1WX2B

Crystal structure of the oxy-form of the copper-bound streptomyces castaneoglobisporus tyrosinase complexed with a caddie protein prepared by the addition of hydrogenperoxide
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
83
structure length
72
Chain Sequence
b'AAPESFDEVYKGRRIQGRPAGYEVFVDGVQLHVMRNADGSWISVVSHYDPVPTPRAAARAAVDELQGAPLLP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords tyrosinase
publication title Crystallographic Evidence That the Dinuclear Copper Center of Tyrosinase Is Flexible during Catalysis
pubmed doi rcsb
source organism Streptomyces castaneoglobisporus
molecule tags Oxidoreductase/metal transport
total genus 15
structure length 72
sequence length 83
ec nomenclature
pdb deposition date 2005-01-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF06236 MelC1 Tyrosinase co-factor MelC1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1880.10 Alpha Beta 2-Layer Sandwich protein ne1242 fold protein ne1242 domain like 1wx2B01
3AX0B 3AWZB 3AWSB 2ZWGB 2ZMZB 2ZWFB 1WXCB 2JV8A 2AHKB 1WX5B 3AWWB 1WX4B 2AHLB 2ZMYB 2ZWEB 3AWYB 3AWUB 3AWTB 2ZWDB 1WX2B 3AWVB 2ZMXB 3AWXB
chains in the Genus database with same CATH superfamily
3AX0B 2DE5A 3AWZB 3AWSB 4NBFA 1Z01A 2ZWGB 2DE6A 3GCFA 4NBDA 2ZMZB 2ZWFB 1Z02A 3GKQA 3VMGA 1WXCB 2JV8A 2AHKB 4NBBA 4NBHA 4NBAA 1WX5B 3AWWB 4NB8A 1WX4B 4NB9A 2DE7A 4NBEA 2AHLB 3VMHA 2ZMYB 4NBGA 2ZWEB 3AWYB 1WW9A 3AWTB 3AWUB 2ZWDB 1WX2B 4NBCA 1Z03A 3AWVB 2ZMXB 3VMIA 3AWXB
chains in the Genus database with same CATH topology
3AX0B 3AWZB 3AWSB 2ZWGB 2ZMZB 2ZWFB 1WXCB 2JV8A 2AHKB 1WX5B 3AWWB 1WX4B 2AHLB 2ZMYB 2ZWEB 3AWYB 3AWUB 3AWTB 2ZWDB 1WX2B 3AWVB 2ZMXB 3AWXB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AX0 B;  3AWZ B;  3AWS B;  2ZWG B;  2ZMZ B;  2ZWF B;  1WXC B;  2JV8 A;  2AHK B;  1WX5 B;  3AWW B;  1WX4 B;  2AHL B;  2ZMY B;  2ZWE B;  3AWY B;  3AWU B;  3AWT B;  2ZWD B;  1WX2 B;  3AWV B;  2ZMX B;  3AWX B; 
#chains in the Genus database with same CATH topology
 3AX0 B;  2DE5 A;  3AWZ B;  3AWS B;  4NBF A;  1Z01 A;  2ZWG B;  2DE6 A;  3GCF A;  4NBD A;  2ZMZ B;  2ZWF B;  1Z02 A;  3GKQ A;  3VMG A;  1WXC B;  2JV8 A;  2AHK B;  4NBB A;  4NBH A;  4NBA A;  1WX5 B;  3AWW B;  4NB8 A;  1WX4 B;  4NB9 A;  2DE7 A;  4NBE A;  2AHL B;  3VMH A;  2ZMY B;  4NBG A;  2ZWE B;  3AWY B;  1WW9 A;  3AWT B;  3AWU B;  2ZWD B;  1WX2 B;  4NBC A;  1Z03 A;  3AWV B;  2ZMX B;  3VMI A;  3AWX B; 
#chains in the Genus database with same CATH homology
 3AX0 B;  3AWZ B;  3AWS B;  2ZWG B;  2ZMZ B;  2ZWF B;  1WXC B;  2JV8 A;  2AHK B;  1WX5 B;  3AWW B;  1WX4 B;  2AHL B;  2ZMY B;  2ZWE B;  3AWY B;  3AWU B;  3AWT B;  2ZWD B;  1WX2 B;  3AWV B;  2ZMX B;  3AWX B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...