1WX6A

Solution structure of the sh3 domain of the human cytoplasmic protein nck2
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
91
structure length
91
Chain Sequence
GSSGSSGLSNGQGSRVLHVVQTLYPFSSVTEEELNFEKGETMEVIEKPENDPEWWKCKNARGQVGLVPKNYVVVLSDGPALHPAHSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of the SH3 domain of the human cytoplasmic protein NCK2
rcsb
molecule keywords Cytoplasmic protein NCK2
molecule tags Structural genomics, unknown function
source organism Homo sapiens
total genus 7
structure length 91
sequence length 91
ec nomenclature
pdb deposition date 2005-01-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 1wx6A01
2VWFA 2F2VA 1PKSA 2RF0A 1T0JA 5FWBA 3EG1A 2KGTA 1ABOA 4RUGA 5I22A 3TVTA 3I9QA 2DE0X 2EYZA 3PE0A 1X2KA 4DEYA 1X27A 2J7IA 1SSHA 1U06A 1ZX6A 2CUBA 2D8JA 2L3SA 2ROLA 2K2MA 1GCQC 2GTOA 1SHFA 1K76A 4AFZC 2JM8A 1AZEA 4J9IA 2A28A 1M27C 2L3QA 1Z9QA 4X1VA 2RQVA 2JS0A 3THKA 1E6HA 4JPBW 2FG0A 1GBRA 2I0NA 1M3AA 3RNJA 2LJ1A 1N5ZA 2EPDA 4JJDA 1HD3A 3PVLA 1AWXA 2CH4W 1QCFA 1Y0MA 1X6BA 1AD5A 2J06A 4J9BA 1ZBJA 3NHNA 2V1QA 1MV3A 4OMMA 2EYYA 3UATA 4JJBA 2C0TA 2D8HA 3QWXX 1SHGA 2JW4A 2YUOA 1PWTA 3EHRA 4D8KA 2YT6A 2MIOA 2FRWA 2CT3A 2F2WA 1YP5A 1ZLMA 2AKKA 2DL8A 2DBKA 3UF4A 1GL5A 1V1CA 1X69A 1GFDA 2KRMA 2LX7A 3M0PA 5IXBA 3EG0A 1UHCA 2DRKA 4Z88A 1UHFA 3GBQA 3VS6A 2FEIA 3H41A 3H0HA 1SEMA 4IIOA 2LZ6B 4RTUA 3VS0A 1T3LA 2E5KA 2KT8A 1YCSB 2FRYA 1U5SA 2DF6A 4LUDA 3SHWA 2JMAA 4RTXA 3TSWA 4J9CA 1NYGA 1AVZC 1FMKA 1RLPC 2DVJA 2FPFA 2GBQA 4ZNXA 2J6OA 4RTTA 1UUEA 1JO8A 2EW3A 3ZL7C 1TUDA 2NWMA 1VYUA 1OV3A 2KXCA 1NEBA 3VS5A 3M0UA 2GTJA 1WLPB 2F2XA 5IXFA 1RI9A 4Y92A 1W1FA 1AEYA 1RLQC 1Y57A 2JS2A 4LNPA 2KYBA 1ZSGA 2YUNA 4EIKA 4OMNA 4J9GA 1G83A 1QWFA 2NUZA 2K6DA 4AFUC 2ECZA 1UGVA 2HSPA 3O5ZA 3A98A 2G6FX 4OMOA 1HSQA 1EFNA 1M8MA 2PNIA 2K79A 1UE9A 2EBPA 2EYXA 2AZSA 1QLYA 2ROTA 4CC7A 3EG2A 2KE9A 4AFQC 1KSWA 4HVWA 1QKXA 3VS4A 1GCPA 1ARKA 4CC4B 4RTWA 1QWEA 2KBTA 1G2BA 2MOXA 1BK2A 3QWYA 1FYNA 1WYXA 2ED1A 2CSQA 1SRMA 2O2OA 3I5SA 1OEBA 3M0QA 1U3OA 4DEXA 4AFSC 2KXDA 2O9SA 1ZUKA 3VS1A 2JXBA 4E6RA 2AK5A 2EGEA 2O31A 4ORZA 1WIEA 4A63B 4J9FA 1PHTA 4OMPA 5I11A 2BZ8A 2O88A 2H8HA 1PRLC 2LQNA 3UA6A 3RBBB 1RUWA 4FSSA 4JZ4A 2LQWA 1WFWA 2DNUA 2BZYA 1AOJA 1GRIA 2DM1A 1YN8A 2LMJA 2QDLA 1LCKA 1HJDA 2LP5A 3IQLA 4HCKA 2EQIA 3H0IA 2CDTA 2A36A 1TG0A 3U23A 4HVUA 3M0TA 1K9AA 1ABQA 4CC2A 5ECAA 2ESWA 3VS2A 3JV3A 1MUZA 2C0IA 2K7AA 3KFVA 1NM7A 2A08A 2BZXA 2M0YA 2IIMA 2X3XD 2B86A 2KEAA 1UTIA 1Z9ZA 2DL3A 4CC3A 1XOVA 4JZ3A 5FW9A 1NLOC 2DJQA 3H0FA 1VYVA 1BB9A 4LE9A 2FPDA 2DX1A 1CSKA 2OJ2A 1WXTA 3I35A 2LJ3A 2DLPA 1NG2A 5EC7A 1S1NA 4RTYA 5IH2A 2KYMA 3EHQA 1PKTA 2A37A 2RQWA 1OOTA 2SRCA 2AZVA 2K3BA 4OMLA 2HBWA 1QKWA 4HXJA 1KFZA 1M30A 3M0RA 2L3PA 2L2PA 2RQTA 2KNBB 2K9GA 2JM9A 3NMZC 3NPFA 2HDAA 4RTZA 2FPEA 2HEQA 3CQTA 2GGRA 4LN2A 1WXBA 2EGAA 2FO0A 4GLMA 1K4US 3TSZA 1WI7A 4AG2C 2DL7A 5GJWB 1JXMA 1OPLA 1M3CA 1H92A 1MV0B 1B3QA 1GFCA 1SRLA 1JEGA 1ZUYA 3I5RA 4JJCA 1H8KA 1K0XA 1BU1A 2JT4A 2EKHA 1AWOA 4WCIA 1A0NB 4HVVA 1YWPA 2LCSA 2HCKA 3ULRB 3LH5A 4K11A 1WDXA 3M0SA 1NEGA 2LJ0A 2J05A 4J9HA 1IO6A 2KT1A 1H3HA 1J3TA 1JXOA 1W6XA 4M4ZA 2XMFA 2KRSA 1JQQA 1B07A 4F16A 3EG3A 1UDLA 2KRNA 2RNAA 2KROA 2EVRA 4LUEA 2CUDA 2OAWA 2O9VA 1I0CA 2YUQA 2GQIA 4RTVA 3C0CA 2RQRA 4D8DA 2DILA 4J9EA 1T3SA 2DBMA 4F14A 2EGCA 3SEMA 1W70A 1OPKA 3VS3A 2YDLA 3REAB 1E7OA 2J6FA 5IHKA 3VRZA 2DMOA 1WXUA 1VA7A 2AKLA 2JMCA 2DL4A 2BTTA 1JU5C 1E6GA 4GBQA 2VVKA 2JTEA 2D1XA 1X6GA 2RPNA 1PNJA 2KR3A 2M51A 2W10A 1I1JA 2SEMA 1SPKA 1T0HA 1UJ0A 1AWJA 5HCKA 1AWWA 2W0ZA 5IHNA 2ED0A 1TUCA 3VS7A 5IHIA 2ENMA 1BBZA 5L23A 1KIKA 4R0KA 1AZGB 3VRYA 5GJVB 3R6NA 1CKAA 2YSQA 4OMQA 4IIMA 1VYTA 5FWCA 2V1RA 1PRMC 1UG1A 2CREA 2CSIA 2C0OA 1I07A 1M3BA 4Z8AA 3REBB 2MCNA 1KJWA 2X3WD 2RMOA 4F17A 2RQUA 2CH4A 1X43A 1GBQA 3NGPA 1NLPC 2DYBA 3EGUA 4KRTA 1WX6A 2PZ1A 4QT7A 1K0SA 2RN8A 4J9DA 4AG1C 2L0AA 2DL5A 2OI3A 1GCQA 4ESRA 1NYFA 1UJYA 2DA9A 3FJ5A 1WA7A 1CKBA 1UFFA 1ZUUA 2P4RA 2DRMA 2LNHB 1X2QA 2YUPA 1YNZA 1UECA 2ABLA 2EYWA 2CT4A 2D0NA 3PVQA 2VKNA 2J6KA 2PTKA 4Z89A 1YWOA 1K1ZA 2GNCA 3UA7A
chains in the Genus database with same CATH superfamily
4JS4A 5D6WA 4KUIA 3M54A 3EG1A 3JCMb 4DBFA 3JCMf 3E2UA 3I9QA 2EYZA 1X2KA 1X27A 2J7IA 2D8JA 2L3SA 4F7UF 5LJ5d 5KYNA 4EMKA 2GTOA 1K76A 3TQ7P 3OYKA 1I5OB 2CKKA 2O4XA 1PCXA 2JZ2A 2X4WA 3CEYA 2X51A 3TEEA 2COWA 1VQ4A 2L3QA 3HSBA 4X1VA 2HBPA 3SDZA 2RJEA 4JPBW 3JCMc 4BI8B 1GBRA 2I0NA 2RH2A 1HD3A 2CH4W 2LX9A 1NZ9A 2E4HA 4HA8A 4LXCA 3EG9A 1MV3A 3UATA 4JJBA 1PC0A 3QWXX 1SHGA 2JW4A 5DM7R 1KC8R 1PWTA 3EHRA 5CCAA 1VQ6T 2CT3A 4X9DA 3M5AA 5LJ5g 3DKMA 5D6YA 4JLIA 2OTJQ 1X69A 4FL6A 8ATCB 2KRMA 2FZCB 2ZPEB 1UHCA 2DETA 4Z88A 1UHFA 2O4XB 3PNWC 2QQAA 1Y7XA 1I5LA 2CP6A 4RMOA 2KQWA 3VS0A 1T3LA 1IGUA 1NJIC 3SHWA 3OSSC 1RACB 2QA4Q 4RTXA 1KD1U 3RDVA 1VQ9T 2OTLT 3BFMA 1D1BA 2FPFA 2GBQA 2IVWA 4OVAA 4ZNXA 3CCLQ 1WGSA 4DBHA 2EW3A 4C8QE 1VQNA 1M2VB 1M90R 5GMKl 2CZ6B 3JSCA 2GTJA 1NPRA 4Y92A 3WXMB 1AEYA 1RLQC 4ZGDB 4LNPA 4HT8A 4PL6A 4EIKA 4OMNA 1QWFA 1JBMA 3INZA 4AFUC 1XJWB 2ECZA 4J7FA 1KHIA 4XU3A 3A98A 2VC8A 3JRZA 5GMKm 1N9SA 2G6FX 2LCLA 5CKDA 5KYWA 2K3XA 2NUTB 3QBYA 1R8OB 2K79A 1UE9A 2ZPIB 1QLYA 1TOVA 1QKXA 3CCEQ 1G2BA 5KH6A 3QWYA 4ELYC 3RUXA 2DEUA 4LDXA 1SSFA 1OEBA 2L8DA 3CPWP 1K8AU 1IGQA 4DA4A 4E2FB 3GNFB 3META 2KXDA 3M53A 4ME7A 5FU6B 5J3BA 4QVDA 4ORZA 1WJQA 2M0OA 5LJ5j 1Y71A 1VQPT 2DIGA 2H3JA 3RBBB 4E7LA 3OYBA 4CI0C 2QQSA 3L2QA 2LQWA 2DNUA 2R5MA 5CKFA 1VQ4Q 2DD4A 1JB0E 3OB9A 2DK3A 3ZBDA 2HMAA 1YN8A 2QDLA 2VUBA 5KYWB 2PVGB 1LCKA 4FYXB 2LP5A 4FSXA 3OYCA 2RHZA 5C6SA 5LJ5e 3QKJA 2QA4T 2QK0A 2RI3A 3M0TA 4X34A 4LD6A 3QYHB 3BY7A 5FU7B 1OYXA 2XICA 3C12A 3SB2A 1UGQB 1RAEB 1MUZA 2FZGB 5LJ5f 3KFVA 1NM7A 2HSEB 2R5AA 4C92A 4E7IA 2B8AA 1W2BS 1R0BG 1BKBA 4M7DA 1MMAA 2X3XD 2DL3A 1Z9ZA 2QGFB 1XOVA 4JZ3A 2LC4A 1K73C 2EYQA 3H0FA 3L2RA 1MMDA 4FT2A 4MZTA 3M57A 1CSKA 2RHXA 5GAOm 3I35A 4ZTFA 1YJWQ 4PNOA 2LJ3A 1PG5B 1K9MU 2R58A 5EC7A 1S1NA 1HXDA 3J81E 2QEXA 1BIAA 4RTYA 2KYMA 1PKTA 3BW1A 2RQWA 4N4HA 1OOTA 2K3BA 3VV0A 2K5LA 3CCVA 4QVZA 3MO8A 3S3OA 2HBWA 1KK7A 1QCOA 1KFZA 3V7RA 2L3PA 1D0YA 1OULA 2YWWA 2CP2A 2CP7A 5I2MA 5KE2A 4LN2A 1VQOA 3CCET 2Y4XA 5HK3A 1KQ2A 4M7AD 1VQNQ 1K4US 4BD3A 2DAQA 2EJ9A 3HHTB 1VQ7T 4AG2C 4OGEA 2L5QA 5C0MA 5KCHA 5KYUA 1JXMA 3C95A 2JVVA 2QDYB 1RAFB 4KH1B 1MV0B 2NUPA 1B3QA 1GFCA 1SRLA 2MF2A 2QASA 4F7UA 4JRPA 5GAOp 3OYJA 1OQKA 3QG1A 3S3NA 4JJCA 2X4JA 3V7CA 1BU1A 1NBEB 2JT4A 2M02A 2EKHA 1ZSZB 4OB1B 1YWPA 2XDBA 9ATCB 3G1JA 3AT1B 3CXCA 4EDUA 1ZQ1A 4E7KA 1D3BB 2KROA 2OAWA 4PLLA 2O9VA 1I0CA 2ZPHB 2GQIA 3FEOA 4M7AB 4RTVA 1PSEA 2RQRA 4J9EA 2DBMA 4F14A 3OYDA 1QVGA 3SEMA 1IHWA 3REAB 4KBMB 2J6FA 3E19A 5IHKA 1KQSA 4J6YA 2DL4A 4IUVA 1BI3A 2KY9A 1VQ6A 4KULA 4F7UB 4JJNK 2F5TX 1O75A 5LJ3h 2W10A 2CZ1B 1YJWT 1UJ0A 1AWJA 3JCMX 1TUCA 1OZ2A 3VS7A 2ENMA 1KIKA 1AZGB 1G8XA 2RK1A 1N8RR 1CKAA 3H8ZA 4OMQA 1Q7YC 3MJXA 3AHUA 1VYTA 2DYIA 1OU9A 2CSIA 3JCMP 3UWNA 2MCNA 1G5VA 2RMOA 4BDZA 2DO3A 1X43A 1UEBA 6AT1B 3HFNA 2PZ1A 1D0XA 1OZ3A 1VQNT 1VQ9A 3CPFA 4J9DA 3CBMA 2K5FA 3CBPA 4O5VA 4J8OA 4ESRA 1NYFA 2ZPGB 3OYFA 2KK4A 5DLOA 4L59A 3X24B 3CMAT 3LWHA 1NJIU 4FCYA 4R56A 2JJ9A 4PJOD 1KC8U 4XU1A 5CQXA 2QEXQ 1LJOA 3M4GA 4II1A 2J6KA 4M75D 3JB9H 2K3YA 3OW2A 2DVEA 3I55T 2YLCA 2GNCA 4C5GA 8AT1B 3CCMA 1K8AC 1QQJA 3MEAA 1T0JA 3VJPA 4JRIA 3H6ZA 1BIBA 2KGTA 1ABOA 2ZCFB 1VQOQ 2DE0X 4DEYA 2HL3A 2MMPA 1VIFA 2DXCA 1SSHA 1U06A 2WSCE 1SHFA 4M7AE 2JM8A 2JUFA 2RM4A 4JS5A 3P8BB 4J9IA 4M7AC 2HKNA 2A28A 4PJOB 2HKQB 4ZTJA 2H3EB 2E10A 2MAMA 1TUGB 1S72T 3OYYA 1VQMT 3PIPA 4XK8E 2JS0A 1E6HA 4JDSA 1KHCA 2FG0A 2ZPBB 3OYGA 3CC4Q 1M3AA 4XTYA 4A4FA 1N5ZA 2EPDA 4F7UE 1VQPA 3PVLA 4C5IA 4XU2A 2LT4A 2J06A 4J9BA 3NHNA 4KT0E 3VYHB 2EFIA 4OMMA 2EYYA 2D8HA 5I2SA 2LT1A 4D8KA 2MIOA 2FRWA 2F2WA 3V8JA 3QZ9B 2DL8A 5CIUA 2QA4A 1KG1A 3MP1A 2DPPB 2XD0A 2HQHA 1VQLT 3EGDB 4QVCA 3CCJT 1K9MC 1GL5A 1YBYA 1V1CA 1Q82R 3SWNC 2QG9B 5IT9E 3OYHA 3M0PA 2MYSA 2DRKA 3JB9J 1I8FA 1VQ6Q 3LX7A 3M56A 1DJ7B 4IIOA 2LZ6B 5GAN8 2CS7A 3WVDB 4OB3B 1QP3A 2E12A 1HYOA 2KMTA 3L2WA 3TSWA 3EH2A 1KQ1A 3A8GB 1NYGA 1FMKA 1RLPC 4LDUA 2PUOB 2DVJA 1RAHB 5GMKh 2LDMA 4PFOA 1K73U 2R57A 1TH7A 4B9XA 1VYUA 1NEBA 3JB9G 4A4HA 3VS5A 2JN0A 2AIRB 1RI9A 4FYYB 2LRQA 3A5ZB 3RKWA 1VQ9Q 3OMGA 2KYBA 5AT1B 3OYEA 4M7AF 1ZSGA 3CCEA 1UB4A 2HSPA 1VQ7A 3O5ZA 4JLGA 4KGZB 2BIVA 2RO0A 4IUQA 1LNXA 4Y91A 1M8MA 4GY5A 5D7UA 4MMKA 1OU8A 2OX7A 3CC4T 4E7HA 4PJOE 2ROTA 4HCCA 1VQ5Q 4PJOC 4AFQC 1Q86R 1SF9A 4OMFB 5KYYA 3OYAA 2DXUA 4BACA 1QWEA 3CC7T 2KBTA 3CCMQ 1BK2A 1BI0A 4M75C 4M77D 1SRMA 2O2OA 3URGA 3NFCA 3JCMJ 2E41A 3M0QA 1YJ9Q 4RCCA 3VS1A 3CD6T 3HTRA 4A63B 3CCQA 2YRDA 2FHDA 5HKCA 2EAYA 3T9NA 3CCSA 1QW1A 4XTWA 2LQNA 1M2VA 2MK5A 4FSSA 3NTKA 2BZYA 2V26A 1QVFP 1AOJA 1NE8A 2DM1A 3L2VA 4HCBA 1U1SA 2ATCB 1HJDA 1UGPB 2V8IA 3OYMA 3V8KA 3RKYA 2EQIA 2FZKB 2CDTA 1YHQT 1M2OA 4PLIA 2VXFA 1TG0A 1VQPQ 2MWPA 1YJWA 1Q95G 5KYYB 3Q1JA 5GAN2 2M1HA 2C0IA 4IUPA 4ZN1A 2A08A 4A4GA 2NUTA 3MPUB 2BZXA 3DLLA 1YIJT 5GAMh 2PQWA 3E1SA 3S3MA 2KEAA 1UTIA 2DJQA 1KC8C 2QTVA 4IUUA 2DX1A 2LNVA 1WXTA 2DLPA 2CGHA 4UC4A 1Q7YU 1JJ2P 2D0QB 3FDRA 2XKOC 4PJOF 4BDYA 4NL2A 1Y96B 3CMAA 1W2BP 1ACMB 1QKWA 2IG0A 2RHUA 3M0RA 2CP3A 4YTLA 1VQ5T 3HPWA 1TS9A 2K9GA 5HY6A 3NPFA 4RTZA 4M75F 2FPEA 1PSFA 2GGRA 1Q81R 2KDSA 3MP6A 3CCMT 3GP8A 3GF5A 2DL7A 3LLRA 2PVDB 3I55A 1H92A 5LJ3d 1QVPA 2QGGA 1YJ9T 1M90C 1QVFS 1N9RA 5M9OA 1K0XA 2E65A 3MEUA 2LCCA 1QP2A 2GFAA 2KI7A 1LPLA 4WCIA 4LDVA 4Q5WA 4ZN3A 1VQ7Q 4HVVA 2LCSA 4K11A 4KGXB 3M0SA 1D1AA 3I56T 1QMCA 2QTXA 1J3TA 1JXOA 3M55A 2XMFA 3UPUA 1S72A 1VQMA 3FIFA 5CO7A 4F16A 3EG3A 4PJMA 2EVRA 1H3ZA 1RAAB 5A0DA 5I21A 4D8DA 3BDLA 2FB7A 3QHSA 3VRZA 5LJ3g 2VV5A 2YRCA 1WXUA 3A8MB 2XG8D 2JMCA 2BTTA 1IHVA 1JU5C 2HZYA 1E6GA 4RG2A 3QJ6A 4M77C 4N0AA 2DIQA 2VVKA 2JTEA 4PK4A 3CCQQ 5CQYA 1X6GA 3DB3A 1JJ2S 2RPNA 4C92G 2X9HA 3CCSQ 5GAOl 4M7DG 4A53A 3JCMV 2CZ7B 4KUDK 2LTOA 1VQLA 1SPKA 1T0HA 3CCJA 4HCZA 5IHNA 2CP0A 3G71T 1BBZA 1M1KR 1MHNA 5GJVB 2QXFA 3R6NA 2YSQA 4IIMA 3ZFJA 5FWCA 1XNIA 1IZ6A 1PRMC 1UG1A 2CREA 2F69A 1ZSZA 1KJWA 2X3WD 2HNIA 4C0GA 3NGPA 4QT7A 4C0FA 4AG1C 2L0AA 2DL5A 5DLQE 3ME9A 3PGGA 1D3BA 2K5IA 5GAN7 4Y28E 1LVKA 5GAN5 2DA9A 1B34A 4FW2A 2XDDA 2L3RA 2X4XA 3FJ5A 4M7AA 1VUBA 1ZUUA 3LH0A 3JCMQ 4WF2A 2DRMA 3RMSA 2LNHB 2YUPA 2VB6A 2D0NA 2FVUA 4F7UG 5GANd 2VKNA 3QO3A 4PFPA 2O01E 3M9QA 4Z89A 1YWOA 3CMAQ 1WJRA 2VWFA 2GQVA 2RF0A 3QIIA 2RJCA 5LL6S 4RKUE 4GLKA 3VUBA 3CC4A 4RUGA 1GXIE 4FU6A 3TVTA 3JB9F 3UDCA 1YCYA 2K2MA 3QUIA 5KYXB 1BI1A 3ZEHA 3CC7A 1GCQC 3I55Q 4M77F 5GAOq 1AZEA 3SWNA 2DXTA 4XTVA 5LJ3j 1XQHA 4M78G 3OSVA 4N4IA 1B34B 1OI1A 3CCQT 1Z9QA 2RJDA 3THKA 3F70A 3CCST 4OB0B 3CD6A 3MCAB 3EGXA 3RNJA 1D1CA 5GANg 1KD1R 1WHGA 3QJYA 5A0GA 1VQ8T 4FIBA 1QCFA 2E5QA 5LJ3e 5GAN4 4A54A 1S72Q 1FMVA 1VQMQ 2V1QA 3DB4A 2YUOA 3C4SA 5LJ3f 5KE3A 2L89A 3EFOA 1YP5A 1YHQA 4M78D 4D6WA 5FRMA 2AKKA 4O6JA 1TSFA 2QYZA 3UF4A 1X01A 5L8RE 5IXBA 3EG0A 1RADB 4FYVB 3SWNB 3GBQA 4BI3A 1YIJA 3NTIA 3H0HA 1SEMA 2A7YA 3PIOA 4NOYA 5IAYA 1VQLQ 2FRYA 4LUDA 3CCJQ 3R6OA 3EGXB 3CCUT 4J9CA 4E7JA 1AVZC 1PM3A 4OP0A 4PJOA 2M9UA 2WSFE 4RTTA 1JO8A 4DQ2A 2VASA 1EIFA 1N8RC 1AT1B 2NWMA 4M75A 1OV3A 2KXCA 5CKBA 3EFOB 3M0UA 1WLPB 2F2XA 2QQ9A 3O8VA 1VQ5A 1W2BA 1W1FA 1WJSA 3LYIA 2YUNA 1TU0B 4J9GA 1G83A 2NUZA 3P8HA 4DBQA 5J26A 3OBWA 1UGVA 4ANJA 1EX4A 5IN1A 4XTXA 1WQ7A 4J7IA 4C92C 2VGNA 2WACA 4OMOA 4FM4B 4FYWB 2PNIA 2HQXA 4EMHA 1YJ9A 3H9NA 3EGDA 3E9GA 2EBPA 2EYXA 2AZSA 1JRIA 1OX9A 3EG2A 5CR2A 2D9TA 5GAMd 3VS4A 1GCPA 2MPXC 4CC4B 5GANj 4RTWA 3LWIA 1WHMA 1ZA1B 2MI6A 1FYNA 4NL3A 2ED1A 4FW1A 3V7SA 2CSQA 3I56A 2KAFA 3RIRA 2F5KA 1M90U 3I5SA 3OS1A 3PT9A 3CPWA 1U3OA 2BUDA 4M75B 2K2VA 2O9SA 1ZUKA 2JXBA 4E6RA 2AK5A 2EGEA 4MZPA 1WIEA 5D6XA 5GANe 1PHTA 3CC7Q 4OMPA 2BZ8A 2H8HA 4C5HA 2EQUA 3UA6A 1RUWA 4C8QG 3BE3A 2QQRA 5GANf 1GRIA 4JUVA 2P0QA 2LMJA 2DEQA 3OS5A 1M1FA 4PJNA 3CD6Q 2E64A 5GAMg 2A36A 1X75C 3U23A 1I81A 2BE9B 1K9AA 3FC3A 1ABQA 2ESWA 3VS2A 3JV3A 1ZA2B 2K7AA 3G71A 2NYSA 2M0YA 2IIMA 1M4ZA 1YI2T 3QYGB 1YHQQ 2EJGA 5FW9A 5GMKe 1NLOC 2QQBA 3OY9A 3OYIA 3QSUA 1FXXA 5FROA 1BB9A 4LE9A 1BI2A 5CKHA 4R55A 3CMET 2EWNA 2FPDA 2OJ2A 4M78C 2RHYA 2CP5A 1QCNA 4LD9K 1NG2A 3ASKA 1YIJQ 2RHIA 5IH2A 1IXDA 2DFUA 4N4GA 1TWBA 2KSSA 3WVEB 2AZVA 2YHTA 1IRXA 1WZOA 4J5YA 1WHJA 2ZAEA 3M4YA 1P92A 2LQ8A 1C0MA 4HXJA 3BDUA 1M30A 4QW2A 3L2UA 2L2PA 3M58A 2KNBB 2K4YA 2HDAA 2HEQA 3V8LA 3CQTA 1FMWA 1WXBA 2IPOB 4HT9A 2FO0A 4AMCA 4GLMA 3TSZA 2A0FB 1MMGA 1OPLA 1YJNA 3L42A 1YITT 3HRUA 1VIEA 1C1AA 1JEGA 5HK0A 4LDWA 3D7SB 3JB9D 1H8KA 4M77A 2X4YA 4M75E 4OGCA 2VGMA 2PVOB 1AWOA 1A0NB 3JCMh 1MNDA 3ULRB 1G3TA 2E70A 2J05A 2LJ0A 3A8LB 2JOYA 1U1TA 4MDXA 1H3HA 2YRVA 2RI2A 4M4ZA 1JQQA 1B07A 3CXCP 1UDLA 2XU8A 2RNAA 4C5EA 2MWOA 4AT1B 1AHJB 2CZ0B 1PD1A 2YUQA 2CYZB 5GAMj 2EKOA 2XHCA 3M59A 2DILA 1T3SA 1VQ8A 1QVGP 4BY6B 1Q86C 3I56Q 3JCMW 3RERA 3RR6A 1Y96A 2DMOA 1KQSP 3A1PA 3X25B 3CC2Q 3FJPA 3OS2A 4BUGA 4L6V5 2EQMA 4GBQA 1NJIR 4M78F 2YXYA 2VYTA 2JTFA 5GAMe 4RCBA 4E7ZA 2KR3A 4M77B 3CBOA 1UGRB 2I2LA 2SEMA 1VQKT 2XDPA 5HCKA 1AWWA 5GAMf 2ED0A 4EPCA 2Y4YA 4PFZA 4L5GA 1SKUB 3EH1A 4EMKB 3SD4A 2NLUA 2V1RA 3G6ET 2ZZDA 2E3HA 2BE7D 3OYNA 4F17A 4X9CA 2CH4A 3LW5E 5FLXE 3CCUA 1NLPC 5J39A 2FL7A 1YFNA 3G71Q 4V2SA 1FX7A 1K0SA 2DTOA 2WSEE 2OAUA 4OF1A 1B7TA 3UT1A 1GCQA 3N5BB 3HP9A 3OQ5A 4WTOB 2RJFA 3EG9B 1CKBA 1UFFA 5CK9A 4C8QC 1MNEA 1YNZA 1UECA 1XTDA 5A2QE 2EYWA 3CXCS 2G3RA 2RI5A 3G4SQ 2PTKA 1FWZA 3OW2P 1N8RU 4VUBA 3UA7A 3VKIA 1SG5A 2F2VA 1PKSA 1RABB 2DERA 1QVGS 2RK2A 3E9FA 3TU4K 5FWBA 4F04B 5CKEA 5I22A 1KQSS 2DJZA 1WHLA 3PE0A 1ZX6A 2DTHA 2CUBA 4Z02A 2ROLA 1V76A 1YJNQ 4AFZC 4C0DB 1Q81C 2C06A 2DZCA 3CC2T 5FRNA 1G3WA 3EAEA 4KGVB 3CCRQ 3A8HB 1M27C 4DOWA 4BY6C 2RQVA 2DZ9A 1M5Q1 1MMNA 2LJ1A 1IB8A 4XU0A 4JJDA 1AWXA 1Y0MA 2RA2A 1X6BA 3KUFA 4B6MA 4M77E 1AD5A 4IURA 4RG8A 1ZBJA 2OTJT 2K57A 3GNGA 2QI2A 2C0TA 1K73R 4QKUA 2YT6A 2HD0A 3OA6A 1IREB 1ZLMA 1VQ8Q 4EMKC 3J7AF 1EZZB 2DBKA 2ZGWA 1GFDA 2LX7A 4PJJA 1W4SA 4LDYA 4C8QF 1WNLA 4NS5A 1RAIB 3VS6A 3CCLT 1YI2A 2FEIA 4JRKA 5LJ5h 3H41A 3FLGA 4RTUA 3L1AA 2E5KA 5EG2A 2LQKA 2KT8A 1YCSB 3PFSA 1U5SA 2DF6A 3OW2S 3OS0A 5KYXA 2JMAA 1LOJA 1ZHIA 3SFMA 4C92D 3CMEA 4J6XA 4BE1A 4M7DD 2FYKA 4M7AG 4TVRA 1O9SA 3G4ST 2GCXA 4P5NA 2J6OA 1N27A 3GIBA 1UUEA 1M8VA 5CVIA 3ZL7C 5GAOn 1M1KC 4ELZC 1TUDA 4OB2B 2X35A 1NPPA 3CCUQ 4KH0B 5IXFA 3X26B 4BE0A 4EMGA 1Y57A 2JS2A 1M1GA 5GMKi 1WPYA 3EFSA 2XI9A 1Q82U 1YJNT 3VYGA 3LGLA 2K6DA 1X6OA 3CPWS 1I4K1 4IUTA 4ZGEB 3CCRT 5KCOA 1YITA 1HSQA 1EFNA 4C92B 3QDFA 4M7DB 3ER0A 4C0DC 3PMIA 2P4TA 1TTHB 4CC7A 2COYA 1BCOA 2KE9A 3OMCA 4J6WA 1KSWA 4HVWA 1ARKA 1F1BB 4B9WA 1G3YA 2LVMA 2MOXA 2DTIA 1WYXA 3QXEB 1OX8A 2XK0A 1VQ4T 4A4EA 5FU6C 4DEXA 4AFSC 4PKCC 2O31A 3HKSA 4J9FA 2KVQG 5I11A 4XAXB 3X20B 4HKEA 2O88A 1PRLC 4XTZA 5GAN3 1RAGB 4JZ4A 1H641 3GLXA 3DLMA 4M78A 4CRIA 1Q7YR 1WFWA 1QVFA 2P0KA 3QPHA 3IQLA 5KYUB 4HCKA 1WHKA 2NUPB 1Y07A 5FU7C 3HRSA 1Q86U 4HVUA 2P0PA 5DY9A 1VQKA 4CC2A 5ECAA 1UGSB 1KD1C 4BE2A 2RB6A 3P8DA 1MGQA 2DD5A 3RMQA 3VU3C 2VXEA 2B86A 4PJOG 2XIDA 4CC3A 3VUZA 3TREA 4DOVA 3JCMd 3G6EA 2HAXA 1VYVA 2BKDN 3PMTA 1TXQA 4JRQA 3HL8A 3EFRA 4J83A 2PUKB 3OBYA 2V8JA 4M75G 2E3IA 1R77A 2GF7A 1JJ2A 4M78B 3NTHA 1YI2Q 2ZPFB 3EHQA 1WQWA 1K8AR 2A37A 1WHHA 2OTLA 2SRCA 4OMLA 3L2ZA 1U8RA 1ZBXA 3FRNA 5A0LA 3CMEQ 4N0AC 3MHXA 2E6ZA 2RQTA 2Z0WA 1M9SA 2JM9A 1D0ZA 4BI4A 5AYFA 4C92E 3NMZC 3J80E 4M7DE 2D6FA 2EGAA 2AT1B 4M7DC 1WI7A 5GJWB 1M3CA 3QDRB 3JCMg 4QQ6A 3CCVQ 3C94A 2PU9B 3LGFA 4ZGJB 3PTAA 1ZUYA 3I5RA 1ZSZC 2GFUA 1BCMA 3OYLA 4A4KA 2HCKA 3LH5A 1R0CB 1WDXA 1YITQ 1NEGA 1PD0A 2YLBA 4J9HA 1IO6A 2KT1A 2HQEA 3CC2A 1W6XA 3RKXA 2KRSA 4PJLA 2KRNA 4LUEA 2CUDA 2EIFA 3MKDA 1K9MR 2JNGA 3C0CA 2M16A 2RD1A 5GAOr 2EGCA 1W70A 1Q81U 1OPKA 3VS3A 2P84A 2YDLA 2E1HA 1E7OA 4ATOA 3MEVA 3JAME 2EQKA 2OTJA 1D09B 1VA7A 2AKLA 4QQDA 2EJFA 1RL2A 1G3SA 5GMKj 4MMLA 2D1XA 2COZA 4FT4A 1PNJA 1N6AA 5GANh 2M51A 5CAIA 1I1JA 7AT1B 1BYMA 4C8QA 3QZ5B 2W0ZA 4MDWA 1RI0A 5IHIA 3S6WA 5L23A 4R0KA 3VRYA 1V29B 2E6NA 4BB7A 4C8QD 2HL5C 3KXTA 3FB9A 2Y90A 3CCLA 1VOMA 3A8OB 3GOXA 4M78E 2V8KA 2C0OA 4XTUA 3HRTA 4C92F 1I07A 3RESA 1M3BA 4Z8AA 3REBB 4M7DF 3KBGA 1VQKQ 2RQUA 1GBQA 4E7SA 3EGUA 2DYBA 4KRTA 3TCJA 1WX6A 1Q82C 3G4SA 2RN8A 2QEXT 3HFOA 2DXBA 3MEWA 2OI3A 4DBRA 3G6EQ 2F1LA 4E47A 2AHJB 1UJYA 3CCVT 4MZMA 3G7ZA 1WA7A 3GPLA 2P4RA 2JTMA 4QQGA 2DKGA 1X2QA 1HK9A 4IKFA 4C0ZA 4XQ3A 2ABLA 1VQOT 4C8QB 2CT4A 5GAN6 3JB9I 3X28B 3MP8A 1C6VX 2A3LA 3PVQA 2OTLQ 1M1KU 2QAZA 4M77G 1K1ZA 2EQJA 3JCMe 3H0IA 3CCRA
chains in the Genus database with same CATH topology
2VWFA 2F2VA 1PKSA 2RF0A 1T0JA 5FWBA 3EG1A 2KGTA 1ABOA 4RUGA 5I22A 3TVTA 3I9QA 2DE0X 2EYZA 3PE0A 1X2KA 4DEYA 1X27A 2J7IA 1SSHA 1U06A 1ZX6A 2CUBA 2D8JA 2L3SA 2ROLA 2K2MA 1GCQC 2GTOA 1SHFA 1K76A 4AFZC 2JM8A 1AZEA 4J9IA 2A28A 1M27C 2L3QA 1Z9QA 4X1VA 2RQVA 2JS0A 3THKA 1E6HA 4JPBW 2FG0A 1GBRA 2I0NA 1M3AA 3RNJA 2LJ1A 1N5ZA 2EPDA 4JJDA 1HD3A 3PVLA 1AWXA 2CH4W 1QCFA 1Y0MA 1X6BA 1AD5A 2J06A 4J9BA 1ZBJA 3NHNA 2V1QA 1MV3A 4OMMA 2EYYA 3UATA 4JJBA 2C0TA 2D8HA 3QWXX 1SHGA 2JW4A 2YUOA 1PWTA 3EHRA 4D8KA 2YT6A 2MIOA 2FRWA 2CT3A 2F2WA 1YP5A 1ZLMA 2AKKA 2DL8A 2DBKA 3UF4A 1GL5A 1V1CA 1X69A 1GFDA 2KRMA 2LX7A 3M0PA 5IXBA 3EG0A 1UHCA 2DRKA 4Z88A 1UHFA 3GBQA 3VS6A 2FEIA 3H41A 3H0HA 1SEMA 4IIOA 2LZ6B 4RTUA 3VS0A 1T3LA 2E5KA 2KT8A 1YCSB 2FRYA 1U5SA 2DF6A 4LUDA 3SHWA 2JMAA 4RTXA 3TSWA 4J9CA 1NYGA 1AVZC 1FMKA 1RLPC 2DVJA 2FPFA 2GBQA 4ZNXA 2J6OA 4RTTA 1UUEA 1JO8A 2EW3A 3ZL7C 1TUDA 2NWMA 1VYUA 1OV3A 2KXCA 1NEBA 3VS5A 3M0UA 2GTJA 1WLPB 2F2XA 5IXFA 1RI9A 4Y92A 1W1FA 1AEYA 1RLQC 1Y57A 2JS2A 4LNPA 2KYBA 1ZSGA 2YUNA 4EIKA 4OMNA 4J9GA 1G83A 1QWFA 2NUZA 2K6DA 4AFUC 2ECZA 1UGVA 2HSPA 3O5ZA 3A98A 2G6FX 4OMOA 1HSQA 1EFNA 1M8MA 2PNIA 2K79A 1UE9A 2EBPA 2EYXA 2AZSA 1QLYA 2ROTA 4CC7A 3EG2A 2KE9A 4AFQC 1KSWA 4HVWA 1QKXA 3VS4A 1GCPA 1ARKA 4CC4B 4RTWA 1QWEA 2KBTA 1G2BA 2MOXA 1BK2A 3QWYA 1FYNA 1WYXA 2ED1A 2CSQA 1SRMA 2O2OA 3I5SA 1OEBA 3M0QA 1U3OA 4DEXA 4AFSC 2KXDA 2O9SA 1ZUKA 3VS1A 2JXBA 4E6RA 2AK5A 2EGEA 2O31A 4ORZA 1WIEA 4A63B 4J9FA 1PHTA 4OMPA 5I11A 2BZ8A 2O88A 2H8HA 1PRLC 2LQNA 3UA6A 3RBBB 1RUWA 4FSSA 4JZ4A 2LQWA 1WFWA 2DNUA 2BZYA 1AOJA 1GRIA 2DM1A 1YN8A 2LMJA 2QDLA 1LCKA 1HJDA 2LP5A 3IQLA 4HCKA 2EQIA 3H0IA 2CDTA 2A36A 1TG0A 3U23A 4HVUA 3M0TA 1K9AA 1ABQA 4CC2A 5ECAA 2ESWA 3VS2A 3JV3A 1MUZA 2C0IA 2K7AA 3KFVA 1NM7A 2A08A 2BZXA 2M0YA 2IIMA 2X3XD 2B86A 2KEAA 1UTIA 1Z9ZA 2DL3A 4CC3A 1XOVA 4JZ3A 5FW9A 1NLOC 2DJQA 3H0FA 1VYVA 1BB9A 4LE9A 2FPDA 2DX1A 1CSKA 2OJ2A 1WXTA 3I35A 2LJ3A 2DLPA 1NG2A 5EC7A 1S1NA 4RTYA 5IH2A 2KYMA 3EHQA 1PKTA 2A37A 2RQWA 1OOTA 2SRCA 2AZVA 2K3BA 4OMLA 2HBWA 1QKWA 4HXJA 1KFZA 1M30A 3M0RA 2L3PA 2L2PA 2RQTA 2KNBB 2K9GA 2JM9A 3NMZC 3NPFA 2HDAA 4RTZA 2FPEA 2HEQA 3CQTA 2GGRA 4LN2A 1WXBA 2EGAA 2FO0A 4GLMA 1K4US 3TSZA 1WI7A 4AG2C 2DL7A 5GJWB 1JXMA 1OPLA 1M3CA 1H92A 1MV0B 1B3QA 1GFCA 1SRLA 1JEGA 1ZUYA 3I5RA 4JJCA 1H8KA 1K0XA 1BU1A 2JT4A 2EKHA 1AWOA 4WCIA 1A0NB 4HVVA 1YWPA 2LCSA 2HCKA 3ULRB 3LH5A 4K11A 1WDXA 3M0SA 1NEGA 2LJ0A 2J05A 4J9HA 1IO6A 2KT1A 1H3HA 1J3TA 1JXOA 1W6XA 4M4ZA 2XMFA 2KRSA 1JQQA 1B07A 4F16A 3EG3A 1UDLA 2KRNA 2RNAA 2KROA 2EVRA 4LUEA 2CUDA 2OAWA 2O9VA 1I0CA 2YUQA 2GQIA 4RTVA 3C0CA 2RQRA 4D8DA 2DILA 4J9EA 1T3SA 2DBMA 4F14A 2EGCA 3SEMA 1W70A 1OPKA 3VS3A 2YDLA 3REAB 1E7OA 2J6FA 5IHKA 3VRZA 2DMOA 1WXUA 1VA7A 2AKLA 2JMCA 2DL4A 2BTTA 1JU5C 1E6GA 4GBQA 2VVKA 2JTEA 2D1XA 1X6GA 2RPNA 1PNJA 2KR3A 2M51A 2W10A 1I1JA 2SEMA 1SPKA 1T0HA 1UJ0A 1AWJA 5HCKA 1AWWA 2W0ZA 5IHNA 2ED0A 1TUCA 3VS7A 5IHIA 2ENMA 1BBZA 5L23A 1KIKA 4R0KA 1AZGB 3VRYA 5GJVB 3R6NA 1CKAA 2YSQA 4OMQA 4IIMA 1VYTA 5FWCA 2V1RA 1PRMC 1UG1A 2CREA 2CSIA 2C0OA 1I07A 1M3BA 4Z8AA 3REBB 2MCNA 1KJWA 2X3WD 2RMOA 4F17A 2RQUA 2CH4A 1X43A 1GBQA 3NGPA 1NLPC 2DYBA 3EGUA 4KRTA 1WX6A 2PZ1A 4QT7A 1K0SA 2RN8A 4J9DA 4AG1C 2L0AA 2DL5A 2OI3A 1GCQA 4ESRA 1NYFA 1UJYA 2DA9A 3FJ5A 1WA7A 1CKBA 1UFFA 1ZUUA 2P4RA 2DRMA 2LNHB 1X2QA 2YUPA 1YNZA 1UECA 2ABLA 2EYWA 2CT4A 2D0NA 3PVQA 2VKNA 2J6KA 2PTKA 4Z89A 1YWOA 1K1ZA 2GNCA 3UA7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VWF A;  2F2V A;  1PKS A;  2RF0 A;  1T0J A;  5FWB A;  3EG1 A;  2KGT A;  1ABO A;  4RUG A;  5I22 A;  3TVT A;  3I9Q A;  2DE0 X;  2EYZ A;  3PE0 A;  1X2K A;  4DEY A;  1X27 A;  2J7I A;  1SSH A;  1U06 A;  1ZX6 A;  2CUB A;  2D8J A;  2L3S A;  2ROL A;  2K2M A;  1GCQ C;  2GTO A;  1SHF A;  1K76 A;  4AFZ C;  2JM8 A;  1AZE A;  4J9I A;  2A28 A;  1M27 C;  2L3Q A;  1Z9Q A;  4X1V A;  2RQV A;  2JS0 A;  3THK A;  1E6H A;  4JPB W;  2FG0 A;  1GBR A;  2I0N A;  1M3A A;  3RNJ A;  2LJ1 A;  1N5Z A;  2EPD A;  4JJD A;  1HD3 A;  3PVL A;  1AWX A;  2CH4 W;  1QCF A;  1Y0M A;  1X6B A;  1AD5 A;  2J06 A;  4J9B A;  1ZBJ A;  3NHN A;  2V1Q A;  1MV3 A;  4OMM A;  2EYY A;  3UAT A;  4JJB A;  2C0T A;  2D8H A;  3QWX X;  1SHG A;  2JW4 A;  2YUO A;  1PWT A;  3EHR A;  4D8K A;  2YT6 A;  2MIO A;  2FRW A;  2CT3 A;  2F2W A;  1YP5 A;  1ZLM A;  2AKK A;  2DL8 A;  2DBK A;  3UF4 A;  1GL5 A;  1V1C A;  1X69 A;  1GFD A;  2KRM A;  2LX7 A;  3M0P A;  5IXB A;  3EG0 A;  1UHC A;  2DRK A;  4Z88 A;  1UHF A;  3GBQ A;  3VS6 A;  2FEI A;  3H41 A;  3H0H A;  1SEM A;  4IIO A;  2LZ6 B;  4RTU A;  3VS0 A;  1T3L A;  2E5K A;  2KT8 A;  1YCS B;  2FRY A;  1U5S A;  2DF6 A;  4LUD A;  3SHW A;  2JMA A;  4RTX A;  3TSW A;  4J9C A;  1NYG A;  1AVZ C;  1FMK A;  1RLP C;  2DVJ A;  2FPF A;  2GBQ A;  4ZNX A;  2J6O A;  4RTT A;  1UUE A;  1JO8 A;  2EW3 A;  3ZL7 C;  1TUD A;  2NWM A;  1VYU A;  1OV3 A;  2KXC A;  1NEB A;  3VS5 A;  3M0U A;  2GTJ A;  1WLP B;  2F2X A;  5IXF A;  1RI9 A;  4Y92 A;  1W1F A;  1AEY A;  1RLQ C;  1Y57 A;  2JS2 A;  4LNP A;  2KYB A;  1ZSG A;  2YUN A;  4EIK A;  4OMN A;  4J9G A;  1G83 A;  1QWF A;  2NUZ A;  2K6D A;  4AFU C;  2ECZ A;  1UGV A;  2HSP A;  3O5Z A;  3A98 A;  2G6F X;  4OMO A;  1HSQ A;  1EFN A;  1M8M A;  2PNI A;  2K79 A;  1UE9 A;  2EBP A;  2EYX A;  2AZS A;  1QLY A;  2ROT A;  4CC7 A;  3EG2 A;  2KE9 A;  4AFQ C;  1KSW A;  4HVW A;  1QKX A;  3VS4 A;  1GCP A;  1ARK A;  4CC4 B;  4RTW A;  1QWE A;  2KBT A;  1G2B A;  2MOX A;  1BK2 A;  3QWY A;  1FYN A;  1WYX A;  2ED1 A;  2CSQ A;  1SRM A;  2O2O A;  3I5S A;  1OEB A;  3M0Q A;  1U3O A;  4DEX A;  4AFS C;  2KXD A;  2O9S A;  1ZUK A;  3VS1 A;  2JXB A;  4E6R A;  2AK5 A;  2EGE A;  2O31 A;  4ORZ A;  1WIE A;  4A63 B;  4J9F A;  1PHT A;  4OMP A;  5I11 A;  2BZ8 A;  2O88 A;  2H8H A;  1PRL C;  2LQN A;  3UA6 A;  3RBB B;  1RUW A;  4FSS A;  4JZ4 A;  2LQW A;  1WFW A;  2DNU A;  2BZY A;  1AOJ A;  1GRI A;  2DM1 A;  1YN8 A;  2LMJ A;  2QDL A;  1LCK A;  1HJD A;  2LP5 A;  3IQL A;  4HCK A;  2EQI A;  3H0I A;  2CDT A;  2A36 A;  1TG0 A;  3U23 A;  4HVU A;  3M0T A;  1K9A A;  1ABQ A;  4CC2 A;  5ECA A;  2ESW A;  3VS2 A;  3JV3 A;  1MUZ A;  2C0I A;  2K7A A;  3KFV A;  1NM7 A;  2A08 A;  2BZX A;  2M0Y A;  2IIM A;  2X3X D;  2B86 A;  2KEA A;  1UTI A;  1Z9Z A;  2DL3 A;  4CC3 A;  1XOV A;  4JZ3 A;  5FW9 A;  1NLO C;  2DJQ A;  3H0F A;  1VYV A;  1BB9 A;  4LE9 A;  2FPD A;  2DX1 A;  1CSK A;  2OJ2 A;  1WXT A;  3I35 A;  2LJ3 A;  2DLP A;  1NG2 A;  5EC7 A;  1S1N A;  4RTY A;  5IH2 A;  2KYM A;  3EHQ A;  1PKT A;  2A37 A;  2RQW A;  1OOT A;  2SRC A;  2AZV A;  2K3B A;  4OML A;  2HBW A;  1QKW A;  4HXJ A;  1KFZ A;  1M30 A;  3M0R A;  2L3P A;  2L2P A;  2RQT A;  2KNB B;  2K9G A;  2JM9 A;  3NMZ C;  3NPF A;  2HDA A;  4RTZ A;  2FPE A;  2HEQ A;  3CQT A;  2GGR A;  4LN2 A;  1WXB A;  2EGA A;  2FO0 A;  4GLM A;  1K4U S;  3TSZ A;  1WI7 A;  4AG2 C;  2DL7 A;  5GJW B;  1JXM A;  1OPL A;  1M3C A;  1H92 A;  1MV0 B;  1B3Q A;  1GFC A;  1SRL A;  1JEG A;  1ZUY A;  3I5R A;  4JJC A;  1H8K A;  1K0X A;  1BU1 A;  2JT4 A;  2EKH A;  1AWO A;  4WCI A;  1A0N B;  4HVV A;  1YWP A;  2LCS A;  2HCK A;  3ULR B;  3LH5 A;  4K11 A;  1WDX A;  3M0S A;  1NEG A;  2LJ0 A;  2J05 A;  4J9H A;  1IO6 A;  2KT1 A;  1H3H A;  1J3T A;  1JXO A;  1W6X A;  4M4Z A;  2XMF A;  2KRS A;  1JQQ A;  1B07 A;  4F16 A;  3EG3 A;  1UDL A;  2KRN A;  2RNA A;  2KRO A;  2EVR A;  4LUE A;  2CUD A;  2OAW A;  2O9V A;  1I0C A;  2YUQ A;  2GQI A;  4RTV A;  3C0C A;  2RQR A;  4D8D A;  2DIL A;  4J9E A;  1T3S A;  2DBM A;  4F14 A;  2EGC A;  3SEM A;  1W70 A;  1OPK A;  3VS3 A;  2YDL A;  3REA B;  1E7O A;  2J6F A;  5IHK A;  3VRZ A;  2DMO A;  1WXU A;  1VA7 A;  2AKL A;  2JMC A;  2DL4 A;  2BTT A;  1JU5 C;  1E6G A;  4GBQ A;  2VVK A;  2JTE A;  2D1X A;  1X6G A;  2RPN A;  1PNJ A;  2KR3 A;  2M51 A;  2W10 A;  1I1J A;  2SEM A;  1SPK A;  1T0H A;  1UJ0 A;  1AWJ A;  5HCK A;  1AWW A;  2W0Z A;  5IHN A;  2ED0 A;  1TUC A;  3VS7 A;  5IHI A;  2ENM A;  1BBZ A;  5L23 A;  1KIK A;  4R0K A;  1AZG B;  3VRY A;  5GJV B;  3R6N A;  1CKA A;  2YSQ A;  4OMQ A;  4IIM A;  1VYT A;  5FWC A;  2V1R A;  1PRM C;  1UG1 A;  2CRE A;  2CSI A;  2C0O A;  1I07 A;  1M3B A;  4Z8A A;  3REB B;  2MCN A;  1KJW A;  2X3W D;  2RMO A;  4F17 A;  2RQU A;  2CH4 A;  1X43 A;  1GBQ A;  3NGP A;  1NLP C;  2DYB A;  3EGU A;  4KRT A;  1WX6 A;  2PZ1 A;  4QT7 A;  1K0S A;  2RN8 A;  4J9D A;  4AG1 C;  2L0A A;  2DL5 A;  2OI3 A;  1GCQ A;  4ESR A;  1NYF A;  1UJY A;  2DA9 A;  3FJ5 A;  1WA7 A;  1CKB A;  1UFF A;  1ZUU A;  2P4R A;  2DRM A;  2LNH B;  1X2Q A;  2YUP A;  1YNZ A;  1UEC A;  2ABL A;  2EYW A;  2CT4 A;  2D0N A;  3PVQ A;  2VKN A;  2J6K A;  2PTK A;  4Z89 A;  1YWO A;  1K1Z A;  2GNC A;  3UA7 A; 
#chains in the Genus database with same CATH topology
 4JS4 A;  5D6W A;  4KUI A;  3M54 A;  3EG1 A;  3JCM b;  4DBF A;  3JCM f;  3E2U A;  3I9Q A;  2EYZ A;  1X2K A;  1X27 A;  2J7I A;  2D8J A;  2L3S A;  4F7U F;  5LJ5 d;  5KYN A;  4EMK A;  2GTO A;  1K76 A;  3TQ7 P;  3OYK A;  1I5O B;  2CKK A;  2O4X A;  1PCX A;  2JZ2 A;  2X4W A;  3CEY A;  2X51 A;  3TEE A;  2COW A;  1VQ4 A;  2L3Q A;  3HSB A;  4X1V A;  2HBP A;  3SDZ A;  2RJE A;  4JPB W;  3JCM c;  4BI8 B;  1GBR A;  2I0N A;  2RH2 A;  1HD3 A;  2CH4 W;  2LX9 A;  1NZ9 A;  2E4H A;  4HA8 A;  4LXC A;  3EG9 A;  1MV3 A;  3UAT A;  4JJB A;  1PC0 A;  3QWX X;  1SHG A;  2JW4 A;  5DM7 R;  1KC8 R;  1PWT A;  3EHR A;  5CCA A;  1VQ6 T;  2CT3 A;  4X9D A;  3M5A A;  5LJ5 g;  3DKM A;  5D6Y A;  4JLI A;  2OTJ Q;  1X69 A;  4FL6 A;  8ATC B;  2KRM A;  2FZC B;  2ZPE B;  1UHC A;  2DET A;  4Z88 A;  1UHF A;  2O4X B;  3PNW C;  2QQA A;  1Y7X A;  1I5L A;  2CP6 A;  4RMO A;  2KQW A;  3VS0 A;  1T3L A;  1IGU A;  1NJI C;  3SHW A;  3OSS C;  1RAC B;  2QA4 Q;  4RTX A;  1KD1 U;  3RDV A;  1VQ9 T;  2OTL T;  3BFM A;  1D1B A;  2FPF A;  2GBQ A;  2IVW A;  4OVA A;  4ZNX A;  3CCL Q;  1WGS A;  4DBH A;  2EW3 A;  4C8Q E;  1VQN A;  1M2V B;  1M90 R;  5GMK l;  2CZ6 B;  3JSC A;  2GTJ A;  1NPR A;  4Y92 A;  3WXM B;  1AEY A;  1RLQ C;  4ZGD B;  4LNP A;  4HT8 A;  4PL6 A;  4EIK A;  4OMN A;  1QWF A;  1JBM A;  3INZ A;  4AFU C;  1XJW B;  2ECZ A;  4J7F A;  1KHI A;  4XU3 A;  3A98 A;  2VC8 A;  3JRZ A;  5GMK m;  1N9S A;  2G6F X;  2LCL A;  5CKD A;  5KYW A;  2K3X A;  2NUT B;  3QBY A;  1R8O B;  2K79 A;  1UE9 A;  2ZPI B;  1QLY A;  1TOV A;  1QKX A;  3CCE Q;  1G2B A;  5KH6 A;  3QWY A;  4ELY C;  3RUX A;  2DEU A;  4LDX A;  1SSF A;  1OEB A;  2L8D A;  3CPW P;  1K8A U;  1IGQ A;  4DA4 A;  4E2F B;  3GNF B;  3MET A;  2KXD A;  3M53 A;  4ME7 A;  5FU6 B;  5J3B A;  4QVD A;  4ORZ A;  1WJQ A;  2M0O A;  5LJ5 j;  1Y71 A;  1VQP T;  2DIG A;  2H3J A;  3RBB B;  4E7L A;  3OYB A;  4CI0 C;  2QQS A;  3L2Q A;  2LQW A;  2DNU A;  2R5M A;  5CKF A;  1VQ4 Q;  2DD4 A;  1JB0 E;  3OB9 A;  2DK3 A;  3ZBD A;  2HMA A;  1YN8 A;  2QDL A;  2VUB A;  5KYW B;  2PVG B;  1LCK A;  4FYX B;  2LP5 A;  4FSX A;  3OYC A;  2RHZ A;  5C6S A;  5LJ5 e;  3QKJ A;  2QA4 T;  2QK0 A;  2RI3 A;  3M0T A;  4X34 A;  4LD6 A;  3QYH B;  3BY7 A;  5FU7 B;  1OYX A;  2XIC A;  3C12 A;  3SB2 A;  1UGQ B;  1RAE B;  1MUZ A;  2FZG B;  5LJ5 f;  3KFV A;  1NM7 A;  2HSE B;  2R5A A;  4C92 A;  4E7I A;  2B8A A;  1W2B S;  1R0B G;  1BKB A;  4M7D A;  1MMA A;  2X3X D;  2DL3 A;  1Z9Z A;  2QGF B;  1XOV A;  4JZ3 A;  2LC4 A;  1K73 C;  2EYQ A;  3H0F A;  3L2R A;  1MMD A;  4FT2 A;  4MZT A;  3M57 A;  1CSK A;  2RHX A;  5GAO m;  3I35 A;  4ZTF A;  1YJW Q;  4PNO A;  2LJ3 A;  1PG5 B;  1K9M U;  2R58 A;  5EC7 A;  1S1N A;  1HXD A;  3J81 E;  2QEX A;  1BIA A;  4RTY A;  2KYM A;  1PKT A;  3BW1 A;  2RQW A;  4N4H A;  1OOT A;  2K3B A;  3VV0 A;  2K5L A;  3CCV A;  4QVZ A;  3MO8 A;  3S3O A;  2HBW A;  1KK7 A;  1QCO A;  1KFZ A;  3V7R A;  2L3P A;  1D0Y A;  1OUL A;  2YWW A;  2CP2 A;  2CP7 A;  5I2M A;  5KE2 A;  4LN2 A;  1VQO A;  3CCE T;  2Y4X A;  5HK3 A;  1KQ2 A;  4M7A D;  1VQN Q;  1K4U S;  4BD3 A;  2DAQ A;  2EJ9 A;  3HHT B;  1VQ7 T;  4AG2 C;  4OGE A;  2L5Q A;  5C0M A;  5KCH A;  5KYU A;  1JXM A;  3C95 A;  2JVV A;  2QDY B;  1RAF B;  4KH1 B;  1MV0 B;  2NUP A;  1B3Q A;  1GFC A;  1SRL A;  2MF2 A;  2QAS A;  4F7U A;  4JRP A;  5GAO p;  3OYJ A;  1OQK A;  3QG1 A;  3S3N A;  4JJC A;  2X4J A;  3V7C A;  1BU1 A;  1NBE B;  2JT4 A;  2M02 A;  2EKH A;  1ZSZ B;  4OB1 B;  1YWP A;  2XDB A;  9ATC B;  3G1J A;  3AT1 B;  3CXC A;  4EDU A;  1ZQ1 A;  4E7K A;  1D3B B;  2KRO A;  2OAW A;  4PLL A;  2O9V A;  1I0C A;  2ZPH B;  2GQI A;  3FEO A;  4M7A B;  4RTV A;  1PSE A;  2RQR A;  4J9E A;  2DBM A;  4F14 A;  3OYD A;  1QVG A;  3SEM A;  1IHW A;  3REA B;  4KBM B;  2J6F A;  3E19 A;  5IHK A;  1KQS A;  4J6Y A;  2DL4 A;  4IUV A;  1BI3 A;  2KY9 A;  1VQ6 A;  4KUL A;  4F7U B;  4JJN K;  2F5T X;  1O75 A;  5LJ3 h;  2W10 A;  2CZ1 B;  1YJW T;  1UJ0 A;  1AWJ A;  3JCM X;  1TUC A;  1OZ2 A;  3VS7 A;  2ENM A;  1KIK A;  1AZG B;  1G8X A;  2RK1 A;  1N8R R;  1CKA A;  3H8Z A;  4OMQ A;  1Q7Y C;  3MJX A;  3AHU A;  1VYT A;  2DYI A;  1OU9 A;  2CSI A;  3JCM P;  3UWN A;  2MCN A;  1G5V A;  2RMO A;  4BDZ A;  2DO3 A;  1X43 A;  1UEB A;  6AT1 B;  3HFN A;  2PZ1 A;  1D0X A;  1OZ3 A;  1VQN T;  1VQ9 A;  3CPF A;  4J9D A;  3CBM A;  2K5F A;  3CBP A;  4O5V A;  4J8O A;  4ESR A;  1NYF A;  2ZPG B;  3OYF A;  2KK4 A;  5DLO A;  4L59 A;  3X24 B;  3CMA T;  3LWH A;  1NJI U;  4FCY A;  4R56 A;  2JJ9 A;  4PJO D;  1KC8 U;  4XU1 A;  5CQX A;  2QEX Q;  1LJO A;  3M4G A;  4II1 A;  2J6K A;  4M75 D;  3JB9 H;  2K3Y A;  3OW2 A;  2DVE A;  3I55 T;  2YLC A;  2GNC A;  4C5G A;  8AT1 B;  3CCM A;  1K8A C;  1QQJ A;  3MEA A;  1T0J A;  3VJP A;  4JRI A;  3H6Z A;  1BIB A;  2KGT A;  1ABO A;  2ZCF B;  1VQO Q;  2DE0 X;  4DEY A;  2HL3 A;  2MMP A;  1VIF A;  2DXC A;  1SSH A;  1U06 A;  2WSC E;  1SHF A;  4M7A E;  2JM8 A;  2JUF A;  2RM4 A;  4JS5 A;  3P8B B;  4J9I A;  4M7A C;  2HKN A;  2A28 A;  4PJO B;  2HKQ B;  4ZTJ A;  2H3E B;  2E10 A;  2MAM A;  1TUG B;  1S72 T;  3OYY A;  1VQM T;  3PIP A;  4XK8 E;  2JS0 A;  1E6H A;  4JDS A;  1KHC A;  2FG0 A;  2ZPB B;  3OYG A;  3CC4 Q;  1M3A A;  4XTY A;  4A4F A;  1N5Z A;  2EPD A;  4F7U E;  1VQP A;  3PVL A;  4C5I A;  4XU2 A;  2LT4 A;  2J06 A;  4J9B A;  3NHN A;  4KT0 E;  3VYH B;  2EFI A;  4OMM A;  2EYY A;  2D8H A;  5I2S A;  2LT1 A;  4D8K A;  2MIO A;  2FRW A;  2F2W A;  3V8J A;  3QZ9 B;  2DL8 A;  5CIU A;  2QA4 A;  1KG1 A;  3MP1 A;  2DPP B;  2XD0 A;  2HQH A;  1VQL T;  3EGD B;  4QVC A;  3CCJ T;  1K9M C;  1GL5 A;  1YBY A;  1V1C A;  1Q82 R;  3SWN C;  2QG9 B;  5IT9 E;  3OYH A;  3M0P A;  2MYS A;  2DRK A;  3JB9 J;  1I8F A;  1VQ6 Q;  3LX7 A;  3M56 A;  1DJ7 B;  4IIO A;  2LZ6 B;  5GAN 8;  2CS7 A;  3WVD B;  4OB3 B;  1QP3 A;  2E12 A;  1HYO A;  2KMT A;  3L2W A;  3TSW A;  3EH2 A;  1KQ1 A;  3A8G B;  1NYG A;  1FMK A;  1RLP C;  4LDU A;  2PUO B;  2DVJ A;  1RAH B;  5GMK h;  2LDM A;  4PFO A;  1K73 U;  2R57 A;  1TH7 A;  4B9X A;  1VYU A;  1NEB A;  3JB9 G;  4A4H A;  3VS5 A;  2JN0 A;  2AIR B;  1RI9 A;  4FYY B;  2LRQ A;  3A5Z B;  3RKW A;  1VQ9 Q;  3OMG A;  2KYB A;  5AT1 B;  3OYE A;  4M7A F;  1ZSG A;  3CCE A;  1UB4 A;  2HSP A;  1VQ7 A;  3O5Z A;  4JLG A;  4KGZ B;  2BIV A;  2RO0 A;  4IUQ A;  1LNX A;  4Y91 A;  1M8M A;  4GY5 A;  5D7U A;  4MMK A;  1OU8 A;  2OX7 A;  3CC4 T;  4E7H A;  4PJO E;  2ROT A;  4HCC A;  1VQ5 Q;  4PJO C;  4AFQ C;  1Q86 R;  1SF9 A;  4OMF B;  5KYY A;  3OYA A;  2DXU A;  4BAC A;  1QWE A;  3CC7 T;  2KBT A;  3CCM Q;  1BK2 A;  1BI0 A;  4M75 C;  4M77 D;  1SRM A;  2O2O A;  3URG A;  3NFC A;  3JCM J;  2E41 A;  3M0Q A;  1YJ9 Q;  4RCC A;  3VS1 A;  3CD6 T;  3HTR A;  4A63 B;  3CCQ A;  2YRD A;  2FHD A;  5HKC A;  2EAY A;  3T9N A;  3CCS A;  1QW1 A;  4XTW A;  2LQN A;  1M2V A;  2MK5 A;  4FSS A;  3NTK A;  2BZY A;  2V26 A;  1QVF P;  1AOJ A;  1NE8 A;  2DM1 A;  3L2V A;  4HCB A;  1U1S A;  2ATC B;  1HJD A;  1UGP B;  2V8I A;  3OYM A;  3V8K A;  3RKY A;  2EQI A;  2FZK B;  2CDT A;  1YHQ T;  1M2O A;  4PLI A;  2VXF A;  1TG0 A;  1VQP Q;  2MWP A;  1YJW A;  1Q95 G;  5KYY B;  3Q1J A;  5GAN 2;  2M1H A;  2C0I A;  4IUP A;  4ZN1 A;  2A08 A;  4A4G A;  2NUT A;  3MPU B;  2BZX A;  3DLL A;  1YIJ T;  5GAM h;  2PQW A;  3E1S A;  3S3M A;  2KEA A;  1UTI A;  2DJQ A;  1KC8 C;  2QTV A;  4IUU A;  2DX1 A;  2LNV A;  1WXT A;  2DLP A;  2CGH A;  4UC4 A;  1Q7Y U;  1JJ2 P;  2D0Q B;  3FDR A;  2XKO C;  4PJO F;  4BDY A;  4NL2 A;  1Y96 B;  3CMA A;  1W2B P;  1ACM B;  1QKW A;  2IG0 A;  2RHU A;  3M0R A;  2CP3 A;  4YTL A;  1VQ5 T;  3HPW A;  1TS9 A;  2K9G A;  5HY6 A;  3NPF A;  4RTZ A;  4M75 F;  2FPE A;  1PSF A;  2GGR A;  1Q81 R;  2KDS A;  3MP6 A;  3CCM T;  3GP8 A;  3GF5 A;  2DL7 A;  3LLR A;  2PVD B;  3I55 A;  1H92 A;  5LJ3 d;  1QVP A;  2QGG A;  1YJ9 T;  1M90 C;  1QVF S;  1N9R A;  5M9O A;  1K0X A;  2E65 A;  3MEU A;  2LCC A;  1QP2 A;  2GFA A;  2KI7 A;  1LPL A;  4WCI A;  4LDV A;  4Q5W A;  4ZN3 A;  1VQ7 Q;  4HVV A;  2LCS A;  4K11 A;  4KGX B;  3M0S A;  1D1A A;  3I56 T;  1QMC A;  2QTX A;  1J3T A;  1JXO A;  3M55 A;  2XMF A;  3UPU A;  1S72 A;  1VQM A;  3FIF A;  5CO7 A;  4F16 A;  3EG3 A;  4PJM A;  2EVR A;  1H3Z A;  1RAA B;  5A0D A;  5I21 A;  4D8D A;  3BDL A;  2FB7 A;  3QHS A;  3VRZ A;  5LJ3 g;  2VV5 A;  2YRC A;  1WXU A;  3A8M B;  2XG8 D;  2JMC A;  2BTT A;  1IHV A;  1JU5 C;  2HZY A;  1E6G A;  4RG2 A;  3QJ6 A;  4M77 C;  4N0A A;  2DIQ A;  2VVK A;  2JTE A;  4PK4 A;  3CCQ Q;  5CQY A;  1X6G A;  3DB3 A;  1JJ2 S;  2RPN A;  4C92 G;  2X9H A;  3CCS Q;  5GAO l;  4M7D G;  4A53 A;  3JCM V;  2CZ7 B;  4KUD K;  2LTO A;  1VQL A;  1SPK A;  1T0H A;  3CCJ A;  4HCZ A;  5IHN A;  2CP0 A;  3G71 T;  1BBZ A;  1M1K R;  1MHN A;  5GJV B;  2QXF A;  3R6N A;  2YSQ A;  4IIM A;  3ZFJ A;  5FWC A;  1XNI A;  1IZ6 A;  1PRM C;  1UG1 A;  2CRE A;  2F69 A;  1ZSZ A;  1KJW A;  2X3W D;  2HNI A;  4C0G A;  3NGP A;  4QT7 A;  4C0F A;  4AG1 C;  2L0A A;  2DL5 A;  5DLQ E;  3ME9 A;  3PGG A;  1D3B A;  2K5I A;  5GAN 7;  4Y28 E;  1LVK A;  5GAN 5;  2DA9 A;  1B34 A;  4FW2 A;  2XDD A;  2L3R A;  2X4X A;  3FJ5 A;  4M7A A;  1VUB A;  1ZUU A;  3LH0 A;  3JCM Q;  4WF2 A;  2DRM A;  3RMS A;  2LNH B;  2YUP A;  2VB6 A;  2D0N A;  2FVU A;  4F7U G;  5GAN d;  2VKN A;  3QO3 A;  4PFP A;  2O01 E;  3M9Q A;  4Z89 A;  1YWO A;  3CMA Q;  1WJR A;  2VWF A;  2GQV A;  2RF0 A;  3QII A;  2RJC A;  5LL6 S;  4RKU E;  4GLK A;  3VUB A;  3CC4 A;  4RUG A;  1GXI E;  4FU6 A;  3TVT A;  3JB9 F;  3UDC A;  1YCY A;  2K2M A;  3QUI A;  5KYX B;  1BI1 A;  3ZEH A;  3CC7 A;  1GCQ C;  3I55 Q;  4M77 F;  5GAO q;  1AZE A;  3SWN A;  2DXT A;  4XTV A;  5LJ3 j;  1XQH A;  4M78 G;  3OSV A;  4N4I A;  1B34 B;  1OI1 A;  3CCQ T;  1Z9Q A;  2RJD A;  3THK A;  3F70 A;  3CCS T;  4OB0 B;  3CD6 A;  3MCA B;  3EGX A;  3RNJ A;  1D1C A;  5GAN g;  1KD1 R;  1WHG A;  3QJY A;  5A0G A;  1VQ8 T;  4FIB A;  1QCF A;  2E5Q A;  5LJ3 e;  5GAN 4;  4A54 A;  1S72 Q;  1FMV A;  1VQM Q;  2V1Q A;  3DB4 A;  2YUO A;  3C4S A;  5LJ3 f;  5KE3 A;  2L89 A;  3EFO A;  1YP5 A;  1YHQ A;  4M78 D;  4D6W A;  5FRM A;  2AKK A;  4O6J A;  1TSF A;  2QYZ A;  3UF4 A;  1X01 A;  5L8R E;  5IXB A;  3EG0 A;  1RAD B;  4FYV B;  3SWN B;  3GBQ A;  4BI3 A;  1YIJ A;  3NTI A;  3H0H A;  1SEM A;  2A7Y A;  3PIO A;  4NOY A;  5IAY A;  1VQL Q;  2FRY A;  4LUD A;  3CCJ Q;  3R6O A;  3EGX B;  3CCU T;  4J9C A;  4E7J A;  1AVZ C;  1PM3 A;  4OP0 A;  4PJO A;  2M9U A;  2WSF E;  4RTT A;  1JO8 A;  4DQ2 A;  2VAS A;  1EIF A;  1N8R C;  1AT1 B;  2NWM A;  4M75 A;  1OV3 A;  2KXC A;  5CKB A;  3EFO B;  3M0U A;  1WLP B;  2F2X A;  2QQ9 A;  3O8V A;  1VQ5 A;  1W2B A;  1W1F A;  1WJS A;  3LYI A;  2YUN A;  1TU0 B;  4J9G A;  1G83 A;  2NUZ A;  3P8H A;  4DBQ A;  5J26 A;  3OBW A;  1UGV A;  4ANJ A;  1EX4 A;  5IN1 A;  4XTX A;  1WQ7 A;  4J7I A;  4C92 C;  2VGN A;  2WAC A;  4OMO A;  4FM4 B;  4FYW B;  2PNI A;  2HQX A;  4EMH A;  1YJ9 A;  3H9N A;  3EGD A;  3E9G A;  2EBP A;  2EYX A;  2AZS A;  1JRI A;  1OX9 A;  3EG2 A;  5CR2 A;  2D9T A;  5GAM d;  3VS4 A;  1GCP A;  2MPX C;  4CC4 B;  5GAN j;  4RTW A;  3LWI A;  1WHM A;  1ZA1 B;  2MI6 A;  1FYN A;  4NL3 A;  2ED1 A;  4FW1 A;  3V7S A;  2CSQ A;  3I56 A;  2KAF A;  3RIR A;  2F5K A;  1M90 U;  3I5S A;  3OS1 A;  3PT9 A;  3CPW A;  1U3O A;  2BUD A;  4M75 B;  2K2V A;  2O9S A;  1ZUK A;  2JXB A;  4E6R A;  2AK5 A;  2EGE A;  4MZP A;  1WIE A;  5D6X A;  5GAN e;  1PHT A;  3CC7 Q;  4OMP A;  2BZ8 A;  2H8H A;  4C5H A;  2EQU A;  3UA6 A;  1RUW A;  4C8Q G;  3BE3 A;  2QQR A;  5GAN f;  1GRI A;  4JUV A;  2P0Q A;  2LMJ A;  2DEQ A;  3OS5 A;  1M1F A;  4PJN A;  3CD6 Q;  2E64 A;  5GAM g;  2A36 A;  1X75 C;  3U23 A;  1I81 A;  2BE9 B;  1K9A A;  3FC3 A;  1ABQ A;  2ESW A;  3VS2 A;  3JV3 A;  1ZA2 B;  2K7A A;  3G71 A;  2NYS A;  2M0Y A;  2IIM A;  1M4Z A;  1YI2 T;  3QYG B;  1YHQ Q;  2EJG A;  5FW9 A;  5GMK e;  1NLO C;  2QQB A;  3OY9 A;  3OYI A;  3QSU A;  1FXX A;  5FRO A;  1BB9 A;  4LE9 A;  1BI2 A;  5CKH A;  4R55 A;  3CME T;  2EWN A;  2FPD A;  2OJ2 A;  4M78 C;  2RHY A;  2CP5 A;  1QCN A;  4LD9 K;  1NG2 A;  3ASK A;  1YIJ Q;  2RHI A;  5IH2 A;  1IXD A;  2DFU A;  4N4G A;  1TWB A;  2KSS A;  3WVE B;  2AZV A;  2YHT A;  1IRX A;  1WZO A;  4J5Y A;  1WHJ A;  2ZAE A;  3M4Y A;  1P92 A;  2LQ8 A;  1C0M A;  4HXJ A;  3BDU A;  1M30 A;  4QW2 A;  3L2U A;  2L2P A;  3M58 A;  2KNB B;  2K4Y A;  2HDA A;  2HEQ A;  3V8L A;  3CQT A;  1FMW A;  1WXB A;  2IPO B;  4HT9 A;  2FO0 A;  4AMC A;  4GLM A;  3TSZ A;  2A0F B;  1MMG A;  1OPL A;  1YJN A;  3L42 A;  1YIT T;  3HRU A;  1VIE A;  1C1A A;  1JEG A;  5HK0 A;  4LDW A;  3D7S B;  3JB9 D;  1H8K A;  4M77 A;  2X4Y A;  4M75 E;  4OGC A;  2VGM A;  2PVO B;  1AWO A;  1A0N B;  3JCM h;  1MND A;  3ULR B;  1G3T A;  2E70 A;  2J05 A;  2LJ0 A;  3A8L B;  2JOY A;  1U1T A;  4MDX A;  1H3H A;  2YRV A;  2RI2 A;  4M4Z A;  1JQQ A;  1B07 A;  3CXC P;  1UDL A;  2XU8 A;  2RNA A;  4C5E A;  2MWO A;  4AT1 B;  1AHJ B;  2CZ0 B;  1PD1 A;  2YUQ A;  2CYZ B;  5GAM j;  2EKO A;  2XHC A;  3M59 A;  2DIL A;  1T3S A;  1VQ8 A;  1QVG P;  4BY6 B;  1Q86 C;  3I56 Q;  3JCM W;  3RER A;  3RR6 A;  1Y96 A;  2DMO A;  1KQS P;  3A1P A;  3X25 B;  3CC2 Q;  3FJP A;  3OS2 A;  4BUG A;  4L6V 5;  2EQM A;  4GBQ A;  1NJI R;  4M78 F;  2YXY A;  2VYT A;  2JTF A;  5GAM e;  4RCB A;  4E7Z A;  2KR3 A;  4M77 B;  3CBO A;  1UGR B;  2I2L A;  2SEM A;  1VQK T;  2XDP A;  5HCK A;  1AWW A;  5GAM f;  2ED0 A;  4EPC A;  2Y4Y A;  4PFZ A;  4L5G A;  1SKU B;  3EH1 A;  4EMK B;  3SD4 A;  2NLU A;  2V1R A;  3G6E T;  2ZZD A;  2E3H A;  2BE7 D;  3OYN A;  4F17 A;  4X9C A;  2CH4 A;  3LW5 E;  5FLX E;  3CCU A;  1NLP C;  5J39 A;  2FL7 A;  1YFN A;  3G71 Q;  4V2S A;  1FX7 A;  1K0S A;  2DTO A;  2WSE E;  2OAU A;  4OF1 A;  1B7T A;  3UT1 A;  1GCQ A;  3N5B B;  3HP9 A;  3OQ5 A;  4WTO B;  2RJF A;  3EG9 B;  1CKB A;  1UFF A;  5CK9 A;  4C8Q C;  1MNE A;  1YNZ A;  1UEC A;  1XTD A;  5A2Q E;  2EYW A;  3CXC S;  2G3R A;  2RI5 A;  3G4S Q;  2PTK A;  1FWZ A;  3OW2 P;  1N8R U;  4VUB A;  3UA7 A;  3VKI A;  1SG5 A;  2F2V A;  1PKS A;  1RAB B;  2DER A;  1QVG S;  2RK2 A;  3E9F A;  3TU4 K;  5FWB A;  4F04 B;  5CKE A;  5I22 A;  1KQS S;  2DJZ A;  1WHL A;  3PE0 A;  1ZX6 A;  2DTH A;  2CUB A;  4Z02 A;  2ROL A;  1V76 A;  1YJN Q;  4AFZ C;  4C0D B;  1Q81 C;  2C06 A;  2DZC A;  3CC2 T;  5FRN A;  1G3W A;  3EAE A;  4KGV B;  3CCR Q;  3A8H B;  1M27 C;  4DOW A;  4BY6 C;  2RQV A;  2DZ9 A;  1M5Q 1;  1MMN A;  2LJ1 A;  1IB8 A;  4XU0 A;  4JJD A;  1AWX A;  1Y0M A;  2RA2 A;  1X6B A;  3KUF A;  4B6M A;  4M77 E;  1AD5 A;  4IUR A;  4RG8 A;  1ZBJ A;  2OTJ T;  2K57 A;  3GNG A;  2QI2 A;  2C0T A;  1K73 R;  4QKU A;  2YT6 A;  2HD0 A;  3OA6 A;  1IRE B;  1ZLM A;  1VQ8 Q;  4EMK C;  3J7A F;  1EZZ B;  2DBK A;  2ZGW A;  1GFD A;  2LX7 A;  4PJJ A;  1W4S A;  4LDY A;  4C8Q F;  1WNL A;  4NS5 A;  1RAI B;  3VS6 A;  3CCL T;  1YI2 A;  2FEI A;  4JRK A;  5LJ5 h;  3H41 A;  3FLG A;  4RTU A;  3L1A A;  2E5K A;  5EG2 A;  2LQK A;  2KT8 A;  1YCS B;  3PFS A;  1U5S A;  2DF6 A;  3OW2 S;  3OS0 A;  5KYX A;  2JMA A;  1LOJ A;  1ZHI A;  3SFM A;  4C92 D;  3CME A;  4J6X A;  4BE1 A;  4M7D D;  2FYK A;  4M7A G;  4TVR A;  1O9S A;  3G4S T;  2GCX A;  4P5N A;  2J6O A;  1N27 A;  3GIB A;  1UUE A;  1M8V A;  5CVI A;  3ZL7 C;  5GAO n;  1M1K C;  4ELZ C;  1TUD A;  4OB2 B;  2X35 A;  1NPP A;  3CCU Q;  4KH0 B;  5IXF A;  3X26 B;  4BE0 A;  4EMG A;  1Y57 A;  2JS2 A;  1M1G A;  5GMK i;  1WPY A;  3EFS A;  2XI9 A;  1Q82 U;  1YJN T;  3VYG A;  3LGL A;  2K6D A;  1X6O A;  3CPW S;  1I4K 1;  4IUT A;  4ZGE B;  3CCR T;  5KCO A;  1YIT A;  1HSQ A;  1EFN A;  4C92 B;  3QDF A;  4M7D B;  3ER0 A;  4C0D C;  3PMI A;  2P4T A;  1TTH B;  4CC7 A;  2COY A;  1BCO A;  2KE9 A;  3OMC A;  4J6W A;  1KSW A;  4HVW A;  1ARK A;  1F1B B;  4B9W A;  1G3Y A;  2LVM A;  2MOX A;  2DTI A;  1WYX A;  3QXE B;  1OX8 A;  2XK0 A;  1VQ4 T;  4A4E A;  5FU6 C;  4DEX A;  4AFS C;  4PKC C;  2O31 A;  3HKS A;  4J9F A;  2KVQ G;  5I11 A;  4XAX B;  3X20 B;  4HKE A;  2O88 A;  1PRL C;  4XTZ A;  5GAN 3;  1RAG B;  4JZ4 A;  1H64 1;  3GLX A;  3DLM A;  4M78 A;  4CRI A;  1Q7Y R;  1WFW A;  1QVF A;  2P0K A;  3QPH A;  3IQL A;  5KYU B;  4HCK A;  1WHK A;  2NUP B;  1Y07 A;  5FU7 C;  3HRS A;  1Q86 U;  4HVU A;  2P0P A;  5DY9 A;  1VQK A;  4CC2 A;  5ECA A;  1UGS B;  1KD1 C;  4BE2 A;  2RB6 A;  3P8D A;  1MGQ A;  2DD5 A;  3RMQ A;  3VU3 C;  2VXE A;  2B86 A;  4PJO G;  2XID A;  4CC3 A;  3VUZ A;  3TRE A;  4DOV A;  3JCM d;  3G6E A;  2HAX A;  1VYV A;  2BKD N;  3PMT A;  1TXQ A;  4JRQ A;  3HL8 A;  3EFR A;  4J83 A;  2PUK B;  3OBY A;  2V8J A;  4M75 G;  2E3I A;  1R77 A;  2GF7 A;  1JJ2 A;  4M78 B;  3NTH A;  1YI2 Q;  2ZPF B;  3EHQ A;  1WQW A;  1K8A R;  2A37 A;  1WHH A;  2OTL A;  2SRC A;  4OML A;  3L2Z A;  1U8R A;  1ZBX A;  3FRN A;  5A0L A;  3CME Q;  4N0A C;  3MHX A;  2E6Z A;  2RQT A;  2Z0W A;  1M9S A;  2JM9 A;  1D0Z A;  4BI4 A;  5AYF A;  4C92 E;  3NMZ C;  3J80 E;  4M7D E;  2D6F A;  2EGA A;  2AT1 B;  4M7D C;  1WI7 A;  5GJW B;  1M3C A;  3QDR B;  3JCM g;  4QQ6 A;  3CCV Q;  3C94 A;  2PU9 B;  3LGF A;  4ZGJ B;  3PTA A;  1ZUY A;  3I5R A;  1ZSZ C;  2GFU A;  1BCM A;  3OYL A;  4A4K A;  2HCK A;  3LH5 A;  1R0C B;  1WDX A;  1YIT Q;  1NEG A;  1PD0 A;  2YLB A;  4J9H A;  1IO6 A;  2KT1 A;  2HQE A;  3CC2 A;  1W6X A;  3RKX A;  2KRS A;  4PJL A;  2KRN A;  4LUE A;  2CUD A;  2EIF A;  3MKD A;  1K9M R;  2JNG A;  3C0C A;  2M16 A;  2RD1 A;  5GAO r;  2EGC A;  1W70 A;  1Q81 U;  1OPK A;  3VS3 A;  2P84 A;  2YDL A;  2E1H A;  1E7O A;  4ATO A;  3MEV A;  3JAM E;  2EQK A;  2OTJ A;  1D09 B;  1VA7 A;  2AKL A;  4QQD A;  2EJF A;  1RL2 A;  1G3S A;  5GMK j;  4MML A;  2D1X A;  2COZ A;  4FT4 A;  1PNJ A;  1N6A A;  5GAN h;  2M51 A;  5CAI A;  1I1J A;  7AT1 B;  1BYM A;  4C8Q A;  3QZ5 B;  2W0Z A;  4MDW A;  1RI0 A;  5IHI A;  3S6W A;  5L23 A;  4R0K A;  3VRY A;  1V29 B;  2E6N A;  4BB7 A;  4C8Q D;  2HL5 C;  3KXT A;  3FB9 A;  2Y90 A;  3CCL A;  1VOM A;  3A8O B;  3GOX A;  4M78 E;  2V8K A;  2C0O A;  4XTU A;  3HRT A;  4C92 F;  1I07 A;  3RES A;  1M3B A;  4Z8A A;  3REB B;  4M7D F;  3KBG A;  1VQK Q;  2RQU A;  1GBQ A;  4E7S A;  3EGU A;  2DYB A;  4KRT A;  3TCJ A;  1WX6 A;  1Q82 C;  3G4S A;  2RN8 A;  2QEX T;  3HFO A;  2DXB A;  3MEW A;  2OI3 A;  4DBR A;  3G6E Q;  2F1L A;  4E47 A;  2AHJ B;  1UJY A;  3CCV T;  4MZM A;  3G7Z A;  1WA7 A;  3GPL A;  2P4R A;  2JTM A;  4QQG A;  2DKG A;  1X2Q A;  1HK9 A;  4IKF A;  4C0Z A;  4XQ3 A;  2ABL A;  1VQO T;  4C8Q B;  2CT4 A;  5GAN 6;  3JB9 I;  3X28 B;  3MP8 A;  1C6V X;  2A3L A;  3PVQ A;  2OTL Q;  1M1K U;  2QAZ A;  4M77 G;  1K1Z A;  2EQJ A;  3JCM e;  3H0I A;  3CCR A; 
#chains in the Genus database with same CATH homology
 2VWF A;  2F2V A;  1PKS A;  2RF0 A;  1T0J A;  5FWB A;  3EG1 A;  2KGT A;  1ABO A;  4RUG A;  5I22 A;  3TVT A;  3I9Q A;  2DE0 X;  2EYZ A;  3PE0 A;  1X2K A;  4DEY A;  1X27 A;  2J7I A;  1SSH A;  1U06 A;  1ZX6 A;  2CUB A;  2D8J A;  2L3S A;  2ROL A;  2K2M A;  1GCQ C;  2GTO A;  1SHF A;  1K76 A;  4AFZ C;  2JM8 A;  1AZE A;  4J9I A;  2A28 A;  1M27 C;  2L3Q A;  1Z9Q A;  4X1V A;  2RQV A;  2JS0 A;  3THK A;  1E6H A;  4JPB W;  2FG0 A;  1GBR A;  2I0N A;  1M3A A;  3RNJ A;  2LJ1 A;  1N5Z A;  2EPD A;  4JJD A;  1HD3 A;  3PVL A;  1AWX A;  2CH4 W;  1QCF A;  1Y0M A;  1X6B A;  1AD5 A;  2J06 A;  4J9B A;  1ZBJ A;  3NHN A;  2V1Q A;  1MV3 A;  4OMM A;  2EYY A;  3UAT A;  4JJB A;  2C0T A;  2D8H A;  3QWX X;  1SHG A;  2JW4 A;  2YUO A;  1PWT A;  3EHR A;  4D8K A;  2YT6 A;  2MIO A;  2FRW A;  2CT3 A;  2F2W A;  1YP5 A;  1ZLM A;  2AKK A;  2DL8 A;  2DBK A;  3UF4 A;  1GL5 A;  1V1C A;  1X69 A;  1GFD A;  2KRM A;  2LX7 A;  3M0P A;  5IXB A;  3EG0 A;  1UHC A;  2DRK A;  4Z88 A;  1UHF A;  3GBQ A;  3VS6 A;  2FEI A;  3H41 A;  3H0H A;  1SEM A;  4IIO A;  2LZ6 B;  4RTU A;  3VS0 A;  1T3L A;  2E5K A;  2KT8 A;  1YCS B;  2FRY A;  1U5S A;  2DF6 A;  4LUD A;  3SHW A;  2JMA A;  4RTX A;  3TSW A;  4J9C A;  1NYG A;  1AVZ C;  1FMK A;  1RLP C;  2DVJ A;  2FPF A;  2GBQ A;  4ZNX A;  2J6O A;  4RTT A;  1UUE A;  1JO8 A;  2EW3 A;  3ZL7 C;  1TUD A;  2NWM A;  1VYU A;  1OV3 A;  2KXC A;  1NEB A;  3VS5 A;  3M0U A;  2GTJ A;  1WLP B;  2F2X A;  5IXF A;  1RI9 A;  4Y92 A;  1W1F A;  1AEY A;  1RLQ C;  1Y57 A;  2JS2 A;  4LNP A;  2KYB A;  1ZSG A;  2YUN A;  4EIK A;  4OMN A;  4J9G A;  1G83 A;  1QWF A;  2NUZ A;  2K6D A;  4AFU C;  2ECZ A;  1UGV A;  2HSP A;  3O5Z A;  3A98 A;  2G6F X;  4OMO A;  1HSQ A;  1EFN A;  1M8M A;  2PNI A;  2K79 A;  1UE9 A;  2EBP A;  2EYX A;  2AZS A;  1QLY A;  2ROT A;  4CC7 A;  3EG2 A;  2KE9 A;  4AFQ C;  1KSW A;  4HVW A;  1QKX A;  3VS4 A;  1GCP A;  1ARK A;  4CC4 B;  4RTW A;  1QWE A;  2KBT A;  1G2B A;  2MOX A;  1BK2 A;  3QWY A;  1FYN A;  1WYX A;  2ED1 A;  2CSQ A;  1SRM A;  2O2O A;  3I5S A;  1OEB A;  3M0Q A;  1U3O A;  4DEX A;  4AFS C;  2KXD A;  2O9S A;  1ZUK A;  3VS1 A;  2JXB A;  4E6R A;  2AK5 A;  2EGE A;  2O31 A;  4ORZ A;  1WIE A;  4A63 B;  4J9F A;  1PHT A;  4OMP A;  5I11 A;  2BZ8 A;  2O88 A;  2H8H A;  1PRL C;  2LQN A;  3UA6 A;  3RBB B;  1RUW A;  4FSS A;  4JZ4 A;  2LQW A;  1WFW A;  2DNU A;  2BZY A;  1AOJ A;  1GRI A;  2DM1 A;  1YN8 A;  2LMJ A;  2QDL A;  1LCK A;  1HJD A;  2LP5 A;  3IQL A;  4HCK A;  2EQI A;  3H0I A;  2CDT A;  2A36 A;  1TG0 A;  3U23 A;  4HVU A;  3M0T A;  1K9A A;  1ABQ A;  4CC2 A;  5ECA A;  2ESW A;  3VS2 A;  3JV3 A;  1MUZ A;  2C0I A;  2K7A A;  3KFV A;  1NM7 A;  2A08 A;  2BZX A;  2M0Y A;  2IIM A;  2X3X D;  2B86 A;  2KEA A;  1UTI A;  1Z9Z A;  2DL3 A;  4CC3 A;  1XOV A;  4JZ3 A;  5FW9 A;  1NLO C;  2DJQ A;  3H0F A;  1VYV A;  1BB9 A;  4LE9 A;  2FPD A;  2DX1 A;  1CSK A;  2OJ2 A;  1WXT A;  3I35 A;  2LJ3 A;  2DLP A;  1NG2 A;  5EC7 A;  1S1N A;  4RTY A;  5IH2 A;  2KYM A;  3EHQ A;  1PKT A;  2A37 A;  2RQW A;  1OOT A;  2SRC A;  2AZV A;  2K3B A;  4OML A;  2HBW A;  1QKW A;  4HXJ A;  1KFZ A;  1M30 A;  3M0R A;  2L3P A;  2L2P A;  2RQT A;  2KNB B;  2K9G A;  2JM9 A;  3NMZ C;  3NPF A;  2HDA A;  4RTZ A;  2FPE A;  2HEQ A;  3CQT A;  2GGR A;  4LN2 A;  1WXB A;  2EGA A;  2FO0 A;  4GLM A;  1K4U S;  3TSZ A;  1WI7 A;  4AG2 C;  2DL7 A;  5GJW B;  1JXM A;  1OPL A;  1M3C A;  1H92 A;  1MV0 B;  1B3Q A;  1GFC A;  1SRL A;  1JEG A;  1ZUY A;  3I5R A;  4JJC A;  1H8K A;  1K0X A;  1BU1 A;  2JT4 A;  2EKH A;  1AWO A;  4WCI A;  1A0N B;  4HVV A;  1YWP A;  2LCS A;  2HCK A;  3ULR B;  3LH5 A;  4K11 A;  1WDX A;  3M0S A;  1NEG A;  2LJ0 A;  2J05 A;  4J9H A;  1IO6 A;  2KT1 A;  1H3H A;  1J3T A;  1JXO A;  1W6X A;  4M4Z A;  2XMF A;  2KRS A;  1JQQ A;  1B07 A;  4F16 A;  3EG3 A;  1UDL A;  2KRN A;  2RNA A;  2KRO A;  2EVR A;  4LUE A;  2CUD A;  2OAW A;  2O9V A;  1I0C A;  2YUQ A;  2GQI A;  4RTV A;  3C0C A;  2RQR A;  4D8D A;  2DIL A;  4J9E A;  1T3S A;  2DBM A;  4F14 A;  2EGC A;  3SEM A;  1W70 A;  1OPK A;  3VS3 A;  2YDL A;  3REA B;  1E7O A;  2J6F A;  5IHK A;  3VRZ A;  2DMO A;  1WXU A;  1VA7 A;  2AKL A;  2JMC A;  2DL4 A;  2BTT A;  1JU5 C;  1E6G A;  4GBQ A;  2VVK A;  2JTE A;  2D1X A;  1X6G A;  2RPN A;  1PNJ A;  2KR3 A;  2M51 A;  2W10 A;  1I1J A;  2SEM A;  1SPK A;  1T0H A;  1UJ0 A;  1AWJ A;  5HCK A;  1AWW A;  2W0Z A;  5IHN A;  2ED0 A;  1TUC A;  3VS7 A;  5IHI A;  2ENM A;  1BBZ A;  5L23 A;  1KIK A;  4R0K A;  1AZG B;  3VRY A;  5GJV B;  3R6N A;  1CKA A;  2YSQ A;  4OMQ A;  4IIM A;  1VYT A;  5FWC A;  2V1R A;  1PRM C;  1UG1 A;  2CRE A;  2CSI A;  2C0O A;  1I07 A;  1M3B A;  4Z8A A;  3REB B;  2MCN A;  1KJW A;  2X3W D;  2RMO A;  4F17 A;  2RQU A;  2CH4 A;  1X43 A;  1GBQ A;  3NGP A;  1NLP C;  2DYB A;  3EGU A;  4KRT A;  1WX6 A;  2PZ1 A;  4QT7 A;  1K0S A;  2RN8 A;  4J9D A;  4AG1 C;  2L0A A;  2DL5 A;  2OI3 A;  1GCQ A;  4ESR A;  1NYF A;  1UJY A;  2DA9 A;  3FJ5 A;  1WA7 A;  1CKB A;  1UFF A;  1ZUU A;  2P4R A;  2DRM A;  2LNH B;  1X2Q A;  2YUP A;  1YNZ A;  1UEC A;  2ABL A;  2EYW A;  2CT4 A;  2D0N A;  3PVQ A;  2VKN A;  2J6K A;  2PTK A;  4Z89 A;  1YWO A;  1K1Z A;  2GNC A;  3UA7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...