1WX5B

Crystal structure of the copper-free streptomyces castaneoglobisporus tyrosinase complexed with a caddie protein in the monoclinic crystal
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
82
structure length
71
Chain Sequence
b'APESFDEVYKGRRIQGRPAGYEVFVDGVQLHVMRNADGSWISVVSHYDPVPTPRAAARAAVDELQGAPLLP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords tyrosinase
publication title Crystallographic Evidence That the Dinuclear Copper Center of Tyrosinase Is Flexible during Catalysis
pubmed doi rcsb
source organism Streptomyces castaneoglobisporus
molecule tags Oxidoreductase/metal transport
total genus 17
structure length 71
sequence length 82
chains with identical sequence D
ec nomenclature
pdb deposition date 2005-01-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF06236 MelC1 Tyrosinase co-factor MelC1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1880.10 Alpha Beta 2-Layer Sandwich protein ne1242 fold protein ne1242 domain like 1wx5B01
1WXCB 3AX0B 3AWSB 2ZWGB 3AWUB 3AWVB 1WX2B 2ZMYB 3AWYB 2AHKB 3AWTB 3AWXB 2ZMXB 1WX5B 3AWZB 2JV8A 2AHLB 2ZWFB 2ZWEB 3AWWB 2ZWDB 1WX4B 2ZMZB
chains in the Genus database with same CATH superfamily
4NBHA 1WXCB 1Z01A 2DE7A 4NBAA 3VMIA 3AX0B 2DE5A 3AWSB 4NBGA 2ZWGB 1WW9A 2DE6A 1Z02A 3VMGA 1Z03A 3AWUB 3AWVB 1WX2B 2ZMYB 3AWYB 2AHKB 3AWTB 4NB8A 3AWXB 3VMHA 2ZMXB 4NBFA 4NBEA 4NBCA 1WX5B 4NB9A 3GCFA 3AWZB 4NBBA 2JV8A 2AHLB 2ZWFB 4NBDA 2ZWEB 3GKQA 3AWWB 2ZWDB 1WX4B 2ZMZB
chains in the Genus database with same CATH topology
1WXCB 3AX0B 3AWSB 2ZWGB 3AWUB 3AWVB 1WX2B 2ZMYB 3AWYB 2AHKB 3AWTB 3AWXB 2ZMXB 1WX5B 3AWZB 2JV8A 2AHLB 2ZWFB 2ZWEB 3AWWB 2ZWDB 1WX4B 2ZMZB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WXC B;  3AX0 B;  3AWS B;  2ZWG B;  3AWU B;  3AWV B;  1WX2 B;  2ZMY B;  3AWY B;  2AHK B;  3AWT B;  3AWX B;  2ZMX B;  1WX5 B;  3AWZ B;  2JV8 A;  2AHL B;  2ZWF B;  2ZWE B;  3AWW B;  2ZWD B;  1WX4 B;  2ZMZ B; 
#chains in the Genus database with same CATH topology
 4NBH A;  1WXC B;  1Z01 A;  2DE7 A;  4NBA A;  3VMI A;  3AX0 B;  2DE5 A;  3AWS B;  4NBG A;  2ZWG B;  1WW9 A;  2DE6 A;  1Z02 A;  3VMG A;  1Z03 A;  3AWU B;  3AWV B;  1WX2 B;  2ZMY B;  3AWY B;  2AHK B;  3AWT B;  4NB8 A;  3AWX B;  3VMH A;  2ZMX B;  4NBF A;  4NBE A;  4NBC A;  1WX5 B;  4NB9 A;  3GCF A;  3AWZ B;  4NBB A;  2JV8 A;  2AHL B;  2ZWF B;  4NBD A;  2ZWE B;  3GKQ A;  3AWW B;  2ZWD B;  1WX4 B;  2ZMZ B; 
#chains in the Genus database with same CATH homology
 1WXC B;  3AX0 B;  3AWS B;  2ZWG B;  3AWU B;  3AWV B;  1WX2 B;  2ZMY B;  3AWY B;  2AHK B;  3AWT B;  3AWX B;  2ZMX B;  1WX5 B;  3AWZ B;  2JV8 A;  2AHL B;  2ZWF B;  2ZWE B;  3AWW B;  2ZWD B;  1WX4 B;  2ZMZ B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...