1WX5B

Crystal structure of the copper-free streptomyces castaneoglobisporus tyrosinase complexed with a caddie protein in the monoclinic crystal
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
82
structure length
71
Chain Sequence
APESFDEVYKGRRIQGRPAGYEVFVDGVQLHVMRNADGSWISVVSHYDPVPTPRAAARAAVDELQGAPLLP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords tyrosinase
publication title Crystallographic Evidence That the Dinuclear Copper Center of Tyrosinase Is Flexible during Catalysis
pubmed doi rcsb
source organism Streptomyces castaneoglobisporus
molecule tags Oxidoreductase/metal transport
total genus 17
structure length 71
sequence length 82
chains with identical sequence D
ec nomenclature
pdb deposition date 2005-01-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF06236 MelC1 Tyrosinase co-factor MelC1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1880.10 Alpha Beta 2-Layer Sandwich protein ne1242 fold protein ne1242 domain like 1wx5B01
3AWWB 3AWZB 2ZWGB 1WX5B 3AWYB 3AX0B 2AHLB 2ZWEB 2AHKB 2ZWDB 1WXCB 1WX2B 2JV8A 3AWVB 3AWTB 2ZMYB 3AWSB 2ZWFB 3AWXB 3AWUB 2ZMZB 1WX4B 2ZMXB
chains in the Genus database with same CATH superfamily
4NBAA 3AWWB 3AWZB 2ZWGB 1WX5B 4NBGA 3AWYB 3AX0B 2AHLB 3GKQA 4NB8A 2ZWEB 1WW9A 2AHKB 2ZWDB 4NBFA 1Z01A 3VMGA 2ZMXB 4NBEA 1WXCB 1WX2B 3GCFA 4NBBA 2JV8A 1Z03A 3AWVB 4NBDA 4NB9A 3AWTB 2DE7A 2ZMYB 4NBCA 3VMHA 2DE5A 3AWSB 2ZWFB 3AWXB 3AWUB 1Z02A 2ZMZB 1WX4B 2DE6A 3VMIA 4NBHA
chains in the Genus database with same CATH topology
3AWWB 3AWZB 2ZWGB 1WX5B 3AWYB 3AX0B 2AHLB 2ZWEB 2AHKB 2ZWDB 1WXCB 1WX2B 2JV8A 3AWVB 3AWTB 2ZMYB 3AWSB 2ZWFB 3AWXB 3AWUB 2ZMZB 1WX4B 2ZMXB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AWW B;  3AWZ B;  2ZWG B;  1WX5 B;  3AWY B;  3AX0 B;  2AHL B;  2ZWE B;  2AHK B;  2ZWD B;  1WXC B;  1WX2 B;  2JV8 A;  3AWV B;  3AWT B;  2ZMY B;  3AWS B;  2ZWF B;  3AWX B;  3AWU B;  2ZMZ B;  1WX4 B;  2ZMX B; 
#chains in the Genus database with same CATH topology
 4NBA A;  3AWW B;  3AWZ B;  2ZWG B;  1WX5 B;  4NBG A;  3AWY B;  3AX0 B;  2AHL B;  3GKQ A;  4NB8 A;  2ZWE B;  1WW9 A;  2AHK B;  2ZWD B;  4NBF A;  1Z01 A;  3VMG A;  2ZMX B;  4NBE A;  1WXC B;  1WX2 B;  3GCF A;  4NBB A;  2JV8 A;  1Z03 A;  3AWV B;  4NBD A;  4NB9 A;  3AWT B;  2DE7 A;  2ZMY B;  4NBC A;  3VMH A;  2DE5 A;  3AWS B;  2ZWF B;  3AWX B;  3AWU B;  1Z02 A;  2ZMZ B;  1WX4 B;  2DE6 A;  3VMI A;  4NBH A; 
#chains in the Genus database with same CATH homology
 3AWW B;  3AWZ B;  2ZWG B;  1WX5 B;  3AWY B;  3AX0 B;  2AHL B;  2ZWE B;  2AHK B;  2ZWD B;  1WXC B;  1WX2 B;  2JV8 A;  3AWV B;  3AWT B;  2ZMY B;  3AWS B;  2ZWF B;  3AWX B;  3AWU B;  2ZMZ B;  1WX4 B;  2ZMX B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...