA 1SANA 3Q0UA 1XGMA 4KA4A 3ELKA 5JHFA 1WJAA 1VNDA 3L00A 2IS1A 2XF7A 1TQPA 3TGNA 3S14J 2VKEA 3SYTA 5F0CA 1MIJA 4G6DA 3H3UA 3C2GA 3P9CA 2LRDA 1VQ8I 1WCMJ 3JCUC 4IXAA 1HA8A 3LA7A 4HDVA 5ERIA 2WAFA 4FX4A 1D1CA 3F8MA 5K5OA 3I53A 4GFBA 2CS3A 4G7HF 2DMQA 2FA5A 3QPLA 5GPAA 2JUGA 4MGRA 4U87A 1R7JA 5J1RA 3TO6A 2QSGX 1B59A 2AS5F 2KJCA 1PVEA 3FMRA 4QPOA 5JVGF 3EUHC 4M9SA 2VE9A 3VDXA 1WI9A 4BUPA 3J7YJ 1LE8B 1SEUA 2R7QA 3CCSI 3BG7A 3JR9A 3A1YA 3O8HA 3RYRA 5J1UA 5FKLA 1OYIA 2HQ5A 3TMOA 2HYJA 1J5YA 3OOUA 2ISZA 5M3MJ 3ONQA 1IXRC 4MQ9F 2MD5A 3SQNA 2O8KA 3RPQA 3WE3A 2WY7Q 2JN6A 3WU2C 1IO2A 1JE8A 4KIGA 1ETKA 2ECCA 4M6XA 1P4WA 4ZZLA 5ICCA 4NQWB 4IRHA 4GGGA 4DZJA 2ISYA 4LG3A 5BQTA 4B1RA 4XSZF 1PP8F 1DU0A 2K3PA 4OAZA 3FHNA 2IA1A 1SFOJ 2P81A 2V1XA 3CC7I 3NEUA 3DU5A 2V6EA 2L4AA 1H0MA 3PQJA 2VKVA 1X2MA 2VOPA 3TBIA 3PSIA 2JTVA 1P4XA 2RAEA 2X6XA 2MFZA 2OUMA 2M87A 4AM3A 1Q1HA 3U2RA 1S72I 4IVNA 1IG7A 2R93J 3CCUI 1MGTA 3EUKL 2WB1N 2ZXHA 1BR2A 2A5WA 2M8EA 5K7ZA 3TP3A 2YR2A 4E7LA 1USTA 4R79A 1RPWA 4NB5A 2ZJPF 4YIIA 2Y31A 2ZMEB 3F8NA 5HOOA 4RB3C 2XPWA 5HNFA 4XLFA 1OQYA 5DM7F 3IL2A 3GWZA 3HOUJ 3KEYA 1Y8RB 4PJ0C 3BG5A 1R4MB 2XSDC 1YW8A 1MBHA 2JVHA 4GXOA 2DTRA 1JGSA 1OR7C 1SVOA 3FMQA 1V5FA 2JA7J 2L3DA 4BHPA 1RI7A 5F6FA 2QQBA 3VWBA 2HTJA 2K9NA 5DUKA 4O3MA 4HV5A 3BR5A 4WWCA 1CGPA 3OS1A 3MKWB 2L02A 4XLEA 3JAMZ 3GZ6A 3CP2A 4CO8A 2EK5A 4W1UA 4XLHA 4S0HB 1X1CA 2FD5A 3HPGA 3N05A 3HJEA 2MGQA 2K7LA 1YIJI 2WAEA 2A05A 1R22A 4F52A 5LFAA 4CICA 4KISA 3E0JB 2ME0A 4MTEA 1P7JA 3TQNA 3DPTA 3PL8A 4C9YA 1D5YA 3KEQA 1GXQA 4IOCF 3KP3A 2V1NA 2O0YA 2DA3A 4BEHA 2RN7A 3H35A 4A3MJ 4U7DA 1IV6A 4P55A 2FOWA 2KPMA 4JP0A 3ZMZA 3K4LA 2QCOA 1IRXA 1E2XA 1TZLA 3CUQC 4D5FA 1QA6A 4M6VA 2VLAA 2R5YA 3PNYA 4KYWA 3RCOA 1FBUA 2EINH 5FD5A 2FMLA 3CCYA 2LK2A 3DBRB 5TRDA 5HDKA 2OZUA 2P5KA 5HVQC 1ON2A 5ILSA 2X1CA 4A2UA 3HPHA 4IO9F 4UNOA 4II3A 4CH7A 4YG2F 1BW6A 1OCPA 1QPMA 2KZVA 3GTJJ 5EZHA 3IAS2 4BDYA 1H8AC 1I3QJ 3RIRA 5JFRA 2AQEA 3VSLA 4UXNA 1IUFA 1U6GA 4N0BA 3GTQJ 2DCEA 2GAUA 4D5CA 3R61A 5D6FA 4X0GA 2VBXA 5GADJ 4JK1X 3AL0B 4Y13A 2PJPA 3HC7A 1ETOA 4DZPA 1E3OC 3RZOJ 1Z7UA 2MSYA 4I0AA 1QHHD 3EDPA 2K4JA 1IZ1A 1G3SA 4XBFA 2CQKA 3HGGA 2M45A 2PQ8A 2R4GA 5M5YJ 1M1EB 2QQAA 4CSWA 3RKQA 2QYOA 3IH3A 1K7AA 1HQCA 3UR3C 3OWTA 2NNNA 3HRMA 4BHBA 3F21A 3W6KB 4D0PA 3WU1B 1NG7A 3ZQLA 2XRLA 4ZDPA 2BZTA 4KUMA 1RR7A 5AONA 4DNCA 2V6CA 2Y0SN 3PUFA 5KAIC 3FBNB 1QZZA 3Q3SA 1TNSA 3HG9A 2OC6A 3A02A 3K1PA 9ANTA 3SEQA 3S2DJ 2K4BA 2IGMA 2JJ7A 4YEJA 1WH7A 3ESWB 1K6YA 4AU7A 3U1KA 3BCAA 4LIVA 3BTIA 4ZYAA 3CCQI 3K2AA 2HWVA 2PEXA 2QWWA 1EH6A 2V26A 4HF2A 3ISPA 4FQGA 1Y56A 2HYGD 2EIMH 3M7GA 1ZRDA 1U3EM 2XAJA 4HNTA 1R9TJ 5CKTA 4Y17A 2LY9A 1R58A 1MBGA 4IHTA 1TT5B 4HNVA 5DYMA 3ABMH 3E5XA 4YIFA 3CZ6A 2DOEA 3IAM2 1VQ9I 4YFXF 2E1MC 5KCMA 3CUQB 5EG0B 2TRTA 1BI3A 2KHMA 1HF0A 2R7UA 2QUFA 2E7XA 4EJWA 2Q1ZB 3KZYA 1GUUA 1Z9CA 2MC4A 5HLIA 3EYYA 5F1JA 2Y2ZA 3PM1A 2H1KA 4KNYA 3F8BA 2HQAA 5CYVA 2VC0A 2R7DA 3CCRI 1IXSB 2JSPA 2WY8Q 4II2A 5CVRA 5J8FA 1T39A 3LL7A 1WI3A 1LPQA 2BY2A 5GAHJ 3JSOA 4A5NA 1Z91A 3HOXJ 2E35A 4BGDA 5FKOA 2VPRA 3C3WA 1WQ2A 3HOTA 1RUNA 1Y1WJ 5K5RA 3NAUA 3HKZN 2VE8A 4M74A 1U8BA 1W0TA 3LSTA 3DTEA 3BDDA 4BXUA 1ZN2A 2HOAA 2H09A 5EJCA 5DTDA 2K5CA 3DKXA 3J7AO 2EFNA 3BZ6A 3ROUA 2NS0A 1T8IA 2BBYA 1FP1D 1UHWA 4B44A 2M7BA 4WXCA 2HKOA 3LSHA 1QNTA 3RQIA 2QBYA 4ANJA 3O6BB 1G3TA 1S7EA 1GXPA 1TC3C 3A2KA 3PIOF 2N8GA 2UXNA 4GO1A 4KT6A 1DGRM 3CCJI 4OAYA 1UG2A 4NC7A 4A3KJ 2QKMB 3I4NJ 2W82A 1QHGA 3H0DA 5F0HA
chains in the Genus database with same CATH topology
4RB2C 2HEOA 3BJAA 1IAWA 4IPAA 5JVTA 2OD5A 3KCCA 3KLNA 3R4KA 4M9XA 4HAMA 4AVPA 2IRFG 1Z1DA 5IT3A 4GYIA 1IN8A 1K78B 3KP6A 1HBXG 1YS6A 4WK8F 2V9VA 3REOA 1FSHA 2STWA 3MQ0A 1Z6TA 2LKPA 4UHTA 2UXXA 5IT9K 2P7VB 5DUIA 1GHCA 3C1DA 2FBHA 1W7PB 2PG4A 1QBJA 3KLOA 2P5LC 3HYIA 1XGNA 1R36A 1R1TA 1IF1A 4IRGA 1XSVA 3HUGA 1YQAA 3QP5A 2EFWA 2XVCA 3KE2A 2OZ6A 2QVOA 1ZAOA 1MJ9A 2A61A 2L01A 4HX4A 1SD6A 1BC7C 3JAMK 4HLXA 3N97A 1TQMA 3RKXA 1IUYA 5JHUA 2HFHA 4UUVA 3FWEA 2GIVA 3T1BA 4BHCA 4OMZA 1A04A 4LLNA 3E5QA 2CSOA 4GCVA 4U88A 2MLKA 4EM2A 4CHUA 3T8TA 3IC7A 3HRUA 2L4MA 4KN4X 2H94A 5LGTA 1U2WA 1ZREA 3VB2A 3ZPLA 3QOPA 1XD7A 4LK0F 2ESHA 2CW0F 4EJOA 1I1SA 2FU4A 3K69A 4ENNA 2DI3A 5D6EA 3TKYA 5L3BA 1IXCA 3KETA 2DT5A 2P6SA 1DUXC 4Q5SF 2DFIA 1QZYA 3CDHA 4CDGA 4LLGF 3Q9VA 3KP7A 3E6CC 1O3RA 1MD0A 5JI6A 1KGSA 4BH9A 2OQGA 1ZH5A 3FX3A 3HHGA 2JZYA 2OA4A 2XV4S 2E1CA 1FYLA 5KVRA 2XKOA 2VT2A 1SD5A 2IT0A 2QBYB 1O57A 2MLGA 2HOEA 2F5EA 5LBQA 1TBXA 3T0YA 2XAQA 5CVVA 3GF2A 4M73A 3E6MA 1JHFA 2ZNYA 3WTSC 1BM9A 3QAHA 2O03A 3MAJA 4BYYA 3V4GA 5ICFA 4IJAA 3DQVC 5H6QA 1YLFA 1ZRCA 1USSA 1FYKA 4L9NA 3WTWC 4HX7A 3Q9SA 2QLZA 3GFMA 1LDJA 4GYGA 3I0TA 3R0AA 1YW7A 2M1BA 1UCRA 2D1VA 2V1DA 5E1ZB 3R60A 2A3SA 4N9IA 3KP5A 2HS5A 3LFKA 2OAZA 2W84A 4HA8A 5HDGA 4HDUA 4JBAA 3QRFF 4FHTA 3LQRA 5D5WB 3IWZA 4AWXB 3V8KA 4WX9A 4LGWA 2EV0A 5L3FA 1KU9A 2XAFA 2C6YA 5AIQA 2DPUA 2IA0A 5DCFA 1BN5A 5D4RA 2STTA 5BS6A 4M72A 2RNJA 2MH2A 3F8FA 2YSRA 2EV5A 3GZ5A 5D5UB 3E6DA 5CVIA 4MEYF 1B9MA 3HTUA 3K2ZA 3WTXC 3BJOA 2EJRA 2Q8KA 3CUOA 3SFZA 2X0LA 5TJJA 5E8GA 2D2WA 1RIOH 4O5VA 1ZLKA 3E97A 3LWFA 1UHMA 3V7RA 4A5MA 4L18B 3N4MA 1I6XA 1J0RA 1IN6A 1LB2A 1E17A 3COAC 2KRFA 4EJTA 4ESJA 3G73A 1ZLJA 5DD4A 4XSXF 2IA2A 1H9TA 3IWFA 1RUOA 2XASA 3HRSA 1PUEE 1F4KA 1KU3A 2RKHA 4UVBA 4HW0A 1HXDA 2CGPA 5KK1A 1KU7A 1LVAA 4LJZF 1HKTA 3GLXA 4LB5A 2RDPA 2FEZA 2XUBA 2M5WA 2GA2A 4RB1A 4HOBA 1AOYA 2RGVA 3DF8A 5LEJA 1WKMA 4JQFA 3I71A 2H6CA 4EV0A 3BOQA 4U7BA 1I27A 2DLLA 2PMHA 3ECHA 1LNWA 2L54A 5BPDA 5FFXA 3M8FA 1CF7A 2Z5UA 2VN2A 4RS8A 1XGOA 2ACJA 2GXGA 1EH8A 1FP2A 2FOKA 3D0SA 4S04A 1D3YA 5ICGA 1DPUA 3MZHA 3WTVC 2JT1A 2G7UA 3KP2A 1FBSA 4PDKA 3I4PA 3V8JA 3KP4A 1BBYA 2EA2A 4YFNF 3W6JB 2PLYA 3TOAA 1K78A 4U0YA 2VBZA 1XGSA 4HLYA 3U9GA 3LAPA 5LHHA 1FBQA 4L0YB 2ZXJA 3WGHA 3JTGA 2EA4A 1P92A 2DQRA 1J59A 3GX4X 2XROA 2HKXA 2DQLA 2WWYA 2F5DA 1J7KA 3BPXA 1TQIA 2AXLA 1DDNA 5D8LB 4PGGA 1W7PD 1YS7A 4BQAA 2XIGA 3RYPA 4IHSA 1R23A 3DP7A 4RAZA 2P8TA 2JPCA 2LSOA 2VOOA 4LG0A 4XRFA 3SZTA 2GWRA 1KA8A 3K0LA 3ABUA 2COMA 1PDNC 3H92A 4L9JA 1ON1A 1O3QA 2IJLA 3RKWA 4CZZA 3HSRA 4LG0B 4P9UA 2PBIA 3L2CA 4ZYHA 3EUHA 2V1UA 4M71A 1FYMA 3LQQA 1QGPA 1XB4A 5BPIA 2XAHA 2Z99A 2BYVE 3VEPA 3EETA 1T98A 3EQLF 1XSXA 4HX8A 1LJ9A 4LLLA 4G9YA 2K27A 1J9IA 2VT3A 4KIFA 4OOIA 4OIOF 1SD4A 5FD6A 1LDKB 4AIJA 2YX4A 1ZGAA 3LA3A 3GFLA 2P4WA 3Q5FA 2IPQX 1OYWA 3TDUC 3SHFA 5ILUA 1XMKA 3WTUC 3K1NA 4ON0A 4I7HA 6PAXA 1IN7A 2CWEA 2PI0A 3EYIA 3IHUA 1G6NA 2MBFA 3BROA 5HS7A 3SXYA 4IF4A 1W7PA 3GEZA 4P96A 2YX7A 2CG4A 2GZWA 2BE5F 2DK8A 1TW3A 3DV8A 2CO5A 4I02A 5LLQA 1L0OC 3HIFA 2Z33A 1S8NA 1D8JA 1XMAA 2UZKA 3P7NA 4N9HA 3ZMDA 2CYYA 3FXRA 3TO7A 5ED4A 3FXQA 5H20A 2O3FA 4Z2YA 3J81Z 1W5SA 3DEUA 4PGHA 1FWZA 1JXSA 3F23A 2Y48A 5ICEA 2DW4A 3DPLC 4I01A 3ZMTA 2KKOA 4Q47A 1SAXA 3HHHA 4OIRF 3I58A 5LEKA 3VFZA 4RAYA 1U78A 1LEBA 3F6VA 1V4RA 1IW7F 2P7CB 2W57A 2G7HA 2FRHA 1R5HA 3LA2A 4EVIA 3M8EA 4Q4ZF 1ODDA 5E18F 2KJBA 2FNPA 3I59A 3V8LA 5LHGA 2UWMA 4H0EA 1UFMA 3GW2A 2ZMEA 2D1HA 4HV6A 3AAFA 1RNLA 3IRRA 4RB0A 4XLPF 4EM0B 5HS9A 4EMSA 2IW5A 3K1MA 2H6BA 1TNTA 2OBPA 2Y75A 3I5UA 2FXAA 5D5VB 3JTHA 5EEGA 3FM5A 1W4MA 3WU0A 1T2KA 1RZ4A 5ILVA 2MA3A 1MDMA 3ULQB 5EEHA 4LD5A 1P4AA 3QU3A 2NNYA 3DXJF 2QZ8A 1JHHA 5HLHA 1XCVA 2VXZA 2D45A 2TDXA 3E6BA 3WTZA 3JW4A 5L3EA 3WGIA 4NHJA 3P9KA 4EQQA 1T0FA 3J81K 1H9GA 2O61A 3IKVA 1HKSA 2K86A 2GQQA 1P6RA 2EFPA 2NYXA 1STZA 1WRJA 3L7WA 3E5UA 2V79A 2LF8A 4FX0A 1HSJA 4A0ZA 4UV9A 2DBBA 5BMZA 1DPRA 4ASNA 3LAJA 2F5FA 2PN6A 5E8IA 4G8XA 2A68F 2XAGA 1K79A 4KT5C 3C18A 1MKMA 3I59B 2P5VA 3ZN0A 5CLSA 3KZZA 1ZRFA 4CXFA 2FNAA 1BI1A 2W25A 1OPCA 1G3YA 2Y0MA 4M9ZA 4NQWA 5F1RA 4KIBA 4EM1A 1S3JA 1IN5A 2VONA 4OIQF 1TW2A 4KDPA 2IP2A 3TO9A 1T38A 3KEOA 3IKTA 4UVAA 3P9IA 3DFGA 1YG2A 2JPBA 4XLNF 2NAZA 3VOEA 3J80Z 3WTYC 2OU2A 5FFZA 4U0VA 2W85A 3JSPA 1J2XA 3D5LA 4UV8A 5HS8A 3F6OA 1FNNA 4S05A 1S6LA 2P6TA 3GFIA 3GO5A 5HDNA 3L09A 2WV0A 1R1UA 4I98B 4ETSA 3V7CA 2NRAC 1UB9A 4A0XA 3ECOA 2X4HA 3R0JA 4O6JA 2IVMA 2R7FA 1XN7A 1U5TA 1S7AA 5DDGA 4F7ZA 4ENKA 1I1GA 3J80K 1ZG1A 2HDCA 4OINF 1FSEA 1FY7A 5E17F 1G3WA 1F9NA 3WTTC 3PFIA 4K2EA 3ZP5A 1D5VA 4HF0A 3RPUA 2Z9OA 5LGNA 4Y15A 4RGXA 1HW5A 4DQ2A 3FM3A 3FMSA 4U0WA 5DEQA 3MCZA 1B6AA 4M6YA 1QO0D 4L9TA 1YFHA 2KIMA 3T8RA 2FBIA 1ZARA 4YFKF 2W24A 5CJ9A 5D5XB 3BP8A 2DO7A 2VBWA 1BI2A 3CLOA 3IRQA 5J8CA 3F22A 1OKRA 2FMYA 4OU0A 3V7SA 2XHKA 2A07F 2QM3A 4EJUA 2O8XA 5BOXA 1S7OA 5DCMA 1SFUA 1B1BA 2HQNA 3MFKA 1SFXA 1BIAA 2FSWA 2VBYA 3KFWX 5J6XA 4WXDA 4BAYA 1WWXA 1FC3A 5D8KB 1YTYA 1K6OA 4TV7A 2ZBKA 4ZYEA 4EGYA 2ELHA 3GXOA 5DCMB 3WGGA 2GA1A 4G7OF 2M30A 2VC1A 5JR3A 3H3ZA 1ONVA 2HTSA 2JRTA 2HGCA 4AIHA 3DKWA 3I64A 2EV6A 2O6GE 1XSDA 1SFEA 1X3UA 2EWNA 4HQMA 5LRRA 1KU2A 3I54A 4ZYGA 1P2FA 4A6EA 1VTNC 5L3DA 3B02A 1HSTA 4HBLA 5L3GA 4E70A 4IRIA 2R3SA 3TOBA 2DU9A 4ZH4F 2OQRA 2WTEA 2LF7A 4RGRA 1YO5C 2PFBA 3HSEA 3CUQA 2PMUA 1R00A 3C7JA 4P5OA 4UVCA 1XDUA 1PP7U 4L0ZB 2HYFA 4MHGA 4ESBA 1MDMB 1NHAA 1B4AA 1U8RA 2A6EF 2EB7A 1TLHB 1FX7A 4R1HA 4RGSA 3FF5A 1OR7A 1XDSA 3G3ZA 2ZNZA 1QQIA 4P9FA 2A6HF 2A5YB 3ML6A 4HQEA 3CO6C 4WF2A 4BNCA 5AIPA 1KQ9A 3RJPA 4AIKA 3S2WA 1KYWA 3F3XA 2ZKZA 3QP6A 5D4SA 3ZMVA 4HF1A 3CO7C 2F5CA 1CF7B 3QU6A 2FQ3A 5LRSA 1O3TA 2ADUA 4KFCA 4G6QA 1MJBA 1FZPB 3BPVA 1IN4A 1OYYA 3WODF 1F5TA 2CFXA 2Z3YA 4AD9A 4EGZA 4HYEA 1IRFA 1BOAA 2BGCA 1FOKA 2G9WA 4RGUA 4MEXF 1XCBA 1BI0A 1ZGJA 3B73A 5A2QZ 2MC3A 1HW2A 5CVUA 5HLGA 5A2QK 2QQ9A 1Z6RA 1W5TA 2RQPA 1O3SA 4LK1F 4MNUA 4OMYA 3E3VA 2F2EA 3CJNA 3U1DA 3BWGA 2ZCWA 2H27A 1HW1A 2EFQA 3ERED 3ZN1A 3CTAA 3RDIA 1D8KA 4CGZA 3FZVA 3RKYA 1BJAA 1L3LA 3ZMUA 3OV8A 2DPDA 2ETHA 5K5QA 1DP7P 1BIBA 4MQVA 2YPRA 4G7ZF 1EH7A 5F64A 4WXHA 2ZFWA 4PCQA 3BJ6A 4PZJA 1Z05A 3SZPA 3R6SA 1KQ8A 1EV7A 1YIOA 1J75A 3O2PE 3QPTA 1HKQA 4KN7X 3RI4A 3QPHA 5DD8A 3GUDA 5FLXZ 1TTYA 2ZJ2A 3GVAA 4LFUA 4Q48A 1FLIA 4QLCU 1R5GA 2E7WA 2ZO4A 2XGXA 4I2OA 1SMTA 2B0LA 3K9TA 4I09A 3O3KA 2FE3A 4A0YA 2J5OA 1F1ZA 1ZYRF 3T5XA 4A6DA 4L5IA 3L9FA 1MZBA 1G4DA 5E20A 1ZHFA 4KMFA 5FLXK 2Q2EA 2RC4A 1C0WA 1MJAA 2LDUA 2MH9A 4B8XA 3M1EA 1ZG5A 1LEAA 2WC2A 2EFOA 5FB2A 1T6SA 2HQRA 2Q0OA 1SMYF 1YYVA 1LQ1A 3FXUA 3M9AA 3ABTA 5L3CA 5FO5A 1KQ0A 3MEXA 4ZZDA 4CYDA 1U5TC 3HRTA 2FF4A 3GYHX 1R1VA 2RVCA 4L9VA 5CVJA 5E1XA 1YW9A 3MWMA 3NQOA 2DAOA 1I5ZA 3HOSA 3FHZA 2GXBA 1BC8C 2LNBA 2BEOA 2A69F 4ENJA 1OMIA 4FT8A 5FGMA 3TDZC 3VODA 3RTRA 4ZYDA 2QENA 3WE2A 4EJVA 2E1NA 1FT9A 3WG9A 2FBKA 2JSCA 4OIPF 3PQKA 2KIFA 2J5PA 1SD7A 2RV8A 2ESNA 3NRVA 5LGUA 3ZQ7A 1B9NA 4LMYA 1IRGA 4QWQA 4KMUX 1O7LA 4ESFA 4WCGA 3MZYA 4G94A 2DK5A 4L5JA 4A12A 3F8CA 4HZFA 1AWCA 1ZG3A 5DV5A 1FPQA 3HSFA 1KYZA 4R8HA 4B09A 2XRNA 3ZMSA 3OOPA 3HTSB 2VODA 1LDDA 4ENMA 4KICA 3BY6A 2BV6A 1ULYA 2HZTA 2XKPA 4I0BA 2HR3A 1S29A 1O7FA 5IT9Z 1U5TB 4LB6B 2KIUA 1V3FA 1Y0UA 5E1WA 1GVJA 3GFJA 1WSUA 5K1YA 2K02A 5LHIA 5H6RA 1REPC 2YU3A 3F72A 4MTDA 4KA4A 1XGMA 3ELKA 3L00A 1TQPA 3TGNA 4G6DA 3H3UA 3P9CA 4IXAA 3LA7A 4HDVA 5ERIA 4FX4A 3F8MA 5K5OA 3I53A 4G7HF 2FA5A 4MGRA 1R7JA 3TO6A 1B59A 2AS5F 2KJCA 3FMRA 4M9SA 2VE9A 1WI9A 3RYRA 1OYIA 1J5YA 2ISZA 1IXRC 4MQ9F 2MD5A 3SQNA 3RPQA 3WE3A 1JE8A 4KIGA 4M6XA 1P4WA 4ZZLA 5ICCA 4IRHA 4GGGA 2ISYA 5BQTA 4XSZF 1PP8F 2IA1A 2V1XA 3NEUA 2L4AA 1H0MA 3PQJA 2VOPA 2JTVA 1P4XA 2M87A 1Q1HA 3U2RA 4IVNA 1MGTA 2M8EA 2YR2A 1USTA 4R79A 4NB5A 4YIIA 2ZMEB 3F8NA 5HOOA 4RB3C 3IL2A 3GWZA 1YW8A 4GXOA 2DTRA 1JGSA 3FMQA 2L3DA 4BHPA 1RI7A 5F6FA 2QQBA 2HTJA 5DUKA 4O3MA 4HV5A 4WWCA 1CGPA 2L02A 3GZ6A 3JAMZ 4CO8A 2EK5A 2K7LA 1R22A 4CICA 4MTEA 3TQNA 3DPTA 3KEQA 1GXQA 3KP3A 2O0YA 2RN7A 4U7DA 4P55A 3ZMZA 1E2XA 3CUQC 4KYWA 1FBUA 5FD5A 2FMLA 5TRDA 5HDKA 2OZUA 2P5KA 5HVQC 1ON2A 5ILSA 4A2UA 4UNOA 4YG2F 1QPMA 3RIRA 5JFRA 4UXNA 1U6GA 4N0BA 2GAUA 3R61A 5D6FA 2VBXA 4JK1X 4Y13A 2PJPA 1Z7UA 4I0AA 3EDPA 2K4JA 1IZ1A 1G3SA 4XBFA 2CQKA 2M45A 2PQ8A 2QQAA 2QYOA 1K7AA 1HQCA 2NNNA 3HRMA 4BHBA 3F21A 3W6KB 4D0PA 3WU1B 4KUMA 5AONA 4DNCA 2V6CA 1QZZA 1TNSA 3K1PA 2K4BA 2HWVA 2PEXA 2QWWA 1EH6A 4HF2A 3ISPA 2HYGD 3M7GA 1ZRDA 1U3EM 2XAJA 4Y17A 1R58A 4IHTA 5DYMA 3E5XA 4YIFA 4YFXF 3CUQB 1BI3A 2QUFA 2E7XA 4EJWA 3KZYA 1Z9CA 5HLIA 3EYYA 4KNYA 3F8BA 5CYVA 2VC0A 2R7DA 1IXSB 5CVRA 5J8FA 1T39A 3JSOA 4A5NA 1Z91A 3C3WA 1WQ2A 3HOTA 1RUNA 5K5RA 2VE8A 4M74A 3LSTA 3BDDA 4BXUA 1ZN2A 2H09A 3J7AO 2EFNA 3BZ6A 3ROUA 2NS0A 2BBYA 1FP1D 1UHWA 4WXCA 2HKOA 1QNTA 2QBYA 3O6BB 1G3TA 1GXPA 2UXNA 4GO1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4RB2 C;  2HEO A;  3BJA A;  1IAW A;  4IPA A;  5JVT A;  2OD5 A;  3KCC A;  3KLN A;  3R4K A;  4M9X A;  4HAM A;  4AVP A;  2IRF G;  1Z1D A;  5IT3 A;  4GYI A;  1IN8 A;  1K78 B;  3KP6 A;  1HBX G;  1YS6 A;  4WK8 F;  2V9V A;  3REO A;  1FSH A;  2STW A;  3MQ0 A;  1Z6T A;  2LKP A;  4UHT A;  2UXX A;  5IT9 K;  2P7V B;  5DUI A;  1GHC A;  3C1D A;  2FBH A;  1W7P B;  2PG4 A;  1QBJ A;  3KLO A;  2P5L C;  3HYI A;  1XGN A;  1R36 A;  1R1T A;  1IF1 A;  4IRG A;  1XSV A;  3HUG A;  1YQA A;  3QP5 A;  2EFW A;  2XVC A;  3KE2 A;  2OZ6 A;  2QVO A;  1ZAO A;  1MJ9 A;  2A61 A;  2L01 A;  4HX4 A;  1SD6 A;  1BC7 C;  3JAM K;  4HLX A;  3N97 A;  1TQM A;  3RKX A;  1IUY A;  5JHU A;  2HFH A;  4UUV A;  3FWE A;  2GIV A;  3T1B A;  4BHC A;  4OMZ A;  1A04 A;  4LLN A;  3E5Q A;  2CSO A;  4GCV A;  4U88 A;  2MLK A;  4EM2 A;  4CHU A;  3T8T A;  3IC7 A;  3HRU A;  2L4M A;  4KN4 X;  2H94 A;  5LGT A;  1U2W A;  1ZRE A;  3VB2 A;  3ZPL A;  3QOP A;  1XD7 A;  4LK0 F;  2ESH A;  2CW0 F;  4EJO A;  1I1S A;  2FU4 A;  3K69 A;  4ENN A;  2DI3 A;  5D6E A;  3TKY A;  5L3B A;  1IXC A;  3KET A;  2DT5 A;  2P6S A;  1DUX C;  4Q5S F;  2DFI A;  1QZY A;  3CDH A;  4CDG A;  4LLG F;  3Q9V A;  3KP7 A;  3E6C C;  1O3R A;  1MD0 A;  5JI6 A;  1KGS A;  4BH9 A;  2OQG A;  1ZH5 A;  3FX3 A;  3HHG A;  2JZY A;  2OA4 A;  2XV4 S;  2E1C A;  1FYL A;  5KVR A;  2XKO A;  2VT2 A;  1SD5 A;  2IT0 A;  2QBY B;  1O57 A;  2MLG A;  2HOE A;  2F5E A;  5LBQ A;  1TBX A;  3T0Y A;  2XAQ A;  5CVV A;  3GF2 A;  4M73 A;  3E6M A;  1JHF A;  2ZNY A;  3WTS C;  1BM9 A;  3QAH A;  2O03 A;  3MAJ A;  4BYY A;  3V4G A;  5ICF A;  4IJA A;  3DQV C;  5H6Q A;  1YLF A;  1ZRC A;  1USS A;  1FYK A;  4L9N A;  3WTW C;  4HX7 A;  3Q9S A;  2QLZ A;  3GFM A;  1LDJ A;  4GYG A;  3I0T A;  3R0A A;  1YW7 A;  2M1B A;  1UCR A;  2D1V A;  2V1D A;  5E1Z B;  3R60 A;  2A3S A;  4N9I A;  3KP5 A;  2HS5 A;  3LFK A;  2OAZ A;  2W84 A;  4HA8 A;  5HDG A;  4HDU A;  4JBA A;  3QRF F;  4FHT A;  3LQR A;  5D5W B;  3IWZ A;  4AWX B;  3V8K A;  4WX9 A;  4LGW A;  2EV0 A;  5L3F A;  1KU9 A;  2XAF A;  2C6Y A;  5AIQ A;  2DPU A;  2IA0 A;  5DCF A;  1BN5 A;  5D4R A;  2STT A;  5BS6 A;  4M72 A;  2RNJ A;  2MH2 A;  3F8F A;  2YSR A;  2EV5 A;  3GZ5 A;  5D5U B;  3E6D A;  5CVI A;  4MEY F;  1B9M A;  3HTU A;  3K2Z A;  3WTX C;  3BJO A;  2EJR A;  2Q8K A;  3CUO A;  3SFZ A;  2X0L A;  5TJJ A;  5E8G A;  2D2W A;  1RIO H;  4O5V A;  1ZLK A;  3E97 A;  3LWF A;  1UHM A;  3V7R A;  4A5M A;  4L18 B;  3N4M A;  1I6X A;  1J0R A;  1IN6 A;  1LB2 A;  1E17 A;  3COA C;  2KRF A;  4EJT A;  4ESJ A;  3G73 A;  1ZLJ A;  5DD4 A;  4XSX F;  2IA2 A;  1H9T A;  3IWF A;  1RUO A;  2XAS A;  3HRS A;  1PUE E;  1F4K A;  1KU3 A;  2RKH A;  4UVB A;  4HW0 A;  1HXD A;  2CGP A;  5KK1 A;  1KU7 A;  1LVA A;  4LJZ F;  1HKT A;  3GLX A;  4LB5 A;  2RDP A;  2FEZ A;  2XUB A;  2M5W A;  2GA2 A;  4RB1 A;  4HOB A;  1AOY A;  2RGV A;  3DF8 A;  5LEJ A;  1WKM A;  4JQF A;  3I71 A;  2H6C A;  4EV0 A;  3BOQ A;  4U7B A;  1I27 A;  2DLL A;  2PMH A;  3ECH A;  1LNW A;  2L54 A;  5BPD A;  5FFX A;  3M8F A;  1CF7 A;  2Z5U A;  2VN2 A;  4RS8 A;  1XGO A;  2ACJ A;  2GXG A;  1EH8 A;  1FP2 A;  2FOK A;  3D0S A;  4S04 A;  1D3Y A;  5ICG A;  1DPU A;  3MZH A;  3WTV C;  2JT1 A;  2G7U A;  3KP2 A;  1FBS A;  4PDK A;  3I4P A;  3V8J A;  3KP4 A;  1BBY A;  2EA2 A;  4YFN F;  3W6J B;  2PLY A;  3TOA A;  1K78 A;  4U0Y A;  2VBZ A;  1XGS A;  4HLY A;  3U9G A;  3LAP A;  5LHH A;  1FBQ A;  4L0Y B;  2ZXJ A;  3WGH A;  3JTG A;  2EA4 A;  1P92 A;  2DQR A;  1J59 A;  3GX4 X;  2XRO A;  2HKX A;  2DQL A;  2WWY A;  2F5D A;  1J7K A;  3BPX A;  1TQI A;  2AXL A;  1DDN A;  5D8L B;  4PGG A;  1W7P D;  1YS7 A;  4BQA A;  2XIG A;  3RYP A;  4IHS A;  1R23 A;  3DP7 A;  4RAZ A;  2P8T A;  2JPC A;  2LSO A;  2VOO A;  4LG0 A;  4XRF A;  3SZT A;  2GWR A;  1KA8 A;  3K0L A;  3ABU A;  2COM A;  1PDN C;  3H92 A;  4L9J A;  1ON1 A;  1O3Q A;  2IJL A;  3RKW A;  4CZZ A;  3HSR A;  4LG0 B;  4P9U A;  2PBI A;  3L2C A;  4ZYH A;  3EUH A;  2V1U A;  4M71 A;  1FYM A;  3LQQ A;  1QGP A;  1XB4 A;  5BPI A;  2XAH A;  2Z99 A;  2BYV E;  3VEP A;  3EET A;  1T98 A;  3EQL F;  1XSX A;  4HX8 A;  1LJ9 A;  4LLL A;  4G9Y A;  2K27 A;  1J9I A;  2VT3 A;  4KIF A;  4OOI A;  4OIO F;  1SD4 A;  5FD6 A;  1LDK B;  4AIJ A;  2YX4 A;  1ZGA A;  3LA3 A;  3GFL A;  2P4W A;  3Q5F A;  2IPQ X;  1OYW A;  3TDU C;  3SHF A;  5ILU A;  1XMK A;  3WTU C;  3K1N A;  4ON0 A;  4I7H A;  6PAX A;  1IN7 A;  2CWE A;  2PI0 A;  3EYI A;  3IHU A;  1G6N A;  2MBF A;  3BRO A;  5HS7 A;  3SXY A;  4IF4 A;  1W7P A;  3GEZ A;  4P96 A;  2YX7 A;  2CG4 A;  2GZW A;  2BE5 F;  2DK8 A;  1TW3 A;  3DV8 A;  2CO5 A;  4I02 A;  5LLQ A;  1L0O C;  3HIF A;  2Z33 A;  1S8N A;  1D8J A;  1XMA A;  2UZK A;  3P7N A;  4N9H A;  3ZMD A;  2CYY A;  3FXR A;  3TO7 A;  5ED4 A;  3FXQ A;  5H20 A;  2O3F A;  4Z2Y A;  3J81 Z;  1W5S A;  3DEU A;  4PGH A;  1FWZ A;  1JXS A;  3F23 A;  2Y48 A;  5ICE A;  2DW4 A;  3DPL C;  4I01 A;  3ZMT A;  2KKO A;  4Q47 A;  1SAX A;  3HHH A;  4OIR F;  3I58 A;  5LEK A;  3VFZ A;  4RAY A;  1U78 A;  1LEB A;  3F6V A;  1V4R A;  1IW7 F;  2P7C B;  2W57 A;  2G7H A;  2FRH A;  1R5H A;  3LA2 A;  4EVI A;  3M8E A;  4Q4Z F;  1ODD A;  5E18 F;  2KJB A;  2FNP A;  3I59 A;  3V8L A;  5LHG A;  2UWM A;  4H0E A;  1UFM A;  3GW2 A;  2ZME A;  2D1H A;  4HV6 A;  3AAF A;  1RNL A;  3IRR A;  4RB0 A;  4XLP F;  4EM0 B;  5HS9 A;  4EMS A;  2IW5 A;  3K1M A;  2H6B A;  1TNT A;  2OBP A;  2Y75 A;  3I5U A;  2FXA A;  5D5V B;  3JTH A;  5EEG A;  3FM5 A;  1W4M A;  3WU0 A;  1T2K A;  1RZ4 A;  5ILV A;  2MA3 A;  1MDM A;  3ULQ B;  5EEH A;  4LD5 A;  1P4A A;  3QU3 A;  2NNY A;  3DXJ F;  2QZ8 A;  1JHH A;  5HLH A;  1XCV A;  2VXZ A;  2D45 A;  2TDX A;  3E6B A;  3WTZ A;  3JW4 A;  5L3E A;  3WGI A;  4NHJ A;  3P9K A;  4EQQ A;  1T0F A;  3J81 K;  1H9G A;  2O61 A;  3IKV A;  1HKS A;  2K86 A;  2GQQ A;  1P6R A;  2EFP A;  2NYX A;  1STZ A;  1WRJ A;  3L7W A;  3E5U A;  2V79 A;  2LF8 A;  4FX0 A;  1HSJ A;  4A0Z A;  4UV9 A;  2DBB A;  5BMZ A;  1DPR A;  4ASN A;  3LAJ A;  2F5F A;  2PN6 A;  5E8I A;  4G8X A;  2A68 F;  2XAG A;  1K79 A;  4KT5 C;  3C18 A;  1MKM A;  3I59 B;  2P5V A;  3ZN0 A;  5CLS A;  3KZZ A;  1ZRF A;  4CXF A;  2FNA A;  1BI1 A;  2W25 A;  1OPC A;  1G3Y A;  2Y0M A;  4M9Z A;  4NQW A;  5F1R A;  4KIB A;  4EM1 A;  1S3J A;  1IN5 A;  2VON A;  4OIQ F;  1TW2 A;  4KDP A;  2IP2 A;  3TO9 A;  1T38 A;  3KEO A;  3IKT A;  4UVA A;  3P9I A;  3DFG A;  1YG2 A;  2JPB A;  4XLN F;  2NAZ A;  3VOE A;  3J80 Z;  3WTY C;  2OU2 A;  5FFZ A;  4U0V A;  2W85 A;  3JSP A;  1J2X A;  3D5L A;  4UV8 A;  5HS8 A;  3F6O A;  1FNN A;  4S05 A;  1S6L A;  2P6T A;  3GFI A;  3GO5 A;  5HDN A;  3L09 A;  2WV0 A;  1R1U A;  4I98 B;  4ETS A;  3V7C A;  2NRA C;  1UB9 A;  4A0X A;  3ECO A;  2X4H A;  3R0J A;  4O6J A;  2IVM A;  2R7F A;  1XN7 A;  1U5T A;  1S7A A;  5DDG A;  4F7Z A;  4ENK A;  1I1G A;  3J80 K;  1ZG1 A;  2HDC A;  4OIN F;  1FSE A;  1FY7 A;  5E17 F;  1G3W A;  1F9N A;  3WTT C;  3PFI A;  4K2E A;  3ZP5 A;  1D5V A;  4HF0 A;  3RPU A;  2Z9O A;  5LGN A;  4Y15 A;  4RGX A;  1HW5 A;  4DQ2 A;  3FM3 A;  3FMS A;  4U0W A;  5DEQ A;  3MCZ A;  1B6A A;  4M6Y A;  1QO0 D;  4L9T A;  1YFH A;  2KIM A;  3T8R A;  2FBI A;  1ZAR A;  4YFK F;  2W24 A;  5CJ9 A;  5D5X B;  3BP8 A;  2DO7 A;  2VBW A;  1BI2 A;  3CLO A;  3IRQ A;  5J8C A;  3F22 A;  1OKR A;  2FMY A;  4OU0 A;  3V7S A;  2XHK A;  2A07 F;  2QM3 A;  4EJU A;  2O8X A;  5BOX A;  1S7O A;  5DCM A;  1SFU A;  1B1B A;  2HQN A;  3MFK A;  1SFX A;  1BIA A;  2FSW A;  2VBY A;  3KFW X;  5J6X A;  4WXD A;  4BAY A;  1WWX A;  1FC3 A;  5D8K B;  1YTY A;  1K6O A;  4TV7 A;  2ZBK A;  4ZYE A;  4EGY A;  2ELH A;  3GXO A;  5DCM B;  3WGG A;  2GA1 A;  4G7O F;  2M30 A;  2VC1 A;  5JR3 A;  3H3Z A;  1ONV A;  2HTS A;  2JRT A;  2HGC A;  4AIH A;  3DKW A;  3I64 A;  2EV6 A;  2O6G E;  1XSD A;  1SFE A;  1X3U A;  2EWN A;  4HQM A;  5LRR A;  1KU2 A;  3I54 A;  4ZYG A;  1P2F A;  4A6E A;  1VTN C;  5L3D A;  3B02 A;  1HST A;  4HBL A;  5L3G A;  4E70 A;  4IRI A;  2R3S A;  3TOB A;  2DU9 A;  4ZH4 F;  2OQR A;  2WTE A;  2LF7 A;  4RGR A;  1YO5 C;  2PFB A;  3HSE A;  3CUQ A;  2PMU A;  1R00 A;  3C7J A;  4P5O A;  4UVC A;  1XDU A;  1PP7 U;  4L0Z B;  2HYF A;  4MHG A;  4ESB A;  1MDM B;  1NHA A;  1B4A A;  1U8R A;  2A6E F;  2EB7 A;  1TLH B;  1FX7 A;  4R1H A;  4RGS A;  3FF5 A;  1OR7 A;  1XDS A;  3G3Z A;  2ZNZ A;  1QQI A;  4P9F A;  2A6H F;  2A5Y B;  3ML6 A;  4HQE A;  3CO6 C;  4WF2 A;  4BNC A;  5AIP A;  1KQ9 A;  3RJP A;  4AIK A;  3S2W A;  1KYW A;  3F3X A;  2ZKZ A;  3QP6 A;  5D4S A;  3ZMV A;  4HF1 A;  3CO7 C;  2F5C A;  1CF7 B;  3QU6 A;  2FQ3 A;  5LRS A;  1O3T A;  2ADU A;  4KFC A;  4G6Q A;  1MJB A;  1FZP B;  3BPV A;  1IN4 A;  1OYY A;  3WOD F;  1F5T A;  2CFX A;  2Z3Y A;  4AD9 A;  4EGZ A;  4HYE A;  1IRF A;  1BOA A;  2BGC A;  1FOK A;  2G9W A;  4RGU A;  4MEX F;  1XCB A;  1BI0 A;  1ZGJ A;  3B73 A;  5A2Q Z;  2MC3 A;  1HW2 A;  5CVU A;  5HLG A;  5A2Q K;  2QQ9 A;  1Z6R A;  1W5T A;  2RQP A;  1O3S A;  4LK1 F;  4MNU A;  4OMY A;  3E3V A;  2F2E A;  3CJN A;  3U1D A;  3BWG A;  2ZCW A;  2H27 A;  1HW1 A;  2EFQ A;  3ERE D;  3ZN1 A;  3CTA A;  3RDI A;  1D8K A;  4CGZ A;  3FZV A;  3RKY A;  1BJA A;  1L3L A;  3ZMU A;  3OV8 A;  2DPD A;  2ETH A;  5K5Q A;  1DP7 P;  1BIB A;  4MQV A;  2YPR A;  4G7Z F;  1EH7 A;  5F64 A;  4WXH A;  2ZFW A;  4PCQ A;  3BJ6 A;  4PZJ A;  1Z05 A;  3SZP A;  3R6S A;  1KQ8 A;  1EV7 A;  1YIO A;  1J75 A;  3O2P E;  3QPT A;  1HKQ A;  4KN7 X;  3RI4 A;  3QPH A;  5DD8 A;  3GUD A;  5FLX Z;  1TTY A;  2ZJ2 A;  3GVA A;  4LFU A;  4Q48 A;  1FLI A;  4QLC U;  1R5G A;  2E7W A;  2ZO4 A;  2XGX A;  4I2O A;  1SMT A;  2B0L A;  3K9T A;  4I09 A;  3O3K A;  2FE3 A;  4A0Y A;  2J5O A;  1F1Z A;  1ZYR F;  3T5X A;  4A6D A;  4L5I A;  3L9F A;  1MZB A;  1G4D A;  5E20 A;  1ZHF A;  4KMF A;  5FLX K;  2Q2E A;  2RC4 A;  1C0W A;  1MJA A;  2LDU A;  2MH9 A;  4B8X A;  3M1E A;  1ZG5 A;  1LEA A;  2WC2 A;  2EFO A;  5FB2 A;  1T6S A;  2HQR A;  2Q0O A;  1SMY F;  1YYV A;  1LQ1 A;  3FXU A;  3M9A A;  3ABT A;  5L3C A;  5FO5 A;  1KQ0 A;  3MEX A;  4ZZD A;  4CYD A;  1U5T C;  3HRT A;  2FF4 A;  3GYH X;  1R1V A;  2RVC A;  4L9V A;  5CVJ A;  5E1X A;  1YW9 A;  3MWM A;  3NQO A;  2DAO A;  1I5Z A;  3HOS A;  3FHZ A;  2GXB A;  1BC8 C;  2LNB A;  2BEO A;  2A69 F;  4ENJ A;  1OMI A;  4FT8 A;  5FGM A;  3TDZ C;  3VOD A;  3RTR A;  4ZYD A;  2QEN A;  3WE2 A;  4EJV A;  2E1N A;  1FT9 A;  3WG9 A;  2FBK A;  2JSC A;  4OIP F;  3PQK A;  2KIF A;  2J5P A;  1SD7 A;  2RV8 A;  2ESN A;  3NRV A;  5LGU A;  3ZQ7 A;  1B9N A;  4LMY A;  1IRG A;  4QWQ A;  4KMU X;  1O7L A;  4ESF A;  4WCG A;  3MZY A;  4G94 A;  2DK5 A;  4L5J A;  4A12 A;  3F8C A;  4HZF A;  1AWC A;  1ZG3 A;  5DV5 A;  1FPQ A;  3HSF A;  1KYZ A;  4R8H A;  4B09 A;  2XRN A;  3ZMS A;  3OOP A;  3HTS B;  2VOD A;  1LDD A;  4ENM A;  4KIC A;  3BY6 A;  2BV6 A;  1ULY A;  2HZT A;  2XKP A;  4I0B A;  2HR3 A;  1S29 A;  1O7F A;  5IT9 Z;  1U5T B;  4LB6 B;  2KIU A;  1V3F A;  1Y0U A;  5E1W A;  1GVJ A;  3GFJ A;  1WSU A;  5K1Y A;  2K02 A;  5LHI A;  5H6R A;  1REP C;  2YU3 A;  3F72 A;  4MTD A;  4KA4 A;  1XGM A;  3ELK A;  3L00 A;  1TQP A;  3TGN A;  4G6D A;  3H3U A;  3P9C A;  4IXA A;  3LA7 A;  4HDV A;  5ERI A;  4FX4 A;  3F8M A;  5K5O A;  3I53 A;  4G7H F;  2FA5 A;  4MGR A;  1R7J A;  3TO6 A;  1B59 A;  2AS5 F;  2KJC A;  3FMR A;  4M9S A;  2VE9 A;  1WI9 A;  3RYR A;  1OYI A;  1J5Y A;  2ISZ A;  1IXR C;  4MQ9 F;  2MD5 A;  3SQN A;  3RPQ A;  3WE3 A;  1JE8 A;  4KIG A;  4M6X A;  1P4W A;  4ZZL A;  5ICC A;  4IRH A;  4GGG A;  2ISY A;  5BQT A;  4XSZ F;  1PP8 F;  2IA1 A;  2V1X A;  3NEU A;  2L4A A;  1H0M A;  3PQJ A;  2VOP A;  2JTV A;  1P4X A;  2M87 A;  1Q1H A;  3U2R A;  4IVN A;  1MGT A;  2M8E A;  2YR2 A;  1UST A;  4R79 A;  4NB5 A;  4YII A;  2ZME B;  3F8N A;  5HOO A;  4RB3 C;  3IL2 A;  3GWZ A;  1YW8 A;  4GXO A;  2DTR A;  1JGS A;  3FMQ A;  2L3D A;  4BHP A;  1RI7 A;  5F6F A;  2QQB A;  2HTJ A;  5DUK A;  4O3M A;  4HV5 A;  4WWC A;  1CGP A;  2L02 A;  3GZ6 A;  3JAM Z;  4CO8 A;  2EK5 A;  2K7L A;  1R22 A;  4CIC A;  4MTE A;  3TQN A;  3DPT A;  3KEQ A;  1GXQ A;  3KP3 A;  2O0Y A;  2RN7 A;  4U7D A;  4P55 A;  3ZMZ A;  1E2X A;  3CUQ C;  4KYW A;  1FBU A;  5FD5 A;  2FML A;  5TRD A;  5HDK A;  2OZU A;  2P5K A;  5HVQ C;  1ON2 A;  5ILS A;  4A2U A;  4UNO A;  4YG2 F;  1QPM A;  3RIR A;  5JFR A;  4UXN A;  1U6G A;  4N0B A;  2GAU A;  3R61 A;  5D6F A;  2VBX A;  4JK1 X;  4Y13 A;  2PJP A;  1Z7U A;  4I0A A;  3EDP A;  2K4J A;  1IZ1 A;  1G3S A;  4XBF A;  2CQK A;  2M45 A;  2PQ8 A;  2QQA A;  2QYO A;  1K7A A;  1HQC A;  2NNN A;  3HRM A;  4BHB A;  3F21 A;  3W6K B;  4D0P A;  3WU1 B;  4KUM A;  5AON A;  4DNC A;  2V6C A;  1QZZ A;  1TNS A;  3K1P A;  2K4B A;  2HWV A;  2PEX A;  2QWW A;  1EH6 A;  4HF2 A;  3ISP A;  2HYG D;  3M7G A;  1ZRD A;  1U3E M;  2XAJ A;  4Y17 A;  1R58 A;  4IHT A;  5DYM A;  3E5X A;  4YIF A;  4YFX F;  3CUQ B;  1BI3 A;  2QUF A;  2E7X A;  4EJW A;  3KZY A;  1Z9C A;  5HLI A;  3EYY A;  4KNY A;  3F8B A;  5CYV A;  2VC0 A;  2R7D A;  1IXS B;  5CVR A;  5J8F A;  1T39 A;  3JSO A;  4A5N A;  1Z91 A;  3C3W A;  1WQ2 A;  3HOT A;  1RUN A;  5K5R A;  2VE8 A;  4M74 A;  3LST A;  3BDD A;  4BXU A;  1ZN2 A;  2H09 A;  3J7A O;  2EFN A;  3BZ6 A;  3ROU A;  2NS0 A;  2BBY A;  1FP1 D;  1UHW A;  4WXC A;  2HKO A;  1QNT A;  2QBY A;  3O6B B;  1G3T A;  1GXP A;  2UXN A;  4GO1 A; 
#chains in the Genus database with same CATH topology
 2IBD A;  2AHQ A;  2GOM A;  4RB2 C;  2HEO A;  5J47 A;  3BJA A;  1IAW A;  4IPA A;  5JVT A;  3FXO A;  2OD5 A;  3KCC A;  2LBF B;  2QA4 I;  3KLN A;  3R4K A;  4M9X A;  2E71 A;  4HSR A;  2CUJ A;  2Y0S A;  4XKW A;  1Q1V A;  4F92 B;  4XQF A;  4HAM A;  1ETY A;  2VI6 A;  4AVP A;  5F04 A;  4G12 A;  2K9L A;  1NK2 P;  2EBI A;  2IRF G;  1Z1D A;  5IT3 A;  4GYI A;  3I9V 2;  1IN8 A;  5H2F C;  2ID6 A;  1K78 B;  3KP6 A;  5E3N A;  1HBX G;  1YS6 A;  2E1O A;  4WK8 F;  2V9V A;  1AA7 A;  3REO A;  1FSH A;  2STW A;  3MQ0 A;  1Z6T A;  2LKP A;  4UHT A;  3MZ8 A;  2VJ4 A;  2BVL A;  5FKK A;  3L2V A;  2UXX A;  2XDV A;  4DBQ A;  5IT9 K;  2P7V B;  5DUI A;  1GHC A;  3CJT B;  3S1Q J;  1S5L C;  4KIT B;  3CC4 I;  3C1D A;  2DA4 A;  2NVT J;  2FBH A;  3KYL A;  1W7P B;  4E7Z A;  2PG4 A;  1QBJ A;  4XOT A;  3M07 A;  3ZCO A;  2RRE A;  2VQC A;  3KLO A;  2P5L C;  3HYI A;  3VSK A;  1XGN A;  1R36 A;  1R1T A;  2E60 A;  3MMY B;  1IF1 A;  3BR0 A;  1W36 C;  2JVG A;  4IRG A;  1XSV A;  3HUG A;  3OYK A;  1YQA A;  3QP5 A;  2EFW A;  2XVC A;  3KE2 A;  2OZ6 A;  3BC8 A;  4UB6 C;  2NOJ B;  2QVO A;  1JJ6 C;  1ZAO A;  1MJ9 A;  4JX5 A;  2A61 A;  4DBR A;  3ZOB A;  2L01 A;  1T95 A;  4HX4 A;  4BQN A;  1SD6 A;  3DBL B;  4B48 A;  4BJ5 C;  1BC7 C;  3JAM K;  2L7K A;  2VPL A;  4HLX A;  2XB5 A;  1ZKG A;  3N97 A;  1TQM A;  3RKX A;  2K3F A;  1IUY A;  5JHU A;  2E2I J;  2HFH A;  3HB9 A;  4UUV A;  3FWE A;  2VB6 A;  2R7S A;  2GIV A;  3T1B A;  3ASN H;  4OMZ A;  4BHC A;  2KIS A;  1A04 A;  4LLN A;  3E5Q A;  1MBJ A;  4V2F A;  1JUS A;  2CSO A;  2VQG A;  4GCV A;  4U88 A;  2OJE D;  2MLK A;  2OCC H;  4EM2 A;  2LKX A;  1FMV A;  4CHU A;  4IOA F;  3OSG A;  2UV1 A;  3BZC A;  3IC7 A;  4MIM A;  3T8T A;  3HRU A;  3OS2 A;  2DFE A;  1V55 H;  1IDY A;  2L4M A;  3HBL A;  4KN4 X;  2H94 A;  2E5Z A;  1U2W A;  5LGT A;  2XB0 X;  1ZRE A;  3VB2 A;  1JUP A;  2NS8 A;  3QOP A;  2DA1 A;  3CC2 I;  3ZPL A;  1XD7 A;  1N78 A;  4LK0 F;  1QPI A;  5FKM A;  2WAQ A;  2ESH A;  3BG9 A;  2CW0 F;  3HOW J;  1APL C;  3SFI A;  4EJO A;  2FU4 A;  3K69 A;  1I1S A;  4RA2 A;  2DI3 A;  3BR2 A;  4ENN A;  5D6E A;  2ZB9 A;  3TKY A;  5L3B A;  2MW8 A;  1IXC A;  2VL8 A;  3KET A;  3BR6 A;  4A3G J;  1X1D A;  2DT5 A;  3OYL A;  5K7F A;  3A03 A;  3S15 J;  2P6S A;  1DUX C;  4Q5S F;  2DFI A;  4D7M A;  1QZY A;  2W7N A;  3CDH A;  3PUB A;  3H5R A;  4CDG A;  4LLG F;  3Q9V A;  3KP7 A;  3AL0 C;  3E6C C;  3OYM A;  3BZK A;  4BAC A;  1O3R A;  3OYN A;  1MD0 A;  3CCV I;  4RLQ A;  5JI6 A;  1I50 J;  1D0X A;  1KGS A;  4BH9 A;  4F3Q A;  2OQG A;  1H89 C;  1ZH5 A;  2R7Z J;  3J7A Y;  3PO3 J;  1ZQ3 P;  2Z2S B;  4YRV A;  4YEL A;  4HEA 2;  3FX3 A;  3S32 A;  3PSF A;  4M3D A;  3HHG A;  2JZY A;  2OA4 A;  2TCT A;  2XV4 S;  2E1C A;  1FYL A;  5KVR A;  2CQ7 A;  2XKO A;  3B6A A;  2VT2 A;  2KIQ A;  4FE4 A;  1OFC X;  1SD5 A;  2CQN A;  3MKL A;  5GP9 A;  2IT0 A;  1FOY A;  2QBY B;  1JUM A;  1O57 A;  2MLG A;  2K9Q A;  2HNH A;  2HOE A;  3ABK H;  3CF5 F;  4UUT A;  3RPU D;  2F5E A;  5LBQ A;  5JLW A;  1TBX A;  1Y8Q B;  2XAQ A;  3K4J A;  2UUZ A;  5CVV A;  3T0Y A;  4BE2 A;  3GF2 A;  4M73 A;  3OIQ A;  3E6M A;  1JHF A;  2X9D A;  2ZNY A;  3WTS C;  3QQA A;  1BM9 A;  1BL0 A;  1XS9 A;  1D0Z A;  1G8X A;  3QAH A;  4Y7N J;  2CQX A;  2O03 A;  2L7M P;  3EUA A;  3MAJ A;  1ETQ A;  4BYY A;  1PUF B;  2QF7 A;  4E7J A;  3V4G A;  2DFF A;  5ICF A;  4C2M J;  1HDP A;  4IJA A;  1T0F C;  3DQV C;  5H6Q A;  4IHV A;  1YLF A;  1ZRC A;  2L9S A;  2DDB A;  3IH4 A;  1USS A;  1FYK A;  3BR1 A;  4MFD A;  1GLN A;  3I3L A;  4L9N A;  3WTW C;  3OYC A;  4HX7 A;  3Q9S A;  2QLZ A;  3GFM A;  4FTH A;  1LDJ A;  2KT0 A;  2F6C A;  4GYG A;  2DA7 A;  3I0T A;  3R0A A;  1YW7 A;  2DJI A;  2M1B A;  1UCR A;  1LUJ B;  2M0C A;  4LIT A;  5J4V A;  1XMX A;  1DU6 A;  3H36 A;  2GBY A;  3O8G A;  1NG6 A;  2D1V A;  2V1D A;  5E1Z B;  4XLC A;  3R60 A;  2A3S A;  4N9I A;  4XKV A;  3KP5 A;  2HS5 A;  4IQ4 A;  3LFK A;  2OAZ A;  2W84 A;  1ORK A;  2LH9 A;  4HA8 A;  5HDG A;  4HDU A;  2JA6 J;  1MW7 A;  4JBA A;  3OYG A;  3GTL J;  5E3L A;  2X6Y A;  3QRF F;  4ITV A;  4FHT A;  1X3W B;  3LQR A;  3IWZ A;  4AWX B;  5D5W B;  4F55 A;  3QYE A;  3V8K A;  2R7X A;  2K9M A;  5J1Y A;  4W97 A;  3RQ4 A;  2XF5 A;  4C2U A;  4WX9 A;  2KRC A;  3CJR B;  4LGW A;  4XKC A;  5JLX A;  2EV0 A;  5L3F A;  4PSX A;  1P9Q C;  1KU9 A;  2XAF A;  2OV7 A;  2C6Y A;  5AIQ A;  2DPU A;  2IA0 A;  5DCF A;  1BN5 A;  5D4R A;  2CQQ A;  2STT A;  4C3J J;  3GTM J;  3IH2 A;  5BS6 A;  2R0Q C;  4M72 A;  2RNJ A;  2LMD A;  2HDD A;  4ZTJ A;  2HVR A;  1WH5 A;  4FET A;  5GAG J;  2VQL A;  2QQ8 A;  3HXL A;  2CW7 A;  4RLF A;  2MH2 A;  3GCM A;  5C3E J;  3F8F A;  2YSR A;  3I55 I;  2EV5 A;  3GZ5 A;  4RAG A;  3DTI A;  3ZQQ A;  3BLY A;  2I10 A;  5D5U B;  1VQK I;  3E6D A;  5CVI A;  4MEY F;  3BTC A;  1B9M A;  3HTU A;  3K2Z A;  5KHD A;  3WTX C;  4XRS G;  3BJO A;  2EJR A;  2Q8K A;  2G0E A;  4JX4 A;  3CUO A;  3SFZ A;  2QKL B;  2X0L A;  3S17 J;  5TJJ A;  5E8G A;  2D2W A;  1RIO H;  3LMM A;  4O5V A;  1ZLK A;  3E97 A;  3LWF A;  3OYF A;  1RC9 A;  4IZZ A;  1UHM A;  2L7F P;  3H0G J;  3UNG C;  4DW6 A;  2CUE A;  3V7R A;  4A5M A;  4L18 B;  4E7K A;  3N4M A;  1I6X A;  1J0R A;  1IN6 A;  1HDD C;  1VQ6 I;  1LB2 A;  1E17 A;  1Z3Y A;  2DTZ A;  3COA C;  4B4C A;  1X19 A;  3CP8 A;  4BJ6 C;  2WV1 A;  2V9P A;  4J19 A;  1MSF C;  1FEX A;  4PFP A;  2KRF A;  4EJT A;  4ESJ A;  3G73 A;  1ZLJ A;  1UMQ A;  5DD4 A;  3OYI A;  3A0B C;  3AG2 H;  4XSX F;  2IA2 A;  1H9T A;  4C3I J;  3OSF A;  3IWF A;  1RUO A;  2XAS A;  1RET A;  3HRS A;  3VYT B;  1PUE E;  1F4K A;  4A3J J;  2RKH A;  1KU3 A;  4UVB A;  3NWS A;  1GVD A;  2M0M A;  4HW0 A;  1HXD A;  2CGP A;  5KK1 A;  2LTP A;  1Z21 A;  1KU7 A;  3FK7 A;  1LVA A;  4LJZ F;  3PJR A;  2ZME C;  1HKT A;  2OPT A;  3CQZ J;  3GLX A;  3H5A A;  3SDG A;  2ME6 A;  4LB5 A;  3ZGK A;  2RDP A;  2FEZ A;  2XUB A;  3P5J A;  1K4T A;  3K7A J;  5EDN A;  4LOC A;  2M5W A;  2GA2 A;  4RB1 A;  4HOB A;  2QSH X;  1AOY A;  2RGV A;  1QU3 A;  3DPU A;  3DF8 A;  1VQO I;  5LEJ A;  1WKM A;  2VXD A;  1B72 A;  4JQF A;  3I71 A;  2H6C A;  4EV0 A;  3BOQ A;  4U7B A;  4PJJ A;  1I27 A;  2DLL A;  2ECB A;  2PMH A;  4IX7 A;  4XRS A;  3ECH A;  1OCO H;  3FIW A;  1LNW A;  2L54 A;  3AKZ A;  5BPD A;  5FFX A;  2DMU A;  3M8F A;  2H8R A;  1CF7 A;  4HG2 A;  2ZXI A;  4E7H A;  2Z5U A;  2VN2 A;  4RS8 A;  1XGO A;  2ACJ A;  3H3V K;  2GXG A;  2LC2 A;  4M3G A;  1EH8 A;  3PO2 J;  1FP2 A;  5C44 J;  2FOK A;  3LSP A;  3D0S A;  3OYD A;  4S04 A;  1D3Y A;  2ZC2 A;  4CCJ A;  5ICG A;  3AFH A;  1JJ8 C;  1Z7L A;  1DPU A;  4X6A J;  3MZH A;  3WTV C;  2JT1 A;  4DYR A;  2G7U A;  3KP2 A;  1FBS A;  4I99 C;  4PDK A;  3ZQF A;  1Z3X A;  3K10 A;  2LR8 A;  3I4P A;  3V8J A;  1SC7 A;  3KP4 A;  1BBY A;  2EA2 A;  4YFN F;  1TP4 A;  3W6J B;  4D1Q A;  2PLY A;  3TOA A;  1K78 A;  4U0Y A;  2VBZ A;  3GBG A;  1XGS A;  2AXT C;  4EAT A;  3ASO H;  2EIJ H;  4HLY A;  3FKJ A;  3U9G A;  3LAP A;  1QVT A;  5LHH A;  1FBQ A;  4L0Y B;  2ZXJ A;  3WGH A;  3JTG A;  1JI8 A;  2EA4 A;  5BNG A;  1P92 A;  2DQR A;  3CF2 A;  1BA5 A;  5E3O A;  1J59 A;  5F0F A;  3FXJ A;  3GX4 X;  2XRO A;  3WHB A;  2HKX A;  1FMW A;  2DQL A;  3L1P A;  2WWY A;  2LRE A;  2F5D A;  1J7K A;  2Y9Y A;  3BPX A;  1TQI A;  2AXL A;  1DDN A;  2RQQ A;  2JWT A;  5D8L B;  1VQM I;  1ENH A;  4BE0 A;  4PGG A;  1X4O A;  2W00 A;  3CMY A;  1W7P D;  5M3F J;  1YS7 A;  2V4J C;  3OMY A;  4BQA A;  3OIO A;  2PMZ A;  4C3H J;  3LSM A;  2XIG A;  1MNM C;  4CCN A;  1Z77 A;  3DLA A;  5GAE J;  1DP3 A;  3RYP A;  1MBE A;  4ZTF A;  4IHS A;  3L2U A;  3D5R C;  1R23 A;  4Z6Y A;  1MSE C;  1H88 C;  4FCY A;  3DP7 A;  2BHY A;  4RAZ A;  2P8T A;  2JPC A;  2LSO A;  2VOO A;  1OCC H;  4LG0 A;  4XRF A;  3DTK A;  3SZT A;  5CPR B;  2BHZ A;  2XPU A;  2M2E A;  2GWR A;  1KA8 A;  5EYR A;  4XON A;  2HXI A;  1XC5 A;  5FRN A;  3K0L A;  3ABU A;  2EZL A;  2COM A;  1PDN C;  4H4K C;  1VFC A;  2JMW A;  3H92 A;  4NDL A;  2DA5 A;  2LG4 A;  4HPQ A;  5K7H A;  4L9J A;  1ON1 A;  1A6Q A;  1O3Q A;  2IJL A;  3RKW A;  4IHW A;  3CD6 I;  4CZZ A;  3HSR A;  4LG0 B;  3K4N A;  5B66 C;  4P9U A;  2PBI A;  5HNH A;  3OR2 C;  3L2C A;  4ZYH A;  2IXS A;  3EUH A;  2V1U A;  4M71 A;  1FYM A;  5M5X J;  3LQQ A;  1QGP A;  3M1C A;  1XB4 A;  5BPI A;  2XAH A;  3CCM I;  4NC8 A;  2QEX I;  2VUM J;  1HC8 A;  2Z99 A;  3JRH A;  3OL3 A;  2BYV E;  4BBR J;  1FIA A;  3VEP A;  2Y69 H;  3EET A;  1T98 A;  1GV2 A;  1TWC J;  1XSX A;  3EQL F;  3OYB A;  4HX8 A;  2LVS A;  1LJ9 A;  4LLL A;  2XGC A;  2K27 A;  3B6C A;  4G9Y A;  1J9I A;  2VT3 A;  4KIF A;  3MN2 A;  4FIS A;  4OOI A;  4AID A;  1YI2 I;  5C4J J;  1X1B A;  4G6T B;  4OIO F;  1SD4 A;  5FD6 A;  1LDK B;  4AIJ A;  2R7O A;  4XOP A;  2M4G A;  3WG7 H;  3FXM A;  2R7V A;  1RKT A;  2YX4 A;  1ZGA A;  3LA3 A;  3GFL A;  1UZC A;  2BY3 A;  2L5Q A;  2IPQ X;  2P4W A;  3M8J A;  2A6T A;  3Q5F A;  1LFU P;  1NK3 P;  1OYW A;  2XGD A;  1KON A;  3TDU C;  1YJW I;  2NVY J;  3SHF A;  4XMY A;  5ILU A;  1XMK A;  4A3L J;  3WTU C;  1D1B A;  4PJM A;  3K1N A;  4ON0 A;  4I7H A;  6PAX A;  2R7R A;  1IN7 A;  5HLT A;  4UY8 I;  2CWE A;  2PI0 A;  2PJR B;  1PYV A;  2COB A;  2V9K A;  3AG3 H;  3EYI A;  2BY0 A;  1G6N A;  3IHU A;  2MBF A;  3BRO A;  3FXK A;  3IV5 A;  2DXI A;  1RR8 C;  1HOM A;  5HS7 A;  1IJW C;  3SXY A;  4IF4 A;  4XN3 A;  3RZD J;  2MAB A;  4J00 A;  3BG3 A;  2WA0 A;  1W7P A;  2DA2 A;  3GEZ A;  5IYD J;  1ZR2 A;  1UJ8 A;  4P96 A;  1YE9 A;  2YX7 A;  2I8D A;  3GTK J;  2CG4 A;  2GZW A;  2BE5 F;  2DK8 A;  4I76 A;  1TW3 A;  3DV8 A;  4IL6 C;  2CO5 A;  4I02 A;  5LLQ A;  3TED A;  3BQY A;  1L0O C;  1DQU A;  3HIF A;  2Z33 A;  2CV2 A;  1S8N A;  1D8J A;  1XMA A;  1ACI A;  2L2O A;  4M3E A;  5CQE A;  2D5V A;  2VJ5 A;  2H8W A;  2UZK A;  1MMS A;  2V7F A;  3P7N A;  1E3H A;  3A01 A;  2H1L A;  4N9H A;  3ZMD A;  1ETX A;  1I6H J;  2CYY A;  2KDO A;  3FXR A;  3TO7 A;  5ED4 A;  3FXQ A;  4E6K G;  5H20 A;  1MMA A;  2NVU B;  2M34 A;  2O3F A;  3OIP A;  4Z2Y A;  3J81 Z;  1W5S A;  3DEU A;  1N25 A;  4CCL A;  4PGH A;  1IV8 A;  1FWZ A;  2PX9 A;  1IRZ A;  1JXS A;  3F23 A;  2Y48 A;  5ICE A;  2DW4 A;  3DPL C;  4I01 A;  3ZMT A;  2KKO A;  4Q47 A;  1SAX A;  3CCL I;  3HHH A;  4D7N A;  4CUG A;  1T56 A;  4OIR F;  3I58 A;  5LEK A;  3VFZ A;  1FTT A;  1AKH A;  1MBK A;  4RAY A;  2CV0 A;  1U78 A;  1LEB A;  3ZXS A;  3F6V A;  1V4R A;  3G6E I;  1IW7 F;  2P7C B;  2W57 A;  1W1W E;  1WZ2 A;  2G7H A;  2FRH A;  1R5H A;  3LA2 A;  4EVI A;  3L2R A;  3OY9 A;  3M8E A;  1MNE A;  2LYC A;  4QTR A;  1N77 A;  3I56 I;  4Q4Z F;  4CCM A;  4Y4R A;  1OCT C;  5FJ8 J;  3DEE A;  5FRM A;  3CLQ A;  4DIQ A;  1ODD A;  1YX5 A;  2EH3 A;  3K6G A;  5E18 F;  2KJB A;  5FLM J;  2YU9 J;  1MMN A;  1B8I A;  5IY5 H;  3LSI A;  3HM5 A;  2FNP A;  3I59 A;  4GRI A;  2QGU A;  2KRH A;  3V8L A;  4A3F J;  3DKY A;  5LHG A;  2CV1 A;  2M7A A;  2UWM A;  1V5G A;  3W6V A;  4H0E A;  1UFM A;  3PFY A;  3GW2 A;  1R71 A;  2ZME A;  2JRM A;  2D1H A;  4HV6 A;  1WGX A;  2IGN A;  1RNL A;  3AAF A;  3BTL A;  3KPH A;  4P1W A;  4F91 B;  1TT0 A;  3IRR A;  4IQJ A;  4RB0 A;  1X3Z B;  1WVR A;  4XLP F;  1YRN B;  4EM0 B;  5HS9 A;  5TGT A;  2R5Z B;  4EMS A;  2IW5 A;  3KIO A;  2L7Z A;  3K1M A;  1JKQ C;  1NH3 A;  2FX0 A;  1TNT A;  2H6B A;  1PUF A;  1IC8 A;  2OBP A;  2Y75 A;  2ELK A;  3I5U A;  2FXA A;  2DYR H;  5D5V B;  1X4P A;  3JTH A;  5EEG A;  4QSH A;  3FM5 A;  1W4M A;  1OCZ H;  1ETW A;  3WU0 A;  1T2K A;  2IS2 A;  2KL4 A;  1RZ4 A;  4BY7 J;  5ILV A;  2BY1 A;  3G4S I;  2ID3 A;  2MA3 A;  1MDM A;  3ULQ B;  2HXO A;  2ZJQ F;  2KMU A;  5EEH A;  2DOA A;  4LD5 A;  5IPA A;  1EF4 A;  5CQG A;  1P4A A;  3QU3 A;  2NNY A;  3DXJ F;  3TP0 A;  2QZ8 A;  4PK4 A;  4AUX A;  4JYK A;  2EZK A;  4EEF G;  5M5W J;  1JHH A;  3QPS A;  5HLH A;  1X58 A;  4A3B J;  1XCV A;  2VXZ A;  4E7I A;  4BY1 J;  2R5Z A;  3G1O A;  1Y0N A;  3SEZ A;  2D45 A;  2TDX A;  3E6B A;  3WTZ A;  3IUO A;  2B7E A;  3DEW A;  2O5R A;  3JW4 A;  5FRO A;  5L3E A;  3WGI A;  2LFB A;  5TIS C;  4NHJ A;  1MBF A;  1I39 A;  3P9K A;  4EQQ A;  1T0F A;  3QOD A;  3J81 K;  1H9G A;  2NS7 A;  2IS4 A;  3ZRG A;  2O61 A;  2JA5 J;  3IKV A;  4HRI A;  1HKS A;  2DMN A;  2K86 A;  2DMT A;  3DBH B;  2GQQ A;  1P6R A;  2EFP A;  4AYB N;  2Z1D A;  4FE7 A;  2NYX A;  5FLV A;  1STZ A;  1WRJ A;  3L7W A;  4CYC A;  2LY2 A;  3BQZ A;  4CCO A;  3E5U A;  2V79 A;  1JKP C;  2LF8 A;  4GDF A;  4FX0 A;  2WBM A;  1NTC A;  1HSJ A;  4A0Z A;  2E2H J;  4UV9 A;  2DBB A;  5BMZ A;  1DPR A;  4ASN A;  3LAJ A;  1K83 J;  4B3X A;  2F5F A;  2PN6 A;  2XGE A;  5EF6 A;  5B3S H;  5E8I A;  2R5Y B;  1IDZ A;  5LD2 C;  4XNF A;  4G8X A;  2W1O A;  2A68 F;  2XAG A;  1K79 A;  1WJF A;  4KT5 C;  3C18 A;  1VQL I;  1GT0 C;  1MKM A;  3I59 B;  1VI0 A;  4UUS A;  4BEH B;  2P5V A;  2CH0 A;  4A3D J;  3ZN0 A;  2DMP A;  5CLS A;  3KZZ A;  1ZRF A;  2X1D A;  4CXF A;  2FNA A;  1BI1 A;  2W25 A;  1EJ9 A;  1YJ9 I;  2I5U A;  2GM4 A;  1OPC A;  3S8P A;  1G3Y A;  2Y0M A;  2RNG A;  2DOD A;  4M9Z A;  4NQW A;  5F1R A;  1TWH J;  3AG4 H;  4KIB A;  1SVL A;  2VKH A;  1A5J A;  5E79 C;  2YUS A;  4EM1 A;  3S1M J;  1S3J A;  1F43 A;  2L9N A;  3G71 I;  1HLV A;  1IN5 A;  2ZFU A;  4PFO A;  2VON A;  4OIQ F;  2E19 A;  2FJ1 A;  1E0E A;  1EA3 A;  1TW2 A;  4KDP A;  2IP2 A;  1SVM A;  3TO9 A;  3X2Q H;  1T38 A;  3KEO A;  3ZQC A;  3TW7 A;  1AKH B;  1UG0 A;  3LSG A;  4A69 C;  5J4Y A;  2JA8 J;  3IKT A;  4UVA A;  3QOE A;  2K9S A;  4ZDO A;  3P9I A;  3DFG A;  5J3L A;  1J09 A;  1YG2 A;  2VIX A;  2DT7 B;  2JPB A;  3D1N I;  1K61 A;  4XLN F;  3HOZ J;  3ZQI A;  3ZR8 X;  2NAZ A;  3VOE A;  1XTA A;  3CJQ B;  3J80 Z;  3WTY C;  2OU2 A;  4XOR A;  2VJI A;  1XX5 A;  3CMA I;  5FFZ A;  4BBS J;  4U0V A;  3AG1 H;  1TL8 A;  2W85 A;  4C30 A;  3BCB A;  3QYB A;  4UB8 C;  2F4M B;  2HPI A;  2E2J J;  4MLO A;  3JSP A;  2XSJ C;  1J2X A;  5IYB J;  5DM6 F;  3D5L A;  4UV8 A;  3HL2 A;  5HS8 A;  3GME A;  1G2H A;  3F9K A;  4BJT A;  3A01 B;  3MKY B;  3F6O A;  3LNQ A;  1FNN A;  1LFB A;  1MH3 A;  3CDL A;  4S05 A;  1S6L A;  3LSR A;  3Q0V A;  2P6T A;  1AHD P;  3GFI A;  2VAS A;  2CFO A;  3GO5 A;  4XR6 A;  3VYR B;  5HDN A;  3L09 A;  1XG1 A;  2WV0 A;  2O7O A;  1R1U A;  4I98 B;  4ETS A;  2BXZ A;  3V7C A;  4ZDL A;  2AQF A;  3HDD A;  4B3A A;  2KQR A;  2NRA C;  2CUF A;  5B5E C;  1UB9 A;  3W3C A;  4A0X A;  3ECO A;  2X4H A;  3R0J A;  2CW8 A;  4O6J A;  2IVM A;  4IHY A;  3S2H J;  2R7F A;  3DLL F;  1XN7 A;  1U5T A;  1MH4 A;  1S7A A;  5DDG A;  4F7Z A;  4ENK A;  3JRI A;  1LE8 A;  1I1G A;  3J80 K;  1ZG1 A;  2HDC A;  2LOO A;  1VQP I;  1AU7 A;  4OIN F;  2BW3 A;  1FSE A;  1FY7 A;  1W36 D;  2F5V A;  5E17 F;  1A35 A;  1G3W A;  1F9N A;  4RAF A;  2X48 A;  3WTT C;  3PFI A;  4K2E A;  3ZP5 A;  2MYS A;  4HNU A;  4Y3O A;  1V5E A;  2W48 A;  1D5V A;  4HF0 A;  3RPU A;  3JRD A;  2Z9O A;  5LGN A;  3CME I;  5F08 A;  4Y15 A;  1JT6 A;  4RGX A;  1HW5 A;  4DQ2 A;  4XID A;  3FM3 A;  4DYQ A;  3FMS A;  4U0W A;  4XN0 A;  5DEQ A;  3MCZ A;  1B6A A;  4M6Y A;  1QO0 D;  1RRJ A;  4L9T A;  1YFH A;  2KIM A;  3CES A;  1BOB A;  3T8R A;  2FBI A;  5IOY A;  1ZAR A;  3RSN A;  4YFK F;  3W2W A;  2W24 A;  5CJ9 A;  2HOT A;  5D5X B;  1Z67 A;  1D0Y A;  3BP8 A;  4AYB A;  3NWT A;  2DO7 A;  2VBW A;  1BI2 A;  2ZJR F;  5GTI C;  3G2B A;  1WJB A;  4XKB A;  3GTP J;  1VF9 A;  2FQ4 A;  3CLO A;  5J8C A;  3IRQ A;  4RM3 A;  2DA6 A;  3F22 A;  1OKR A;  2FMY A;  3L2Q A;  4OU0 A;  3GTO J;  3V7S A;  1YIT I;  3SDB A;  2XHK A;  4RBO A;  2A07 F;  2QM3 A;  1ETV A;  4EJU A;  4IEJ A;  3JRA A;  4NUB A;  1ERD A;  2O8X A;  5BOX A;  1S7O A;  5DCM A;  1T08 B;  3PNV A;  2VQH A;  3G1M A;  3K70 C;  2EPF A;  1SFU A;  1B1B A;  2HQN A;  3MFK A;  4BS9 A;  5IOZ A;  1SFX A;  1BIA A;  2FSW A;  2VBY A;  3KFW X;  1JKR C;  2OTL I;  3VYU B;  2LY1 A;  4J01 A;  5J6X A;  1EKE A;  4WXD A;  2BVM A;  1WWX A;  4XM3 A;  4BAY A;  3KYD B;  1ZK8 A;  1FC3 A;  2IGK A;  5D8K B;  1YTY A;  2BW3 B;  1K6O A;  4PSW A;  4TV7 A;  4OWR B;  4HST A;  2ZBK A;  4ZYE A;  4YIR X;  4EGY A;  2ELH A;  2ELJ A;  3GXO A;  5DCM B;  2ZSI B;  4RM2 A;  3WGG A;  2L9R A;  1WPK A;  2GA1 A;  2XAU A;  3W2A A;  2VKD A;  1R5I D;  4G7O F;  2M30 A;  3C2B A;  2VC1 A;  5JR3 A;  3H3Z A;  1TWG J;  1ONV A;  1N75 A;  2HTS A;  2JRT A;  3SJM A;  2FUG 2;  1LFP A;  1MND A;  3OR1 C;  2LD5 A;  2HGC A;  4AIH A;  3GZN B;  2DT6 A;  2R92 J;  3DKW A;  3I64 A;  2EV6 A;  3K4K A;  2O6G E;  1XSD A;  1SFE A;  1RKW A;  2WAQ N;  2OCE A;  4XIC A;  3PIP F;  1X3U A;  2EWN A;  4HQM A;  2R7W A;  5LRR A;  3S16 J;  3FBI B;  3MVP A;  1GV5 A;  1KU2 A;  3LFU A;  1VQ7 I;  3I54 A;  4ZYG A;  1P2F A;  4A6E A;  2BXY A;  1VTN C;  2Q2E B;  4MFE A;  4N4N B;  2NXN B;  5L3D A;  3B02 A;  1HST A;  4HBL A;  5L3G A;  4E70 A;  4M3F A;  3NAR A;  2ZSH B;  4IRI A;  2R3S A;  3TOB A;  3S3N A;  2B9S A;  2DU9 A;  4MO7 A;  5DS9 A;  4ZH4 F;  2OQR A;  4L5E A;  3UKG A;  2WTE A;  2LF7 A;  4LIU A;  3C2H A;  2EZH A;  1FOX A;  4RGR A;  1YO5 C;  1A6I A;  2HI3 A;  1IGN A;  2PFB A;  3HSE A;  2NOG A;  3CUQ A;  5EG0 A;  3S3O A;  5E3M A;  4A3E J;  3HGY A;  2PMU A;  1JKO C;  1POG A;  1R00 A;  1XPX A;  4NBQ A;  3C7J A;  4P5O A;  2EQR A;  2M4K A;  4UVC A;  1JTY A;  4PJL A;  1XDU A;  2X51 A;  1PP7 U;  4L0Z B;  2HYF A;  4MHG A;  1R4N B;  4ESB A;  1MDM B;  1NHA A;  1B4A A;  1U8R A;  2A6E F;  4BXX J;  2XF6 A;  2EB7 A;  1TLH B;  1FX7 A;  3LSJ A;  4R1H A;  1UEL B;  2XPV A;  4RGS A;  3FF5 A;  1OR7 A;  1XDS A;  2ICW G;  2EZI A;  3E1S A;  3G3Z A;  2ZNZ A;  1U0J A;  3E7L A;  3QWL A;  1QQI A;  3OYH A;  4P9F A;  2A6H F;  2A5Y B;  3ML6 A;  2WAD A;  2M8G X;  1W5C C;  1OLT A;  4ZJZ A;  4HQE A;  3BG6 A;  4DJA A;  3H9J A;  4BE1 A;  1OCR H;  2HZD A;  1I3A A;  3CO6 C;  1F36 A;  1V54 H;  4WF2 A;  3KYC B;  3TL4 X;  3G1L A;  4BNC A;  4XLA A;  5AIP A;  4N4O B;  1KQ9 A;  3RJP A;  3LOC A;  4AIK A;  1QRY A;  3A4C A;  2X6W A;  4XK4 A;  3S2W A;  1KYW A;  3F3X A;  2ZKZ A;  4IHX A;  4A3C J;  3QP6 A;  5D4S A;  1VQN I;  3ZMV A;  2CU7 A;  4HF1 A;  3CO7 C;  3HZJ A;  2GXA A;  2K85 A;  4BQQ A;  2F5C A;  1CF7 B;  3QU6 A;  1W0U A;  3I4M J;  1BR4 A;  2FQ3 A;  5LRS A;  1O3T A;  2ADU A;  4KFC A;  4G6Q A;  2HOS A;  3JRF A;  1MJB A;  3OYJ A;  1FZP B;  2GLO A;  3M4O J;  1B72 B;  3BPV A;  3JRG A;  1IN4 A;  5EGO A;  3BTJ A;  1CQT A;  1Y6I A;  2IS6 A;  1FTZ A;  1G59 A;  1OYY A;  3WOD F;  1F5T A;  2M9H A;  2CFX A;  3OYA A;  2Z3Y A;  5B1A H;  1BJZ A;  4AD9 A;  4A3I J;  4AVZ A;  1UHS A;  5FKN A;  2DYS H;  2CRG A;  4ZC3 A;  2Z16 A;  3M3Y J;  3FDY A;  2X6O A;  4DYC A;  4EGZ A;  4HYE A;  1IRF A;  4UUS B;  1YHQ I;  1QZE A;  3TW6 A;  2GIZ A;  4XL9 A;  5IP7 J;  1BOA A;  2BGC A;  1FOK A;  2G9W A;  1MMD A;  3ERM A;  4RGU A;  4MEX F;  1ITY A;  1O4X A;  1XCB A;  1FIP A;  1BI0 A;  1ZGW A;  1ZGJ A;  3GLL A;  2KP6 A;  3S93 A;  3B73 A;  4NNJ A;  2DDA A;  5IYC J;  5A2Q Z;  3HKZ A;  2MC3 A;  4PUS A;  4JOM A;  1SAU A;  1HW2 A;  1FJL A;  5CVU A;  4DOZ A;  5HLG A;  5A2Q K;  2JQ7 A;  5IP6 A;  5EGO B;  2QQ9 A;  1Z6R A;  1W5T A;  3DU6 A;  2RQP A;  3S1R J;  1R49 A;  1KZH A;  1O3S A;  4BKX A;  4CYC B;  1K4S A;  3FK6 A;  4LK1 F;  4MNU A;  4F93 B;  3OS0 A;  4OMY A;  3E3V A;  3H5N A;  3IP4 B;  2F2E A;  2KZG A;  1U9O A;  3CJN A;  3U1D A;  3BWG A;  2ZCW A;  2LLK A;  2H27 A;  1B8I B;  1HW1 A;  2EFQ A;  3ERE D;  4E4H A;  2HU9 A;  3ZN1 A;  3CTA A;  3H9Q A;  2Y9Z A;  3RDI A;  1D8K A;  4CGZ A;  3FZV A;  3OL4 A;  2KFD A;  2P0W A;  3RKY A;  2E36 A;  1BJA A;  4A93 J;  1L3L A;  3ZMU A;  2W4S A;  1WFX A;  3PNT A;  3OV8 A;  3ZQG A;  2OF7 A;  1GDT A;  2DPD A;  2ETH A;  1LVK A;  5K5Q A;  3FIS A;  1DP7 P;  3VPR A;  1BIB A;  4MQV A;  2YPR A;  4G7Z F;  1EH7 A;  2M3A A;  3U21 A;  5F64 A;  1FOW A;  4WXH A;  2ZFW A;  2F48 A;  4PCQ A;  3BJ6 A;  4PZJ A;  1Z05 A;  1VQ5 I;  5GPC A;  3SZP A;  2CJJ A;  3KX2 A;  3ZQH A;  3CMM A;  3LSK A;  3R6S A;  1X2N A;  5KNL A;  3DCF A;  1KQ8 A;  3MD2 A;  3FKI J;  2PJR A;  1EV7 A;  2PMZ N;  1YIO A;  1P7I A;  1J75 A;  3O2P E;  4B47 A;  1ZR4 A;  3QPT A;  1HKQ A;  3J7Z I;  4KN7 X;  3RI4 A;  2E34 A;  3QPH A;  2E5N A;  5DD8 A;  4C2T A;  3GUD A;  5FLX Z;  1TTY A;  1WHU A;  3L2W A;  1Y1V J;  1E3P A;  1JTX A;  4RDU A;  2ZJ2 A;  3F0C A;  5J40 A;  3GVA A;  4LFU A;  4AC0 A;  4V19 K;  4Q48 A;  1FLI A;  1A31 A;  4Y33 A;  4QLC U;  1R5G A;  1D1A A;  2E7W A;  3HOY J;  2GOX B;  2QSF X;  2ZO4 A;  1VZ0 A;  2XGX A;  4I2O A;  1SMT A;  2B0L A;  3K9T A;  4I09 A;  1JT0 A;  3ABL H;  3O3K A;  2FE3 A;  2KDZ A;  4A0Y A;  2J5O A;  1F1Z A;  1ZYR F;  1ZEL A;  3T5X A;  5HOD A;  1ZTR A;  1YRN A;  4A6D A;  1BR1 A;  4L5I A;  3L9F A;  1MZB A;  1G4D A;  2X1E A;  1ZHF A;  2ZXW H;  5E20 A;  4KMF A;  5FLX K;  3MKZ A;  2Q2E A;  2RC4 A;  1WJD A;  1C0W A;  1MJA A;  3FXL A;  4BXF A;  2DJN A;  2LDU A;  2MH9 A;  4B8X A;  5EEA A;  3M1E A;  3A0H C;  3H1C A;  1TWF J;  1ZG5 A;  1LEA A;  3OYE A;  3K4B A;  3S1N J;  2WC2 A;  1MMG A;  2EFO A;  2AO9 A;  5FB2 A;  1T6S A;  4E7S A;  2HQR A;  2JA2 A;  4IKF A;  2Q0O A;  1X1P A;  1SMY F;  1YYV A;  2L9V A;  5IP9 J;  1LQ1 A;  3FXU A;  3M9A A;  3ABT A;  2DOF A;  3H9G A;  5L3C A;  2CUZ A;  3S3M A;  5FO5 A;  1KQ0 A;  3MEX A;  2EIK H;  4RMN A;  4ZZD A;  4CYD A;  1WJC A;  1U5T C;  3QYF A;  2YS9 A;  3HRT A;  2FF4 A;  2IAI A;  1Z0X A;  3HEF A;  2HPM A;  3GYH X;  1R1V A;  2RVC A;  3HOV J;  4L9V A;  5CVJ A;  5E1X A;  3JRB A;  1YW9 A;  2VJJ A;  3MWM A;  4DGW B;  3DWL E;  3NQO A;  1YJN I;  2DAO A;  3CDI A;  2LP0 A;  1I5Z A;  3JRE A;  1X1A A;  3HOS A;  3FHZ A;  2GXB A;  1BC8 C;  1T33 A;  3KZI C;  2LNB A;  4B43 A;  2BEO A;  2L0K A;  5C4X J;  4CCK A;  4ABZ A;  2A69 F;  5GTH C;  4ENJ A;  1OMI A;  4FT8 A;  1S9H A;  4CZC A;  3K70 D;  5FGM A;  3TDZ C;  4QIW N;  1R6R A;  2CMP A;  3VOD A;  2NVX J;  3RTR A;  4ZYD A;  2F4I A;  1QVU A;  2QEN A;  1OIS A;  1LKX A;  4BQO A;  4BL0 B;  3W2V A;  3WE2 A;  2Y30 A;  4EJV A;  1VQ4 I;  2E1N A;  1FT9 A;  3WG9 A;  2FBK A;  2JSC A;  4OIP F;  3PQK A;  2NVQ J;  2DFH A;  2KIF A;  3V42 A;  2J5P A;  3Q0W A;  2R7T A;  2LKS A;  1A36 A;  1SD7 A;  2RV8 A;  3D5S C;  1BW5 A;  2ESN A;  3NRV A;  1JGG A;  5LGU A;  2WB1 A;  4I6Z A;  4Y52 J;  3JRC A;  3ZQ7 A;  1B9N A;  1OJL A;  4LMY A;  1IRG A;  1RES A;  1HCR A;  1DGW Y;  4QWQ A;  3K4M A;  2HDW A;  4KMU X;  1O7L A;  2BOL A;  4JX6 A;  4ESF A;  2OTJ I;  4WCG A;  3MZY A;  4G94 A;  2DK5 A;  1U9N A;  4L5J A;  4A12 A;  4D9J A;  3F8C A;  4HZF A;  3EPZ A;  1ZG3 A;  5DV5 A;  3SZG A;  1AWC A;  5EZG A;  3WHC A;  3CCE I;  1FPQ A;  4XRM A;  5F27 A;  4X1E A;  4BDZ A;  2IGO A;  3HSF A;  1TWA J;  1UAA A;  1KYZ A;  1SFK A;  4R8H A;  2B63 J;  4PJN A;  4B09 A;  2XRN A;  3GTG J;  2DN0 A;  2JUC A;  5B1B H;  3ZMS A;  3OOP A;  3HTS B;  2VOD A;  3K4C A;  1LDD A;  4ENM A;  4KIC A;  3BY6 A;  2MD0 A;  2BV6 A;  3BR3 A;  1ULY A;  2XC7 A;  2LBF A;  2O9L A;  2HZT A;  3VYS B;  2MG4 A;  2XKP A;  2HR3 A;  1WJ5 A;  4I0B A;  1S29 A;  2JK3 A;  1O7F A;  5IT9 Z;  1WJE A;  1U5T B;  4QPQ A;  3HUG B;  4LB6 B;  1Y39 A;  2KIU A;  4M3B A;  1V3F A;  1Y0U A;  5E1W A;  1GVJ A;  3GFJ A;  1WSU A;  5KAF C;  4BU2 A;  4CA0 A;  5K1Y A;  2F4O B;  2HVS A;  2K02 A;  5LHI A;  4V2G A;  2HVQ A;  4FAS D;  2IEK A;  2E1M B;  2K40 A;  5H6R A;  2KLO A;  1YOV B;  2EIL H;  2X85 A;  1REP C;  2YU3 A;  3F72 A;  4NC6 A;  3BT9 A;  4KJZ A;  4MTD A;  1YX3 A;  1PJR A;  1SAN A;  3Q0U A;  1XGM A;  4KA4 A;  3ELK A;  5JHF A;  1WJA A;  1VND A;  3L00 A;  2IS1 A;  2XF7 A;  1TQP A;  3TGN A;  3S14 J;  2VKE A;  3SYT A;  5F0C A;  1MIJ A;  4G6D A;  3H3U A;  3C2G A;  3P9C A;  2LRD A;  1VQ8 I;  1WCM J;  3JCU C;  4IXA A;  1HA8 A;  3LA7 A;  4HDV A;  5ERI A;  2WAF A;  4FX4 A;  1D1C A;  3F8M A;  5K5O A;  3I53 A;  4GFB A;  2CS3 A;  4G7H F;  2DMQ A;  2FA5 A;  3QPL A;  5GPA A;  2JUG A;  4MGR A;  4U87 A;  1R7J A;  5J1R A;  3TO6 A;  2QSG X;  1B59 A;  2AS5 F;  2KJC A;  1PVE A;  3FMR A;  4QPO A;  5JVG F;  3EUH C;  4M9S A;  2VE9 A;  3VDX A;  1WI9 A;  4BUP A;  3J7Y J;  1LE8 B;  1SEU A;  2R7Q A;  3CCS I;  3BG7 A;  3JR9 A;  3A1Y A;  3O8H A;  3RYR A;  5J1U A;  5FKL A;  1OYI A;  2HQ5 A;  3TMO A;  2HYJ A;  1J5Y A;  3OOU A;  2ISZ A;  5M3M J;  3ONQ A;  1IXR C;  4MQ9 F;  2MD5 A;  3SQN A;  2O8K A;  3RPQ A;  3WE3 A;  2WY7 Q;  2JN6 A;  3WU2 C;  1IO2 A;  1JE8 A;  4KIG A;  1ETK A;  2ECC A;  4M6X A;  1P4W A;  4ZZL A;  5ICC A;  4NQW B;  4IRH A;  4GGG A;  4DZJ A;  2ISY A;  4LG3 A;  5BQT A;  4B1R A;  4XSZ F;  1PP8 F;  1DU0 A;  2K3P A;  4OAZ A;  3FHN A;  2IA1 A;  1SFO J;  2P81 A;  2V1X A;  3CC7 I;  3NEU A;  3DU5 A;  2V6E A;  2L4A A;  1H0M A;  3PQJ A;  2VKV A;  1X2M A;  2VOP A;  3TBI A;  3PSI A;  2JTV A;  1P4X A;  2RAE A;  2X6X A;  2MFZ A;  2OUM A;  2M87 A;  4AM3 A;  1Q1H A;  3U2R A;  1S72 I;  4IVN A;  1IG7 A;  2R93 J;  3CCU I;  1MGT A;  3EUK L;  2WB1 N;  2ZXH A;  1BR2 A;  2A5W A;  2M8E A;  5K7Z A;  3TP3 A;  2YR2 A;  4E7L A;  1UST A;  4R79 A;  1RPW A;  4NB5 A;  2ZJP F;  4YII A;  2Y31 A;  2ZME B;  3F8N A;  5HOO A;  4RB3 C;  2XPW A;  5HNF A;  4XLF A;  1OQY A;  5DM7 F;  3IL2 A;  3GWZ A;  3HOU J;  3KEY A;  1Y8R B;  4PJ0 C;  3BG5 A;  1R4M B;  2XSD C;  1YW8 A;  1MBH A;  2JVH A;  4GXO A;  2DTR A;  1JGS A;  1OR7 C;  1SVO A;  3FMQ A;  1V5F A;  2JA7 J;  2L3D A;  4BHP A;  1RI7 A;  5F6F A;  2QQB A;  3VWB A;  2HTJ A;  2K9N A;  5DUK A;  4O3M A;  4HV5 A;  3BR5 A;  4WWC A;  1CGP A;  3OS1 A;  3MKW B;  2L02 A;  4XLE A;  3JAM Z;  3GZ6 A;  3CP2 A;  4CO8 A;  2EK5 A;  4W1U A;  4XLH A;  4S0H B;  1X1C A;  2FD5 A;  3HPG A;  3N05 A;  3HJE A;  2MGQ A;  2K7L A;  1YIJ I;  2WAE A;  2A05 A;  1R22 A;  4F52 A;  5LFA A;  4CIC A;  4KIS A;  3E0J B;  2ME0 A;  4MTE A;  1P7J A;  3TQN A;  3DPT A;  3PL8 A;  4C9Y A;  1D5Y A;  3KEQ A;  1GXQ A;  4IOC F;  3KP3 A;  2V1N A;  2O0Y A;  2DA3 A;  4BEH A;  2RN7 A;  3H35 A;  4A3M J;  4U7D A;  1IV6 A;  4P55 A;  2FOW A;  2KPM A;  4JP0 A;  3ZMZ A;  3K4L A;  2QCO A;  1IRX A;  1E2X A;  1TZL A;  3CUQ C;  4D5F A;  1QA6 A;  4M6V A;  2VLA A;  2R5Y A;  3PNY A;  4KYW A;  3RCO A;  1FBU A;  2EIN H;  5FD5 A;  2FML A;  3CCY A;  2LK2 A;  3DBR B;  5TRD A;  5HDK A;  2OZU A;  2P5K A;  5HVQ C;  1ON2 A;  5ILS A;  2X1C A;  4A2U A;  3HPH A;  4IO9 F;  4UNO A;  4II3 A;  4CH7 A;  4YG2 F;  1BW6 A;  1OCP A;  1QPM A;  2KZV A;  3GTJ J;  5EZH A;  3IAS 2;  4BDY A;  1H8A C;  1I3Q J;  3RIR A;  5JFR A;  2AQE A;  3VSL A;  4UXN A;  1IUF A;  1U6G A;  4N0B A;  3GTQ J;  2DCE A;  2GAU A;  4D5C A;  3R61 A;  5D6F A;  4X0G A;  2VBX A;  5GAD J;  4JK1 X;  3AL0 B;  4Y13 A;  2PJP A;  3HC7 A;  1ETO A;  4DZP A;  1E3O C;  3RZO J;  1Z7U A;  2MSY A;  4I0A A;  1QHH D;  3EDP A;  2K4J A;  1IZ1 A;  1G3S A;  4XBF A;  2CQK A;  3HGG A;  2M45 A;  2PQ8 A;  2R4G A;  5M5Y J;  1M1E B;  2QQA A;  4CSW A;  3RKQ A;  2QYO A;  3IH3 A;  1K7A A;  1HQC A;  3UR3 C;  3OWT A;  2NNN A;  3HRM A;  4BHB A;  3F21 A;  3W6K B;  4D0P A;  3WU1 B;  1NG7 A;  3ZQL A;  2XRL A;  4ZDP A;  2BZT A;  4KUM A;  1RR7 A;  5AON A;  4DNC A;  2V6C A;  2Y0S N;  3PUF A;  5KAI C;  3FBN B;  1QZZ A;  3Q3S A;  1TNS A;  3HG9 A;  2OC6 A;  3A02 A;  3K1P A;  9ANT A;  3SEQ A;  3S2D J;  2K4B A;  2IGM A;  2JJ7 A;  4YEJ A;  1WH7 A;  3ESW B;  1K6Y A;  4AU7 A;  3U1K A;  3BCA A;  4LIV A;  3BTI A;  4ZYA A;  3CCQ I;  3K2A A;  2HWV A;  2PEX A;  2QWW A;  1EH6 A;  2V26 A;  4HF2 A;  3ISP A;  4FQG A;  1Y56 A;  2HYG D;  2EIM H;  3M7G A;  1ZRD A;  1U3E M;  2XAJ A;  4HNT A;  1R9T J;  5CKT A;  4Y17 A;  2LY9 A;  1R58 A;  1MBG A;  4IHT A;  1TT5 B;  4HNV A;  5DYM A;  3ABM H;  3E5X A;  4YIF A;  3CZ6 A;  2DOE A;  3IAM 2;  1VQ9 I;  4YFX F;  2E1M C;  5KCM A;  3CUQ B;  5EG0 B;  2TRT A;  1BI3 A;  2KHM A;  1HF0 A;  2R7U A;  2QUF A;  2E7X A;  4EJW A;  2Q1Z B;  3KZY A;  1GUU A;  1Z9C A;  2MC4 A;  5HLI A;  3EYY A;  5F1J A;  2Y2Z A;  3PM1 A;  2H1K A;  4KNY A;  3F8B A;  2HQA A;  5CYV A;  2VC0 A;  2R7D A;  3CCR I;  1IXS B;  2JSP A;  2WY8 Q;  4II2 A;  5CVR A;  5J8F A;  1T39 A;  3LL7 A;  1WI3 A;  1LPQ A;  2BY2 A;  5GAH J;  3JSO A;  4A5N A;  1Z91 A;  3HOX J;  2E35 A;  4BGD A;  5FKO A;  2VPR A;  3C3W A;  1WQ2 A;  3HOT A;  1RUN A;  1Y1W J;  5K5R A;  3NAU A;  3HKZ N;  2VE8 A;  4M74 A;  1U8B A;  1W0T A;  3LST A;  3DTE A;  3BDD A;  4BXU A;  1ZN2 A;  2HOA A;  2H09 A;  5EJC A;  5DTD A;  2K5C A;  3DKX A;  3J7A O;  2EFN A;  3BZ6 A;  3ROU A;  2NS0 A;  1T8I A;  2BBY A;  1FP1 D;  1UHW A;  4B44 A;  2M7B A;  4WXC A;  2HKO A;  3LSH A;  1QNT A;  3RQI A;  2QBY A;  4ANJ A;  3O6B B;  1G3T A;  1S7E A;  1GXP A;  1TC3 C;  3A2K A;  3PIO F;  2N8G A;  2UXN A;  4GO1 A;  4KT6 A;  1DGR M;  3CCJ I;  4OAY A;  1UG2 A;  4NC7 A;  4A3K J;  2QKM B;  3I4N J;  2W82 A;  1QHG A;  3H0D A;  5F0H A; 
#chains in the Genus database with same CATH homology
 4RB2 C;  2HEO A;  3BJA A;  1IAW A;  4IPA A;  5JVT A;  2OD5 A;  3KCC A;  3KLN A;  3R4K A;  4M9X A;  4HAM A;  4AVP A;  2IRF G;  1Z1D A;  5IT3 A;  4GYI A;  1IN8 A;  1K78 B;  3KP6 A;  1HBX G;  1YS6 A;  4WK8 F;  2V9V A;  3REO A;  1FSH A;  2STW A;  3MQ0 A;  1Z6T A;  2LKP A;  4UHT A;  2UXX A;  5IT9 K;  2P7V B;  5DUI A;  1GHC A;  3C1D A;  2FBH A;  1W7P B;  2PG4 A;  1QBJ A;  3KLO A;  2P5L C;  3HYI A;  1XGN A;  1R36 A;  1R1T A;  1IF1 A;  4IRG A;  1XSV A;  3HUG A;  1YQA A;  3QP5 A;  2EFW A;  2XVC A;  3KE2 A;  2OZ6 A;  2QVO A;  1ZAO A;  1MJ9 A;  2A61 A;  2L01 A;  4HX4 A;  1SD6 A;  1BC7 C;  3JAM K;  4HLX A;  3N97 A;  1TQM A;  3RKX A;  1IUY A;  5JHU A;  2HFH A;  4UUV A;  3FWE A;  2GIV A;  3T1B A;  4BHC A;  4OMZ A;  1A04 A;  4LLN A;  3E5Q A;  2CSO A;  4GCV A;  4U88 A;  2MLK A;  4EM2 A;  4CHU A;  3T8T A;  3IC7 A;  3HRU A;  2L4M A;  4KN4 X;  2H94 A;  5LGT A;  1U2W A;  1ZRE A;  3VB2 A;  3ZPL A;  3QOP A;  1XD7 A;  4LK0 F;  2ESH A;  2CW0 F;  4EJO A;  1I1S A;  2FU4 A;  3K69 A;  4ENN A;  2DI3 A;  5D6E A;  3TKY A;  5L3B A;  1IXC A;  3KET A;  2DT5 A;  2P6S A;  1DUX C;  4Q5S F;  2DFI A;  1QZY A;  3CDH A;  4CDG A;  4LLG F;  3Q9V A;  3KP7 A;  3E6C C;  1O3R A;  1MD0 A;  5JI6 A;  1KGS A;  4BH9 A;  2OQG A;  1ZH5 A;  3FX3 A;  3HHG A;  2JZY A;  2OA4 A;  2XV4 S;  2E1C A;  1FYL A;  5KVR A;  2XKO A;  2VT2 A;  1SD5 A;  2IT0 A;  2QBY B;  1O57 A;  2MLG A;  2HOE A;  2F5E A;  5LBQ A;  1TBX A;  3T0Y A;  2XAQ A;  5CVV A;  3GF2 A;  4M73 A;  3E6M A;  1JHF A;  2ZNY A;  3WTS C;  1BM9 A;  3QAH A;  2O03 A;  3MAJ A;  4BYY A;  3V4G A;  5ICF A;  4IJA A;  3DQV C;  5H6Q A;  1YLF A;  1ZRC A;  1USS A;  1FYK A;  4L9N A;  3WTW C;  4HX7 A;  3Q9S A;  2QLZ A;  3GFM A;  1LDJ A;  4GYG A;  3I0T A;  3R0A A;  1YW7 A;  2M1B A;  1UCR A;  2D1V A;  2V1D A;  5E1Z B;  3R60 A;  2A3S A;  4N9I A;  3KP5 A;  2HS5 A;  3LFK A;  2OAZ A;  2W84 A;  4HA8 A;  5HDG A;  4HDU A;  4JBA A;  3QRF F;  4FHT A;  3LQR A;  5D5W B;  3IWZ A;  4AWX B;  3V8K A;  4WX9 A;  4LGW A;  2EV0 A;  5L3F A;  1KU9 A;  2XAF A;  2C6Y A;  5AIQ A;  2DPU A;  2IA0 A;  5DCF A;  1BN5 A;  5D4R A;  2STT A;  5BS6 A;  4M72 A;  2RNJ A;  2MH2 A;  3F8F A;  2YSR A;  2EV5 A;  3GZ5 A;  5D5U B;  3E6D A;  5CVI A;  4MEY F;  1B9M A;  3HTU A;  3K2Z A;  3WTX C;  3BJO A;  2EJR A;  2Q8K A;  3CUO A;  3SFZ A;  2X0L A;  5TJJ A;  5E8G A;  2D2W A;  1RIO H;  4O5V A;  1ZLK A;  3E97 A;  3LWF A;  1UHM A;  3V7R A;  4A5M A;  4L18 B;  3N4M A;  1I6X A;  1J0R A;  1IN6 A;  1LB2 A;  1E17 A;  3COA C;  2KRF A;  4EJT A;  4ESJ A;  3G73 A;  1ZLJ A;  5DD4 A;  4XSX F;  2IA2 A;  1H9T A;  3IWF A;  1RUO A;  2XAS A;  3HRS A;  1PUE E;  1F4K A;  1KU3 A;  2RKH A;  4UVB A;  4HW0 A;  1HXD A;  2CGP A;  5KK1 A;  1KU7 A;  1LVA A;  4LJZ F;  1HKT A;  3GLX A;  4LB5 A;  2RDP A;  2FEZ A;  2XUB A;  2M5W A;  2GA2 A;  4RB1 A;  4HOB A;  1AOY A;  2RGV A;  3DF8 A;  5LEJ A;  1WKM A;  4JQF A;  3I71 A;  2H6C A;  4EV0 A;  3BOQ A;  4U7B A;  1I27 A;  2DLL A;  2PMH A;  3ECH A;  1LNW A;  2L54 A;  5BPD A;  5FFX A;  3M8F A;  1CF7 A;  2Z5U A;  2VN2 A;  4RS8 A;  1XGO A;  2ACJ A;  2GXG A;  1EH8 A;  1FP2 A;  2FOK A;  3D0S A;  4S04 A;  1D3Y A;  5ICG A;  1DPU A;  3MZH A;  3WTV C;  2JT1 A;  2G7U A;  3KP2 A;  1FBS A;  4PDK A;  3I4P A;  3V8J A;  3KP4 A;  1BBY A;  2EA2 A;  4YFN F;  3W6J B;  2PLY A;  3TOA A;  1K78 A;  4U0Y A;  2VBZ A;  1XGS A;  4HLY A;  3U9G A;  3LAP A;  5LHH A;  1FBQ A;  4L0Y B;  2ZXJ A;  3WGH A;  3JTG A;  2EA4 A;  1P92 A;  2DQR A;  1J59 A;  3GX4 X;  2XRO A;  2HKX A;  2DQL A;  2WWY A;  2F5D A;  1J7K A;  3BPX A;  1TQI A;  2AXL A;  1DDN A;  5D8L B;  4PGG A;  1W7P D;  1YS7 A;  4BQA A;  2XIG A;  3RYP A;  4IHS A;  1R23 A;  3DP7 A;  4RAZ A;  2P8T A;  2JPC A;  2LSO A;  2VOO A;  4LG0 A;  4XRF A;  3SZT A;  2GWR A;  1KA8 A;  3K0L A;  3ABU A;  2COM A;  1PDN C;  3H92 A;  4L9J A;  1ON1 A;  1O3Q A;  2IJL A;  3RKW A;  4CZZ A;  3HSR A;  4LG0 B;  4P9U A;  2PBI A;  3L2C A;  4ZYH A;  3EUH A;  2V1U A;  4M71 A;  1FYM A;  3LQQ A;  1QGP A;  1XB4 A;  5BPI A;  2XAH A;  2Z99 A;  2BYV E;  3VEP A;  3EET A;  1T98 A;  3EQL F;  1XSX A;  4HX8 A;  1LJ9 A;  4LLL A;  4G9Y A;  2K27 A;  1J9I A;  2VT3 A;  4KIF A;  4OOI A;  4OIO F;  1SD4 A;  5FD6 A;  1LDK B;  4AIJ A;  2YX4 A;  1ZGA A;  3LA3 A;  3GFL A;  2P4W A;  3Q5F A;  2IPQ X;  1OYW A;  3TDU C;  3SHF A;  5ILU A;  1XMK A;  3WTU C;  3K1N A;  4ON0 A;  4I7H A;  6PAX A;  1IN7 A;  2CWE A;  2PI0 A;  3EYI A;  3IHU A;  1G6N A;  2MBF A;  3BRO A;  5HS7 A;  3SXY A;  4IF4 A;  1W7P A;  3GEZ A;  4P96 A;  2YX7 A;  2CG4 A;  2GZW A;  2BE5 F;  2DK8 A;  1TW3 A;  3DV8 A;  2CO5 A;  4I02 A;  5LLQ A;  1L0O C;  3HIF A;  2Z33 A;  1S8N A;  1D8J A;  1XMA A;  2UZK A;  3P7N A;  4N9H A;  3ZMD A;  2CYY A;  3FXR A;  3TO7 A;  5ED4 A;  3FXQ A;  5H20 A;  2O3F A;  4Z2Y A;  3J81 Z;  1W5S A;  3DEU A;  4PGH A;  1FWZ A;  1JXS A;  3F23 A;  2Y48 A;  5ICE A;  2DW4 A;  3DPL C;  4I01 A;  3ZMT A;  2KKO A;  4Q47 A;  1SAX A;  3HHH A;  4OIR F;  3I58 A;  5LEK A;  3VFZ A;  4RAY A;  1U78 A;  1LEB A;  3F6V A;  1V4R A;  1IW7 F;  2P7C B;  2W57 A;  2G7H A;  2FRH A;  1R5H A;  3LA2 A;  4EVI A;  3M8E A;  4Q4Z F;  1ODD A;  5E18 F;  2KJB A;  2FNP A;  3I59 A;  3V8L A;  5LHG A;  2UWM A;  4H0E A;  1UFM A;  3GW2 A;  2ZME A;  2D1H A;  4HV6 A;  3AAF A;  1RNL A;  3IRR A;  4RB0 A;  4XLP F;  4EM0 B;  5HS9 A;  4EMS A;  2IW5 A;  3K1M A;  2H6B A;  1TNT A;  2OBP A;  2Y75 A;  3I5U A;  2FXA A;  5D5V B;  3JTH A;  5EEG A;  3FM5 A;  1W4M A;  3WU0 A;  1T2K A;  1RZ4 A;  5ILV A;  2MA3 A;  1MDM A;  3ULQ B;  5EEH A;  4LD5 A;  1P4A A;  3QU3 A;  2NNY A;  3DXJ F;  2QZ8 A;  1JHH A;  5HLH A;  1XCV A;  2VXZ A;  2D45 A;  2TDX A;  3E6B A;  3WTZ A;  3JW4 A;  5L3E A;  3WGI A;  4NHJ A;  3P9K A;  4EQQ A;  1T0F A;  3J81 K;  1H9G A;  2O61 A;  3IKV A;  1HKS A;  2K86 A;  2GQQ A;  1P6R A;  2EFP A;  2NYX A;  1STZ A;  1WRJ A;  3L7W A;  3E5U A;  2V79 A;  2LF8 A;  4FX0 A;  1HSJ A;  4A0Z A;  4UV9 A;  2DBB A;  5BMZ A;  1DPR A;  4ASN A;  3LAJ A;  2F5F A;  2PN6 A;  5E8I A;  4G8X A;  2A68 F;  2XAG A;  1K79 A;  4KT5 C;  3C18 A;  1MKM A;  3I59 B;  2P5V A;  3ZN0 A;  5CLS A;  3KZZ A;  1ZRF A;  4CXF A;  2FNA A;  1BI1 A;  2W25 A;  1OPC A;  1G3Y A;  2Y0M A;  4M9Z A;  4NQW A;  5F1R A;  4KIB A;  4EM1 A;  1S3J A;  1IN5 A;  2VON A;  4OIQ F;  1TW2 A;  4KDP A;  2IP2 A;  3TO9 A;  1T38 A;  3KEO A;  3IKT A;  4UVA A;  3P9I A;  3DFG A;  1YG2 A;  2JPB A;  4XLN F;  2NAZ A;  3VOE A;  3J80 Z;  3WTY C;  2OU2 A;  5FFZ A;  4U0V A;  2W85 A;  3JSP A;  1J2X A;  3D5L A;  4UV8 A;  5HS8 A;  3F6O A;  1FNN A;  4S05 A;  1S6L A;  2P6T A;  3GFI A;  3GO5 A;  5HDN A;  3L09 A;  2WV0 A;  1R1U A;  4I98 B;  4ETS A;  3V7C A;  2NRA C;  1UB9 A;  4A0X A;  3ECO A;  2X4H A;  3R0J A;  4O6J A;  2IVM A;  2R7F A;  1XN7 A;  1U5T A;  1S7A A;  5DDG A;  4F7Z A;  4ENK A;  1I1G A;  3J80 K;  1ZG1 A;  2HDC A;  4OIN F;  1FSE A;  1FY7 A;  5E17 F;  1G3W A;  1F9N A;  3WTT C;  3PFI A;  4K2E A;  3ZP5 A;  1D5V A;  4HF0 A;  3RPU A;  2Z9O A;  5LGN A;  4Y15 A;  4RGX A;  1HW5 A;  4DQ2 A;  3FM3 A;  3FMS A;  4U0W A;  5DEQ A;  3MCZ A;  1B6A A;  4M6Y A;  1QO0 D;  4L9T A;  1YFH A;  2KIM A;  3T8R A;  2FBI A;  1ZAR A;  4YFK F;  2W24 A;  5CJ9 A;  5D5X B;  3BP8 A;  2DO7 A;  2VBW A;  1BI2 A;  3CLO A;  3IRQ A;  5J8C A;  3F22 A;  1OKR A;  2FMY A;  4OU0 A;  3V7S A;  2XHK A;  2A07 F;  2QM3 A;  4EJU A;  2O8X A;  5BOX A;  1S7O A;  5DCM A;  1SFU A;  1B1B A;  2HQN A;  3MFK A;  1SFX A;  1BIA A;  2FSW A;  2VBY A;  3KFW X;  5J6X A;  4WXD A;  4BAY A;  1WWX A;  1FC3 A;  5D8K B;  1YTY A;  1K6O A;  4TV7 A;  2ZBK A;  4ZYE A;  4EGY A;  2ELH A;  3GXO A;  5DCM B;  3WGG A;  2GA1 A;  4G7O F;  2M30 A;  2VC1 A;  5JR3 A;  3H3Z A;  1ONV A;  2HTS A;  2JRT A;  2HGC A;  4AIH A;  3DKW A;  3I64 A;  2EV6 A;  2O6G E;  1XSD A;  1SFE A;  1X3U A;  2EWN A;  4HQM A;  5LRR A;  1KU2 A;  3I54 A;  4ZYG A;  1P2F A;  4A6E A;  1VTN C;  5L3D A;  3B02 A;  1HST A;  4HBL A;  5L3G A;  4E70 A;  4IRI A;  2R3S A;  3TOB A;  2DU9 A;  4ZH4 F;  2OQR A;  2WTE A;  2LF7 A;  4RGR A;  1YO5 C;  2PFB A;  3HSE A;  3CUQ A;  2PMU A;  1R00 A;  3C7J A;  4P5O A;  4UVC A;  1XDU A;  1PP7 U;  4L0Z B;  2HYF A;  4MHG A;  4ESB A;  1MDM B;  1NHA A;  1B4A A;  1U8R A;  2A6E F;  2EB7 A;  1TLH B;  1FX7 A;  4R1H A;  4RGS A;  3FF5 A;  1OR7 A;  1XDS A;  3G3Z A;  2ZNZ A;  1QQI A;  4P9F A;  2A6H F;  2A5Y B;  3ML6 A;  4HQE A;  3CO6 C;  4WF2 A;  4BNC A;  5AIP A;  1KQ9 A;  3RJP A;  4AIK A;  3S2W A;  1KYW A;  3F3X A;  2ZKZ A;  3QP6 A;  5D4S A;  3ZMV A;  4HF1 A;  3CO7 C;  2F5C A;  1CF7 B;  3QU6 A;  2FQ3 A;  5LRS A;  1O3T A;  2ADU A;  4KFC A;  4G6Q A;  1MJB A;  1FZP B;  3BPV A;  1IN4 A;  1OYY A;  3WOD F;  1F5T A;  2CFX A;  2Z3Y A;  4AD9 A;  4EGZ A;  4HYE A;  1IRF A;  1BOA A;  2BGC A;  1FOK A;  2G9W A;  4RGU A;  4MEX F;  1XCB A;  1BI0 A;  1ZGJ A;  3B73 A;  5A2Q Z;  2MC3 A;  1HW2 A;  5CVU A;  5HLG A;  5A2Q K;  2QQ9 A;  1Z6R A;  1W5T A;  2RQP A;  1O3S A;  4LK1 F;  4MNU A;  4OMY A;  3E3V A;  2F2E A;  3CJN A;  3U1D A;  3BWG A;  2ZCW A;  2H27 A;  1HW1 A;  2EFQ A;  3ERE D;  3ZN1 A;  3CTA A;  3RDI A;  1D8K A;  4CGZ A;  3FZV A;  3RKY A;  1BJA A;  1L3L A;  3ZMU A;  3OV8 A;  2DPD A;  2ETH A;  5K5Q A;  1DP7 P;  1BIB A;  4MQV A;  2YPR A;  4G7Z F;  1EH7 A;  5F64 A;  4WXH A;  2ZFW A;  4PCQ A;  3BJ6 A;  4PZJ A;  1Z05 A;  3SZP A;  3R6S A;  1KQ8 A;  1EV7 A;  1YIO A;  1J75 A;  3O2P E;  3QPT A;  1HKQ A;  4KN7 X;  3RI4 A;  3QPH A;  5DD8 A;  3GUD A;  5FLX Z;  1TTY A;  2ZJ2 A;  3GVA A;  4LFU A;  4Q48 A;  1FLI A;  4QLC U;  1R5G A;  2E7W A;  2ZO4 A;  2XGX A;  4I2O A;  1SMT A;  2B0L A;  3K9T A;  4I09 A;  3O3K A;  2FE3 A;  4A0Y A;  2J5O A;  1F1Z A;  1ZYR F;  3T5X A;  4A6D A;  4L5I A;  3L9F A;  1MZB A;  1G4D A;  5E20 A;  1ZHF A;  4KMF A;  5FLX K;  2Q2E A;  2RC4 A;  1C0W A;  1MJA A;  2LDU A;  2MH9 A;  4B8X A;  3M1E A;  1ZG5 A;  1LEA A;  2WC2 A;  2EFO A;  5FB2 A;  1T6S A;  2HQR A;  2Q0O A;  1SMY F;  1YYV A;  1LQ1 A;  3FXU A;  3M9A A;  3ABT A;  5L3C A;  5FO5 A;  1KQ0 A;  3MEX A;  4ZZD A;  4CYD A;  1U5T C;  3HRT A;  2FF4 A;  3GYH X;  1R1V A;  2RVC A;  4L9V A;  5CVJ A;  5E1X A;  1YW9 A;  3MWM A;  3NQO A;  2DAO A;  1I5Z A;  3HOS A;  3FHZ A;  2GXB A;  1BC8 C;  2LNB A;  2BEO A;  2A69 F;  4ENJ A;  1OMI A;  4FT8 A;  5FGM A;  3TDZ C;  3VOD A;  3RTR A;  4ZYD A;  2QEN A;  3WE2 A;  4EJV A;  2E1N A;  1FT9 A;  3WG9 A;  2FBK A;  2JSC A;  4OIP F;  3PQK A;  2KIF A;  2J5P A;  1SD7 A;  2RV8 A;  2ESN A;  3NRV A;  5LGU A;  3ZQ7 A;  1B9N A;  4LMY A;  1IRG A;  4QWQ A;  4KMU X;  1O7L A;  4ESF A;  4WCG A;  3MZY A;  4G94 A;  2DK5 A;  4L5J A;  4A12 A;  3F8C A;  4HZF A;  1AWC A;  1ZG3 A;  5DV5 A;  1FPQ A;  3HSF A;  1KYZ A;  4R8H A;  4B09 A;  2XRN A;  3ZMS A;  3OOP A;  3HTS B;  2VOD A;  1LDD A;  4ENM A;  4KIC A;  3BY6 A;  2BV6 A;  1ULY A;  2HZT A;  2XKP A;  4I0B A;  2HR3 A;  1S29 A;  1O7F A;  5IT9 Z;  1U5T B;  4LB6 B;  2KIU A;  1V3F A;  1Y0U A;  5E1W A;  1GVJ A;  3GFJ A;  1WSU A;  5K1Y A;  2K02 A;  5LHI A;  5H6R A;  1REP C;  2YU3 A;  3F72 A;  4MTD A;  4KA4 A;  1XGM A;  3ELK A;  3L00 A;  1TQP A;  3TGN A;  4G6D A;  3H3U A;  3P9C A;  4IXA A;  3LA7 A;  4HDV A;  5ERI A;  4FX4 A;  3F8M A;  5K5O A;  3I53 A;  4G7H F;  2FA5 A;  4MGR A;  1R7J A;  3TO6 A;  1B59 A;  2AS5 F;  2KJC A;  3FMR A;  4M9S A;  2VE9 A;  1WI9 A;  3RYR A;  1OYI A;  1J5Y A;  2ISZ A;  1IXR C;  4MQ9 F;  2MD5 A;  3SQN A;  3RPQ A;  3WE3 A;  1JE8 A;  4KIG A;  4M6X A;  1P4W A;  4ZZL A;  5ICC A;  4IRH A;  4GGG A;  2ISY A;  5BQT A;  4XSZ F;  1PP8 F;  2IA1 A;  2V1X A;  3NEU A;  2L4A A;  1H0M A;  3PQJ A;  2VOP A;  2JTV A;  1P4X A;  2M87 A;  1Q1H A;  3U2R A;  4IVN A;  1MGT A;  2M8E A;  2YR2 A;  1UST A;  4R79 A;  4NB5 A;  4YII A;  2ZME B;  3F8N A;  5HOO A;  4RB3 C;  3IL2 A;  3GWZ A;  1YW8 A;  4GXO A;  2DTR A;  1JGS A;  3FMQ A;  2L3D A;  4BHP A;  1RI7 A;  5F6F A;  2QQB A;  2HTJ A;  5DUK A;  4O3M A;  4HV5 A;  4WWC A;  1CGP A;  2L02 A;  3GZ6 A;  3JAM Z;  4CO8 A;  2EK5 A;  2K7L A;  1R22 A;  4CIC A;  4MTE A;  3TQN A;  3DPT A;  3KEQ A;  1GXQ A;  3KP3 A;  2O0Y A;  2RN7 A;  4U7D A;  4P55 A;  3ZMZ A;  1E2X A;  3CUQ C;  4KYW A;  1FBU A;  5FD5 A;  2FML A;  5TRD A;  5HDK A;  2OZU A;  2P5K A;  5HVQ C;  1ON2 A;  5ILS A;  4A2U A;  4UNO A;  4YG2 F;  1QPM A;  3RIR A;  5JFR A;  4UXN A;  1U6G A;  4N0B A;  2GAU A;  3R61 A;  5D6F A;  2VBX A;  4JK1 X;  4Y13 A;  2PJP A;  1Z7U A;  4I0A A;  3EDP A;  2K4J A;  1IZ1 A;  1G3S A;  4XBF A;  2CQK A;  2M45 A;  2PQ8 A;  2QQA A;  2QYO A;  1K7A A;  1HQC A;  2NNN A;  3HRM A;  4BHB A;  3F21 A;  3W6K B;  4D0P A;  3WU1 B;  4KUM A;  5AON A;  4DNC A;  2V6C A;  1QZZ A;  1TNS A;  3K1P A;  2K4B A;  2HWV A;  2PEX A;  2QWW A;  1EH6 A;  4HF2 A;  3ISP A;  2HYG D;  3M7G A;  1ZRD A;  1U3E M;  2XAJ A;  4Y17 A;  1R58 A;  4IHT A;  5DYM A;  3E5X A;  4YIF A;  4YFX F;  3CUQ B;  1BI3 A;  2QUF A;  2E7X A;  4EJW A;  3KZY A;  1Z9C A;  5HLI A;  3EYY A;  4KNY A;  3F8B A;  5CYV A;  2VC0 A;  2R7D A;  1IXS B;  5CVR A;  5J8F A;  1T39 A;  3JSO A;  4A5N A;  1Z91 A;  3C3W A;  1WQ2 A;  3HOT A;  1RUN A;  5K5R A;  2VE8 A;  4M74 A;  3LST A;  3BDD A;  4BXU A;  1ZN2 A;  2H09 A;  3J7A O;  2EFN A;  3BZ6 A;  3ROU A;  2NS0 A;  2BBY A;  1FP1 D;  1UHW A;  4WXC A;  2HKO A;  1QNT A;  2QBY A;  3O6B B;  1G3T A;  1GXP A;  2UXN A;  4GO1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...