1WX6A

Solution structure of the sh3 domain of the human cytoplasmic protein nck2
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
91
structure length
91
Chain Sequence
GSSGSSGLSNGQGSRVLHVVQTLYPFSSVTEEELNFEKGETMEVIEKPENDPEWWKCKNARGQVGLVPKNYVVVLSDGPALHPAHSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cytoplasmic protein NCK2
publication title Solution structure of the SH3 domain of the human cytoplasmic protein NCK2
rcsb
source organism Homo sapiens
molecule tags Structural genomics, unknown function
total genus 7
structure length 91
sequence length 91
ec nomenclature
pdb deposition date 2005-01-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 1wx6A01
3UATA 2OAWA 1HJDA 2KT8A 3PVLA 4AFUC 2CREA 4KRTA 1T0JA 1X2KA 4J9FA 3H0IA 1GL5A 1G83A 5EC7A 4JPBW 1NEBA 2GTJA 2NUZA 2CT4A 1HSQA 1K0SA 4F16A 1SSHA 1K9AA 1TUDA 1VYUA 1GFCA 2DL4A 2B86A 1GFDA 2ESWA 2DLPA 3IQLA 2LQWA 2LJ3A 1YCSB 3I5SA 3TSWA 5GJWB 1K76A 5HCKA 1ABQA 3UF4A 1X69A 4JJBA 2MIOA 1UUEA 2C0IA 1OV3A 3EHRA 4CC2A 4Y92A 3THKA 2JS0A 1AEYA 2ROTA 1UE9A 4RTUA 2SEMA 1VYTA 3A98A 2AK5A 2ENMA 3LH5A 1NM7A 2FRYA 2KRSA 3M0PA 4GBQA 2A36A 4AG1C 4DEXA 2DL5A 2FO0A 3H0HA 1QLYA 4OMNA 1MV3A 2FRWA 2RQRA 3NGPA 1E6GA 2JMCA 1WXUA 1WFWA 2K3BA 2KRMA 2LZ6B 4IIMA 2C0TA 2HCKA 4OMQA 2E5KA 1LCKA 4WCIA 2YT6A 4OMMA 3TVTA 1NG2A 2CDTA 2DE0X 3JV3A 4HVUA 2OJ2A 2JW4A 1X6GA 1I07A 1M3CA 2DJQA 1H92A 2MOXA 1ABOA 4RTWA 1UFFA 4RTVA 1QKXA 2EGAA 2KYMA 1K1ZA 2KROA 4HCKA 4HVVA 3VS4A 4D8DA 2J6FA 2KXCA 2YUNA 1KFZA 2EBPA 3R6NA 2DNUA 2K7AA 5L23A 2DL7A 2G6FX 4CC3A 1G2BA 3QWYA 1ZX6A 4LUEA 2KYBA 4RTZA 2ED1A 2KT1A 2KBTA 2L3QA 3TSZA 2J7IA 4IIOA 1FMKA 2PNIA 1SRLA 1HD3A 2LJ1A 1GCQC 3SHWA 1ZBJA 1UTIA 2M51A 4GLMA 1NYFA 1MUZA 1A0NB 1Y0MA 2MCNA 1OPKA 3KFVA 1YN8A 2ED0A 1AWXA 2CUBA 4QT7A 1KJWA 2RMOA 2CH4W 1AWWA 2CSQA 1CKBA 2DL8A 2PZ1A 2DL3A 2GGRA 1U5SA 2VKNA 3VS3A 2I0NA 4FSSA 1NLOC 4AFQC 1X43A 3VRYA 3RBBB 5FWBA 2DA9A 1YNZA 1NYGA 2DMOA 2HBWA 1AWOA 1UJYA 3ULRB 2J6KA 5ECAA 1AZEA 4ESRA 1RLQC 4J9HA 1I0CA 2LNHB 2LQNA 1BBZA 1QKWA 2EYYA 4LUDA 1JEGA 1T3SA 1AOJA 2A08A 1B3QA 1BK2A 2H8HA 3EHQA 1J3TA 1XOVA 1PKSA 1W70A 1ZLMA 1M8MA 4RTYA 1UJ0A 4J9IA 2JM9A 4AFZC 2D8JA 1YP5A 1SHFA 2K79A 2L3PA 3I9QA 4HXJA 2VWFA 2EYZA 1NLPC 1UHFA 4Z88A 3REBB 2L0AA 3FJ5A 3U23A 2AKLA 2P4RA 3EG2A 1JQQA 2FPDA 3M0UA 2DBMA 2O9VA 1OOTA 2EW3A 2RQUA 4OMLA 4J9GA 4F17A 2FEIA 2GNCA 2CSIA 2EVRA 1M27C 3REAB 1PKTA 3M0TA 2RQTA 2LCSA 4K11A 2AZSA 5IXFA 1T3LA 1TG0A 3PVQA 1OPLA 1X27A 1V1CA 1WXTA 2LMJA 1PWTA 2M0YA 1W6XA 4HVWA 4OMOA 2D8HA 4Z8AA 3SEMA 1U06A 4J9DA 2RN8A 4EIKA 1RI9A 1ZUUA 4A63B 1FYNA 4X1VA 4OMPA 1N5ZA 1WLPB 3GBQA 5IHKA 1ARKA 1U3OA 2BZYA 2EGCA 1I1JA 2FG0A 2J05A 1K4US 3VS2A 2JMAA 1W1FA 2EKHA 3I35A 2JM8A 1CKAA 3EG0A 5I22A 2KEAA 3QWXX 2KE9A 1KSWA 1CSKA 5I11A 1GCQA 3M0RA 2YUPA 2KRNA 4F14A 4JZ3A 1IO6A 4CC7A 1JO8A 2C0OA 5IHIA 3VRZA 2CH4A 2KGTA 1UGVA 1BU1A 2YSQA 2W10A 2K6DA 1QCFA 2K2MA 2LX7A 4JJCA 2YDLA 4LNPA 5GJVB 2RF0A 2D1XA 1UHCA 4RTTA 4LE9A 2GBQA 2X3XD 1Z9ZA 2EYWA 2A28A 2JS2A 2LP5A 2IIMA 2L2PA 2F2VA 2EGEA 2JT4A 4RUGA 2L3SA 3O5ZA 4AFSC 1EFNA 3ZL7C 2DRMA 1WYXA 2QDLA 1JXMA 2DYBA 2EQIA 1S1NA 1YWOA 1H8KA 2ROLA 1AZGB 1VA7A 1WI7A 1WXBA 2O9SA 1PNJA 4ZNXA 2KXDA 1UECA 2RPNA 4RTXA 3H0FA 2GTOA 2CT3A 2DVJA 1OEBA 1X2QA 1H3HA 1M3AA 2DBKA 1SHGA 3NPFA 2HSPA 2JXBA 2KNBB 1BB9A 4ORZA 1Z9QA 2DF6A 2D0NA 2XMFA 1ZUYA 3H41A 2RQWA 2HEQA 2PTKA 2YUQA 1WA7A 2F2XA 2O31A 1RUWA 1E6HA 2FPFA 3RNJA 1JXOA 2HDAA 2F2WA 2AKKA 2X3WD 1YWPA 2J6OA 2RNAA 2RQVA 1JU5C 4M4ZA 2YUOA 4AG2C 3M0QA 2AZVA 3EG3A 1SRMA 1RLPC 1KIKA 1GCPA 1X6BA 2ECZA 3VS7A 1AWJA 2A37A 3NHNA 5IH2A 1AD5A 2EYXA 2K9GA 2J06A 1B07A 2EPDA 3PE0A 1M3BA 2CUDA 2JTEA 1K0XA 3NMZC 1WDXA 3UA6A 2O88A 2FPEA 2SRCA 2KR3A 4Z89A 3M0SA 3UA7A 3VS6A 1TUCA 1ZSGA 1VYVA 2BZXA 2GQIA 4JJDA 2W0ZA 1SEMA 3EGUA 1UG1A 4J9CA 2BTTA 1NEGA 1E7OA 5IHNA 2BZ8A 4JZ4A 2V1QA 1M30A 2OI3A 4CC4B 1GRIA 1T0HA 2NWMA 3C0CA 3VS5A 1UDLA 1ZUKA 4D8KA 5FW9A 1PHTA 1SPKA 2LJ0A 1GBQA 2ABLA 3CQTA 2VVKA 3VS0A 4J9BA 3VS1A 2DM1A 1PRLC 1GBRA 1AVZC 1PRMC 3EG1A 2O2OA 2DRKA 4DEYA 5IXBA 1WIEA 4E6RA 2DX1A 4R0KA 2V1RA 1Y57A 4J9EA 3I5RA 2DILA 1WX6A 1QWEA 5FWCA 1MV0B 1QWFA 4LN2A
chains in the Genus database with same CATH superfamily
3FLGA 1OZ2A 3CBMA 5GAN2 2XG8D 2FHDA 1XTDA 4J8OA 3G71T 4JPBW 3OS5A 1TXQA 2FZCB 9ATCB 3X20B 4OMFB 1K9AA 3CC7Q 4PFPA 3OYAA 5FU6C 1YITA 5CK9A 4A54A 3VYGA 5GJWB 4JJBA 4M7DF 2MIOA 4CC2A 4Y92A 3FC3A 1OZ3A 2M0OA 2SEMA 1Q82U 4PLIA 3A98A 1OI1A 2BKDN 1D3BB 2K4YA 4KH1B 3CBOA 3CPWS 2DL5A 2FO0A 3H0HA 3X28B 4LD9K 3F70A 1H641 4QQDA 4M7AE 3TCJA 2ZPFB 1OQKA 2KRMA 2COWA 1F1BB 4IIMA 3CMAA 1X6OA 4C92A 3BDLA 3JB9D 4PJOD 5CKEA 3HPWA 3X25B 1NG2A 4DBFA 4HVUA 2DJQA 4IUQA 1VQNQ 4QVZA 1ABOA 4RTWA 2E12A 1UFFA 2KYMA 1SSFA 1UGPB 1K1ZA 4LDUA 5A0DA 4BI8B 3RMQA 4HCKA 3DLLA 1S72T 2YUNA 4II1A 2DNUA 2K7AA 2G6FX 3OSSC 1ZX6A 2KYBA 1WHLA 1YHQT 3M59A 2ED1A 4OB1B 2KBTA 4J6XA 3L2RA 1FMKA 2AHJB 2QA4Q 2QTXA 1QVFA 1HD3A 3G4ST 1NZ9A 2CP0A 1YI2Q 4P5NA 4EMKA 4JLGA 4QQGA 1NYFA 1Y0MA 4N0AC 2ED0A 1AWXA 2CUBA 3A8GB 5A0LA 1TTHB 3CCLT 2ZPEB 4CRIA 4DBHA 2DL8A 3V8LA 4M77C 2DL3A 3FRNA 3CCUT 1U5SA 2VKNA 5FWBA 4ZGJB 1YNZA 2AT1B 2YRDA 1WZOA 3OYGA 2EWNA 2G3RA 1AWOA 5C0MA 1QCNA 5ECAA 4ESRA 4Y91A 4L59A 1M5Q1 3BFMA 3EH1A 1BBZA 1KHCA 1B3QA 3MEAA 4TVRA 1QVFS 2QG9B 3A8HB 4C5GA 1PKSA 1W70A 1ZLMA 1VQNA 2HNIA 4RTYA 2F1LA 3VKIA 5GMKm 1WPYA 4M78E 2CS7A 3I9QA 2H3EB 3MPUB 4C8QA 4KGXB 5I21A 2EYZA 3GOXA 1ZSZA 3OMCA 3CCRQ 1QW1A 1NLPC 1WJRA 3JB9F 2CKKA 4PJOF 1VQ5Q 4Z88A 1AT1B 1MNDA 1YJNQ 3FJ5A 1K8AU 3EG2A 3EG9B 3OQ5A 3OSVA 2XHCA 1TUGB 4M77D 1RAGB 1PSFA 3OYCA 2RQUA 1VQ8T 2LT4A 2XDPA 4OMLA 5GANj 2OTLT 3CCJQ 2FEIA 4JRIA 1M27C 8ATCB 2QYZA 5D6XA 4PJJA 3JCMW 2DIQA 2CP7A 1ZHIA 5M9OA 2D0QB 5GAN6 5GANh 1VQPQ 2ZGWA 1OYXA 2QK0A 4E7JA 1UGQB 3OYIA 2D8HA 2P0QA 1ZUUA 4A63B 1IXDA 3ZBDA 2K5LA 2YXYA 3GBQA 4PKCC 1D0ZA 1U3OA 2BZYA 1D3BA 2DTOA 2EGCA 2FG0A 3CCEQ 1K9MC 1K4US 2M02A 1W1FA 3GF5A 1Y96B 2VB6A 3I35A 3C94A 2KE9A 1KSWA 2KK4A 1LVKA 4M75C 4PJOB 1VQ7T 4JRKA 2K3XA 4ZN3A 5HK0A 4IUTA 2MWOA 4ZGEB 3CC7T 2RJCA 4KUDK 4JZ3A 1JO8A 1ZBXA 1V76A 3EGXB 2CH4A 2QGGA 4EDUA 1UGVA 1BU1A 1FMVA 2XK0A 2K2MA 1VQ5A 2X51A 1WHGA 1UHCA 1YJNA 4RTTA 5FU6B 2RHXA 3FB9A 2GBQA 1NJIC 2JNGA 3R6OA 2LP5A 2L2PA 1WHHA 4RUGA 3OBYA 3CCJA 2L3SA 1RL2A 4L6V5 4M7DA 5GMKi 3BW1A 4FL6A 2FZGB 2OAUA 4WTOB 1YWOA 4DOWA 3S3NA 1AZGB 3QZ9B 3L2WA 4E7HA 5GAN3 4ZNXA 4M77F 2DKGA 1VQPA 3VYHB 2V8KA 2LC4A 1OEBA 2EJGA 1PG5B 1M1KU 4M75D 2DBKA 3BDUA 5GAOl 1N8RR 1BI3A 1SF9A 3CCQA 2JXBA 1PD0A 4ORZA 4M7AC 3CCEA 3MEVA 2D0NA 1ZUYA 4MZMA 4CI0C 2LNVA 2PTKA 4J83A 2QA4T 5FLXE 2CZ6B 2P4TA 1VOMA 1JB0E 2EJ9A 3QUIA 1RUWA 2FPFA 1YI2T 3FEOA 2E4HA 4PL6A 2QAZA 4J5YA 2AKKA 5FROA 2J6OA 2RQVA 3QKJA 3M0QA 2KDSA 2AZVA 1X6BA 2ZAEA 2XDBA 2Y4XA 5IH2A 4C5EA 1DJ7B 5A2QE 3ASKA 4ZTJA 2EPDA 2YLBA 4MDXA 2JTEA 1IRXA 3LWHA 1WDXA 2KR3A 3M0SA 1VUBA 4M77B 3UA7A 4JJNK 2RHZA 3KUFA 1TUCA 2D6FA 2GQIA 3A8OB 2OTJQ 1UG1A 4J9CA 2BTTA 3QYGB 1E7OA 2BZ8A 4JZ4A 2V1QA 2COYA 1C0MA 2JN0A 4M7AD 1P92A 3L42A 1VQMQ 1UDLA 4D8KA 5GAN5 1SKUB 5DY9A 3MP1A 2ABLA 1KD1C 2RK1A 5DM7R 2QQRA 3NTIA 3GPLA 5HY6A 4F7UE 1VQ4Q 3CCRT 4FT2A 1QVGA 2RI5A 3EG1A 4HT9A 5GMKe 3OYBA 4LDWA 1KC8U 1VQOT 4RG8A 2NUTB 1VQKQ 1WQWA 2RJFA 3MP8A 1Y57A 2NYSA 2HMAA 4M75F 1Y96A 3Q1JA 4OP0A 1I81A 3C12A 3JCMX 2P0KA 4PJOA 2QEXQ 1X01A 4M78C 4KRTA 1T0JA 1X2KA 4J9FA 1M90U 2HZYA 3VV0A 3JCMc 3LH0A 2NUZA 2DERA 3EGXA 2EAYA 5LL6S 2GF7A 1SSHA 3TU4K 1U8RA 2DJZA 1Q81U 2B86A 4M77G 3L2ZA 2DLPA 1QVFP 3IQLA 2LQWA 1Q86U 1N9RA 1K76A 1QVGS 1ABQA 1X69A 1Q82C 4FT4A 1R77A 2C0IA 2M16A 4PLLA 3MO8A 2ROTA 4C5IA 3CCET 3WVEB 2CZ1B 3HTRA 4PFOA 1NPRA 4LDYA 2ENMA 2DXTA 2H3JA 3M0PA 1ZQ1A 3H9NA 4UC4A 1MV3A 1E6GA 2LZ6B 5CQXA 1NBEB 3V7SA 2CP5A 2YWWA 2E5KA 4WCIA 3A1PA 2JZ2A 2RJDA 3TVTA 1VQ4A 2RH2A 2DE0X 2HD0A 4M75B 3VUBA 4AT1B 2QQAA 3S6WA 5FRNA 1RABB 3QYHB 4M78D 3V7CA 2LT1A 1Q82R 2FZKB 2MOXA 4RTVA 2EGAA 2DEUA 4XTUA 3FDRA 1VQKA 2KROA 3VS4A 4C92E 4YTLA 2J6FA 4NL2A 8AT1B 1G2BA 3DB3A 4LUEA 5FRMA 2QEXA 2RHIA 2XICA 2KT1A 2YLCA 4BE2A 1VQ9Q 5D7UA 2PNIA 2X4JA 1LJOA 1KHIA 1GCQC 4QW2A 1ZBJA 2LTOA 3CMAQ 1UTIA 2M51A 1KQ1A 1MUZA 1A0NB 1Q7YU 4KULA 3SDZA 1WHKA 3OYYA 3V8JA 4BDYA 2CSQA 1CKBA 2QASA 4N0AA 2L5QA 4ATOA 5CO7A 2DZCA 1NLOC 3VRYA 4M77A 1QCOA 3RMSA 3JCMP 4A4EA 1B7TA 4OGCA 2J6KA 4N4HA 5KYWA 3E9GA 3KXTA 3OW2A 3HL8A 1RLQC 3NTHA 1I0CA 1MGQA 2E3HA 1RADB 1QKWA 5GAN7 4M75G 5LJ5f 3META 1J3TA 4WF2A 4JLIA 5LJ3g 1M8MA 1PCXA 1YCYA 2JM9A 1G3WA 2KAFA 2D8JA 1YP5A 3PMTA 1ZA1B 3RKXA 3CPFA 2NUTA 3M54A 2OTJT 2L0AA 1R0BG 3U23A 3M0UA 1VQ9A 5LJ3d 4E7ZA 3CD6Q 4C8QE 4E7LA 3OW2S 2CYZB 2E6NA 3OYFA 1VQMT 3INZA 4FIBA 1H3ZA 4F17A 2CSIA 4IUUA 1MHNA 4K11A 2AZSA 1N9SA 2OX7A 3I56A 3JCMf 3OY9A 1M1GA 1V1CA 5GAMf 2E5QA 2LMJA 1K8AR 2MWPA 2V8JA 2CZ7B 3E19A 4OMOA 1VQKT 4J9DA 2ZPBB 2RN8A 4EIKA 4OB2B 4Z02A 4M7AG 2XD0A 3RESA 1FYNA 5LJ5e 4X1VA 7AT1B 4JRPA 5AT1B 1N5ZA 1WLPB 2VXEA 1ARKA 2R58A 4X9DA 2V26A 1I8FA 2E70A 5GAOr 1NPPA 2NUPA 2HAXA 2EKHA 1M2VB 2JM8A 2DK3A 3EG0A 3WXMB 5I22A 5CAIA 1TH7A 3EFRA 2KEAA 3QWXX 2YUPA 2KRNA 4F14A 4O6JA 3L1AA 4B6MA 4M75A 1GXIE 2AIRB 3L2QA 2L8DA 4M78B 1JRIA 2IPOB 3M57A 2E41A 3M4GA 3JCMQ 2C0OA 2YHTA 3CC2Q 3VRZA 4HCZA 2DIGA 2YDLA 3H6ZA 5J26A 5GJVB 2P84A 2RF0A 2HQEA 3LLRA 3P8DA 3PT9A 4LE9A 4LD6A 5CIUA 2X3XD 2WSFE 3AT1B 4A4KA 2EYWA 1PC0A 4QQ6A 2MAMA 3CD6A 2D9TA 2EGEA 3JCMe 1KQ2A 4ZN1A 1JJ2A 5GAMe 2QQ9A 1EFNA 3T9NA 2DRMA 2QTVA 2QDLA 1JXMA 4E7KA 1D1AA 1VA7A 1WI7A 5LJ5d 1OU9A 1YITT 3HRTA 2KXDA 3CMEQ 1UECA 2RPNA 4RTXA 2GTOA 4M7DE 2CT3A 2NLUA 2JTFA 1K73U 3OYDA 2EQJA 3KBGA 1U1TA 3HP9A 4A4FA 1IHWA 2M9UA 4E47A 2HSEB 3N5BB 4C5HA 5A0GA 1WGSA 5GAN8 5KYYB 3SB2A 2XMFA 2HEQA 1YJ9A 2K3YA 2QGFB 2YUQA 3TREA 1LPLA 4JS5A 1IGUA 1QVGP 2LQ8A 1NE8A 4XU3A 5GAMg 4FYWB 4M78G 1E6HA 4JRQA 1M1KR 3CMAT 1JJ2S 3RNJA 2HDAA 4DBQA 1UB4A 2C06A 1LOJA 5KYUB 5CKDA 1YWPA 4M4ZA 4AG2C 4C92C 3CC2A 2LDMA 3RIRA 1FXXA 4ELZC 1RLPC 3VS7A 2ECZA 3H8ZA 2ZCFB 1AD5A 2J06A 5GAMd 1EX4A 2CUDA 3CCQQ 3UA6A 2O88A 2FPEA 2SRCA 5IAYA 3MEWA 2A3LA 1I5LA 4R55A 3EGUA 4ELYC 4JS4A 2LX9A 2XKOC 3M58A 5IN1A 1M30A 2BE7D 4ME7A 1VQ6Q 3A5ZB 4CC4B 3CMEA 2F69A 2NWMA 2RJEA 4XTZA 4EMKC 5GAOp 3VS5A 4V2SA 2FVUA 1ZUKA 4QVCA 1PHTA 1SPKA 1GBQA 2I2LA 3MCAB 6AT1B 3PTAA 4FW2A 4J9BA 2DM1A 1JBMA 2LCCA 2L89A 2DETA 1N8RC 1AVZC 3CCMQ 4C92D 4DEYA 1PD1A 4XTVA 2DEQA 3D7SB 4R0KA 3I5RA 5GMKl 5GANf 2DILA 1QWEA 1XQHA 1MV0B 3GP8A 3HRUA 2DFUA 2CREA 3MKDA 1VQNT 5FU7C 5EC7A 2GTJA 1K0SA 2CT4A 1HSQA 2DYIA 4F16A 4BACA 1TUDA 1KC8R 3JRZA 4XQ3A 5D6YA 1GFCA 2KVQG 4OVAA 5KYXB 3OA6A 4PJOE 1GFDA 4MMKA 3OS1A 2ESWA 1MMNA 3RUXA 2LJ3A 1YCSB 3I5SA 3TSWA 2Y90A 1XJWB 1UUEA 1OV3A 3EHRA 3THKA 4J7IA 4RG2A 1UE9A 1M90R 2COZA 3CXCA 1VYTA 2AK5A 4E2FB 3LH5A 1VQ6A 2A36A 4AG1C 1Q81R 4DEXA 1QLYA 4OMNA 3OBWA 1C6VX 3UPUA 2RQRA 3NGPA 2JMCA 1WXUA 1WFWA 2K3BA 2JTMA 1Q86R 3CC4A 4J7FA 1X75C 2C0TA 4OMQA 2MYSA 2QQSA 2XU8A 4OMMA 4F7UB 3OW2P 4LXCA 2CDTA 3A8LB 3LGFA 2OJ2A 2DXBA 3RERA 1X6GA 3CCMA 1I07A 2XDDA 1M3CA 3HKSA 1H92A 4Q5WA 4AMCA 3G71Q 3J80E 5GANe 4C0DC 3OB9A 1BI0A 3EG9A 2EQMA 2F5KA 3SD4A 3DB4A 4D8DA 5KYYA 2KXCA 1KFZA 5CKHA 2EBPA 3QO3A 3R6NA 4C0ZA 2PUKB 1G3SA 4CC3A 5C6SA 4NL3A 1Q95G 4RTZA 3CXCS 4KBMB 4IIOA 1QP3A 5KYUA 3UWNA 4B9WA 3CMET 4GLMA 2DAQA 2QQBA 2MF2A 1K9MU 3JSCA 3KFVA 4XU0A 4QT7A 3OYMA 1VQ5T 1BIBA 2X9HA 5LJ3h 1YJNT 3M53A 1TU0B 2GGRA 1VIEA 5J3BA 3VS3A 2I0NA 4FSSA 4FYYB 3C95A 5IT9E 2VGNA 3OYLA 3QSUA 1RI0A 2DMOA 2HBWA 1UJYA 3CCJT 1WJQA 4RKUE 5KCHA 3UDCA 2HQHA 1Q7YR 4J9HA 5CKFA 4F7UG 1VQLQ 4M7DC 2VGMA 5KE2A 5GANd 3I55Q 1JEGA 1AOJA 2A08A 1NJIU 1VQPT 4BI4A 1YHQQ 2H8HA 4PFZA 1XOVA 2JOYA 3HRSA 3G71A 4J9IA 1N6AA 1D1CA 2RHUA 2E64A 2MI6A 3CCQT 4C92B 1SHFA 2EIFA 2K79A 4JUVA 4RCCA 2YRCA 3S3OA 2KQWA 2HBPA 1UHFA 1TWBA 1UEBA 1YFNA 1WJSA 2VASA 3CCUQ 2A0FB 3LW5E 1B34B 2HKQB 1HK9A 3M55A 3SWNC 1BYMA 1OOTA 3EFOB 2X4WA 3HFNA 4J9GA 3GIBA 3QPHA 2GNCA 3REAB 1PKTA 3LWIA 5D6WA 4BD3A 2A7YA 3PVQA 1X27A 4M7AF 5KYXA 4IUVA 4M7DD 1WXTA 4FSXA 1JJ2P 4EMKB 5CVIA 1PWTA 2M0YA 3CBPA 1W6XA 2E10A 4HVWA 4Z8AA 2E65A 3SEMA 4L5GA 3URGA 5GAN4 2E1HA 1S72A 4OMPA 5IHKA 3X26B 1YJWQ 3L2VA 1RAFB 1VQLA 2R57A 3GNGA 3I55A 2RI2A 1W2BA 3VS2A 4E7IA 3O8VA 2IG0A 1YHQA 4XTWA 1G3TA 1CSKA 5I11A 2RI3A 4C92G 3G1JA 1OX9A 5KE3A 1IO6A 3I56Q 3QJYA 1VQ8Q 4CC7A 2JJ9A 2L3RA 5FU7B 2YSQA 2W10A 2K6DA 1QCFA 2JUFA 3CCVQ 3CCLA 2HQXA 3CCUA 4E7SA 2KSSA 3G6EQ 4QVDA 1KD1U 2A28A 4M7AB 4BE1A 1EZZB 1WQ7A 4BB7A 2F2VA 2PUOB 2DXUA 2JT4A 2Z0WA 5I2MA 1V29B 2DXCA 3O5ZA 1M2OA 1W2BS 4A53A 3ZL7C 1WYXA 3G7ZA 4XTYA 1FX7A 4B9XA 3OS0A 4DA4A 2FL7A 3HFOA 2ROLA 1D0YA 1WXBA 4BE0A 2O9SA 1PNJA 4XU1A 4BUGA 5AYFA 3OYEA 2DVJA 1VQ7Q 1K8AC 2DTHA 1Y71A 3NPFA 3MP6A 4NOYA 1YJWA 2KNBB 1FMWA 2HKNA 4FCYA 2WSEE 4M78F 3MEUA 4C0DB 4J6YA 1PM3A 3H41A 4VUBA 1R0CB 2O4XB 4X9CA 1LNXA 4N4GA 2F2XA 2O31A 1K73R 4C0FA 1OU8A 3E1SA 1VQ8A 2K57A 2X3WD 1VQ4T 2OTLA 2YUOA 3HHTB 1PSEA 1BI1A 3EG3A 1SRMA 3CCVA 1AWJA 3E2UA 3DKMA 2K9GA 4C8QG 4N4IA 1B07A 3PE0A 3G6EA 3S3MA 3NMZC 1TS9A 3OYNA 3PIOA 1QP2A 3QDRB 2QEXT 1B34A 3VS6A 5DLQE 1ZSGA 3JCMJ 3LX7A 1EIFA 1VYVA 2BZXA 1YJ9Q 1VQLT 2BIVA 3C4SA 3EFOA 2LVMA 3OS2A 2Y4YA 3I55T 2MPXC 4BDZA 1NEGA 4OF1A 4OB3B 2PVOB 2RK2A 3M56A 5IHNA 4HA8A 2R5MA 1ZA2B 4PJLA 2ATCB 4MZTA 1T0HA 3PGGA 2B8AA 4M7DB 3CXCP 5FW9A 3JCMb 1VQ7A 3M9QA 3JB9I 1WHMA 1I4K1 1KG1A 3OYJA 3CC7A 3CQTA 4C0GA 3VS1A 1PRLC 3AHUA 5LJ5g 1D1BA 1PRMC 5CQYA 2DRKA 3M5AA 2DX1A 4HCBA 2V1RA 2GFAA 1RAHB 4J9EA 4RCBA 4LDVA 1I5OB 3DLMA 2HL3A 2EQKA 3UATA 1M1KC 2OAWA 3RKWA 1M9SA 2F5TX 2M1HA 2KT8A 3PVLA 4AFUC 1HJDA 3EH2A 3BE3A 3H0IA 1GL5A 1G83A 3SWNB 2KI7A 2CZ0B 1NEBA 1BKBA 3HSBA 2ZPIB 4LDXA 1Y7XA 1VYUA 1SG5A 2DL4A 3RKYA 3VUZA 3WVDB 5HCKA 3UF4A 4IKFA 1YJWT 4M7AA 1VQ9T 2JS0A 1AEYA 3JCMg 4GY5A 1WHJA 4RTUA 1W4SA 2DD4A 4MMLA 4M7DG 1NM7A 2FRYA 2KRSA 4GBQA 2E6ZA 1VQOQ 5HK3A 2QA4A 2FRWA 1YIJQ 5GAOm 3I56T 1YI2A 2HCKA 1LCKA 2YT6A 1RAEB 3JCMd 3JV3A 2RB6A 3VU3C 3QBYA 3CCVT 1RAAB 2JW4A 4DQ2A 5J39A 3VJPA 1QKXA 1KQSA 4O5VA 2BUDA 3G6ET 4HVVA 2E3IA 3OYHA 2RD1A 3OYKA 3TQ7P 2DL7A 1C1AA 3P8BB 5L23A 4NS5A 3QWYA 2O4XA 5GAOq 1HYOA 1M1FA 2EJFA 1QQJA 1VIFA 2L3QA 3TSZA 2CP6A 2J7IA 4BY6C 4KH0B 4FW1A 1BIAA 1SRLA 5I2SA 2LJ1A 3SHWA 3CC4Q 5GMKj 4IUPA 3JCMV 4QKUA 2PQWA 5KYNA 2MCNA 1OPKA 1KC8C 1YN8A 2O01E 1KJWA 2RMOA 2CH4W 1AWWA 2PZ1A 3MJXA 5GMKh 4KT0E 4Y28E 4AFQC 1X43A 3CCRA 1KQSS 3RBBB 4RMOA 1MNEA 3CD6T 4F7UF 2DA9A 3JB9H 4FM4B 1NYGA 1M2VA 4XTXA 1M90C 1U1SA 1O9SA 3ULRB 3E9FA 4ZTFA 1VQOA 4XU2A 1AZEA 3X24B 1YBYA 1K9MR 1YIJA 1Q81C 2LNHB 2LQNA 4LUDA 2EYYA 1OX8A 4M78A 1T3SA 2ZZDA 3RR6A 2XIDA 1BK2A 1Q86C 1HXDA 3PIPA 3EHQA 1IHVA 2VV5A 1W2BP 3UT1A 1UJ0A 4C8QC 3JB9J 4AFZC 1ZSZC 4ANJA 2L3PA 4HXJA 2VWFA 3PMIA 1KK7A 2K5IA 4KGZB 1G8XA 2KY9A 1YJ9T 1MMAA 4KGVB 3REBB 3L2UA 1G3YA 3J7AF 1NJIR 4EMGA 4IURA 2AKLA 3QHSA 2P4RA 2DTIA 4JDSA 1JQQA 2FPDA 2HL5C 4FYVB 4GLKA 2DBMA 4HT8A 3JB9G 4PJOG 2O9VA 3ZEHA 1WNLA 2YRVA 4KUIA 2EW3A 3P8HA 3MHXA 3CCSQ 5CCAA 2CP2A 3QDFA 3SWNA 5CKBA 3CC2T 2K5FA 1D0XA 1RACB 2EVRA 1UGSB 3M0TA 2RQTA 2RO0A 4PJNA 2LCSA 5IXFA 3ME9A 1T3LA 1TG0A 3CEYA 1OPLA 2GQVA 4A4HA 4DOVA 3A8MB 2BE9B 4HCCA 5HKCA 3GNFB 5GAOn 3CPWP 1OULA 1AHJB 1G5VA 2EKOA 1U06A 2QDYB 1RI9A 2FB7A 2KMTA 3EGDB 4C8QD 2DZ9A 4DBRA 3FIFA 1MMGA 5DLOA 1I1JA 3M4YA 4C92F 3FJPA 2J05A 2PVGB 5LJ3j 1Q7YC 2JMAA 4OGEA 2GFUA 1CKAA 4PNOA 1IREB 2LRQA 2RHYA 1GCQA 1UGRB 3M0RA 5KYWB 1QMCA 4OB0B 2DVEA 4MZPA 4PJMA 5GANg 2CP3A 3OMGA 5IHIA 3NTKA 1BI2A 2KGTA 4X34A 2QXFA 2LX7A 2EYQA 3QIIA 4JJCA 4EPCA 2DD5A 4LNPA 2D1XA 1XNIA 2EQUA 1S72Q 1Z9ZA 2K2VA 2X4YA 1R8OB 2JS2A 2IIMA 3CCSA 4M77E 5CR2A 1Y07A 2X4XA 2FYKA 4ZGDB 1N8RU 2LQKA 1YIJT 4AFSC 5KH6A 2X35A 2DYBA 2EQIA 1S1NA 3QZ5B 1H8KA 1N27A 2GCXA 3TEEA 3G4SQ 4FYXB 4HKEA 3H0FA 3QJ6A 3NFCA 4EMHA 1KD1R 3EFSA 5EG2A 5KCOA 1X2QA 2VXFA 1H3HA 1M3AA 3QG1A 3CCLQ 1SHGA 2HSPA 1FWZA 1BB9A 1BCMA 1Z9QA 2DO3A 1IB8A 2DF6A 4A4GA 1VQ6T 2RQWA 4XK8E 3QXEB 2OTJA 1WA7A 5LJ3f 2XI9A 1TOVA 3EAEA 3CC4T 1JXOA 1MMDA 2F2WA 4FU6A 3LGLA 2NUPB 1VQMA 2RNAA 4C8QF 1JU5C 2RA2A 5L8RE 4BY6B 2WSCE 5LJ5j 2V8IA 3CCMT 1KIKA 1GCPA 1ACMB 2A37A 2WACA 3NHNA 2EYXA 2QI2A 3ZFJA 1YITQ 1M3BA 4F04B 3ER0A 5LJ5h 1K0XA 4PK4A 4XAXB 2VYTA 4Z89A 3V7RA 1D09B 1RAIB 3SFMA 2EFIA 2W0ZA 4JJDA 2R5AA 1SEMA 4MDWA 2CGHA 4F7UA 2LCLA 2VC8A 2OI3A 2IVWA 3G4SA 1GRIA 2MK5A 3LYIA 3C0CA 2OTLQ 2LJ0A 1TSFA 1IGQA 2RM4A 2ZPGB 1BCOA 1M8VA 2VVKA 2VUBA 3VS0A 2JVVA 2MMPA 1GBRA 2PU9B 4M75E 5LJ3e 1IZ6A 4BI3A 5GAMj 4J6WA 4D6WA 2O2OA 2P0PA 3PFSA 3PNWC 4C8QB 5IXBA 3EGDA 4R56A 1WIEA 4E6RA 1ZSZB 3GLXA 1O75A 1M4ZA 1QVPA 3BY7A 3JAME 3RDVA 2DPPB 3JCMh 3CCST 4PJOC 3CPWA 1WX6A 5GAMh 2PVDB 2ZPHB 5FWCA 1KQSP 1QWFA 4LN2A 3V8KA 1K73C 3J81E
chains in the Genus database with same CATH topology
3UATA 2OAWA 1HJDA 2KT8A 3PVLA 4AFUC 2CREA 4KRTA 1T0JA 1X2KA 4J9FA 3H0IA 1GL5A 1G83A 5EC7A 4JPBW 1NEBA 2GTJA 2NUZA 2CT4A 1HSQA 1K0SA 4F16A 1SSHA 1K9AA 1TUDA 1VYUA 1GFCA 2DL4A 2B86A 1GFDA 2ESWA 2DLPA 3IQLA 2LQWA 2LJ3A 1YCSB 3I5SA 3TSWA 5GJWB 1K76A 5HCKA 1ABQA 3UF4A 1X69A 4JJBA 2MIOA 1UUEA 2C0IA 1OV3A 3EHRA 4CC2A 4Y92A 3THKA 2JS0A 1AEYA 2ROTA 1UE9A 4RTUA 2SEMA 1VYTA 3A98A 2AK5A 2ENMA 3LH5A 1NM7A 2FRYA 2KRSA 3M0PA 4GBQA 2A36A 4AG1C 4DEXA 2DL5A 2FO0A 3H0HA 1QLYA 4OMNA 1MV3A 2FRWA 2RQRA 3NGPA 1E6GA 2JMCA 1WXUA 1WFWA 2K3BA 2KRMA 2LZ6B 4IIMA 2C0TA 2HCKA 4OMQA 2E5KA 1LCKA 4WCIA 2YT6A 4OMMA 3TVTA 1NG2A 2CDTA 2DE0X 3JV3A 4HVUA 2OJ2A 2JW4A 1X6GA 1I07A 1M3CA 2DJQA 1H92A 2MOXA 1ABOA 4RTWA 1UFFA 4RTVA 1QKXA 2EGAA 2KYMA 1K1ZA 2KROA 4HCKA 4HVVA 3VS4A 4D8DA 2J6FA 2KXCA 2YUNA 1KFZA 2EBPA 3R6NA 2DNUA 2K7AA 5L23A 2DL7A 2G6FX 4CC3A 1G2BA 3QWYA 1ZX6A 4LUEA 2KYBA 4RTZA 2ED1A 2KT1A 2KBTA 2L3QA 3TSZA 2J7IA 4IIOA 1FMKA 2PNIA 1SRLA 1HD3A 2LJ1A 1GCQC 3SHWA 1ZBJA 1UTIA 2M51A 4GLMA 1NYFA 1MUZA 1A0NB 1Y0MA 2MCNA 1OPKA 3KFVA 1YN8A 2ED0A 1AWXA 2CUBA 4QT7A 1KJWA 2RMOA 2CH4W 1AWWA 2CSQA 1CKBA 2DL8A 2PZ1A 2DL3A 2GGRA 1U5SA 2VKNA 3VS3A 2I0NA 4FSSA 1NLOC 4AFQC 1X43A 3VRYA 3RBBB 5FWBA 2DA9A 1YNZA 1NYGA 2DMOA 2HBWA 1AWOA 1UJYA 3ULRB 2J6KA 5ECAA 1AZEA 4ESRA 1RLQC 4J9HA 1I0CA 2LNHB 2LQNA 1BBZA 1QKWA 2EYYA 4LUDA 1JEGA 1T3SA 1AOJA 2A08A 1B3QA 1BK2A 2H8HA 3EHQA 1J3TA 1XOVA 1PKSA 1W70A 1ZLMA 1M8MA 4RTYA 1UJ0A 4J9IA 2JM9A 4AFZC 2D8JA 1YP5A 1SHFA 2K79A 2L3PA 3I9QA 4HXJA 2VWFA 2EYZA 1NLPC 1UHFA 4Z88A 3REBB 2L0AA 3FJ5A 3U23A 2AKLA 2P4RA 3EG2A 1JQQA 2FPDA 3M0UA 2DBMA 2O9VA 1OOTA 2EW3A 2RQUA 4OMLA 4J9GA 4F17A 2FEIA 2GNCA 2CSIA 2EVRA 1M27C 3REAB 1PKTA 3M0TA 2RQTA 2LCSA 4K11A 2AZSA 5IXFA 1T3LA 1TG0A 3PVQA 1OPLA 1X27A 1V1CA 1WXTA 2LMJA 1PWTA 2M0YA 1W6XA 4HVWA 4OMOA 2D8HA 4Z8AA 3SEMA 1U06A 4J9DA 2RN8A 4EIKA 1RI9A 1ZUUA 4A63B 1FYNA 4X1VA 4OMPA 1N5ZA 1WLPB 3GBQA 5IHKA 1ARKA 1U3OA 2BZYA 2EGCA 1I1JA 2FG0A 2J05A 1K4US 3VS2A 2JMAA 1W1FA 2EKHA 3I35A 2JM8A 1CKAA 3EG0A 5I22A 2KEAA 3QWXX 2KE9A 1KSWA 1CSKA 5I11A 1GCQA 3M0RA 2YUPA 2KRNA 4F14A 4JZ3A 1IO6A 4CC7A 1JO8A 2C0OA 5IHIA 3VRZA 2CH4A 2KGTA 1UGVA 1BU1A 2YSQA 2W10A 2K6DA 1QCFA 2K2MA 2LX7A 4JJCA 2YDLA 4LNPA 5GJVB 2RF0A 2D1XA 1UHCA 4RTTA 4LE9A 2GBQA 2X3XD 1Z9ZA 2EYWA 2A28A 2JS2A 2LP5A 2IIMA 2L2PA 2F2VA 2EGEA 2JT4A 4RUGA 2L3SA 3O5ZA 4AFSC 1EFNA 3ZL7C 2DRMA 1WYXA 2QDLA 1JXMA 2DYBA 2EQIA 1S1NA 1YWOA 1H8KA 2ROLA 1AZGB 1VA7A 1WI7A 1WXBA 2O9SA 1PNJA 4ZNXA 2KXDA 1UECA 2RPNA 4RTXA 3H0FA 2GTOA 2CT3A 2DVJA 1OEBA 1X2QA 1H3HA 1M3AA 2DBKA 1SHGA 3NPFA 2HSPA 2JXBA 2KNBB 1BB9A 4ORZA 1Z9QA 2DF6A 2D0NA 2XMFA 1ZUYA 3H41A 2RQWA 2HEQA 2PTKA 2YUQA 1WA7A 2F2XA 2O31A 1RUWA 1E6HA 2FPFA 3RNJA 1JXOA 2HDAA 2F2WA 2AKKA 2X3WD 1YWPA 2J6OA 2RNAA 2RQVA 1JU5C 4M4ZA 2YUOA 4AG2C 3M0QA 2AZVA 3EG3A 1SRMA 1RLPC 1KIKA 1GCPA 1X6BA 2ECZA 3VS7A 1AWJA 2A37A 3NHNA 5IH2A 1AD5A 2EYXA 2K9GA 2J06A 1B07A 2EPDA 3PE0A 1M3BA 2CUDA 2JTEA 1K0XA 3NMZC 1WDXA 3UA6A 2O88A 2FPEA 2SRCA 2KR3A 4Z89A 3M0SA 3UA7A 3VS6A 1TUCA 1ZSGA 1VYVA 2BZXA 2GQIA 4JJDA 2W0ZA 1SEMA 3EGUA 1UG1A 4J9CA 2BTTA 1NEGA 1E7OA 5IHNA 2BZ8A 4JZ4A 2V1QA 1M30A 2OI3A 4CC4B 1GRIA 1T0HA 2NWMA 3C0CA 3VS5A 1UDLA 1ZUKA 4D8KA 5FW9A 1PHTA 1SPKA 2LJ0A 1GBQA 2ABLA 3CQTA 2VVKA 3VS0A 4J9BA 3VS1A 2DM1A 1PRLC 1GBRA 1AVZC 1PRMC 3EG1A 2O2OA 2DRKA 4DEYA 5IXBA 1WIEA 4E6RA 2DX1A 4R0KA 2V1RA 1Y57A 4J9EA 3I5RA 2DILA 1WX6A 1QWEA 5FWCA 1MV0B 1QWFA 4LN2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3UAT A;  2OAW A;  1HJD A;  2KT8 A;  3PVL A;  4AFU C;  2CRE A;  4KRT A;  1T0J A;  1X2K A;  4J9F A;  3H0I A;  1GL5 A;  1G83 A;  5EC7 A;  4JPB W;  1NEB A;  2GTJ A;  2NUZ A;  2CT4 A;  1HSQ A;  1K0S A;  4F16 A;  1SSH A;  1K9A A;  1TUD A;  1VYU A;  1GFC A;  2DL4 A;  2B86 A;  1GFD A;  2ESW A;  2DLP A;  3IQL A;  2LQW A;  2LJ3 A;  1YCS B;  3I5S A;  3TSW A;  5GJW B;  1K76 A;  5HCK A;  1ABQ A;  3UF4 A;  1X69 A;  4JJB A;  2MIO A;  1UUE A;  2C0I A;  1OV3 A;  3EHR A;  4CC2 A;  4Y92 A;  3THK A;  2JS0 A;  1AEY A;  2ROT A;  1UE9 A;  4RTU A;  2SEM A;  1VYT A;  3A98 A;  2AK5 A;  2ENM A;  3LH5 A;  1NM7 A;  2FRY A;  2KRS A;  3M0P A;  4GBQ A;  2A36 A;  4AG1 C;  4DEX A;  2DL5 A;  2FO0 A;  3H0H A;  1QLY A;  4OMN A;  1MV3 A;  2FRW A;  2RQR A;  3NGP A;  1E6G A;  2JMC A;  1WXU A;  1WFW A;  2K3B A;  2KRM A;  2LZ6 B;  4IIM A;  2C0T A;  2HCK A;  4OMQ A;  2E5K A;  1LCK A;  4WCI A;  2YT6 A;  4OMM A;  3TVT A;  1NG2 A;  2CDT A;  2DE0 X;  3JV3 A;  4HVU A;  2OJ2 A;  2JW4 A;  1X6G A;  1I07 A;  1M3C A;  2DJQ A;  1H92 A;  2MOX A;  1ABO A;  4RTW A;  1UFF A;  4RTV A;  1QKX A;  2EGA A;  2KYM A;  1K1Z A;  2KRO A;  4HCK A;  4HVV A;  3VS4 A;  4D8D A;  2J6F A;  2KXC A;  2YUN A;  1KFZ A;  2EBP A;  3R6N A;  2DNU A;  2K7A A;  5L23 A;  2DL7 A;  2G6F X;  4CC3 A;  1G2B A;  3QWY A;  1ZX6 A;  4LUE A;  2KYB A;  4RTZ A;  2ED1 A;  2KT1 A;  2KBT A;  2L3Q A;  3TSZ A;  2J7I A;  4IIO A;  1FMK A;  2PNI A;  1SRL A;  1HD3 A;  2LJ1 A;  1GCQ C;  3SHW A;  1ZBJ A;  1UTI A;  2M51 A;  4GLM A;  1NYF A;  1MUZ A;  1A0N B;  1Y0M A;  2MCN A;  1OPK A;  3KFV A;  1YN8 A;  2ED0 A;  1AWX A;  2CUB A;  4QT7 A;  1KJW A;  2RMO A;  2CH4 W;  1AWW A;  2CSQ A;  1CKB A;  2DL8 A;  2PZ1 A;  2DL3 A;  2GGR A;  1U5S A;  2VKN A;  3VS3 A;  2I0N A;  4FSS A;  1NLO C;  4AFQ C;  1X43 A;  3VRY A;  3RBB B;  5FWB A;  2DA9 A;  1YNZ A;  1NYG A;  2DMO A;  2HBW A;  1AWO A;  1UJY A;  3ULR B;  2J6K A;  5ECA A;  1AZE A;  4ESR A;  1RLQ C;  4J9H A;  1I0C A;  2LNH B;  2LQN A;  1BBZ A;  1QKW A;  2EYY A;  4LUD A;  1JEG A;  1T3S A;  1AOJ A;  2A08 A;  1B3Q A;  1BK2 A;  2H8H A;  3EHQ A;  1J3T A;  1XOV A;  1PKS A;  1W70 A;  1ZLM A;  1M8M A;  4RTY A;  1UJ0 A;  4J9I A;  2JM9 A;  4AFZ C;  2D8J A;  1YP5 A;  1SHF A;  2K79 A;  2L3P A;  3I9Q A;  4HXJ A;  2VWF A;  2EYZ A;  1NLP C;  1UHF A;  4Z88 A;  3REB B;  2L0A A;  3FJ5 A;  3U23 A;  2AKL A;  2P4R A;  3EG2 A;  1JQQ A;  2FPD A;  3M0U A;  2DBM A;  2O9V A;  1OOT A;  2EW3 A;  2RQU A;  4OML A;  4J9G A;  4F17 A;  2FEI A;  2GNC A;  2CSI A;  2EVR A;  1M27 C;  3REA B;  1PKT A;  3M0T A;  2RQT A;  2LCS A;  4K11 A;  2AZS A;  5IXF A;  1T3L A;  1TG0 A;  3PVQ A;  1OPL A;  1X27 A;  1V1C A;  1WXT A;  2LMJ A;  1PWT A;  2M0Y A;  1W6X A;  4HVW A;  4OMO A;  2D8H A;  4Z8A A;  3SEM A;  1U06 A;  4J9D A;  2RN8 A;  4EIK A;  1RI9 A;  1ZUU A;  4A63 B;  1FYN A;  4X1V A;  4OMP A;  1N5Z A;  1WLP B;  3GBQ A;  5IHK A;  1ARK A;  1U3O A;  2BZY A;  2EGC A;  1I1J A;  2FG0 A;  2J05 A;  1K4U S;  3VS2 A;  2JMA A;  1W1F A;  2EKH A;  3I35 A;  2JM8 A;  1CKA A;  3EG0 A;  5I22 A;  2KEA A;  3QWX X;  2KE9 A;  1KSW A;  1CSK A;  5I11 A;  1GCQ A;  3M0R A;  2YUP A;  2KRN A;  4F14 A;  4JZ3 A;  1IO6 A;  4CC7 A;  1JO8 A;  2C0O A;  5IHI A;  3VRZ A;  2CH4 A;  2KGT A;  1UGV A;  1BU1 A;  2YSQ A;  2W10 A;  2K6D A;  1QCF A;  2K2M A;  2LX7 A;  4JJC A;  2YDL A;  4LNP A;  5GJV B;  2RF0 A;  2D1X A;  1UHC A;  4RTT A;  4LE9 A;  2GBQ A;  2X3X D;  1Z9Z A;  2EYW A;  2A28 A;  2JS2 A;  2LP5 A;  2IIM A;  2L2P A;  2F2V A;  2EGE A;  2JT4 A;  4RUG A;  2L3S A;  3O5Z A;  4AFS C;  1EFN A;  3ZL7 C;  2DRM A;  1WYX A;  2QDL A;  1JXM A;  2DYB A;  2EQI A;  1S1N A;  1YWO A;  1H8K A;  2ROL A;  1AZG B;  1VA7 A;  1WI7 A;  1WXB A;  2O9S A;  1PNJ A;  4ZNX A;  2KXD A;  1UEC A;  2RPN A;  4RTX A;  3H0F A;  2GTO A;  2CT3 A;  2DVJ A;  1OEB A;  1X2Q A;  1H3H A;  1M3A A;  2DBK A;  1SHG A;  3NPF A;  2HSP A;  2JXB A;  2KNB B;  1BB9 A;  4ORZ A;  1Z9Q A;  2DF6 A;  2D0N A;  2XMF A;  1ZUY A;  3H41 A;  2RQW A;  2HEQ A;  2PTK A;  2YUQ A;  1WA7 A;  2F2X A;  2O31 A;  1RUW A;  1E6H A;  2FPF A;  3RNJ A;  1JXO A;  2HDA A;  2F2W A;  2AKK A;  2X3W D;  1YWP A;  2J6O A;  2RNA A;  2RQV A;  1JU5 C;  4M4Z A;  2YUO A;  4AG2 C;  3M0Q A;  2AZV A;  3EG3 A;  1SRM A;  1RLP C;  1KIK A;  1GCP A;  1X6B A;  2ECZ A;  3VS7 A;  1AWJ A;  2A37 A;  3NHN A;  5IH2 A;  1AD5 A;  2EYX A;  2K9G A;  2J06 A;  1B07 A;  2EPD A;  3PE0 A;  1M3B A;  2CUD A;  2JTE A;  1K0X A;  3NMZ C;  1WDX A;  3UA6 A;  2O88 A;  2FPE A;  2SRC A;  2KR3 A;  4Z89 A;  3M0S A;  3UA7 A;  3VS6 A;  1TUC A;  1ZSG A;  1VYV A;  2BZX A;  2GQI A;  4JJD A;  2W0Z A;  1SEM A;  3EGU A;  1UG1 A;  4J9C A;  2BTT A;  1NEG A;  1E7O A;  5IHN A;  2BZ8 A;  4JZ4 A;  2V1Q A;  1M30 A;  2OI3 A;  4CC4 B;  1GRI A;  1T0H A;  2NWM A;  3C0C A;  3VS5 A;  1UDL A;  1ZUK A;  4D8K A;  5FW9 A;  1PHT A;  1SPK A;  2LJ0 A;  1GBQ A;  2ABL A;  3CQT A;  2VVK A;  3VS0 A;  4J9B A;  3VS1 A;  2DM1 A;  1PRL C;  1GBR A;  1AVZ C;  1PRM C;  3EG1 A;  2O2O A;  2DRK A;  4DEY A;  5IXB A;  1WIE A;  4E6R A;  2DX1 A;  4R0K A;  2V1R A;  1Y57 A;  4J9E A;  3I5R A;  2DIL A;  1WX6 A;  1QWE A;  5FWC A;  1MV0 B;  1QWF A;  4LN2 A; 
#chains in the Genus database with same CATH topology
 3FLG A;  1OZ2 A;  3CBM A;  5GAN 2;  2XG8 D;  2FHD A;  1XTD A;  4J8O A;  3G71 T;  4JPB W;  3OS5 A;  1TXQ A;  2FZC B;  9ATC B;  3X20 B;  4OMF B;  1K9A A;  3CC7 Q;  4PFP A;  3OYA A;  5FU6 C;  1YIT A;  5CK9 A;  4A54 A;  3VYG A;  5GJW B;  4JJB A;  4M7D F;  2MIO A;  4CC2 A;  4Y92 A;  3FC3 A;  1OZ3 A;  2M0O A;  2SEM A;  1Q82 U;  4PLI A;  3A98 A;  1OI1 A;  2BKD N;  1D3B B;  2K4Y A;  4KH1 B;  3CBO A;  3CPW S;  2DL5 A;  2FO0 A;  3H0H A;  3X28 B;  4LD9 K;  3F70 A;  1H64 1;  4QQD A;  4M7A E;  3TCJ A;  2ZPF B;  1OQK A;  2KRM A;  2COW A;  1F1B B;  4IIM A;  3CMA A;  1X6O A;  4C92 A;  3BDL A;  3JB9 D;  4PJO D;  5CKE A;  3HPW A;  3X25 B;  1NG2 A;  4DBF A;  4HVU A;  2DJQ A;  4IUQ A;  1VQN Q;  4QVZ A;  1ABO A;  4RTW A;  2E12 A;  1UFF A;  2KYM A;  1SSF A;  1UGP B;  1K1Z A;  4LDU A;  5A0D A;  4BI8 B;  3RMQ A;  4HCK A;  3DLL A;  1S72 T;  2YUN A;  4II1 A;  2DNU A;  2K7A A;  2G6F X;  3OSS C;  1ZX6 A;  2KYB A;  1WHL A;  1YHQ T;  3M59 A;  2ED1 A;  4OB1 B;  2KBT A;  4J6X A;  3L2R A;  1FMK A;  2AHJ B;  2QA4 Q;  2QTX A;  1QVF A;  1HD3 A;  3G4S T;  1NZ9 A;  2CP0 A;  1YI2 Q;  4P5N A;  4EMK A;  4JLG A;  4QQG A;  1NYF A;  1Y0M A;  4N0A C;  2ED0 A;  1AWX A;  2CUB A;  3A8G B;  5A0L A;  1TTH B;  3CCL T;  2ZPE B;  4CRI A;  4DBH A;  2DL8 A;  3V8L A;  4M77 C;  2DL3 A;  3FRN A;  3CCU T;  1U5S A;  2VKN A;  5FWB A;  4ZGJ B;  1YNZ A;  2AT1 B;  2YRD A;  1WZO A;  3OYG A;  2EWN A;  2G3R A;  1AWO A;  5C0M A;  1QCN A;  5ECA A;  4ESR A;  4Y91 A;  4L59 A;  1M5Q 1;  3BFM A;  3EH1 A;  1BBZ A;  1KHC A;  1B3Q A;  3MEA A;  4TVR A;  1QVF S;  2QG9 B;  3A8H B;  4C5G A;  1PKS A;  1W70 A;  1ZLM A;  1VQN A;  2HNI A;  4RTY A;  2F1L A;  3VKI A;  5GMK m;  1WPY A;  4M78 E;  2CS7 A;  3I9Q A;  2H3E B;  3MPU B;  4C8Q A;  4KGX B;  5I21 A;  2EYZ A;  3GOX A;  1ZSZ A;  3OMC A;  3CCR Q;  1QW1 A;  1NLP C;  1WJR A;  3JB9 F;  2CKK A;  4PJO F;  1VQ5 Q;  4Z88 A;  1AT1 B;  1MND A;  1YJN Q;  3FJ5 A;  1K8A U;  3EG2 A;  3EG9 B;  3OQ5 A;  3OSV A;  2XHC A;  1TUG B;  4M77 D;  1RAG B;  1PSF A;  3OYC A;  2RQU A;  1VQ8 T;  2LT4 A;  2XDP A;  4OML A;  5GAN j;  2OTL T;  3CCJ Q;  2FEI A;  4JRI A;  1M27 C;  8ATC B;  2QYZ A;  5D6X A;  4PJJ A;  3JCM W;  2DIQ A;  2CP7 A;  1ZHI A;  5M9O A;  2D0Q B;  5GAN 6;  5GAN h;  1VQP Q;  2ZGW A;  1OYX A;  2QK0 A;  4E7J A;  1UGQ B;  3OYI A;  2D8H A;  2P0Q A;  1ZUU A;  4A63 B;  1IXD A;  3ZBD A;  2K5L A;  2YXY A;  3GBQ A;  4PKC C;  1D0Z A;  1U3O A;  2BZY A;  1D3B A;  2DTO A;  2EGC A;  2FG0 A;  3CCE Q;  1K9M C;  1K4U S;  2M02 A;  1W1F A;  3GF5 A;  1Y96 B;  2VB6 A;  3I35 A;  3C94 A;  2KE9 A;  1KSW A;  2KK4 A;  1LVK A;  4M75 C;  4PJO B;  1VQ7 T;  4JRK A;  2K3X A;  4ZN3 A;  5HK0 A;  4IUT A;  2MWO A;  4ZGE B;  3CC7 T;  2RJC A;  4KUD K;  4JZ3 A;  1JO8 A;  1ZBX A;  1V76 A;  3EGX B;  2CH4 A;  2QGG A;  4EDU A;  1UGV A;  1BU1 A;  1FMV A;  2XK0 A;  2K2M A;  1VQ5 A;  2X51 A;  1WHG A;  1UHC A;  1YJN A;  4RTT A;  5FU6 B;  2RHX A;  3FB9 A;  2GBQ A;  1NJI C;  2JNG A;  3R6O A;  2LP5 A;  2L2P A;  1WHH A;  4RUG A;  3OBY A;  3CCJ A;  2L3S A;  1RL2 A;  4L6V 5;  4M7D A;  5GMK i;  3BW1 A;  4FL6 A;  2FZG B;  2OAU A;  4WTO B;  1YWO A;  4DOW A;  3S3N A;  1AZG B;  3QZ9 B;  3L2W A;  4E7H A;  5GAN 3;  4ZNX A;  4M77 F;  2DKG A;  1VQP A;  3VYH B;  2V8K A;  2LC4 A;  1OEB A;  2EJG A;  1PG5 B;  1M1K U;  4M75 D;  2DBK A;  3BDU A;  5GAO l;  1N8R R;  1BI3 A;  1SF9 A;  3CCQ A;  2JXB A;  1PD0 A;  4ORZ A;  4M7A C;  3CCE A;  3MEV A;  2D0N A;  1ZUY A;  4MZM A;  4CI0 C;  2LNV A;  2PTK A;  4J83 A;  2QA4 T;  5FLX E;  2CZ6 B;  2P4T A;  1VOM A;  1JB0 E;  2EJ9 A;  3QUI A;  1RUW A;  2FPF A;  1YI2 T;  3FEO A;  2E4H A;  4PL6 A;  2QAZ A;  4J5Y A;  2AKK A;  5FRO A;  2J6O A;  2RQV A;  3QKJ A;  3M0Q A;  2KDS A;  2AZV A;  1X6B A;  2ZAE A;  2XDB A;  2Y4X A;  5IH2 A;  4C5E A;  1DJ7 B;  5A2Q E;  3ASK A;  4ZTJ A;  2EPD A;  2YLB A;  4MDX A;  2JTE A;  1IRX A;  3LWH A;  1WDX A;  2KR3 A;  3M0S A;  1VUB A;  4M77 B;  3UA7 A;  4JJN K;  2RHZ A;  3KUF A;  1TUC A;  2D6F A;  2GQI A;  3A8O B;  2OTJ Q;  1UG1 A;  4J9C A;  2BTT A;  3QYG B;  1E7O A;  2BZ8 A;  4JZ4 A;  2V1Q A;  2COY A;  1C0M A;  2JN0 A;  4M7A D;  1P92 A;  3L42 A;  1VQM Q;  1UDL A;  4D8K A;  5GAN 5;  1SKU B;  5DY9 A;  3MP1 A;  2ABL A;  1KD1 C;  2RK1 A;  5DM7 R;  2QQR A;  3NTI A;  3GPL A;  5HY6 A;  4F7U E;  1VQ4 Q;  3CCR T;  4FT2 A;  1QVG A;  2RI5 A;  3EG1 A;  4HT9 A;  5GMK e;  3OYB A;  4LDW A;  1KC8 U;  1VQO T;  4RG8 A;  2NUT B;  1VQK Q;  1WQW A;  2RJF A;  3MP8 A;  1Y57 A;  2NYS A;  2HMA A;  4M75 F;  1Y96 A;  3Q1J A;  4OP0 A;  1I81 A;  3C12 A;  3JCM X;  2P0K A;  4PJO A;  2QEX Q;  1X01 A;  4M78 C;  4KRT A;  1T0J A;  1X2K A;  4J9F A;  1M90 U;  2HZY A;  3VV0 A;  3JCM c;  3LH0 A;  2NUZ A;  2DER A;  3EGX A;  2EAY A;  5LL6 S;  2GF7 A;  1SSH A;  3TU4 K;  1U8R A;  2DJZ A;  1Q81 U;  2B86 A;  4M77 G;  3L2Z A;  2DLP A;  1QVF P;  3IQL A;  2LQW A;  1Q86 U;  1N9R A;  1K76 A;  1QVG S;  1ABQ A;  1X69 A;  1Q82 C;  4FT4 A;  1R77 A;  2C0I A;  2M16 A;  4PLL A;  3MO8 A;  2ROT A;  4C5I A;  3CCE T;  3WVE B;  2CZ1 B;  3HTR A;  4PFO A;  1NPR A;  4LDY A;  2ENM A;  2DXT A;  2H3J A;  3M0P A;  1ZQ1 A;  3H9N A;  4UC4 A;  1MV3 A;  1E6G A;  2LZ6 B;  5CQX A;  1NBE B;  3V7S A;  2CP5 A;  2YWW A;  2E5K A;  4WCI A;  3A1P A;  2JZ2 A;  2RJD A;  3TVT A;  1VQ4 A;  2RH2 A;  2DE0 X;  2HD0 A;  4M75 B;  3VUB A;  4AT1 B;  2QQA A;  3S6W A;  5FRN A;  1RAB B;  3QYH B;  4M78 D;  3V7C A;  2LT1 A;  1Q82 R;  2FZK B;  2MOX A;  4RTV A;  2EGA A;  2DEU A;  4XTU A;  3FDR A;  1VQK A;  2KRO A;  3VS4 A;  4C92 E;  4YTL A;  2J6F A;  4NL2 A;  8AT1 B;  1G2B A;  3DB3 A;  4LUE A;  5FRM A;  2QEX A;  2RHI A;  2XIC A;  2KT1 A;  2YLC A;  4BE2 A;  1VQ9 Q;  5D7U A;  2PNI A;  2X4J A;  1LJO A;  1KHI A;  1GCQ C;  4QW2 A;  1ZBJ A;  2LTO A;  3CMA Q;  1UTI A;  2M51 A;  1KQ1 A;  1MUZ A;  1A0N B;  1Q7Y U;  4KUL A;  3SDZ A;  1WHK A;  3OYY A;  3V8J A;  4BDY A;  2CSQ A;  1CKB A;  2QAS A;  4N0A A;  2L5Q A;  4ATO A;  5CO7 A;  2DZC A;  1NLO C;  3VRY A;  4M77 A;  1QCO A;  3RMS A;  3JCM P;  4A4E A;  1B7T A;  4OGC A;  2J6K A;  4N4H A;  5KYW A;  3E9G A;  3KXT A;  3OW2 A;  3HL8 A;  1RLQ C;  3NTH A;  1I0C A;  1MGQ A;  2E3H A;  1RAD B;  1QKW A;  5GAN 7;  4M75 G;  5LJ5 f;  3MET A;  1J3T A;  4WF2 A;  4JLI A;  5LJ3 g;  1M8M A;  1PCX A;  1YCY A;  2JM9 A;  1G3W A;  2KAF A;  2D8J A;  1YP5 A;  3PMT A;  1ZA1 B;  3RKX A;  3CPF A;  2NUT A;  3M54 A;  2OTJ T;  2L0A A;  1R0B G;  3U23 A;  3M0U A;  1VQ9 A;  5LJ3 d;  4E7Z A;  3CD6 Q;  4C8Q E;  4E7L A;  3OW2 S;  2CYZ B;  2E6N A;  3OYF A;  1VQM T;  3INZ A;  4FIB A;  1H3Z A;  4F17 A;  2CSI A;  4IUU A;  1MHN A;  4K11 A;  2AZS A;  1N9S A;  2OX7 A;  3I56 A;  3JCM f;  3OY9 A;  1M1G A;  1V1C A;  5GAM f;  2E5Q A;  2LMJ A;  1K8A R;  2MWP A;  2V8J A;  2CZ7 B;  3E19 A;  4OMO A;  1VQK T;  4J9D A;  2ZPB B;  2RN8 A;  4EIK A;  4OB2 B;  4Z02 A;  4M7A G;  2XD0 A;  3RES A;  1FYN A;  5LJ5 e;  4X1V A;  7AT1 B;  4JRP A;  5AT1 B;  1N5Z A;  1WLP B;  2VXE A;  1ARK A;  2R58 A;  4X9D A;  2V26 A;  1I8F A;  2E70 A;  5GAO r;  1NPP A;  2NUP A;  2HAX A;  2EKH A;  1M2V B;  2JM8 A;  2DK3 A;  3EG0 A;  3WXM B;  5I22 A;  5CAI A;  1TH7 A;  3EFR A;  2KEA A;  3QWX X;  2YUP A;  2KRN A;  4F14 A;  4O6J A;  3L1A A;  4B6M A;  4M75 A;  1GXI E;  2AIR B;  3L2Q A;  2L8D A;  4M78 B;  1JRI A;  2IPO B;  3M57 A;  2E41 A;  3M4G A;  3JCM Q;  2C0O A;  2YHT A;  3CC2 Q;  3VRZ A;  4HCZ A;  2DIG A;  2YDL A;  3H6Z A;  5J26 A;  5GJV B;  2P84 A;  2RF0 A;  2HQE A;  3LLR A;  3P8D A;  3PT9 A;  4LE9 A;  4LD6 A;  5CIU A;  2X3X D;  2WSF E;  3AT1 B;  4A4K A;  2EYW A;  1PC0 A;  4QQ6 A;  2MAM A;  3CD6 A;  2D9T A;  2EGE A;  3JCM e;  1KQ2 A;  4ZN1 A;  1JJ2 A;  5GAM e;  2QQ9 A;  1EFN A;  3T9N A;  2DRM A;  2QTV A;  2QDL A;  1JXM A;  4E7K A;  1D1A A;  1VA7 A;  1WI7 A;  5LJ5 d;  1OU9 A;  1YIT T;  3HRT A;  2KXD A;  3CME Q;  1UEC A;  2RPN A;  4RTX A;  2GTO A;  4M7D E;  2CT3 A;  2NLU A;  2JTF A;  1K73 U;  3OYD A;  2EQJ A;  3KBG A;  1U1T A;  3HP9 A;  4A4F A;  1IHW A;  2M9U A;  4E47 A;  2HSE B;  3N5B B;  4C5H A;  5A0G A;  1WGS A;  5GAN 8;  5KYY B;  3SB2 A;  2XMF A;  2HEQ A;  1YJ9 A;  2K3Y A;  2QGF B;  2YUQ A;  3TRE A;  1LPL A;  4JS5 A;  1IGU A;  1QVG P;  2LQ8 A;  1NE8 A;  4XU3 A;  5GAM g;  4FYW B;  4M78 G;  1E6H A;  4JRQ A;  1M1K R;  3CMA T;  1JJ2 S;  3RNJ A;  2HDA A;  4DBQ A;  1UB4 A;  2C06 A;  1LOJ A;  5KYU B;  5CKD A;  1YWP A;  4M4Z A;  4AG2 C;  4C92 C;  3CC2 A;  2LDM A;  3RIR A;  1FXX A;  4ELZ C;  1RLP C;  3VS7 A;  2ECZ A;  3H8Z A;  2ZCF B;  1AD5 A;  2J06 A;  5GAM d;  1EX4 A;  2CUD A;  3CCQ Q;  3UA6 A;  2O88 A;  2FPE A;  2SRC A;  5IAY A;  3MEW A;  2A3L A;  1I5L A;  4R55 A;  3EGU A;  4ELY C;  4JS4 A;  2LX9 A;  2XKO C;  3M58 A;  5IN1 A;  1M30 A;  2BE7 D;  4ME7 A;  1VQ6 Q;  3A5Z B;  4CC4 B;  3CME A;  2F69 A;  2NWM A;  2RJE A;  4XTZ A;  4EMK C;  5GAO p;  3VS5 A;  4V2S A;  2FVU A;  1ZUK A;  4QVC A;  1PHT A;  1SPK A;  1GBQ A;  2I2L A;  3MCA B;  6AT1 B;  3PTA A;  4FW2 A;  4J9B A;  2DM1 A;  1JBM A;  2LCC A;  2L89 A;  2DET A;  1N8R C;  1AVZ C;  3CCM Q;  4C92 D;  4DEY A;  1PD1 A;  4XTV A;  2DEQ A;  3D7S B;  4R0K A;  3I5R A;  5GMK l;  5GAN f;  2DIL A;  1QWE A;  1XQH A;  1MV0 B;  3GP8 A;  3HRU A;  2DFU A;  2CRE A;  3MKD A;  1VQN T;  5FU7 C;  5EC7 A;  2GTJ A;  1K0S A;  2CT4 A;  1HSQ A;  2DYI A;  4F16 A;  4BAC A;  1TUD A;  1KC8 R;  3JRZ A;  4XQ3 A;  5D6Y A;  1GFC A;  2KVQ G;  4OVA A;  5KYX B;  3OA6 A;  4PJO E;  1GFD A;  4MMK A;  3OS1 A;  2ESW A;  1MMN A;  3RUX A;  2LJ3 A;  1YCS B;  3I5S A;  3TSW A;  2Y90 A;  1XJW B;  1UUE A;  1OV3 A;  3EHR A;  3THK A;  4J7I A;  4RG2 A;  1UE9 A;  1M90 R;  2COZ A;  3CXC A;  1VYT A;  2AK5 A;  4E2F B;  3LH5 A;  1VQ6 A;  2A36 A;  4AG1 C;  1Q81 R;  4DEX A;  1QLY A;  4OMN A;  3OBW A;  1C6V X;  3UPU A;  2RQR A;  3NGP A;  2JMC A;  1WXU A;  1WFW A;  2K3B A;  2JTM A;  1Q86 R;  3CC4 A;  4J7F A;  1X75 C;  2C0T A;  4OMQ A;  2MYS A;  2QQS A;  2XU8 A;  4OMM A;  4F7U B;  3OW2 P;  4LXC A;  2CDT A;  3A8L B;  3LGF A;  2OJ2 A;  2DXB A;  3RER A;  1X6G A;  3CCM A;  1I07 A;  2XDD A;  1M3C A;  3HKS A;  1H92 A;  4Q5W A;  4AMC A;  3G71 Q;  3J80 E;  5GAN e;  4C0D C;  3OB9 A;  1BI0 A;  3EG9 A;  2EQM A;  2F5K A;  3SD4 A;  3DB4 A;  4D8D A;  5KYY A;  2KXC A;  1KFZ A;  5CKH A;  2EBP A;  3QO3 A;  3R6N A;  4C0Z A;  2PUK B;  1G3S A;  4CC3 A;  5C6S A;  4NL3 A;  1Q95 G;  4RTZ A;  3CXC S;  4KBM B;  4IIO A;  1QP3 A;  5KYU A;  3UWN A;  4B9W A;  3CME T;  4GLM A;  2DAQ A;  2QQB A;  2MF2 A;  1K9M U;  3JSC A;  3KFV A;  4XU0 A;  4QT7 A;  3OYM A;  1VQ5 T;  1BIB A;  2X9H A;  5LJ3 h;  1YJN T;  3M53 A;  1TU0 B;  2GGR A;  1VIE A;  5J3B A;  3VS3 A;  2I0N A;  4FSS A;  4FYY B;  3C95 A;  5IT9 E;  2VGN A;  3OYL A;  3QSU A;  1RI0 A;  2DMO A;  2HBW A;  1UJY A;  3CCJ T;  1WJQ A;  4RKU E;  5KCH A;  3UDC A;  2HQH A;  1Q7Y R;  4J9H A;  5CKF A;  4F7U G;  1VQL Q;  4M7D C;  2VGM A;  5KE2 A;  5GAN d;  3I55 Q;  1JEG A;  1AOJ A;  2A08 A;  1NJI U;  1VQP T;  4BI4 A;  1YHQ Q;  2H8H A;  4PFZ A;  1XOV A;  2JOY A;  3HRS A;  3G71 A;  4J9I A;  1N6A A;  1D1C A;  2RHU A;  2E64 A;  2MI6 A;  3CCQ T;  4C92 B;  1SHF A;  2EIF A;  2K79 A;  4JUV A;  4RCC A;  2YRC A;  3S3O A;  2KQW A;  2HBP A;  1UHF A;  1TWB A;  1UEB A;  1YFN A;  1WJS A;  2VAS A;  3CCU Q;  2A0F B;  3LW5 E;  1B34 B;  2HKQ B;  1HK9 A;  3M55 A;  3SWN C;  1BYM A;  1OOT A;  3EFO B;  2X4W A;  3HFN A;  4J9G A;  3GIB A;  3QPH A;  2GNC A;  3REA B;  1PKT A;  3LWI A;  5D6W A;  4BD3 A;  2A7Y A;  3PVQ A;  1X27 A;  4M7A F;  5KYX A;  4IUV A;  4M7D D;  1WXT A;  4FSX A;  1JJ2 P;  4EMK B;  5CVI A;  1PWT A;  2M0Y A;  3CBP A;  1W6X A;  2E10 A;  4HVW A;  4Z8A A;  2E65 A;  3SEM A;  4L5G A;  3URG A;  5GAN 4;  2E1H A;  1S72 A;  4OMP A;  5IHK A;  3X26 B;  1YJW Q;  3L2V A;  1RAF B;  1VQL A;  2R57 A;  3GNG A;  3I55 A;  2RI2 A;  1W2B A;  3VS2 A;  4E7I A;  3O8V A;  2IG0 A;  1YHQ A;  4XTW A;  1G3T A;  1CSK A;  5I11 A;  2RI3 A;  4C92 G;  3G1J A;  1OX9 A;  5KE3 A;  1IO6 A;  3I56 Q;  3QJY A;  1VQ8 Q;  4CC7 A;  2JJ9 A;  2L3R A;  5FU7 B;  2YSQ A;  2W10 A;  2K6D A;  1QCF A;  2JUF A;  3CCV Q;  3CCL A;  2HQX A;  3CCU A;  4E7S A;  2KSS A;  3G6E Q;  4QVD A;  1KD1 U;  2A28 A;  4M7A B;  4BE1 A;  1EZZ B;  1WQ7 A;  4BB7 A;  2F2V A;  2PUO B;  2DXU A;  2JT4 A;  2Z0W A;  5I2M A;  1V29 B;  2DXC A;  3O5Z A;  1M2O A;  1W2B S;  4A53 A;  3ZL7 C;  1WYX A;  3G7Z A;  4XTY A;  1FX7 A;  4B9X A;  3OS0 A;  4DA4 A;  2FL7 A;  3HFO A;  2ROL A;  1D0Y A;  1WXB A;  4BE0 A;  2O9S A;  1PNJ A;  4XU1 A;  4BUG A;  5AYF A;  3OYE A;  2DVJ A;  1VQ7 Q;  1K8A C;  2DTH A;  1Y71 A;  3NPF A;  3MP6 A;  4NOY A;  1YJW A;  2KNB B;  1FMW A;  2HKN A;  4FCY A;  2WSE E;  4M78 F;  3MEU A;  4C0D B;  4J6Y A;  1PM3 A;  3H41 A;  4VUB A;  1R0C B;  2O4X B;  4X9C A;  1LNX A;  4N4G A;  2F2X A;  2O31 A;  1K73 R;  4C0F A;  1OU8 A;  3E1S A;  1VQ8 A;  2K57 A;  2X3W D;  1VQ4 T;  2OTL A;  2YUO A;  3HHT B;  1PSE A;  1BI1 A;  3EG3 A;  1SRM A;  3CCV A;  1AWJ A;  3E2U A;  3DKM A;  2K9G A;  4C8Q G;  4N4I A;  1B07 A;  3PE0 A;  3G6E A;  3S3M A;  3NMZ C;  1TS9 A;  3OYN A;  3PIO A;  1QP2 A;  3QDR B;  2QEX T;  1B34 A;  3VS6 A;  5DLQ E;  1ZSG A;  3JCM J;  3LX7 A;  1EIF A;  1VYV A;  2BZX A;  1YJ9 Q;  1VQL T;  2BIV A;  3C4S A;  3EFO A;  2LVM A;  3OS2 A;  2Y4Y A;  3I55 T;  2MPX C;  4BDZ A;  1NEG A;  4OF1 A;  4OB3 B;  2PVO B;  2RK2 A;  3M56 A;  5IHN A;  4HA8 A;  2R5M A;  1ZA2 B;  4PJL A;  2ATC B;  4MZT A;  1T0H A;  3PGG A;  2B8A A;  4M7D B;  3CXC P;  5FW9 A;  3JCM b;  1VQ7 A;  3M9Q A;  3JB9 I;  1WHM A;  1I4K 1;  1KG1 A;  3OYJ A;  3CC7 A;  3CQT A;  4C0G A;  3VS1 A;  1PRL C;  3AHU A;  5LJ5 g;  1D1B A;  1PRM C;  5CQY A;  2DRK A;  3M5A A;  2DX1 A;  4HCB A;  2V1R A;  2GFA A;  1RAH B;  4J9E A;  4RCB A;  4LDV A;  1I5O B;  3DLM A;  2HL3 A;  2EQK A;  3UAT A;  1M1K C;  2OAW A;  3RKW A;  1M9S A;  2F5T X;  2M1H A;  2KT8 A;  3PVL A;  4AFU C;  1HJD A;  3EH2 A;  3BE3 A;  3H0I A;  1GL5 A;  1G83 A;  3SWN B;  2KI7 A;  2CZ0 B;  1NEB A;  1BKB A;  3HSB A;  2ZPI B;  4LDX A;  1Y7X A;  1VYU A;  1SG5 A;  2DL4 A;  3RKY A;  3VUZ A;  3WVD B;  5HCK A;  3UF4 A;  4IKF A;  1YJW T;  4M7A A;  1VQ9 T;  2JS0 A;  1AEY A;  3JCM g;  4GY5 A;  1WHJ A;  4RTU A;  1W4S A;  2DD4 A;  4MML A;  4M7D G;  1NM7 A;  2FRY A;  2KRS A;  4GBQ A;  2E6Z A;  1VQO Q;  5HK3 A;  2QA4 A;  2FRW A;  1YIJ Q;  5GAO m;  3I56 T;  1YI2 A;  2HCK A;  1LCK A;  2YT6 A;  1RAE B;  3JCM d;  3JV3 A;  2RB6 A;  3VU3 C;  3QBY A;  3CCV T;  1RAA B;  2JW4 A;  4DQ2 A;  5J39 A;  3VJP A;  1QKX A;  1KQS A;  4O5V A;  2BUD A;  3G6E T;  4HVV A;  2E3I A;  3OYH A;  2RD1 A;  3OYK A;  3TQ7 P;  2DL7 A;  1C1A A;  3P8B B;  5L23 A;  4NS5 A;  3QWY A;  2O4X A;  5GAO q;  1HYO A;  1M1F A;  2EJF A;  1QQJ A;  1VIF A;  2L3Q A;  3TSZ A;  2CP6 A;  2J7I A;  4BY6 C;  4KH0 B;  4FW1 A;  1BIA A;  1SRL A;  5I2S A;  2LJ1 A;  3SHW A;  3CC4 Q;  5GMK j;  4IUP A;  3JCM V;  4QKU A;  2PQW A;  5KYN A;  2MCN A;  1OPK A;  1KC8 C;  1YN8 A;  2O01 E;  1KJW A;  2RMO A;  2CH4 W;  1AWW A;  2PZ1 A;  3MJX A;  5GMK h;  4KT0 E;  4Y28 E;  4AFQ C;  1X43 A;  3CCR A;  1KQS S;  3RBB B;  4RMO A;  1MNE A;  3CD6 T;  4F7U F;  2DA9 A;  3JB9 H;  4FM4 B;  1NYG A;  1M2V A;  4XTX A;  1M90 C;  1U1S A;  1O9S A;  3ULR B;  3E9F A;  4ZTF A;  1VQO A;  4XU2 A;  1AZE A;  3X24 B;  1YBY A;  1K9M R;  1YIJ A;  1Q81 C;  2LNH B;  2LQN A;  4LUD A;  2EYY A;  1OX8 A;  4M78 A;  1T3S A;  2ZZD A;  3RR6 A;  2XID A;  1BK2 A;  1Q86 C;  1HXD A;  3PIP A;  3EHQ A;  1IHV A;  2VV5 A;  1W2B P;  3UT1 A;  1UJ0 A;  4C8Q C;  3JB9 J;  4AFZ C;  1ZSZ C;  4ANJ A;  2L3P A;  4HXJ A;  2VWF A;  3PMI A;  1KK7 A;  2K5I A;  4KGZ B;  1G8X A;  2KY9 A;  1YJ9 T;  1MMA A;  4KGV B;  3REB B;  3L2U A;  1G3Y A;  3J7A F;  1NJI R;  4EMG A;  4IUR A;  2AKL A;  3QHS A;  2P4R A;  2DTI A;  4JDS A;  1JQQ A;  2FPD A;  2HL5 C;  4FYV B;  4GLK A;  2DBM A;  4HT8 A;  3JB9 G;  4PJO G;  2O9V A;  3ZEH A;  1WNL A;  2YRV A;  4KUI A;  2EW3 A;  3P8H A;  3MHX A;  3CCS Q;  5CCA A;  2CP2 A;  3QDF A;  3SWN A;  5CKB A;  3CC2 T;  2K5F A;  1D0X A;  1RAC B;  2EVR A;  1UGS B;  3M0T A;  2RQT A;  2RO0 A;  4PJN A;  2LCS A;  5IXF A;  3ME9 A;  1T3L A;  1TG0 A;  3CEY A;  1OPL A;  2GQV A;  4A4H A;  4DOV A;  3A8M B;  2BE9 B;  4HCC A;  5HKC A;  3GNF B;  5GAO n;  3CPW P;  1OUL A;  1AHJ B;  1G5V A;  2EKO A;  1U06 A;  2QDY B;  1RI9 A;  2FB7 A;  2KMT A;  3EGD B;  4C8Q D;  2DZ9 A;  4DBR A;  3FIF A;  1MMG A;  5DLO A;  1I1J A;  3M4Y A;  4C92 F;  3FJP A;  2J05 A;  2PVG B;  5LJ3 j;  1Q7Y C;  2JMA A;  4OGE A;  2GFU A;  1CKA A;  4PNO A;  1IRE B;  2LRQ A;  2RHY A;  1GCQ A;  1UGR B;  3M0R A;  5KYW B;  1QMC A;  4OB0 B;  2DVE A;  4MZP A;  4PJM A;  5GAN g;  2CP3 A;  3OMG A;  5IHI A;  3NTK A;  1BI2 A;  2KGT A;  4X34 A;  2QXF A;  2LX7 A;  2EYQ A;  3QII A;  4JJC A;  4EPC A;  2DD5 A;  4LNP A;  2D1X A;  1XNI A;  2EQU A;  1S72 Q;  1Z9Z A;  2K2V A;  2X4Y A;  1R8O B;  2JS2 A;  2IIM A;  3CCS A;  4M77 E;  5CR2 A;  1Y07 A;  2X4X A;  2FYK A;  4ZGD B;  1N8R U;  2LQK A;  1YIJ T;  4AFS C;  5KH6 A;  2X35 A;  2DYB A;  2EQI A;  1S1N A;  3QZ5 B;  1H8K A;  1N27 A;  2GCX A;  3TEE A;  3G4S Q;  4FYX B;  4HKE A;  3H0F A;  3QJ6 A;  3NFC A;  4EMH A;  1KD1 R;  3EFS A;  5EG2 A;  5KCO A;  1X2Q A;  2VXF A;  1H3H A;  1M3A A;  3QG1 A;  3CCL Q;  1SHG A;  2HSP A;  1FWZ A;  1BB9 A;  1BCM A;  1Z9Q A;  2DO3 A;  1IB8 A;  2DF6 A;  4A4G A;  1VQ6 T;  2RQW A;  4XK8 E;  3QXE B;  2OTJ A;  1WA7 A;  5LJ3 f;  2XI9 A;  1TOV A;  3EAE A;  3CC4 T;  1JXO A;  1MMD A;  2F2W A;  4FU6 A;  3LGL A;  2NUP B;  1VQM A;  2RNA A;  4C8Q F;  1JU5 C;  2RA2 A;  5L8R E;  4BY6 B;  2WSC E;  5LJ5 j;  2V8I A;  3CCM T;  1KIK A;  1GCP A;  1ACM B;  2A37 A;  2WAC A;  3NHN A;  2EYX A;  2QI2 A;  3ZFJ A;  1YIT Q;  1M3B A;  4F04 B;  3ER0 A;  5LJ5 h;  1K0X A;  4PK4 A;  4XAX B;  2VYT A;  4Z89 A;  3V7R A;  1D09 B;  1RAI B;  3SFM A;  2EFI A;  2W0Z A;  4JJD A;  2R5A A;  1SEM A;  4MDW A;  2CGH A;  4F7U A;  2LCL A;  2VC8 A;  2OI3 A;  2IVW A;  3G4S A;  1GRI A;  2MK5 A;  3LYI A;  3C0C A;  2OTL Q;  2LJ0 A;  1TSF A;  1IGQ A;  2RM4 A;  2ZPG B;  1BCO A;  1M8V A;  2VVK A;  2VUB A;  3VS0 A;  2JVV A;  2MMP A;  1GBR A;  2PU9 B;  4M75 E;  5LJ3 e;  1IZ6 A;  4BI3 A;  5GAM j;  4J6W A;  4D6W A;  2O2O A;  2P0P A;  3PFS A;  3PNW C;  4C8Q B;  5IXB A;  3EGD A;  4R56 A;  1WIE A;  4E6R A;  1ZSZ B;  3GLX A;  1O75 A;  1M4Z A;  1QVP A;  3BY7 A;  3JAM E;  3RDV A;  2DPP B;  3JCM h;  3CCS T;  4PJO C;  3CPW A;  1WX6 A;  5GAM h;  2PVD B;  2ZPH B;  5FWC A;  1KQS P;  1QWF A;  4LN2 A;  3V8K A;  1K73 C;  3J81 E; 
#chains in the Genus database with same CATH homology
 3UAT A;  2OAW A;  1HJD A;  2KT8 A;  3PVL A;  4AFU C;  2CRE A;  4KRT A;  1T0J A;  1X2K A;  4J9F A;  3H0I A;  1GL5 A;  1G83 A;  5EC7 A;  4JPB W;  1NEB A;  2GTJ A;  2NUZ A;  2CT4 A;  1HSQ A;  1K0S A;  4F16 A;  1SSH A;  1K9A A;  1TUD A;  1VYU A;  1GFC A;  2DL4 A;  2B86 A;  1GFD A;  2ESW A;  2DLP A;  3IQL A;  2LQW A;  2LJ3 A;  1YCS B;  3I5S A;  3TSW A;  5GJW B;  1K76 A;  5HCK A;  1ABQ A;  3UF4 A;  1X69 A;  4JJB A;  2MIO A;  1UUE A;  2C0I A;  1OV3 A;  3EHR A;  4CC2 A;  4Y92 A;  3THK A;  2JS0 A;  1AEY A;  2ROT A;  1UE9 A;  4RTU A;  2SEM A;  1VYT A;  3A98 A;  2AK5 A;  2ENM A;  3LH5 A;  1NM7 A;  2FRY A;  2KRS A;  3M0P A;  4GBQ A;  2A36 A;  4AG1 C;  4DEX A;  2DL5 A;  2FO0 A;  3H0H A;  1QLY A;  4OMN A;  1MV3 A;  2FRW A;  2RQR A;  3NGP A;  1E6G A;  2JMC A;  1WXU A;  1WFW A;  2K3B A;  2KRM A;  2LZ6 B;  4IIM A;  2C0T A;  2HCK A;  4OMQ A;  2E5K A;  1LCK A;  4WCI A;  2YT6 A;  4OMM A;  3TVT A;  1NG2 A;  2CDT A;  2DE0 X;  3JV3 A;  4HVU A;  2OJ2 A;  2JW4 A;  1X6G A;  1I07 A;  1M3C A;  2DJQ A;  1H92 A;  2MOX A;  1ABO A;  4RTW A;  1UFF A;  4RTV A;  1QKX A;  2EGA A;  2KYM A;  1K1Z A;  2KRO A;  4HCK A;  4HVV A;  3VS4 A;  4D8D A;  2J6F A;  2KXC A;  2YUN A;  1KFZ A;  2EBP A;  3R6N A;  2DNU A;  2K7A A;  5L23 A;  2DL7 A;  2G6F X;  4CC3 A;  1G2B A;  3QWY A;  1ZX6 A;  4LUE A;  2KYB A;  4RTZ A;  2ED1 A;  2KT1 A;  2KBT A;  2L3Q A;  3TSZ A;  2J7I A;  4IIO A;  1FMK A;  2PNI A;  1SRL A;  1HD3 A;  2LJ1 A;  1GCQ C;  3SHW A;  1ZBJ A;  1UTI A;  2M51 A;  4GLM A;  1NYF A;  1MUZ A;  1A0N B;  1Y0M A;  2MCN A;  1OPK A;  3KFV A;  1YN8 A;  2ED0 A;  1AWX A;  2CUB A;  4QT7 A;  1KJW A;  2RMO A;  2CH4 W;  1AWW A;  2CSQ A;  1CKB A;  2DL8 A;  2PZ1 A;  2DL3 A;  2GGR A;  1U5S A;  2VKN A;  3VS3 A;  2I0N A;  4FSS A;  1NLO C;  4AFQ C;  1X43 A;  3VRY A;  3RBB B;  5FWB A;  2DA9 A;  1YNZ A;  1NYG A;  2DMO A;  2HBW A;  1AWO A;  1UJY A;  3ULR B;  2J6K A;  5ECA A;  1AZE A;  4ESR A;  1RLQ C;  4J9H A;  1I0C A;  2LNH B;  2LQN A;  1BBZ A;  1QKW A;  2EYY A;  4LUD A;  1JEG A;  1T3S A;  1AOJ A;  2A08 A;  1B3Q A;  1BK2 A;  2H8H A;  3EHQ A;  1J3T A;  1XOV A;  1PKS A;  1W70 A;  1ZLM A;  1M8M A;  4RTY A;  1UJ0 A;  4J9I A;  2JM9 A;  4AFZ C;  2D8J A;  1YP5 A;  1SHF A;  2K79 A;  2L3P A;  3I9Q A;  4HXJ A;  2VWF A;  2EYZ A;  1NLP C;  1UHF A;  4Z88 A;  3REB B;  2L0A A;  3FJ5 A;  3U23 A;  2AKL A;  2P4R A;  3EG2 A;  1JQQ A;  2FPD A;  3M0U A;  2DBM A;  2O9V A;  1OOT A;  2EW3 A;  2RQU A;  4OML A;  4J9G A;  4F17 A;  2FEI A;  2GNC A;  2CSI A;  2EVR A;  1M27 C;  3REA B;  1PKT A;  3M0T A;  2RQT A;  2LCS A;  4K11 A;  2AZS A;  5IXF A;  1T3L A;  1TG0 A;  3PVQ A;  1OPL A;  1X27 A;  1V1C A;  1WXT A;  2LMJ A;  1PWT A;  2M0Y A;  1W6X A;  4HVW A;  4OMO A;  2D8H A;  4Z8A A;  3SEM A;  1U06 A;  4J9D A;  2RN8 A;  4EIK A;  1RI9 A;  1ZUU A;  4A63 B;  1FYN A;  4X1V A;  4OMP A;  1N5Z A;  1WLP B;  3GBQ A;  5IHK A;  1ARK A;  1U3O A;  2BZY A;  2EGC A;  1I1J A;  2FG0 A;  2J05 A;  1K4U S;  3VS2 A;  2JMA A;  1W1F A;  2EKH A;  3I35 A;  2JM8 A;  1CKA A;  3EG0 A;  5I22 A;  2KEA A;  3QWX X;  2KE9 A;  1KSW A;  1CSK A;  5I11 A;  1GCQ A;  3M0R A;  2YUP A;  2KRN A;  4F14 A;  4JZ3 A;  1IO6 A;  4CC7 A;  1JO8 A;  2C0O A;  5IHI A;  3VRZ A;  2CH4 A;  2KGT A;  1UGV A;  1BU1 A;  2YSQ A;  2W10 A;  2K6D A;  1QCF A;  2K2M A;  2LX7 A;  4JJC A;  2YDL A;  4LNP A;  5GJV B;  2RF0 A;  2D1X A;  1UHC A;  4RTT A;  4LE9 A;  2GBQ A;  2X3X D;  1Z9Z A;  2EYW A;  2A28 A;  2JS2 A;  2LP5 A;  2IIM A;  2L2P A;  2F2V A;  2EGE A;  2JT4 A;  4RUG A;  2L3S A;  3O5Z A;  4AFS C;  1EFN A;  3ZL7 C;  2DRM A;  1WYX A;  2QDL A;  1JXM A;  2DYB A;  2EQI A;  1S1N A;  1YWO A;  1H8K A;  2ROL A;  1AZG B;  1VA7 A;  1WI7 A;  1WXB A;  2O9S A;  1PNJ A;  4ZNX A;  2KXD A;  1UEC A;  2RPN A;  4RTX A;  3H0F A;  2GTO A;  2CT3 A;  2DVJ A;  1OEB A;  1X2Q A;  1H3H A;  1M3A A;  2DBK A;  1SHG A;  3NPF A;  2HSP A;  2JXB A;  2KNB B;  1BB9 A;  4ORZ A;  1Z9Q A;  2DF6 A;  2D0N A;  2XMF A;  1ZUY A;  3H41 A;  2RQW A;  2HEQ A;  2PTK A;  2YUQ A;  1WA7 A;  2F2X A;  2O31 A;  1RUW A;  1E6H A;  2FPF A;  3RNJ A;  1JXO A;  2HDA A;  2F2W A;  2AKK A;  2X3W D;  1YWP A;  2J6O A;  2RNA A;  2RQV A;  1JU5 C;  4M4Z A;  2YUO A;  4AG2 C;  3M0Q A;  2AZV A;  3EG3 A;  1SRM A;  1RLP C;  1KIK A;  1GCP A;  1X6B A;  2ECZ A;  3VS7 A;  1AWJ A;  2A37 A;  3NHN A;  5IH2 A;  1AD5 A;  2EYX A;  2K9G A;  2J06 A;  1B07 A;  2EPD A;  3PE0 A;  1M3B A;  2CUD A;  2JTE A;  1K0X A;  3NMZ C;  1WDX A;  3UA6 A;  2O88 A;  2FPE A;  2SRC A;  2KR3 A;  4Z89 A;  3M0S A;  3UA7 A;  3VS6 A;  1TUC A;  1ZSG A;  1VYV A;  2BZX A;  2GQI A;  4JJD A;  2W0Z A;  1SEM A;  3EGU A;  1UG1 A;  4J9C A;  2BTT A;  1NEG A;  1E7O A;  5IHN A;  2BZ8 A;  4JZ4 A;  2V1Q A;  1M30 A;  2OI3 A;  4CC4 B;  1GRI A;  1T0H A;  2NWM A;  3C0C A;  3VS5 A;  1UDL A;  1ZUK A;  4D8K A;  5FW9 A;  1PHT A;  1SPK A;  2LJ0 A;  1GBQ A;  2ABL A;  3CQT A;  2VVK A;  3VS0 A;  4J9B A;  3VS1 A;  2DM1 A;  1PRL C;  1GBR A;  1AVZ C;  1PRM C;  3EG1 A;  2O2O A;  2DRK A;  4DEY A;  5IXB A;  1WIE A;  4E6R A;  2DX1 A;  4R0K A;  2V1R A;  1Y57 A;  4J9E A;  3I5R A;  2DIL A;  1WX6 A;  1QWE A;  5FWC A;  1MV0 B;  1QWF A;  4LN2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...