1WX7A

Solution structure of the n-terminal ubiquitin-like domain in the human ubiquilin 3 (ubqln3)
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
106
structure length
106
Chain Sequence
GSSGSSGSPAPVQDPHLIKVTVKTPKDKEDFSVTDTCTIQQLKEEISQRFKAHPDQLVLIFAGKILKDPDSLAQCGVRDGLTVHLVIKRQHRAMGNECPASGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution Structure of the N-terminal Ubiquitin-like Domain in the Human Ubiquilin 3 (UBQLN3)
rcsb
molecule keywords Ubiquilin 3
molecule tags Structural genomics, unknown function
source organism Homo sapiens
total genus 13
structure length 106
sequence length 106
ec nomenclature
pdb deposition date 2005-01-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00240 ubiquitin Ubiquitin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 1wx7A01
3R7RA 4IG7B 2EKEC 1Q1OA 4EFOA 2N7DA 3TBLD 2ZNVB 5LXHA 3KW5B 4M0WB 3U7DA 2G3QB 4IM2A 1GJZA 4TKNA 3M63B 4I6LB 4HWIB 5C23A 4BFRA 2N9XA 3QAQA 3ZNZB 2PE9A 2L8JA 3OJ3A 4ASWC 1V80A 1V5TA 5DPTA 4BKSD 1E8WA 2K8CA 3QK0A 4GU2A 4FADA 4I6PA 3UGBB 2O6VD 1C3TA 2D07B 2KJHB 2N1WA 4BOZB 4NY0A 2V4LA 4EUTA 4PYZA 1SGHA 1E7VA 1XT9B 2BKRB 3K9OB 2FCSA 1M94A 4M8MA 3JYUA 3KUDB 3QIJA 4JGHB 1V9JA 2KDFB 4X57B 5CX3A 4AJWA 1JRUA 2L0TA 3NHEB 2FCQA 3ZRCA 3ZTDA 2KWUB 2M1MA 4DDGD 4EKUA 2O6VB 2NBVB 3QQ8B 4XC2A 1E8ZA 3CF6E 2MLBA 1WZ3A 2LVQA 2NCNA 5E6PA 2KN5A 4HPMB 1IPGA 1WY8A 4ZRIA 1WXMA 2K25A 2PPHA 1GC6A 3UIOB 2C5LC 4MJSA 3RZFA 3T8MA 4PS3A 2LD9A 2KJ6A 3AULA 1EF5A 2MCNB 2L3ZA 1Z5SB 4P7IA 3DVNU 4HPLB 2M0XA 3AI5A 1WXAA 2YLMA 3RUIB 1WJUA 2HE7A 4E3CA 3X0WA 3QWZB 4W9EA 4MGIE 4FBJB 3PPAA 2RD0A 2K8BA 4W9DA 1E5WA 3WAPA 1UGMA 5JHAA 1KJTA 1K8RB 1P9DU 1YQBA 3DBLI 4MM3A 2KWCA 1BT0A 3KUCB 1OEYA 2BWFA 4ICUA 2BGFA 3AU5A 2WYQA 5J17A 1GUAB 4W9LA 3QX1A 4IM0A 2LVOA 5JH5C 1S1QB 4IWPA 2JXXA 2Z0DB 4ICVA 3R3MA 4B95A 2JY6A 4AUQC 4B6WA 2MBBB 5JZEB 5LLIA 3D32A 2JZZA 4ZRKA 3ZNHB 3APDA 1Y8RC 3H7SA 4JLCA 1HE8A 3ZDTA 2ZPNA 4WWPA 4EZJA 1KOTA 4FJYA 1LM8B 3B0AA 4WJNA 2ZVOA 2UYZB 4KZ0A 3KUZA 3GZNI 2IO0B 2LGXA 4TQ0A 3ECIA 3I3TB 4GDLA 3WIMA 4MJSB 1S3SG 1V2YA 2RR9A 5G2NA 1V86A 3IHPC 1Z2MA 3KH0A 1Q0WB 1LXDA 2JVCA 2KDEB 2MBEA 3VUWA 4GMVA 4HDOA 1WJNA 1P1AA 4RM8A 3ZDMC 3EECA 3HK0A 2ZNVC 3UQBA 3ALBA 3A9JA 4HDQA 1AARA 2I1KA 3QC8B 2NBWB 3Q3FA 1IP9A 2KX0A 4XX5A 2BYVE 2NBUA 4BKTA 5BO4B 3GOEA 3WAMA 4JL9A 1V6EA 4M8NA 3A9KA 1SE9A 1PQSA 4NJ7A 2J0KA 3OJ4B 3DVGX 3MHSD 2CR5A 4EZLA 1J8CA 1MG8A 1RLFA 1UBIA 3ZUNA 3RD2A 3V6CB 3IG3A 1WYWB 2FAZA 2G4SA 3RZWC 4ANUA 3APCA 4DBGA 3DBHI 4HXDA 2JF5A 2O2VA 4K81A 1V81A 3VTWA 3W1YA 2KNBA 5L95C 2LZ6A 2FIDA 3PLUA 5EDSA 4GDLB 4W9HA 4BKSA 1WIAA 4MH0E 1WX7A 2Y5BB 2MSED 3N3KB 2LUEA 2L05A 2C60A 2O6VA 2J7QB 5FR6A 2DX5B 3H9DA 1WRDB 5KHOA 4E71A 3PRMB 3ZTCA 3DOWA 2LGYA 3M3JA 3O65B 4BVUC 1V5OA 2WWZA 2IO2B 3A9JB 1ZKHA 3NZSA 2KQ7A 3S2AA 3PSEB 2KTFA 1WX9A 2B3AA 1WXVA 2NVUI 5G55A 1E7UA 5IA7A 2ZJDA 2N1VA 2HJ8A 3A9KB 4OVUA 3BINA 4AWJA 2L0FA 1YIWA 2CS4A 4KDIC 5GMVA 4GB9A 4PS8A 2LASA 4ANVA 3K9PB 4EZKA 1TGZB 1UBQA 3AXCA 2O2VB 2G4DB 3CMMB 4FJZA 1YX5B 3A1QA 4MGKE 1GG3A 1WGHA 3ONSA 4KVGB 5CTRC 4HCPB 4WAAA 2N9EB 5JHBA 4BOSC 2KANA 1R4MI 2RGFA 3UINB 1WF9A 1YJ1A 2WX1A 1VD2A 2MA9B 3U8ZA 2C7HA 1EF1A 2DYBA 4ZDVA 2KOXA 1UELA 2BYFA 3HIZA 3X23A 4II3B 2DZKA 4ZYNA 4DWFA 3IVFA 3DVNV 1WJ4A 1LQBA 3L13A 3WANA 2GBMA 3RULA 1J19A 1ZW7A 2BPSA 2AL3A 2KJRA 4N9F4 1D3ZA 4DK5A 3IBEA 3WAOA 2G45B 2ZEQA 1I42A 1OGWA 2M4NA 1RFAA 3EHVA 3PREA 2KMAA 3CSFA 4TUUA 1T0YA 3PRPB 4KDLB 1TTNA 2KK8A 2XBBC 3L0WB 1V49A 3PGEA 5D94A 3VH3B 1J0GA 3A1QB 2Z0EB 3VDZA 4BBNF 4LJPB 4PYUA 1YX6B 5IAAC 3L17A 2M8SA 4WJQA 2KLCA 5AZFA 3VAWA 3PHWB 3M62B 4ZRJA 2AYOB 2MBOA 2A5UA 3ZIMA 1A5RA 2FIFA 4URKA 2D2QA 5J2RA 3VVWB 2FUHB 4ANXA 2RSUA 3PVLA 3VQIA 3KYDD 3H6NA 3PLVA 3PZDA 2AWTA 3TL5A 2YVCA 1E8YA 2OOBB 2KFKA 1Q5WB 5D7GA 5CHWA 1QZEA 2LRWA 3JVZX 2L7RA 4HLEA 1RRBA 1UD7A 4GGQA 2MBHA 1P3QU 3M95A 2RPQA 3QA8A 2ZZPB 2DZJA 1WGGA 3HM3A 3Q3JA 1KM7A 1TBEA 2DAFA 3JW0X 1H8CA 1WGRA 2KDIA 4DHZE 4IM3A 2IBIB 4K1RB 3ZLZA 2NR2A 1G6JA 1XQQA 1F9JA 2BF8B 4NJ6A 2DZMA 3ZKJC 5KHQA 2LXAA 2LGDA 2C7NB 3QARA 1UH6A 1TZ1A 2KMCA 3LJ3A 4KIKA 4HVBA 2V3SA 4A20A 1WXSA 3TCAA 2OJRA 1RAXA 2KFJA 2M17A 4G11A 2K6QA 3DBRI 4HJKA 4W9KA 3DVGY 3P2BA 2CU1A 5CHFA 5D6JB 4I6NB 4II2B 4W9GA 3PTFC 2FNJB 3L10B 2QHOA 2L76A 3L08A 2CHXA 4RMAA 4W9JA 5D2MB 2PJHA 2L00B 4TQ1A 3WALA 4CO7A 4FHJA 3U30A 2KFKB 2NPTA 2DZIA 4LJOB 3PT2B 4RM9A 3MJWA 4W9IA 3SDLC 2ZPYA 3PS6A 1WMHA 3ZNGC 4CHKA 4GIVA 2XK5A 1E8XA 1EO6A 2KHWB 2KWVB 4NNJB 1UZXB 2K1FA 4IC7B 2DHZA 2KD0A 1WJ6A 3ML8A 4GN1A 4WWNA 3ZW3A 1XD3B 1GC7A 2JRIB 4B9KA 1GNUA 1OQYA 2LWPA 3UIPB 3B1LX 2WX0A 4EEWA 2KKCA 3IFWB 4MGYE 1WE6A 3B08A 2N4FA 4K7WA 3ZRFA 2LJ5A 3TIXA 3AU4A 4KIKB 2MRPA 4LCDE 3SU8X 1WI0A 2VRRB 4FA6A 4E74A 2BKFA 4FN2A 2KVRA 2R2QA 3MTNB 5CHVC 4MELA 2IO3B 4MSQB 2EMTA 2MP2A 4J6IA 2A4ZA 2AEHA 2AL6A 4GXBA 2IY0B 4CYEA 2ZCCA 2NPTB 3SHQA 2GBNA 3R66C 2EMSA 4KSKC 3DQVA 3SD5A 3VXWA 1WMHB 3VTUA 2D3GA 1FXTB 2C7MB 3C0RB 2XK5B 3PHXB 2KX3A 4AJYB 4BKGA 4FLHA 4OVVA 4F7ZA 4IUMB 2GBJA 2GBKA 3PRZA 4GDKA 4HK2A 4A3OA 5LXIB 2HTHA 3H7PA 2D10A 3LDZE 2XEWA 5DPWA 1WX8A 2KTRA 2CHZA 1OTRB 4NPNA 2J0JA 4AOFA 2MQJA 4F8CB 1L7YA 3KYCD 3W1SC 4TV3A 5E6NA 3W1SA 4WJPA 4EOYA 3QHTA 3JSVA 2BWES 3OAWA 3HM6X 5DCNA 2MX2A 2Z59B 2K6DB 3KVFB 1YD8U 3VH4B 4DHJD 2I1JA 2ZVNA 1I35A 3L54A 4NAWA 1CMXB 3OLMD 4G50A 5AZGA 3V61A 4IW0A 4WJOA 1NBFC 2MP2B 2K8HA 1NI2A 4W9FA 2NS5A 4XZ4A 4LDTD 3DBSA 1ISNA 3ML9A 4FULA 3BY4B 3VUXA 4MGZE 4G3XB 2IZVB 2DYMA 4G0NB 3L16A 2JPHA 3CSTA 3NS8A 4DHJB 2LXCA 2MWSB 1VCBA 2WDTB 5AEKB 4GDKB 4YL8A 3ZVVA 2IY1B 3QCAA 2DYOA 2GOWA 3H7PB 3QJZA 1KLVA 1SIFA 1WGDA 3DCGA 3DPDA 2KTRB 4LDTB 4WWOA 4HCNB 1LFDA 3TJPA 4K7UA 4IWQA 2W9NA 2KQSA 4GSWA 4NQLB 3UF8A 2GBRA 2IO1B 4NQKE 1X1MA 2N7EA 5C1ZA 1P0RA 1H4RA 3JSVB 2V1YA 1E90A 2GMIC 3NOBA 3NY5A 4W9CA 2IYDB 4PS7A 2DAJA 3NZUA 3A33B 3N32A 5L83A 1C1YB 4NAWB 3A4SC 2KZRA 4FHKA 2JUOA 2BYEA 4DDID 3UQAA 3PV1A 4AP4C 5HKHA 3N30A 2LI5A 3ENEA 4A3PA 2JT4B 3VFKA 4JIOU 5AZHA 2CKHB 1WH3A 3H1UA 1OEYJ 1R4NI 2J0MA 4GOCA 4WQOB 1NDDA 1WE7A 4IWOA 3RT3B 4F1SA 1WZ0A 2KC2A 5TR5A 1WR6E 4KZCA 1EUVB 1P98A 4MSMB 2JRHA 2KLGA 3R7QA 1U4AA 2MBQA 2PE6B 2UWQA 4BBNC 2PEAA 3TMPB 3VTVA 1WGYA 2KO3A 3V6EB 3APFA 3EFUA 3ZNID 4ANWA 2ZCBA 5DPSA 2R2OA 3EC8A 3VHTC 1WM2A 2FCNA 3HHMA 4DXAB 1L2NA 2JZ3B 2FCMA 2CHWA 2REXA 3DDCB 2DENB 2ASQA 2N9PC 2HD5B 2LRUA 3V62A 2KC1A 1WM3A 2KXJA 4KSLC 1ZGUB 2D11A 2KDBA 2K39A 5E6OA 3V60A 3RCZA 3RYTA 4FJVB 2JWZA 4JQWC 3VUYA 1IYFA 5DPRA 5J18A 1WR1A 1WFYA 3T9LA 4DHZB 4KV2A 2MW5A 2LVPA 4MEMA 2C9WB 4K7SA 3WA0A 3ZO5B 3A4RA 4MDKE
chains in the Genus database with same CATH superfamily
4IG7B 1Q1OA 3AV8A 2ZNVB 4RGOS 1XO3A 3M63B 1SEBD 4HWIB 4BAXA 4ASWC 4OVZA 2PE9A 5DPTA 4MH8A 1E8WA 2K8CA 4GU2A 4FADA 2O6VD 4EUTA 4BOZB 1SGHA 2BKRB 1QOAA 4M8MA 3QIJA 2IGGA 1JRUA 2FCQA 4TSSA 2M1MA 4DDGD 3I63C 2K0PA 3QQ8B 1LGRA 1E8ZA 4IDIA 2MLBA 1TT5B 1KTKA 4HPMB 1WY8A 2EKIA 2K25A 3AEFB 1GC6A 3B9JA 4MJSA 4PS3A 2LD9A 1C4AA 2WDRB 3DVNU 1WXAA 1L4ZB 4MGIE 2RD0A 2V9HA 1UGMA 1YQBA 3DBLI 2KWCA 2JZPA 1OEYA 1F77A 4ICUA 2WYQA 2Y5PA 4ITKA 1WXQA 1S1QB 2MEKA 3R3MA 2BQQA 5LLIA 3APDA 3H7SA 3ZDTA 4WWPA 4L1BA 4WJNA 1YNTE 2UYZB 3EFCA 2JX5A 3FKYA 4RF1A 2IO0B 3RMKC 3WIMA 1L6VA 1FPYA 3IHPC 3VUWA 4WAFA 1QKZA 3EECA 2ZNVC 3FILB 3W5VB 4HDQA 1AARA 2I1KA 4MM3B 2LJIA 2M19A 2NBWB 1V8CA 4XX5A 4BKTA 5BO4B 4JL9A 3A9KA 4EZLA 3AMZA 3DVGX 3MHSD 1DGJA 5T8IA 3V6CB 2FAZA 2G4SA 4ANUA 2JF5A 2O2VA 2M0AA 2FIDA 2KDMA 1WIAA 2Y5BB 2MSED 2C60A 2WHIA 3H9DA 3BYTB 3BVMA 3M3JA 3H8HA 3AEBB 3NZSA 3S2AA 3PSEB 2X8XX 1WXVA 2NVUI 3R2TA 5G55A 3ZYYX 2HJ8A 4OVUA 2L0FA 4XYCA 1I4GA 2J52A 2PMVA 3C19A 4ZRPA 1PGXA 1XLQA 2LUMA 2H88B 3EUB2 2K5PA 4EZKA 4RCOA 3J9CA 1UBQA 3CMMB 4WAAA 2KANA 1R4MI 1M4VA 2WX1A 3U8ZA 2C7HA 2KOXA 3GZNB 2DZKA 4OZCA 3DVNV 2GBMA 2MJDA 1ZW7A 1MG4A 4DK5A 4A9AA 3EHVA 3PREA 1RFAA 2D5GA 1HQRD 1KLUD 3RI7C 2TSSA 3PRPB 4KDLB 2IJ0A 2GRIA 3VH3B 3A1QB 2W82A 4JE3B 2BW2A 1MHXA 3PHWB 3M62B 1D5ZC 3KWLA 3U52E 3GE8C 3VVWB 1JWBD 3OG5A 3TEWA 2V0GA 2KFKA 4K3BA 5D7GA 5IO9A 1IBXB 5CHWA 3AEAB 4LNKA 4HLEA 1D4BA 2MBHA 3FC4A 3QA8A 1P7FA 1IGDA 1WGGA 1VRAB 2L32A 1H8CA 3RN9C 1YOVB 1XEEA 2IBIB 2NTSA 1VJKA 4NJ6A 2DZMA 5D3IB 3ZKJC 2LGDA 1UH6A 1FRRA 2V3SA 3TCAA 2OJRA 4W9KA 4G11A 2CU1A 3P63A 4W9GA 2RDBC 1QOBA 4W9JA 3WALA 5C2TB 3U30A 2NPTA 3AH7A 4RM9A 4W9IA 2ZPYA 3PS6A 1UF0A 4CHKA 4NNJB 4IC7B 2JSVX 3GS2A 3DWGC 4KX6B 4ZYSA 1OQYA 2LWPA 1L0YB 2WX0A 1FFVA 1IGCA 3IFWB 3B08A 2RPVA 4KIKB 2QCZA 1SIJA 4E74A 4S0RA 5CHVC 2R2QA 1PUTA 4MSQB 1QOFA 2A4ZA 5LNK1 3BVGA 4CYEA 1L6UA 1BUIC 2HTME 4KSKC 2KMMA 3SD5A 1FXTB 2C7MB 1FD6A 4BKGA 2XK5B 2KX3A 4IUMB 2YEPB 1JWSD 2D10A 2XEWA 1OTRB 4A6QA 2MQJA 1AWDA 1JCKB 4L23A 1T3QA 4TV3A 4WJPA 2BWES 3HM6X 5DCNA 2MX2A 3KVFB 1D5MC 2I1JA 3L54A 1CMXB 2NTTA 4IW0A 4WJOA 4LNNA 2K8HA 4W9FA 3DBSA 3GE3C 4FULA 3TUOA 4MGZE 2IZVB 3O13A 4G0NB 2KQ4X 5HFYA 3L16A 3NS8A 3I5JC 2MWSB 1VCBA 1I4RA 4GDKB 3ZVVA 3QJZA 1KLVA 3DPDA 1WGDA 1SXTA 2H89B 2J53A 1QOGA 2KQSA 2PKOA 4OZAA 3UF8A 4NQKE 3P4QB 2N7EA 2FBWB 1E90A 2KVZA 3A33B 4DXGA 5L83A 3DHGC 4FHKA 2W54A 4ARIA 3PV1A 4AP4C 2VZKB 5HKHA 3CIRB 3N30A 1N60A 1C76A 4HKZE 4JIOU 3H1UA 1WH3A 1OEYJ 5TR5A 2CJOA 2WXGA 3NUHB 2UWQA 2WS3B 1GPXA 2I2YA 3VTVA 2E3TA 2LMCA 3V6EB 4ANWA 2CJNA 1QILA 4WQMA 3VHTC 1D6EC 2FCMA 1TKEA 2VH2A 1PYWD 3Q8FA 1Y56A 3SR6A 1WM3A 2INPE 1IYFA 2IPKD 4FJVB 5H8YE 3T9LA 3BK2A 4HKQA 2W3RA 4MEMA 4OW0A 3ZO5B 3A4RA 3VR8B 2DWQA 1NI3A 4KGTA 4EFOA 1JQ4A 2N7DA 3KW5B 4M0WB 2G3QB 1ESFA 4TKNA 2J4XA 4YT0B 3NVZA 4BFRA 2N9XA 2L8JA 1V80A 4PT5A 4BKSD 2XN9C 2GLSA 1CJEA 2PTLA 2N1WA 2V3NA 4D2KA 4C7YA 5D3DA 1QF6A 2FCSA 2QIEB 1I4PA 3JYUA 2ON8A 3KUDB 4JGHB 2KDFB 4X57B 2L0TA 3I57A 3SFEB 3ZRCA 3VR9B 2O6VB 4EKUA 1PGBA 3CF6E 5I4DA 2MH7A 1ZDXA 3Q3NC 3Q8EA 3U4EG 2E6XA 2MCNB 2KJ6A 2L3ZA 1Z5SB 3RUIB 1JALA 3X0WA 1C77A 4W9DA 3WAPA 2RDHA 1KJTA 2QMTA 1P9DU 1V1PA 3GP7A 3AE1B 5JHAA 2BGFA 1GUAB 1P7EA 2LVOA 4IWPA 1CQVA 1YN3A 2JXXA 4ICVA 1C4CA 4B95A 2WDVB 4B6WA 1K51A 4RGTA 3D32A 2JZZA 1Y8RC 1KOTA 2WQYB 4EE2A 2ZVOA 3KUZA 3GZNI 1SJED 1YJJA 3Q14C 4TQ0A 3ECIA 3I3TB 4GDLA 4MJSB 1S3SG 5BYQA 2EELA 2JVCA 2KDEB 4XE0A 3NVYA 1GB1A 1WJNA 1L5PA 4XWWA 4R3DA 3SFDB 3UQBA 3HVZA 1VZ6A 3E9SA 1YMHE 2BYVE 2NBUA 3GOEA 3WAMA 1V6EA 1T5XD 1SE9A 2J0KA 1Q10A 3RZWC 1V1OA 1V81A 5L95C 4ZHPA 2AQ3B 1ET6A 1WX7A 4UDUC 2LUEA 2O6VA 3CWIA 4K3CA 2DX5B 3MJ5A 3PRMB 3DOWA 2JYEA 1JWUD 3O65B 5EE0A 3AEDB 4USAA 1V5OA 3W9CB 4DXFA 2KTFA 2D3CA 1E7UA 5IA7A 2ZJDA 2CU3A 3A9KB 4AWJA 1UWXA 3RNEC 5FKAC 4C7ZA 5GMVA 4GB9A 5AUKA 2LASA 4ANVA 3K9PB 3AXCA 2O2VB 2G4DB 4MGKE 1DOYA 1WGHA 3UI3A 2VH1A 5JHBA 2N9EB 1R7SA 3TEXA 1WF9A 2MA9B 2WXLA 3AEEB 2B76B 3IVFA 1WJ4A 1UGJA 1MI0A 3ZGZA 2KJRA 3IBEA 3WAOA 2G45B 1XF5L 2ZEQA 1OGWA 1E9MA 4TUUA 5E6JA 3NRZA 3PGEA 4HJGE 5G5GA 5D94A 3VDZA 4BBNF 4PYUA 1YX6B 3AECB 3BIID 1VLBA 4ZRJA 3DBHB 4REZA 3ZIMA 2GB1A 1A5RA 5J2RA 3AM9A 1YQ4B 1E10A 1E8YA 2OOBB 3Q8BA 1QZEA 3JVZX 4J3OD 4GGQA 1P3QU 3Q8AA 1JWMD 2DZJA 1TBEA 2WXMA 4DHZE 3ZJTA 1G6JA 1F1HA 1XQQA 4YXDB 1F9JA 1TS2A 5KHQA 3QARA 1TZ1A 1L4DB 3LJ3A 1RAXA 2KFJA 2WXFA 3P2BA 4I6NB 1ENFA 3PTFC 2QHOA 1NENB 4TQ1A 1FM0D 4YSZB 2KFKB 4ZRQA 3EGRA 1C79A 1ZOYB 4H2AA 1HXYD 2KN4A 2XNAC 2DHZA 3ML8A 1XD3B 2JRIB 3IXSA 3B1LX 3VRAB 1JWAD 3ZRFA 2INNE 2N4FA 3RNFC 2NMQA 2WXIA 2RDGA 2VRRB 4FA6A 1WGKA 4YTPB 2KVRA 2EMTA 2R61A 2ZCCA 2NPTB 3SHQA 3Q3OC 2GBNA 3R66C 5IOIA 3VTUA 3Q2AC 3ZQ4A 3L4PA 1J7CA 5GXGB 2GBJA 5LXIB 3H7PA 2QEJC 5DPWA 4JWUC 2N9LA 1OFFA 2WXJA 3T3OA 3U7ZA 4ZOHC 1J7BA 3KYCD 1NEKB 3QHTA 3VH4B 1I35A 4NAWA 5AZGA 3OLMD 1K50A 4XZ4A 4LDTD 3TSSA 3BY4B 2DYMA 3CSTA 5BMHA 3VRBB 4CQNA 1EU4A 1N61A 4YL8A 2IY1B 3QCAA 4XGAB 1SIFA 1FXIA 3AE4B 4HCNB 4WWOA 1K53A 4DQOC 1P0RA 1H4RA 2V1YA 2GMIC 3NOBA 1RWSA 3NY5A 2DAJA 2JUOA 2BYEA 1SJHD 1I4QA 1TZOA 2L52A 3ENEA 4A3PA 2JT4B 2KWDA 2J0MA 1FRDA 4GOCA 3Q6BA 1WZ0A 4YTNB 1WR6E 1EUVB 4MSMB 3ZXRA 2JRHA 2KLGA 5BMGA 3RPFC 4ZHOA 3TMPB 1WGYA 3URYA 3ZNID 2ZCBA 5DPSA 3EC8A 4NJCA 3HHMA 4DXAB 1L2NA 2JZ3B 2CHWA 2DENB 2ASQA 2HD5B 2LRUA 3TEYA 4KSLC 1ZGUB 2D11A 2KDBA 2PLPA 4KKJA 3V60A 3RCZA 4JQWC 1WFYA 4KV2A 4QAYA 2WXNA 4MDKE 3R7RA 4LNFA 3NVWA 3TBLD 1GJZA 4IM2A 3N1XC 4JX1C 3BWUD 4I6LB 3QAQA 3PZ8A 1WYGA 1DOIA 3UGBB 1C3TA 4MACA 4NY0A 2V4LA 1E7VA 3K9OB 1M94A 1XLNA 2QC8A 2KWUB 1TY2A 3KWVA 4HRSA 5BYRA 1VZ8A 1WWTA 5IN7A 2JXTA 3AE8B 1WZ3A 2J42A 2NCNA 2KN5A 3TEZA 1FEHA 2JWUA 2M56B 4ZRIA 1WXMA 2MJ3A 2C5LC 3N20C 3RZFA 3AULA 4HPLB 2M0XA 1HTOA 2YLMA 1WJUA 4E3CA 1ZDVA 3QWZB 4A8XC 4W9EA 2INDC 4FBJB 1E5WA 3KUCB 1FIQA 4WWMA 5FR3A 5J17A 3AE7B 1FO4A 1TKGA 2WXRA 1XLPA 5JZEB 2BYTA 1HE8A 4EZJA 1GOZA 2KT7A 2AX5A 1LM8B 2YEPF 1FXAA 1C9FA 1XXGA 1E6EB 5G2NA 1V2YA 2RR9A 1V86A 2WXHA 1MFWA 1Q0WB 2MBEA 1TYGB 1PFDA 1ZXIA 1E7PB 2WP9B 4P1BC 1P1AA 3ZDMC 4US9A 1V1PB 3A9JA 3AN1A 4XWTA 3B2FA 3P42A 5BYSA 4M8NA 3BK1A 1B1ZA 2FE8A 1PQSA 4NJ7A 2CR5A 4TMAB 3HRDD 2N0SB 4YWGG 3RD2A 3IG3A 4HPPA 3APCA 4DBGA 3DBHI 4HXDA 3VTWA 2D3BA 2KNBA 3PLUA 4GDLB 4BKSA 4US8A 3PO0A 2J7QB 2V3PA 5FR6A 5EE9A 1WRDB 2N9KA 5KHOA 4E71A 1YJIA 3ZTCA 2LGYA 3KLSX 2JYTA 3NVVA 1ZKHA 2KQ7A 3RNGC 1KRHA 4IKGA 1XLOA 1YIWA 2BS2B 4ACFA 2CS4A 2HDEA 2L83A 4PS8A 4FJZA 4RGMA 3ONSA 5CTRC 1HTQA 4HCPB 1YJ1A 1VD2A 2K22A 1KFYB 2DYBA 2GI9A 4ZDVA 3BYYB 2BYFA 3HIZA 4WIPA 3W2DA 5IP4D 1LQBA 3L13A 1J19A 2BPSA 4OZBA 1I42A 3AE6B 3WCQA 4RH6A 1NYQA 1TTNA 2KK8A 2XBBC 1J0GA 4GLSC 4LJPB 1ZP0B 3L17A 1XCTL 4WJQA 1D5XC 1JW9D 1SBBB 1VZ7A 4JPSA 2MBOA 2A5UA 4ARCA 2KYWA 4URKA 2FUHB 4ANXA 4C00A 2RSUA 4N58A 3AEGB 3PVLA 3VQIA 2I38A 3KYDD 3H6NA 3PZDA 3TL5A 2YVCA 5AUIA 4L2YA 2L7RA 2VZKD 1HEZE 2ZZPB 3HM3A 3Q3JA 3JW0X 2KDIA 3BZDB 1SSNA 2NR2A 4O1NA 2LXAA 1WXSA 2OHFA 2M17A 4HJKA 2K6QA 3DVGY 2D3AA 1DOXA 4II2B 2FNJB 4S17A 1JROA 2L76A 2CHXA 4RMAA 2PJHA 2L00B 3R8BA 1N5WA 1TS5A 3DWMA 3ZJUA 4LJOB 1C4PA 3SDLC 1HZ6A 3MJWA 1WMHA 1AW7A 1WSPA 1E8XA 1EO6A 2KHWB 3Q3MC 1ZUD2 4HROA 2RMMA 1UZXB 3R2IA 2ICIA 2KD0A 4WWNA 1GC7A 2G1EA 3N1YC 4B9KA 1GNUA 3UIPB 4M00A 4EEWA 3MC0B 4MGYE 1WE6A 4K7WA 2OJWA 2LJ5A 1BMLC 1L0VB 3AU4A 4LCDE 3TIXA 1WI0A 1KLGD 4YSXB 1FCCC 4FN2A 3MTNB 2LGIA 2MP2A 3B2GA 4J6IA 2AL6A 2SEBD 4A90A 2W55A 2EMSA 3DQVA 4LNOA 3Q8CA 3VXWA 2D3GA 1AYFA 1I7HA 3C0RB 4P16A 1FMAD 4F7ZA 4LTUA 3PRZA 1B9RA 4A3OA 2W3SA 3LDZE 1WX8A 2KTRA 2CHZA 3MFGA 2K9XA 4C4VA 2J0JA 1LO5D 4AOFA 3W1SC 5MPOA 2JU6X 2BB5A 5TSSA 1DYQA 3W1SA 3JSVA 4RNAA 2K6DB 1YD8U 4DHJD 4P6VF 2ZVNA 3V61A 5HG2A 2MJEA 1NBFC 4Q2JA 4N59A 2WU2B 1RYJA 3DBRB 1STEA 2JPHA 1QQRA 2DBYA 2DYOA 3H7PB 1VR9A 4LDTB 1N63A 1SF0A 1LFDA 3MP9A 2W9NA 4NQLB 2GBRA 2Z8LA 3N1ZC 5C1ZA 2LHDA 2ONQA 5C3JB 1JRPA 1KF6B 3RFZB 1C1YB 1EWCA 3A4SC 4NAWB 5EE1A 3DHHC 4DDID 2INCC 3W5UB 3NG0A 3P4SB 2CKHB 3U2SC 3ZXVA 4F1SA 4KZCA 3E56A 2WU5B 1U4AA 2PE6B 4BBNC 2PEAA 2KO3A 2PW9A 4YTMB 1A70A 1MVKA 5IKCM 1WM2A 5BMIA 1TS3A 1SE3A 2REXA 3DDCB 1CZPA 2N9PC 2K3UA 2LHEA 3IAM1 2QJLA 3AE5B 3V62A 2KC1A 1NYRA 2KXJA 3ZJVA 2K39A 3RYTA 2G9HD 2WXPA 3P1MA 5J18A 1WR1A 4DHZB 2MW5A 2LVPA 2OEDA 4NZLB 2C9WB 1YQ3B 3WA0A 1F52A 4C56C 2EKEC 1ACCA 4KKIA 5LXHA 3U7DA 2FUG1 5C23A 2HJ1A 3ZNZB 3OJ3A 1V5TA 3QK0A 4B0MA 3C8YA 4I6PA 2D07B 2KJHB 4PYZA 3EA6A 2IDYA 1XT9B 2PVOD 1EU3A 1V9JA 4AJWA 5CX3A 1F2RC 3NHEB 3FAHA 3ZTDA 1JMLA 3KQ4A 2NBVB 4MT5A 4XC2A 2LVQA 5E6PA 1IPGA 1KH0A 3PZ7A 2PPHA 3UIOB 3T8MA 1EF5A 4P7IA 3AI5A 3RNCC 3AE9B 2HE7A 1R4NB 3IT4B 2WGSA 3PPAA 2K8BA 1K8RB 3FILA 4NAMA 4MM3A 1BT0A 2BWFA 1FFUA 1T0QC 3AU5A 3P4RB 3RNAC 4W9LA 3QX1A 4IM0A 5JH5C 1ROEA 1J7AA 1CK1A 2Z0DB 2JY6A 4AUQC 2MBBB 3ZNHB 4ZRKA 2KACA 1RM6C 4JLCA 2ZPNA 4FJYA 2BT6A 3B0AA 2SAKA 4KZ0A 2AQ2B 2LGXA 4C80A 4XDDA 3KH0A 1Z2MA 3HVDA 1LXDA 4GMVA 4HDOA 1UNSA 4B0EA 4RM8A 3AE2B 3HK0A 1TKYA 3ALBA 1K52A 3QC8B 1TJEA 3Q3FA 1IP9A 2KX0A 2BS4B 1I4HA 1UWMA 1J8CA 4N6EB 1N6ZA 3OJ4B 3OWEB 1MG8A 1RLFA 1UBIA 3ZUNA 1WYWB 1OQRA 4K81A 1AN8A 3W1YA 2LZ6A 4JWSC 5EDSA 2DNFA 4W9HA 4MH0E 3N3KB 2L05A 3AB5A 4LNIA 5HHDG 1F0ZA 2ZW1A 3ETRA 4BVUC 5G5HA 2WWZA 1ZE3D 2IO2B 3A9JB 2IGDA 1WX9A 2B3AA 2WXOA 1UUPA 2N1VA 3BINA 1TY0A 4IOIE 4KDIC 2X38A 2QILA 3DBLB 2WXKA 1TGZB 3GB1A 1YX5B 3A1QA 1GG3A 2BS3B 4KVGB 2BVCA 4BOSC 2N7JA 2RGFA 3UINB 1MHHE 1EF1A 1UELA 3X23A 2IGHA 4II3B 4ZYNA 4DWFA 4PK1A 4RFBA 3WANA 3RULA 1SE4A 5JXVA 3LYYA 1D3ZA 2AL3A 2Q5WD 4N9F4 1IBXA 1SE2A 1T6BX 2M4NA 4YSYB 2BTEA 2KMAA 3CSFA 1T0YA 1T0SC 1XCQL 3L0WB 3NZ3A 1V49A 4P1CC 2Z0EB 3ABVB 5IAAC 1MPEA 2M8SA 2KLCA 5AZFA 4FXCA 3VAWA 2AYOB 3MC8A 2FIFA 1TIFA 2D2QA 1ET9A 1PGAA 3RNBC 4RGNA 3PLVA 3AE3B 2AWTA 1Q5WB 1ZPSA 2LRWA 1RRBA 1UD7A 1QLBB 1GB4A 3M95A 1I4XA 3SEBA 2RPQA 1KM7A 2DAFA 1WGRA 1EM7A 2L1AA 4IM3A 4K1RB 3ZLZA 2BF8B 2ZW0A 1VDVA 2C7NB 3IAS1 4OHJA 2KMCA 4KIKA 4HVBA 4A20A 3DBRI 5CHFA 5D6JB 3LXFA 3L10B 3L08A 1R4MB 5D2MB 4CO7A 1N5XA 4FHJA 5EE3A 3DHIC 3HUIA 1HZ5A 2DZIA 1T0RC 3PT2B 1F2RI 4XDCA 3ZNGC 2LFIA 4GIVA 1FNUA 2XK5A 2UU7A 2KWVB 3P4PB 3NJTA 2K1FA 3LB8C 2QDFA 1EWYC 1WJ6A 3ZW3A 4GN1A 5HI1A 2KKCA 2WNMA 3SU8X 2MRPA 1WRIA 1BXTA 2BKFA 4WURA 1N62A 4MELA 2IO3B 3T3NA 2AEHA 4GXBA 2LEKA 2IY0B 1V97A 4RF0A 1RFKA 2WLBA 1SB3C 1WMHB 3PHXB 4AJYB 4FLHA 4OVVA 4HEA1 4GDKA 2GBKA 4HK2A 1QT9A 2HTHA 4LLGM 1MJDA 4KGRA 3I9V1 4NPNA 1FCLA 4F8CB 1TS4A 2WXQA 1L7YA 4KGSA 4BZAA 1FNWA 3MHZA 5E6NA 2JQRB 4EOYA 3OAWA 4M01A 2Z59B 4A55A 4G50A 4WH4A 2WDQB 2MP2B 1NI2A 2NS5A 3ML9A 1ISNA 3VUXA 4G3XB 3MC9A 2MHJA 2BBCA 3BVZA 4DHJB 2LXCA 1GAQB 2WDTB 5AEKB 1FNVA 3Q69A 4LK0M 4M02A 3V05A 5H92C 2GOWA 3DCGA 2KTRB 2LGSA 3NS1A 4C4VB 3TJPA 2Y3AA 4K7UA 4AQ7A 2PIAA 2KAJA 4IWQA 4GSWA 2IO1B 1X1MA 1C78A 2DLBA 3JSVB 4W9CA 2IYDB 2PVGC 4PS7A 3NZUA 1YN5A 3N32A 2ACZB 1HA5A 1PDXA 2KZRA 3UQAA 1IUEA 3IT6B 2LI5A 2Y5CA 3VFKA 5AZHA 1ZXHA 1R4NI 1YN4A 4WQOB 1NDDA 1WE7A 4IWOA 3RT3B 2KC2A 4M0WA 1P98A 3R7QA 4AS1A 2MBQA 1L0XB 3APFA 3EFUA 2BB6A 2R2OA 5FK9C 2FCNA 3N9YC 2AQ1B 5E6OA 2JWZA 3VUYA 1NVID 5DPRA 2V4IB 3V3XA 2QSDA 1E0ZA 1OQQA 4K7SA
chains in the Genus database with same CATH topology
3R7RA 4IG7B 2EKEC 1Q1OA 4EFOA 2N7DA 3TBLD 2ZNVB 5LXHA 3KW5B 4M0WB 3U7DA 2G3QB 4IM2A 1GJZA 4TKNA 3M63B 4I6LB 4HWIB 5C23A 4BFRA 2N9XA 3QAQA 3ZNZB 2PE9A 2L8JA 3OJ3A 4ASWC 1V80A 1V5TA 5DPTA 4BKSD 1E8WA 2K8CA 3QK0A 4GU2A 4FADA 4I6PA 3UGBB 2O6VD 1C3TA 2D07B 2KJHB 2N1WA 4BOZB 4NY0A 2V4LA 4EUTA 4PYZA 1SGHA 1E7VA 1XT9B 2BKRB 3K9OB 2FCSA 1M94A 4M8MA 3JYUA 3KUDB 3QIJA 4JGHB 1V9JA 2KDFB 4X57B 5CX3A 4AJWA 1JRUA 2L0TA 3NHEB 2FCQA 3ZRCA 3ZTDA 2KWUB 2M1MA 4DDGD 4EKUA 2O6VB 2NBVB 3QQ8B 4XC2A 1E8ZA 3CF6E 2MLBA 1WZ3A 2LVQA 2NCNA 5E6PA 2KN5A 4HPMB 1IPGA 1WY8A 4ZRIA 1WXMA 2K25A 2PPHA 1GC6A 3UIOB 2C5LC 4MJSA 3RZFA 3T8MA 4PS3A 2LD9A 2KJ6A 3AULA 1EF5A 2MCNB 2L3ZA 1Z5SB 4P7IA 3DVNU 4HPLB 2M0XA 3AI5A 1WXAA 2YLMA 3RUIB 1WJUA 2HE7A 4E3CA 3X0WA 3QWZB 4W9EA 4MGIE 4FBJB 3PPAA 2RD0A 2K8BA 4W9DA 1E5WA 3WAPA 1UGMA 5JHAA 1KJTA 1K8RB 1P9DU 1YQBA 3DBLI 4MM3A 2KWCA 1BT0A 3KUCB 1OEYA 2BWFA 4ICUA 2BGFA 3AU5A 2WYQA 5J17A 1GUAB 4W9LA 3QX1A 4IM0A 2LVOA 5JH5C 1S1QB 4IWPA 2JXXA 2Z0DB 4ICVA 3R3MA 4B95A 2JY6A 4AUQC 4B6WA 2MBBB 5JZEB 5LLIA 3D32A 2JZZA 4ZRKA 3ZNHB 3APDA 1Y8RC 3H7SA 4JLCA 1HE8A 3ZDTA 2ZPNA 4WWPA 4EZJA 1KOTA 4FJYA 1LM8B 3B0AA 4WJNA 2ZVOA 2UYZB 4KZ0A 3KUZA 3GZNI 2IO0B 2LGXA 4TQ0A 3ECIA 3I3TB 4GDLA 3WIMA 4MJSB 1S3SG 1V2YA 2RR9A 5G2NA 1V86A 3IHPC 1Z2MA 3KH0A 1Q0WB 1LXDA 2JVCA 2KDEB 2MBEA 3VUWA 4GMVA 4HDOA 1WJNA 1P1AA 4RM8A 3ZDMC 3EECA 3HK0A 2ZNVC 3UQBA 3ALBA 3A9JA 4HDQA 1AARA 2I1KA 3QC8B 2NBWB 3Q3FA 1IP9A 2KX0A 4XX5A 2BYVE 2NBUA 4BKTA 5BO4B 3GOEA 3WAMA 4JL9A 1V6EA 4M8NA 3A9KA 1SE9A 1PQSA 4NJ7A 2J0KA 3OJ4B 3DVGX 3MHSD 2CR5A 4EZLA 1J8CA 1MG8A 1RLFA 1UBIA 3ZUNA 3RD2A 3V6CB 3IG3A 1WYWB 2FAZA 2G4SA 3RZWC 4ANUA 3APCA 4DBGA 3DBHI 4HXDA 2JF5A 2O2VA 4K81A 1V81A 3VTWA 3W1YA 2KNBA 5L95C 2LZ6A 2FIDA 3PLUA 5EDSA 4GDLB 4W9HA 4BKSA 1WIAA 4MH0E 1WX7A 2Y5BB 2MSED 3N3KB 2LUEA 2L05A 2C60A 2O6VA 2J7QB 5FR6A 2DX5B 3H9DA 1WRDB 5KHOA 4E71A 3PRMB 3ZTCA 3DOWA 2LGYA 3M3JA 3O65B 4BVUC 1V5OA 2WWZA 2IO2B 3A9JB 1ZKHA 3NZSA 2KQ7A 3S2AA 3PSEB 2KTFA 1WX9A 2B3AA 1WXVA 2NVUI 5G55A 1E7UA 5IA7A 2ZJDA 2N1VA 2HJ8A 3A9KB 4OVUA 3BINA 4AWJA 2L0FA 1YIWA 2CS4A 4KDIC 5GMVA 4GB9A 4PS8A 2LASA 4ANVA 3K9PB 4EZKA 1TGZB 1UBQA 3AXCA 2O2VB 2G4DB 3CMMB 4FJZA 1YX5B 3A1QA 4MGKE 1GG3A 1WGHA 3ONSA 4KVGB 5CTRC 4HCPB 4WAAA 2N9EB 5JHBA 4BOSC 2KANA 1R4MI 2RGFA 3UINB 1WF9A 1YJ1A 2WX1A 1VD2A 2MA9B 3U8ZA 2C7HA 1EF1A 2DYBA 4ZDVA 2KOXA 1UELA 2BYFA 3HIZA 3X23A 4II3B 2DZKA 4ZYNA 4DWFA 3IVFA 3DVNV 1WJ4A 1LQBA 3L13A 3WANA 2GBMA 3RULA 1J19A 1ZW7A 2BPSA 2AL3A 2KJRA 4N9F4 1D3ZA 4DK5A 3IBEA 3WAOA 2G45B 2ZEQA 1I42A 1OGWA 2M4NA 1RFAA 3EHVA 3PREA 2KMAA 3CSFA 4TUUA 1T0YA 3PRPB 4KDLB 1TTNA 2KK8A 2XBBC 3L0WB 1V49A 3PGEA 5D94A 3VH3B 1J0GA 3A1QB 2Z0EB 3VDZA 4BBNF 4LJPB 4PYUA 1YX6B 5IAAC 3L17A 2M8SA 4WJQA 2KLCA 5AZFA 3VAWA 3PHWB 3M62B 4ZRJA 2AYOB 2MBOA 2A5UA 3ZIMA 1A5RA 2FIFA 4URKA 2D2QA 5J2RA 3VVWB 2FUHB 4ANXA 2RSUA 3PVLA 3VQIA 3KYDD 3H6NA 3PLVA 3PZDA 2AWTA 3TL5A 2YVCA 1E8YA 2OOBB 2KFKA 1Q5WB 5D7GA 5CHWA 1QZEA 2LRWA 3JVZX 2L7RA 4HLEA 1RRBA 1UD7A 4GGQA 2MBHA 1P3QU 3M95A 2RPQA 3QA8A 2ZZPB 2DZJA 1WGGA 3HM3A 3Q3JA 1KM7A 1TBEA 2DAFA 3JW0X 1H8CA 1WGRA 2KDIA 4DHZE 4IM3A 2IBIB 4K1RB 3ZLZA 2NR2A 1G6JA 1XQQA 1F9JA 2BF8B 4NJ6A 2DZMA 3ZKJC 5KHQA 2LXAA 2LGDA 2C7NB 3QARA 1UH6A 1TZ1A 2KMCA 3LJ3A 4KIKA 4HVBA 2V3SA 4A20A 1WXSA 3TCAA 2OJRA 1RAXA 2KFJA 2M17A 4G11A 2K6QA 3DBRI 4HJKA 4W9KA 3DVGY 3P2BA 2CU1A 5CHFA 5D6JB 4I6NB 4II2B 4W9GA 3PTFC 2FNJB 3L10B 2QHOA 2L76A 3L08A 2CHXA 4RMAA 4W9JA 5D2MB 2PJHA 2L00B 4TQ1A 3WALA 4CO7A 4FHJA 3U30A 2KFKB 2NPTA 2DZIA 4LJOB 3PT2B 4RM9A 3MJWA 4W9IA 3SDLC 2ZPYA 3PS6A 1WMHA 3ZNGC 4CHKA 4GIVA 2XK5A 1E8XA 1EO6A 2KHWB 2KWVB 4NNJB 1UZXB 2K1FA 4IC7B 2DHZA 2KD0A 1WJ6A 3ML8A 4GN1A 4WWNA 3ZW3A 1XD3B 1GC7A 2JRIB 4B9KA 1GNUA 1OQYA 2LWPA 3UIPB 3B1LX 2WX0A 4EEWA 2KKCA 3IFWB 4MGYE 1WE6A 3B08A 2N4FA 4K7WA 3ZRFA 2LJ5A 3TIXA 3AU4A 4KIKB 2MRPA 4LCDE 3SU8X 1WI0A 2VRRB 4FA6A 4E74A 2BKFA 4FN2A 2KVRA 2R2QA 3MTNB 5CHVC 4MELA 2IO3B 4MSQB 2EMTA 2MP2A 4J6IA 2A4ZA 2AEHA 2AL6A 4GXBA 2IY0B 4CYEA 2ZCCA 2NPTB 3SHQA 2GBNA 3R66C 2EMSA 4KSKC 3DQVA 3SD5A 3VXWA 1WMHB 3VTUA 2D3GA 1FXTB 2C7MB 3C0RB 2XK5B 3PHXB 2KX3A 4AJYB 4BKGA 4FLHA 4OVVA 4F7ZA 4IUMB 2GBJA 2GBKA 3PRZA 4GDKA 4HK2A 4A3OA 5LXIB 2HTHA 3H7PA 2D10A 3LDZE 2XEWA 5DPWA 1WX8A 2KTRA 2CHZA 1OTRB 4NPNA 2J0JA 4AOFA 2MQJA 4F8CB 1L7YA 3KYCD 3W1SC 4TV3A 5E6NA 3W1SA 4WJPA 4EOYA 3QHTA 3JSVA 2BWES 3OAWA 3HM6X 5DCNA 2MX2A 2Z59B 2K6DB 3KVFB 1YD8U 3VH4B 4DHJD 2I1JA 2ZVNA 1I35A 3L54A 4NAWA 1CMXB 3OLMD 4G50A 5AZGA 3V61A 4IW0A 4WJOA 1NBFC 2MP2B 2K8HA 1NI2A 4W9FA 2NS5A 4XZ4A 4LDTD 3DBSA 1ISNA 3ML9A 4FULA 3BY4B 3VUXA 4MGZE 4G3XB 2IZVB 2DYMA 4G0NB 3L16A 2JPHA 3CSTA 3NS8A 4DHJB 2LXCA 2MWSB 1VCBA 2WDTB 5AEKB 4GDKB 4YL8A 3ZVVA 2IY1B 3QCAA 2DYOA 2GOWA 3H7PB 3QJZA 1KLVA 1SIFA 1WGDA 3DCGA 3DPDA 2KTRB 4LDTB 4WWOA 4HCNB 1LFDA 3TJPA 4K7UA 4IWQA 2W9NA 2KQSA 4GSWA 4NQLB 3UF8A 2GBRA 2IO1B 4NQKE 1X1MA 2N7EA 5C1ZA 1P0RA 1H4RA 3JSVB 2V1YA 1E90A 2GMIC 3NOBA 3NY5A 4W9CA 2IYDB 4PS7A 2DAJA 3NZUA 3A33B 3N32A 5L83A 1C1YB 4NAWB 3A4SC 2KZRA 4FHKA 2JUOA 2BYEA 4DDID 3UQAA 3PV1A 4AP4C 5HKHA 3N30A 2LI5A 3ENEA 4A3PA 2JT4B 3VFKA 4JIOU 5AZHA 2CKHB 1WH3A 3H1UA 1OEYJ 1R4NI 2J0MA 4GOCA 4WQOB 1NDDA 1WE7A 4IWOA 3RT3B 4F1SA 1WZ0A 2KC2A 5TR5A 1WR6E 4KZCA 1EUVB 1P98A 4MSMB 2JRHA 2KLGA 3R7QA 1U4AA 2MBQA 2PE6B 2UWQA 4BBNC 2PEAA 3TMPB 3VTVA 1WGYA 2KO3A 3V6EB 3APFA 3EFUA 3ZNID 4ANWA 2ZCBA 5DPSA 2R2OA 3EC8A 3VHTC 1WM2A 2FCNA 3HHMA 4DXAB 1L2NA 2JZ3B 2FCMA 2CHWA 2REXA 3DDCB 2DENB 2ASQA 2N9PC 2HD5B 2LRUA 3V62A 2KC1A 1WM3A 2KXJA 4KSLC 1ZGUB 2D11A 2KDBA 2K39A 5E6OA 3V60A 3RCZA 3RYTA 4FJVB 2JWZA 4JQWC 3VUYA 1IYFA 5DPRA 5J18A 1WR1A 1WFYA 3T9LA 4DHZB 4KV2A 2MW5A 2LVPA 4MEMA 2C9WB 4K7SA 3WA0A 3ZO5B 3A4RA 4MDKE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3R7R A;  4IG7 B;  2EKE C;  1Q1O A;  4EFO A;  2N7D A;  3TBL D;  2ZNV B;  5LXH A;  3KW5 B;  4M0W B;  3U7D A;  2G3Q B;  4IM2 A;  1GJZ A;  4TKN A;  3M63 B;  4I6L B;  4HWI B;  5C23 A;  4BFR A;  2N9X A;  3QAQ A;  3ZNZ B;  2PE9 A;  2L8J A;  3OJ3 A;  4ASW C;  1V80 A;  1V5T A;  5DPT A;  4BKS D;  1E8W A;  2K8C A;  3QK0 A;  4GU2 A;  4FAD A;  4I6P A;  3UGB B;  2O6V D;  1C3T A;  2D07 B;  2KJH B;  2N1W A;  4BOZ B;  4NY0 A;  2V4L A;  4EUT A;  4PYZ A;  1SGH A;  1E7V A;  1XT9 B;  2BKR B;  3K9O B;  2FCS A;  1M94 A;  4M8M A;  3JYU A;  3KUD B;  3QIJ A;  4JGH B;  1V9J A;  2KDF B;  4X57 B;  5CX3 A;  4AJW A;  1JRU A;  2L0T A;  3NHE B;  2FCQ A;  3ZRC A;  3ZTD A;  2KWU B;  2M1M A;  4DDG D;  4EKU A;  2O6V B;  2NBV B;  3QQ8 B;  4XC2 A;  1E8Z A;  3CF6 E;  2MLB A;  1WZ3 A;  2LVQ A;  2NCN A;  5E6P A;  2KN5 A;  4HPM B;  1IPG A;  1WY8 A;  4ZRI A;  1WXM A;  2K25 A;  2PPH A;  1GC6 A;  3UIO B;  2C5L C;  4MJS A;  3RZF A;  3T8M A;  4PS3 A;  2LD9 A;  2KJ6 A;  3AUL A;  1EF5 A;  2MCN B;  2L3Z A;  1Z5S B;  4P7I A;  3DVN U;  4HPL B;  2M0X A;  3AI5 A;  1WXA A;  2YLM A;  3RUI B;  1WJU A;  2HE7 A;  4E3C A;  3X0W A;  3QWZ B;  4W9E A;  4MGI E;  4FBJ B;  3PPA A;  2RD0 A;  2K8B A;  4W9D A;  1E5W A;  3WAP A;  1UGM A;  5JHA A;  1KJT A;  1K8R B;  1P9D U;  1YQB A;  3DBL I;  4MM3 A;  2KWC A;  1BT0 A;  3KUC B;  1OEY A;  2BWF A;  4ICU A;  2BGF A;  3AU5 A;  2WYQ A;  5J17 A;  1GUA B;  4W9L A;  3QX1 A;  4IM0 A;  2LVO A;  5JH5 C;  1S1Q B;  4IWP A;  2JXX A;  2Z0D B;  4ICV A;  3R3M A;  4B95 A;  2JY6 A;  4AUQ C;  4B6W A;  2MBB B;  5JZE B;  5LLI A;  3D32 A;  2JZZ A;  4ZRK A;  3ZNH B;  3APD A;  1Y8R C;  3H7S A;  4JLC A;  1HE8 A;  3ZDT A;  2ZPN A;  4WWP A;  4EZJ A;  1KOT A;  4FJY A;  1LM8 B;  3B0A A;  4WJN A;  2ZVO A;  2UYZ B;  4KZ0 A;  3KUZ A;  3GZN I;  2IO0 B;  2LGX A;  4TQ0 A;  3ECI A;  3I3T B;  4GDL A;  3WIM A;  4MJS B;  1S3S G;  1V2Y A;  2RR9 A;  5G2N A;  1V86 A;  3IHP C;  1Z2M A;  3KH0 A;  1Q0W B;  1LXD A;  2JVC A;  2KDE B;  2MBE A;  3VUW A;  4GMV A;  4HDO A;  1WJN A;  1P1A A;  4RM8 A;  3ZDM C;  3EEC A;  3HK0 A;  2ZNV C;  3UQB A;  3ALB A;  3A9J A;  4HDQ A;  1AAR A;  2I1K A;  3QC8 B;  2NBW B;  3Q3F A;  1IP9 A;  2KX0 A;  4XX5 A;  2BYV E;  2NBU A;  4BKT A;  5BO4 B;  3GOE A;  3WAM A;  4JL9 A;  1V6E A;  4M8N A;  3A9K A;  1SE9 A;  1PQS A;  4NJ7 A;  2J0K A;  3OJ4 B;  3DVG X;  3MHS D;  2CR5 A;  4EZL A;  1J8C A;  1MG8 A;  1RLF A;  1UBI A;  3ZUN A;  3RD2 A;  3V6C B;  3IG3 A;  1WYW B;  2FAZ A;  2G4S A;  3RZW C;  4ANU A;  3APC A;  4DBG A;  3DBH I;  4HXD A;  2JF5 A;  2O2V A;  4K81 A;  1V81 A;  3VTW A;  3W1Y A;  2KNB A;  5L95 C;  2LZ6 A;  2FID A;  3PLU A;  5EDS A;  4GDL B;  4W9H A;  4BKS A;  1WIA A;  4MH0 E;  1WX7 A;  2Y5B B;  2MSE D;  3N3K B;  2LUE A;  2L05 A;  2C60 A;  2O6V A;  2J7Q B;  5FR6 A;  2DX5 B;  3H9D A;  1WRD B;  5KHO A;  4E71 A;  3PRM B;  3ZTC A;  3DOW A;  2LGY A;  3M3J A;  3O65 B;  4BVU C;  1V5O A;  2WWZ A;  2IO2 B;  3A9J B;  1ZKH A;  3NZS A;  2KQ7 A;  3S2A A;  3PSE B;  2KTF A;  1WX9 A;  2B3A A;  1WXV A;  2NVU I;  5G55 A;  1E7U A;  5IA7 A;  2ZJD A;  2N1V A;  2HJ8 A;  3A9K B;  4OVU A;  3BIN A;  4AWJ A;  2L0F A;  1YIW A;  2CS4 A;  4KDI C;  5GMV A;  4GB9 A;  4PS8 A;  2LAS A;  4ANV A;  3K9P B;  4EZK A;  1TGZ B;  1UBQ A;  3AXC A;  2O2V B;  2G4D B;  3CMM B;  4FJZ A;  1YX5 B;  3A1Q A;  4MGK E;  1GG3 A;  1WGH A;  3ONS A;  4KVG B;  5CTR C;  4HCP B;  4WAA A;  2N9E B;  5JHB A;  4BOS C;  2KAN A;  1R4M I;  2RGF A;  3UIN B;  1WF9 A;  1YJ1 A;  2WX1 A;  1VD2 A;  2MA9 B;  3U8Z A;  2C7H A;  1EF1 A;  2DYB A;  4ZDV A;  2KOX A;  1UEL A;  2BYF A;  3HIZ A;  3X23 A;  4II3 B;  2DZK A;  4ZYN A;  4DWF A;  3IVF A;  3DVN V;  1WJ4 A;  1LQB A;  3L13 A;  3WAN A;  2GBM A;  3RUL A;  1J19 A;  1ZW7 A;  2BPS A;  2AL3 A;  2KJR A;  4N9F 4;  1D3Z A;  4DK5 A;  3IBE A;  3WAO A;  2G45 B;  2ZEQ A;  1I42 A;  1OGW A;  2M4N A;  1RFA A;  3EHV A;  3PRE A;  2KMA A;  3CSF A;  4TUU A;  1T0Y A;  3PRP B;  4KDL B;  1TTN A;  2KK8 A;  2XBB C;  3L0W B;  1V49 A;  3PGE A;  5D94 A;  3VH3 B;  1J0G A;  3A1Q B;  2Z0E B;  3VDZ A;  4BBN F;  4LJP B;  4PYU A;  1YX6 B;  5IAA C;  3L17 A;  2M8S A;  4WJQ A;  2KLC A;  5AZF A;  3VAW A;  3PHW B;  3M62 B;  4ZRJ A;  2AYO B;  2MBO A;  2A5U A;  3ZIM A;  1A5R A;  2FIF A;  4URK A;  2D2Q A;  5J2R A;  3VVW B;  2FUH B;  4ANX A;  2RSU A;  3PVL A;  3VQI A;  3KYD D;  3H6N A;  3PLV A;  3PZD A;  2AWT A;  3TL5 A;  2YVC A;  1E8Y A;  2OOB B;  2KFK A;  1Q5W B;  5D7G A;  5CHW A;  1QZE A;  2LRW A;  3JVZ X;  2L7R A;  4HLE A;  1RRB A;  1UD7 A;  4GGQ A;  2MBH A;  1P3Q U;  3M95 A;  2RPQ A;  3QA8 A;  2ZZP B;  2DZJ A;  1WGG A;  3HM3 A;  3Q3J A;  1KM7 A;  1TBE A;  2DAF A;  3JW0 X;  1H8C A;  1WGR A;  2KDI A;  4DHZ E;  4IM3 A;  2IBI B;  4K1R B;  3ZLZ A;  2NR2 A;  1G6J A;  1XQQ A;  1F9J A;  2BF8 B;  4NJ6 A;  2DZM A;  3ZKJ C;  5KHQ A;  2LXA A;  2LGD A;  2C7N B;  3QAR A;  1UH6 A;  1TZ1 A;  2KMC A;  3LJ3 A;  4KIK A;  4HVB A;  2V3S A;  4A20 A;  1WXS A;  3TCA A;  2OJR A;  1RAX A;  2KFJ A;  2M17 A;  4G11 A;  2K6Q A;  3DBR I;  4HJK A;  4W9K A;  3DVG Y;  3P2B A;  2CU1 A;  5CHF A;  5D6J B;  4I6N B;  4II2 B;  4W9G A;  3PTF C;  2FNJ B;  3L10 B;  2QHO A;  2L76 A;  3L08 A;  2CHX A;  4RMA A;  4W9J A;  5D2M B;  2PJH A;  2L00 B;  4TQ1 A;  3WAL A;  4CO7 A;  4FHJ A;  3U30 A;  2KFK B;  2NPT A;  2DZI A;  4LJO B;  3PT2 B;  4RM9 A;  3MJW A;  4W9I A;  3SDL C;  2ZPY A;  3PS6 A;  1WMH A;  3ZNG C;  4CHK A;  4GIV A;  2XK5 A;  1E8X A;  1EO6 A;  2KHW B;  2KWV B;  4NNJ B;  1UZX B;  2K1F A;  4IC7 B;  2DHZ A;  2KD0 A;  1WJ6 A;  3ML8 A;  4GN1 A;  4WWN A;  3ZW3 A;  1XD3 B;  1GC7 A;  2JRI B;  4B9K A;  1GNU A;  1OQY A;  2LWP A;  3UIP B;  3B1L X;  2WX0 A;  4EEW A;  2KKC A;  3IFW B;  4MGY E;  1WE6 A;  3B08 A;  2N4F A;  4K7W A;  3ZRF A;  2LJ5 A;  3TIX A;  3AU4 A;  4KIK B;  2MRP A;  4LCD E;  3SU8 X;  1WI0 A;  2VRR B;  4FA6 A;  4E74 A;  2BKF A;  4FN2 A;  2KVR A;  2R2Q A;  3MTN B;  5CHV C;  4MEL A;  2IO3 B;  4MSQ B;  2EMT A;  2MP2 A;  4J6I A;  2A4Z A;  2AEH A;  2AL6 A;  4GXB A;  2IY0 B;  4CYE A;  2ZCC A;  2NPT B;  3SHQ A;  2GBN A;  3R66 C;  2EMS A;  4KSK C;  3DQV A;  3SD5 A;  3VXW A;  1WMH B;  3VTU A;  2D3G A;  1FXT B;  2C7M B;  3C0R B;  2XK5 B;  3PHX B;  2KX3 A;  4AJY B;  4BKG A;  4FLH A;  4OVV A;  4F7Z A;  4IUM B;  2GBJ A;  2GBK A;  3PRZ A;  4GDK A;  4HK2 A;  4A3O A;  5LXI B;  2HTH A;  3H7P A;  2D10 A;  3LDZ E;  2XEW A;  5DPW A;  1WX8 A;  2KTR A;  2CHZ A;  1OTR B;  4NPN A;  2J0J A;  4AOF A;  2MQJ A;  4F8C B;  1L7Y A;  3KYC D;  3W1S C;  4TV3 A;  5E6N A;  3W1S A;  4WJP A;  4EOY A;  3QHT A;  3JSV A;  2BWE S;  3OAW A;  3HM6 X;  5DCN A;  2MX2 A;  2Z59 B;  2K6D B;  3KVF B;  1YD8 U;  3VH4 B;  4DHJ D;  2I1J A;  2ZVN A;  1I35 A;  3L54 A;  4NAW A;  1CMX B;  3OLM D;  4G50 A;  5AZG A;  3V61 A;  4IW0 A;  4WJO A;  1NBF C;  2MP2 B;  2K8H A;  1NI2 A;  4W9F A;  2NS5 A;  4XZ4 A;  4LDT D;  3DBS A;  1ISN A;  3ML9 A;  4FUL A;  3BY4 B;  3VUX A;  4MGZ E;  4G3X B;  2IZV B;  2DYM A;  4G0N B;  3L16 A;  2JPH A;  3CST A;  3NS8 A;  4DHJ B;  2LXC A;  2MWS B;  1VCB A;  2WDT B;  5AEK B;  4GDK B;  4YL8 A;  3ZVV A;  2IY1 B;  3QCA A;  2DYO A;  2GOW A;  3H7P B;  3QJZ A;  1KLV A;  1SIF A;  1WGD A;  3DCG A;  3DPD A;  2KTR B;  4LDT B;  4WWO A;  4HCN B;  1LFD A;  3TJP A;  4K7U A;  4IWQ A;  2W9N A;  2KQS A;  4GSW A;  4NQL B;  3UF8 A;  2GBR A;  2IO1 B;  4NQK E;  1X1M A;  2N7E A;  5C1Z A;  1P0R A;  1H4R A;  3JSV B;  2V1Y A;  1E90 A;  2GMI C;  3NOB A;  3NY5 A;  4W9C A;  2IYD B;  4PS7 A;  2DAJ A;  3NZU A;  3A33 B;  3N32 A;  5L83 A;  1C1Y B;  4NAW B;  3A4S C;  2KZR A;  4FHK A;  2JUO A;  2BYE A;  4DDI D;  3UQA A;  3PV1 A;  4AP4 C;  5HKH A;  3N30 A;  2LI5 A;  3ENE A;  4A3P A;  2JT4 B;  3VFK A;  4JIO U;  5AZH A;  2CKH B;  1WH3 A;  3H1U A;  1OEY J;  1R4N I;  2J0M A;  4GOC A;  4WQO B;  1NDD A;  1WE7 A;  4IWO A;  3RT3 B;  4F1S A;  1WZ0 A;  2KC2 A;  5TR5 A;  1WR6 E;  4KZC A;  1EUV B;  1P98 A;  4MSM B;  2JRH A;  2KLG A;  3R7Q A;  1U4A A;  2MBQ A;  2PE6 B;  2UWQ A;  4BBN C;  2PEA A;  3TMP B;  3VTV A;  1WGY A;  2KO3 A;  3V6E B;  3APF A;  3EFU A;  3ZNI D;  4ANW A;  2ZCB A;  5DPS A;  2R2O A;  3EC8 A;  3VHT C;  1WM2 A;  2FCN A;  3HHM A;  4DXA B;  1L2N A;  2JZ3 B;  2FCM A;  2CHW A;  2REX A;  3DDC B;  2DEN B;  2ASQ A;  2N9P C;  2HD5 B;  2LRU A;  3V62 A;  2KC1 A;  1WM3 A;  2KXJ A;  4KSL C;  1ZGU B;  2D11 A;  2KDB A;  2K39 A;  5E6O A;  3V60 A;  3RCZ A;  3RYT A;  4FJV B;  2JWZ A;  4JQW C;  3VUY A;  1IYF A;  5DPR A;  5J18 A;  1WR1 A;  1WFY A;  3T9L A;  4DHZ B;  4KV2 A;  2MW5 A;  2LVP A;  4MEM A;  2C9W B;  4K7S A;  3WA0 A;  3ZO5 B;  3A4R A;  4MDK E; 
#chains in the Genus database with same CATH topology
 4IG7 B;  1Q1O A;  3AV8 A;  2ZNV B;  4RGO S;  1XO3 A;  3M63 B;  1SEB D;  4HWI B;  4BAX A;  4ASW C;  4OVZ A;  2PE9 A;  5DPT A;  4MH8 A;  1E8W A;  2K8C A;  4GU2 A;  4FAD A;  2O6V D;  4EUT A;  4BOZ B;  1SGH A;  2BKR B;  1QOA A;  4M8M A;  3QIJ A;  2IGG A;  1JRU A;  2FCQ A;  4TSS A;  2M1M A;  4DDG D;  3I63 C;  2K0P A;  3QQ8 B;  1LGR A;  1E8Z A;  4IDI A;  2MLB A;  1TT5 B;  1KTK A;  4HPM B;  1WY8 A;  2EKI A;  2K25 A;  3AEF B;  1GC6 A;  3B9J A;  4MJS A;  4PS3 A;  2LD9 A;  1C4A A;  2WDR B;  3DVN U;  1WXA A;  1L4Z B;  4MGI E;  2RD0 A;  2V9H A;  1UGM A;  1YQB A;  3DBL I;  2KWC A;  2JZP A;  1OEY A;  1F77 A;  4ICU A;  2WYQ A;  2Y5P A;  4ITK A;  1WXQ A;  1S1Q B;  2MEK A;  3R3M A;  2BQQ A;  5LLI A;  3APD A;  3H7S A;  3ZDT A;  4WWP A;  4L1B A;  4WJN A;  1YNT E;  2UYZ B;  3EFC A;  2JX5 A;  3FKY A;  4RF1 A;  2IO0 B;  3RMK C;  3WIM A;  1L6V A;  1FPY A;  3IHP C;  3VUW A;  4WAF A;  1QKZ A;  3EEC A;  2ZNV C;  3FIL B;  3W5V B;  4HDQ A;  1AAR A;  2I1K A;  4MM3 B;  2LJI A;  2M19 A;  2NBW B;  1V8C A;  4XX5 A;  4BKT A;  5BO4 B;  4JL9 A;  3A9K A;  4EZL A;  3AMZ A;  3DVG X;  3MHS D;  1DGJ A;  5T8I A;  3V6C B;  2FAZ A;  2G4S A;  4ANU A;  2JF5 A;  2O2V A;  2M0A A;  2FID A;  2KDM A;  1WIA A;  2Y5B B;  2MSE D;  2C60 A;  2WHI A;  3H9D A;  3BYT B;  3BVM A;  3M3J A;  3H8H A;  3AEB B;  3NZS A;  3S2A A;  3PSE B;  2X8X X;  1WXV A;  2NVU I;  3R2T A;  5G55 A;  3ZYY X;  2HJ8 A;  4OVU A;  2L0F A;  4XYC A;  1I4G A;  2J52 A;  2PMV A;  3C19 A;  4ZRP A;  1PGX A;  1XLQ A;  2LUM A;  2H88 B;  3EUB 2;  2K5P A;  4EZK A;  4RCO A;  3J9C A;  1UBQ A;  3CMM B;  4WAA A;  2KAN A;  1R4M I;  1M4V A;  2WX1 A;  3U8Z A;  2C7H A;  2KOX A;  3GZN B;  2DZK A;  4OZC A;  3DVN V;  2GBM A;  2MJD A;  1ZW7 A;  1MG4 A;  4DK5 A;  4A9A A;  3EHV A;  3PRE A;  1RFA A;  2D5G A;  1HQR D;  1KLU D;  3RI7 C;  2TSS A;  3PRP B;  4KDL B;  2IJ0 A;  2GRI A;  3VH3 B;  3A1Q B;  2W82 A;  4JE3 B;  2BW2 A;  1MHX A;  3PHW B;  3M62 B;  1D5Z C;  3KWL A;  3U52 E;  3GE8 C;  3VVW B;  1JWB D;  3OG5 A;  3TEW A;  2V0G A;  2KFK A;  4K3B A;  5D7G A;  5IO9 A;  1IBX B;  5CHW A;  3AEA B;  4LNK A;  4HLE A;  1D4B A;  2MBH A;  3FC4 A;  3QA8 A;  1P7F A;  1IGD A;  1WGG A;  1VRA B;  2L32 A;  1H8C A;  3RN9 C;  1YOV B;  1XEE A;  2IBI B;  2NTS A;  1VJK A;  4NJ6 A;  2DZM A;  5D3I B;  3ZKJ C;  2LGD A;  1UH6 A;  1FRR A;  2V3S A;  3TCA A;  2OJR A;  4W9K A;  4G11 A;  2CU1 A;  3P63 A;  4W9G A;  2RDB C;  1QOB A;  4W9J A;  3WAL A;  5C2T B;  3U30 A;  2NPT A;  3AH7 A;  4RM9 A;  4W9I A;  2ZPY A;  3PS6 A;  1UF0 A;  4CHK A;  4NNJ B;  4IC7 B;  2JSV X;  3GS2 A;  3DWG C;  4KX6 B;  4ZYS A;  1OQY A;  2LWP A;  1L0Y B;  2WX0 A;  1FFV A;  1IGC A;  3IFW B;  3B08 A;  2RPV A;  4KIK B;  2QCZ A;  1SIJ A;  4E74 A;  4S0R A;  5CHV C;  2R2Q A;  1PUT A;  4MSQ B;  1QOF A;  2A4Z A;  5LNK 1;  3BVG A;  4CYE A;  1L6U A;  1BUI C;  2HTM E;  4KSK C;  2KMM A;  3SD5 A;  1FXT B;  2C7M B;  1FD6 A;  4BKG A;  2XK5 B;  2KX3 A;  4IUM B;  2YEP B;  1JWS D;  2D10 A;  2XEW A;  1OTR B;  4A6Q A;  2MQJ A;  1AWD A;  1JCK B;  4L23 A;  1T3Q A;  4TV3 A;  4WJP A;  2BWE S;  3HM6 X;  5DCN A;  2MX2 A;  3KVF B;  1D5M C;  2I1J A;  3L54 A;  1CMX B;  2NTT A;  4IW0 A;  4WJO A;  4LNN A;  2K8H A;  4W9F A;  3DBS A;  3GE3 C;  4FUL A;  3TUO A;  4MGZ E;  2IZV B;  3O13 A;  4G0N B;  2KQ4 X;  5HFY A;  3L16 A;  3NS8 A;  3I5J C;  2MWS B;  1VCB A;  1I4R A;  4GDK B;  3ZVV A;  3QJZ A;  1KLV A;  3DPD A;  1WGD A;  1SXT A;  2H89 B;  2J53 A;  1QOG A;  2KQS A;  2PKO A;  4OZA A;  3UF8 A;  4NQK E;  3P4Q B;  2N7E A;  2FBW B;  1E90 A;  2KVZ A;  3A33 B;  4DXG A;  5L83 A;  3DHG C;  4FHK A;  2W54 A;  4ARI A;  3PV1 A;  4AP4 C;  2VZK B;  5HKH A;  3CIR B;  3N30 A;  1N60 A;  1C76 A;  4HKZ E;  4JIO U;  3H1U A;  1WH3 A;  1OEY J;  5TR5 A;  2CJO A;  2WXG A;  3NUH B;  2UWQ A;  2WS3 B;  1GPX A;  2I2Y A;  3VTV A;  2E3T A;  2LMC A;  3V6E B;  4ANW A;  2CJN A;  1QIL A;  4WQM A;  3VHT C;  1D6E C;  2FCM A;  1TKE A;  2VH2 A;  1PYW D;  3Q8F A;  1Y56 A;  3SR6 A;  1WM3 A;  2INP E;  1IYF A;  2IPK D;  4FJV B;  5H8Y E;  3T9L A;  3BK2 A;  4HKQ A;  2W3R A;  4MEM A;  4OW0 A;  3ZO5 B;  3A4R A;  3VR8 B;  2DWQ A;  1NI3 A;  4KGT A;  4EFO A;  1JQ4 A;  2N7D A;  3KW5 B;  4M0W B;  2G3Q B;  1ESF A;  4TKN A;  2J4X A;  4YT0 B;  3NVZ A;  4BFR A;  2N9X A;  2L8J A;  1V80 A;  4PT5 A;  4BKS D;  2XN9 C;  2GLS A;  1CJE A;  2PTL A;  2N1W A;  2V3N A;  4D2K A;  4C7Y A;  5D3D A;  1QF6 A;  2FCS A;  2QIE B;  1I4P A;  3JYU A;  2ON8 A;  3KUD B;  4JGH B;  2KDF B;  4X57 B;  2L0T A;  3I57 A;  3SFE B;  3ZRC A;  3VR9 B;  2O6V B;  4EKU A;  1PGB A;  3CF6 E;  5I4D A;  2MH7 A;  1ZDX A;  3Q3N C;  3Q8E A;  3U4E G;  2E6X A;  2MCN B;  2KJ6 A;  2L3Z A;  1Z5S B;  3RUI B;  1JAL A;  3X0W A;  1C77 A;  4W9D A;  3WAP A;  2RDH A;  1KJT A;  2QMT A;  1P9D U;  1V1P A;  3GP7 A;  3AE1 B;  5JHA A;  2BGF A;  1GUA B;  1P7E A;  2LVO A;  4IWP A;  1CQV A;  1YN3 A;  2JXX A;  4ICV A;  1C4C A;  4B95 A;  2WDV B;  4B6W A;  1K51 A;  4RGT A;  3D32 A;  2JZZ A;  1Y8R C;  1KOT A;  2WQY B;  4EE2 A;  2ZVO A;  3KUZ A;  3GZN I;  1SJE D;  1YJJ A;  3Q14 C;  4TQ0 A;  3ECI A;  3I3T B;  4GDL A;  4MJS B;  1S3S G;  5BYQ A;  2EEL A;  2JVC A;  2KDE B;  4XE0 A;  3NVY A;  1GB1 A;  1WJN A;  1L5P A;  4XWW A;  4R3D A;  3SFD B;  3UQB A;  3HVZ A;  1VZ6 A;  3E9S A;  1YMH E;  2BYV E;  2NBU A;  3GOE A;  3WAM A;  1V6E A;  1T5X D;  1SE9 A;  2J0K A;  1Q10 A;  3RZW C;  1V1O A;  1V81 A;  5L95 C;  4ZHP A;  2AQ3 B;  1ET6 A;  1WX7 A;  4UDU C;  2LUE A;  2O6V A;  3CWI A;  4K3C A;  2DX5 B;  3MJ5 A;  3PRM B;  3DOW A;  2JYE A;  1JWU D;  3O65 B;  5EE0 A;  3AED B;  4USA A;  1V5O A;  3W9C B;  4DXF A;  2KTF A;  2D3C A;  1E7U A;  5IA7 A;  2ZJD A;  2CU3 A;  3A9K B;  4AWJ A;  1UWX A;  3RNE C;  5FKA C;  4C7Z A;  5GMV A;  4GB9 A;  5AUK A;  2LAS A;  4ANV A;  3K9P B;  3AXC A;  2O2V B;  2G4D B;  4MGK E;  1DOY A;  1WGH A;  3UI3 A;  2VH1 A;  5JHB A;  2N9E B;  1R7S A;  3TEX A;  1WF9 A;  2MA9 B;  2WXL A;  3AEE B;  2B76 B;  3IVF A;  1WJ4 A;  1UGJ A;  1MI0 A;  3ZGZ A;  2KJR A;  3IBE A;  3WAO A;  2G45 B;  1XF5 L;  2ZEQ A;  1OGW A;  1E9M A;  4TUU A;  5E6J A;  3NRZ A;  3PGE A;  4HJG E;  5G5G A;  5D94 A;  3VDZ A;  4BBN F;  4PYU A;  1YX6 B;  3AEC B;  3BII D;  1VLB A;  4ZRJ A;  3DBH B;  4REZ A;  3ZIM A;  2GB1 A;  1A5R A;  5J2R A;  3AM9 A;  1YQ4 B;  1E10 A;  1E8Y A;  2OOB B;  3Q8B A;  1QZE A;  3JVZ X;  4J3O D;  4GGQ A;  1P3Q U;  3Q8A A;  1JWM D;  2DZJ A;  1TBE A;  2WXM A;  4DHZ E;  3ZJT A;  1G6J A;  1F1H A;  1XQQ A;  4YXD B;  1F9J A;  1TS2 A;  5KHQ A;  3QAR A;  1TZ1 A;  1L4D B;  3LJ3 A;  1RAX A;  2KFJ A;  2WXF A;  3P2B A;  4I6N B;  1ENF A;  3PTF C;  2QHO A;  1NEN B;  4TQ1 A;  1FM0 D;  4YSZ B;  2KFK B;  4ZRQ A;  3EGR A;  1C79 A;  1ZOY B;  4H2A A;  1HXY D;  2KN4 A;  2XNA C;  2DHZ A;  3ML8 A;  1XD3 B;  2JRI B;  3IXS A;  3B1L X;  3VRA B;  1JWA D;  3ZRF A;  2INN E;  2N4F A;  3RNF C;  2NMQ A;  2WXI A;  2RDG A;  2VRR B;  4FA6 A;  1WGK A;  4YTP B;  2KVR A;  2EMT A;  2R61 A;  2ZCC A;  2NPT B;  3SHQ A;  3Q3O C;  2GBN A;  3R66 C;  5IOI A;  3VTU A;  3Q2A C;  3ZQ4 A;  3L4P A;  1J7C A;  5GXG B;  2GBJ A;  5LXI B;  3H7P A;  2QEJ C;  5DPW A;  4JWU C;  2N9L A;  1OFF A;  2WXJ A;  3T3O A;  3U7Z A;  4ZOH C;  1J7B A;  3KYC D;  1NEK B;  3QHT A;  3VH4 B;  1I35 A;  4NAW A;  5AZG A;  3OLM D;  1K50 A;  4XZ4 A;  4LDT D;  3TSS A;  3BY4 B;  2DYM A;  3CST A;  5BMH A;  3VRB B;  4CQN A;  1EU4 A;  1N61 A;  4YL8 A;  2IY1 B;  3QCA A;  4XGA B;  1SIF A;  1FXI A;  3AE4 B;  4HCN B;  4WWO A;  1K53 A;  4DQO C;  1P0R A;  1H4R A;  2V1Y A;  2GMI C;  3NOB A;  1RWS A;  3NY5 A;  2DAJ A;  2JUO A;  2BYE A;  1SJH D;  1I4Q A;  1TZO A;  2L52 A;  3ENE A;  4A3P A;  2JT4 B;  2KWD A;  2J0M A;  1FRD A;  4GOC A;  3Q6B A;  1WZ0 A;  4YTN B;  1WR6 E;  1EUV B;  4MSM B;  3ZXR A;  2JRH A;  2KLG A;  5BMG A;  3RPF C;  4ZHO A;  3TMP B;  1WGY A;  3URY A;  3ZNI D;  2ZCB A;  5DPS A;  3EC8 A;  4NJC A;  3HHM A;  4DXA B;  1L2N A;  2JZ3 B;  2CHW A;  2DEN B;  2ASQ A;  2HD5 B;  2LRU A;  3TEY A;  4KSL C;  1ZGU B;  2D11 A;  2KDB A;  2PLP A;  4KKJ A;  3V60 A;  3RCZ A;  4JQW C;  1WFY A;  4KV2 A;  4QAY A;  2WXN A;  4MDK E;  3R7R A;  4LNF A;  3NVW A;  3TBL D;  1GJZ A;  4IM2 A;  3N1X C;  4JX1 C;  3BWU D;  4I6L B;  3QAQ A;  3PZ8 A;  1WYG A;  1DOI A;  3UGB B;  1C3T A;  4MAC A;  4NY0 A;  2V4L A;  1E7V A;  3K9O B;  1M94 A;  1XLN A;  2QC8 A;  2KWU B;  1TY2 A;  3KWV A;  4HRS A;  5BYR A;  1VZ8 A;  1WWT A;  5IN7 A;  2JXT A;  3AE8 B;  1WZ3 A;  2J42 A;  2NCN A;  2KN5 A;  3TEZ A;  1FEH A;  2JWU A;  2M56 B;  4ZRI A;  1WXM A;  2MJ3 A;  2C5L C;  3N20 C;  3RZF A;  3AUL A;  4HPL B;  2M0X A;  1HTO A;  2YLM A;  1WJU A;  4E3C A;  1ZDV A;  3QWZ B;  4A8X C;  4W9E A;  2IND C;  4FBJ B;  1E5W A;  3KUC B;  1FIQ A;  4WWM A;  5FR3 A;  5J17 A;  3AE7 B;  1FO4 A;  1TKG A;  2WXR A;  1XLP A;  5JZE B;  2BYT A;  1HE8 A;  4EZJ A;  1GOZ A;  2KT7 A;  2AX5 A;  1LM8 B;  2YEP F;  1FXA A;  1C9F A;  1XXG A;  1E6E B;  5G2N A;  1V2Y A;  2RR9 A;  1V86 A;  2WXH A;  1MFW A;  1Q0W B;  2MBE A;  1TYG B;  1PFD A;  1ZXI A;  1E7P B;  2WP9 B;  4P1B C;  1P1A A;  3ZDM C;  4US9 A;  1V1P B;  3A9J A;  3AN1 A;  4XWT A;  3B2F A;  3P42 A;  5BYS A;  4M8N A;  3BK1 A;  1B1Z A;  2FE8 A;  1PQS A;  4NJ7 A;  2CR5 A;  4TMA B;  3HRD D;  2N0S B;  4YWG G;  3RD2 A;  3IG3 A;  4HPP A;  3APC A;  4DBG A;  3DBH I;  4HXD A;  3VTW A;  2D3B A;  2KNB A;  3PLU A;  4GDL B;  4BKS A;  4US8 A;  3PO0 A;  2J7Q B;  2V3P A;  5FR6 A;  5EE9 A;  1WRD B;  2N9K A;  5KHO A;  4E71 A;  1YJI A;  3ZTC A;  2LGY A;  3KLS X;  2JYT A;  3NVV A;  1ZKH A;  2KQ7 A;  3RNG C;  1KRH A;  4IKG A;  1XLO A;  1YIW A;  2BS2 B;  4ACF A;  2CS4 A;  2HDE A;  2L83 A;  4PS8 A;  4FJZ A;  4RGM A;  3ONS A;  5CTR C;  1HTQ A;  4HCP B;  1YJ1 A;  1VD2 A;  2K22 A;  1KFY B;  2DYB A;  2GI9 A;  4ZDV A;  3BYY B;  2BYF A;  3HIZ A;  4WIP A;  3W2D A;  5IP4 D;  1LQB A;  3L13 A;  1J19 A;  2BPS A;  4OZB A;  1I42 A;  3AE6 B;  3WCQ A;  4RH6 A;  1NYQ A;  1TTN A;  2KK8 A;  2XBB C;  1J0G A;  4GLS C;  4LJP B;  1ZP0 B;  3L17 A;  1XCT L;  4WJQ A;  1D5X C;  1JW9 D;  1SBB B;  1VZ7 A;  4JPS A;  2MBO A;  2A5U A;  4ARC A;  2KYW A;  4URK A;  2FUH B;  4ANX A;  4C00 A;  2RSU A;  4N58 A;  3AEG B;  3PVL A;  3VQI A;  2I38 A;  3KYD D;  3H6N A;  3PZD A;  3TL5 A;  2YVC A;  5AUI A;  4L2Y A;  2L7R A;  2VZK D;  1HEZ E;  2ZZP B;  3HM3 A;  3Q3J A;  3JW0 X;  2KDI A;  3BZD B;  1SSN A;  2NR2 A;  4O1N A;  2LXA A;  1WXS A;  2OHF A;  2M17 A;  4HJK A;  2K6Q A;  3DVG Y;  2D3A A;  1DOX A;  4II2 B;  2FNJ B;  4S17 A;  1JRO A;  2L76 A;  2CHX A;  4RMA A;  2PJH A;  2L00 B;  3R8B A;  1N5W A;  1TS5 A;  3DWM A;  3ZJU A;  4LJO B;  1C4P A;  3SDL C;  1HZ6 A;  3MJW A;  1WMH A;  1AW7 A;  1WSP A;  1E8X A;  1EO6 A;  2KHW B;  3Q3M C;  1ZUD 2;  4HRO A;  2RMM A;  1UZX B;  3R2I A;  2ICI A;  2KD0 A;  4WWN A;  1GC7 A;  2G1E A;  3N1Y C;  4B9K A;  1GNU A;  3UIP B;  4M00 A;  4EEW A;  3MC0 B;  4MGY E;  1WE6 A;  4K7W A;  2OJW A;  2LJ5 A;  1BML C;  1L0V B;  3AU4 A;  4LCD E;  3TIX A;  1WI0 A;  1KLG D;  4YSX B;  1FCC C;  4FN2 A;  3MTN B;  2LGI A;  2MP2 A;  3B2G A;  4J6I A;  2AL6 A;  2SEB D;  4A90 A;  2W55 A;  2EMS A;  3DQV A;  4LNO A;  3Q8C A;  3VXW A;  2D3G A;  1AYF A;  1I7H A;  3C0R B;  4P16 A;  1FMA D;  4F7Z A;  4LTU A;  3PRZ A;  1B9R A;  4A3O A;  2W3S A;  3LDZ E;  1WX8 A;  2KTR A;  2CHZ A;  3MFG A;  2K9X A;  4C4V A;  2J0J A;  1LO5 D;  4AOF A;  3W1S C;  5MPO A;  2JU6 X;  2BB5 A;  5TSS A;  1DYQ A;  3W1S A;  3JSV A;  4RNA A;  2K6D B;  1YD8 U;  4DHJ D;  4P6V F;  2ZVN A;  3V61 A;  5HG2 A;  2MJE A;  1NBF C;  4Q2J A;  4N59 A;  2WU2 B;  1RYJ A;  3DBR B;  1STE A;  2JPH A;  1QQR A;  2DBY A;  2DYO A;  3H7P B;  1VR9 A;  4LDT B;  1N63 A;  1SF0 A;  1LFD A;  3MP9 A;  2W9N A;  4NQL B;  2GBR A;  2Z8L A;  3N1Z C;  5C1Z A;  2LHD A;  2ONQ A;  5C3J B;  1JRP A;  1KF6 B;  3RFZ B;  1C1Y B;  1EWC A;  3A4S C;  4NAW B;  5EE1 A;  3DHH C;  4DDI D;  2INC C;  3W5U B;  3NG0 A;  3P4S B;  2CKH B;  3U2S C;  3ZXV A;  4F1S A;  4KZC A;  3E56 A;  2WU5 B;  1U4A A;  2PE6 B;  4BBN C;  2PEA A;  2KO3 A;  2PW9 A;  4YTM B;  1A70 A;  1MVK A;  5IKC M;  1WM2 A;  5BMI A;  1TS3 A;  1SE3 A;  2REX A;  3DDC B;  1CZP A;  2N9P C;  2K3U A;  2LHE A;  3IAM 1;  2QJL A;  3AE5 B;  3V62 A;  2KC1 A;  1NYR A;  2KXJ A;  3ZJV A;  2K39 A;  3RYT A;  2G9H D;  2WXP A;  3P1M A;  5J18 A;  1WR1 A;  4DHZ B;  2MW5 A;  2LVP A;  2OED A;  4NZL B;  2C9W B;  1YQ3 B;  3WA0 A;  1F52 A;  4C56 C;  2EKE C;  1ACC A;  4KKI A;  5LXH A;  3U7D A;  2FUG 1;  5C23 A;  2HJ1 A;  3ZNZ B;  3OJ3 A;  1V5T A;  3QK0 A;  4B0M A;  3C8Y A;  4I6P A;  2D07 B;  2KJH B;  4PYZ A;  3EA6 A;  2IDY A;  1XT9 B;  2PVO D;  1EU3 A;  1V9J A;  4AJW A;  5CX3 A;  1F2R C;  3NHE B;  3FAH A;  3ZTD A;  1JML A;  3KQ4 A;  2NBV B;  4MT5 A;  4XC2 A;  2LVQ A;  5E6P A;  1IPG A;  1KH0 A;  3PZ7 A;  2PPH A;  3UIO B;  3T8M A;  1EF5 A;  4P7I A;  3AI5 A;  3RNC C;  3AE9 B;  2HE7 A;  1R4N B;  3IT4 B;  2WGS A;  3PPA A;  2K8B A;  1K8R B;  3FIL A;  4NAM A;  4MM3 A;  1BT0 A;  2BWF A;  1FFU A;  1T0Q C;  3AU5 A;  3P4R B;  3RNA C;  4W9L A;  3QX1 A;  4IM0 A;  5JH5 C;  1ROE A;  1J7A A;  1CK1 A;  2Z0D B;  2JY6 A;  4AUQ C;  2MBB B;  3ZNH B;  4ZRK A;  2KAC A;  1RM6 C;  4JLC A;  2ZPN A;  4FJY A;  2BT6 A;  3B0A A;  2SAK A;  4KZ0 A;  2AQ2 B;  2LGX A;  4C80 A;  4XDD A;  3KH0 A;  1Z2M A;  3HVD A;  1LXD A;  4GMV A;  4HDO A;  1UNS A;  4B0E A;  4RM8 A;  3AE2 B;  3HK0 A;  1TKY A;  3ALB A;  1K52 A;  3QC8 B;  1TJE A;  3Q3F A;  1IP9 A;  2KX0 A;  2BS4 B;  1I4H A;  1UWM A;  1J8C A;  4N6E B;  1N6Z A;  3OJ4 B;  3OWE B;  1MG8 A;  1RLF A;  1UBI A;  3ZUN A;  1WYW B;  1OQR A;  4K81 A;  1AN8 A;  3W1Y A;  2LZ6 A;  4JWS C;  5EDS A;  2DNF A;  4W9H A;  4MH0 E;  3N3K B;  2L05 A;  3AB5 A;  4LNI A;  5HHD G;  1F0Z A;  2ZW1 A;  3ETR A;  4BVU C;  5G5H A;  2WWZ A;  1ZE3 D;  2IO2 B;  3A9J B;  2IGD A;  1WX9 A;  2B3A A;  2WXO A;  1UUP A;  2N1V A;  3BIN A;  1TY0 A;  4IOI E;  4KDI C;  2X38 A;  2QIL A;  3DBL B;  2WXK A;  1TGZ B;  3GB1 A;  1YX5 B;  3A1Q A;  1GG3 A;  2BS3 B;  4KVG B;  2BVC A;  4BOS C;  2N7J A;  2RGF A;  3UIN B;  1MHH E;  1EF1 A;  1UEL A;  3X23 A;  2IGH A;  4II3 B;  4ZYN A;  4DWF A;  4PK1 A;  4RFB A;  3WAN A;  3RUL A;  1SE4 A;  5JXV A;  3LYY A;  1D3Z A;  2AL3 A;  2Q5W D;  4N9F 4;  1IBX A;  1SE2 A;  1T6B X;  2M4N A;  4YSY B;  2BTE A;  2KMA A;  3CSF A;  1T0Y A;  1T0S C;  1XCQ L;  3L0W B;  3NZ3 A;  1V49 A;  4P1C C;  2Z0E B;  3ABV B;  5IAA C;  1MPE A;  2M8S A;  2KLC A;  5AZF A;  4FXC A;  3VAW A;  2AYO B;  3MC8 A;  2FIF A;  1TIF A;  2D2Q A;  1ET9 A;  1PGA A;  3RNB C;  4RGN A;  3PLV A;  3AE3 B;  2AWT A;  1Q5W B;  1ZPS A;  2LRW A;  1RRB A;  1UD7 A;  1QLB B;  1GB4 A;  3M95 A;  1I4X A;  3SEB A;  2RPQ A;  1KM7 A;  2DAF A;  1WGR A;  1EM7 A;  2L1A A;  4IM3 A;  4K1R B;  3ZLZ A;  2BF8 B;  2ZW0 A;  1VDV A;  2C7N B;  3IAS 1;  4OHJ A;  2KMC A;  4KIK A;  4HVB A;  4A20 A;  3DBR I;  5CHF A;  5D6J B;  3LXF A;  3L10 B;  3L08 A;  1R4M B;  5D2M B;  4CO7 A;  1N5X A;  4FHJ A;  5EE3 A;  3DHI C;  3HUI A;  1HZ5 A;  2DZI A;  1T0R C;  3PT2 B;  1F2R I;  4XDC A;  3ZNG C;  2LFI A;  4GIV A;  1FNU A;  2XK5 A;  2UU7 A;  2KWV B;  3P4P B;  3NJT A;  2K1F A;  3LB8 C;  2QDF A;  1EWY C;  1WJ6 A;  3ZW3 A;  4GN1 A;  5HI1 A;  2KKC A;  2WNM A;  3SU8 X;  2MRP A;  1WRI A;  1BXT A;  2BKF A;  4WUR A;  1N62 A;  4MEL A;  2IO3 B;  3T3N A;  2AEH A;  4GXB A;  2LEK A;  2IY0 B;  1V97 A;  4RF0 A;  1RFK A;  2WLB A;  1SB3 C;  1WMH B;  3PHX B;  4AJY B;  4FLH A;  4OVV A;  4HEA 1;  4GDK A;  2GBK A;  4HK2 A;  1QT9 A;  2HTH A;  4LLG M;  1MJD A;  4KGR A;  3I9V 1;  4NPN A;  1FCL A;  4F8C B;  1TS4 A;  2WXQ A;  1L7Y A;  4KGS A;  4BZA A;  1FNW A;  3MHZ A;  5E6N A;  2JQR B;  4EOY A;  3OAW A;  4M01 A;  2Z59 B;  4A55 A;  4G50 A;  4WH4 A;  2WDQ B;  2MP2 B;  1NI2 A;  2NS5 A;  3ML9 A;  1ISN A;  3VUX A;  4G3X B;  3MC9 A;  2MHJ A;  2BBC A;  3BVZ A;  4DHJ B;  2LXC A;  1GAQ B;  2WDT B;  5AEK B;  1FNV A;  3Q69 A;  4LK0 M;  4M02 A;  3V05 A;  5H92 C;  2GOW A;  3DCG A;  2KTR B;  2LGS A;  3NS1 A;  4C4V B;  3TJP A;  2Y3A A;  4K7U A;  4AQ7 A;  2PIA A;  2KAJ A;  4IWQ A;  4GSW A;  2IO1 B;  1X1M A;  1C78 A;  2DLB A;  3JSV B;  4W9C A;  2IYD B;  2PVG C;  4PS7 A;  3NZU A;  1YN5 A;  3N32 A;  2ACZ B;  1HA5 A;  1PDX A;  2KZR A;  3UQA A;  1IUE A;  3IT6 B;  2LI5 A;  2Y5C A;  3VFK A;  5AZH A;  1ZXH A;  1R4N I;  1YN4 A;  4WQO B;  1NDD A;  1WE7 A;  4IWO A;  3RT3 B;  2KC2 A;  4M0W A;  1P98 A;  3R7Q A;  4AS1 A;  2MBQ A;  1L0X B;  3APF A;  3EFU A;  2BB6 A;  2R2O A;  5FK9 C;  2FCN A;  3N9Y C;  2AQ1 B;  5E6O A;  2JWZ A;  3VUY A;  1NVI D;  5DPR A;  2V4I B;  3V3X A;  2QSD A;  1E0Z A;  1OQQ A;  4K7S A; 
#chains in the Genus database with same CATH homology
 3R7R A;  4IG7 B;  2EKE C;  1Q1O A;  4EFO A;  2N7D A;  3TBL D;  2ZNV B;  5LXH A;  3KW5 B;  4M0W B;  3U7D A;  2G3Q B;  4IM2 A;  1GJZ A;  4TKN A;  3M63 B;  4I6L B;  4HWI B;  5C23 A;  4BFR A;  2N9X A;  3QAQ A;  3ZNZ B;  2PE9 A;  2L8J A;  3OJ3 A;  4ASW C;  1V80 A;  1V5T A;  5DPT A;  4BKS D;  1E8W A;  2K8C A;  3QK0 A;  4GU2 A;  4FAD A;  4I6P A;  3UGB B;  2O6V D;  1C3T A;  2D07 B;  2KJH B;  2N1W A;  4BOZ B;  4NY0 A;  2V4L A;  4EUT A;  4PYZ A;  1SGH A;  1E7V A;  1XT9 B;  2BKR B;  3K9O B;  2FCS A;  1M94 A;  4M8M A;  3JYU A;  3KUD B;  3QIJ A;  4JGH B;  1V9J A;  2KDF B;  4X57 B;  5CX3 A;  4AJW A;  1JRU A;  2L0T A;  3NHE B;  2FCQ A;  3ZRC A;  3ZTD A;  2KWU B;  2M1M A;  4DDG D;  4EKU A;  2O6V B;  2NBV B;  3QQ8 B;  4XC2 A;  1E8Z A;  3CF6 E;  2MLB A;  1WZ3 A;  2LVQ A;  2NCN A;  5E6P A;  2KN5 A;  4HPM B;  1IPG A;  1WY8 A;  4ZRI A;  1WXM A;  2K25 A;  2PPH A;  1GC6 A;  3UIO B;  2C5L C;  4MJS A;  3RZF A;  3T8M A;  4PS3 A;  2LD9 A;  2KJ6 A;  3AUL A;  1EF5 A;  2MCN B;  2L3Z A;  1Z5S B;  4P7I A;  3DVN U;  4HPL B;  2M0X A;  3AI5 A;  1WXA A;  2YLM A;  3RUI B;  1WJU A;  2HE7 A;  4E3C A;  3X0W A;  3QWZ B;  4W9E A;  4MGI E;  4FBJ B;  3PPA A;  2RD0 A;  2K8B A;  4W9D A;  1E5W A;  3WAP A;  1UGM A;  5JHA A;  1KJT A;  1K8R B;  1P9D U;  1YQB A;  3DBL I;  4MM3 A;  2KWC A;  1BT0 A;  3KUC B;  1OEY A;  2BWF A;  4ICU A;  2BGF A;  3AU5 A;  2WYQ A;  5J17 A;  1GUA B;  4W9L A;  3QX1 A;  4IM0 A;  2LVO A;  5JH5 C;  1S1Q B;  4IWP A;  2JXX A;  2Z0D B;  4ICV A;  3R3M A;  4B95 A;  2JY6 A;  4AUQ C;  4B6W A;  2MBB B;  5JZE B;  5LLI A;  3D32 A;  2JZZ A;  4ZRK A;  3ZNH B;  3APD A;  1Y8R C;  3H7S A;  4JLC A;  1HE8 A;  3ZDT A;  2ZPN A;  4WWP A;  4EZJ A;  1KOT A;  4FJY A;  1LM8 B;  3B0A A;  4WJN A;  2ZVO A;  2UYZ B;  4KZ0 A;  3KUZ A;  3GZN I;  2IO0 B;  2LGX A;  4TQ0 A;  3ECI A;  3I3T B;  4GDL A;  3WIM A;  4MJS B;  1S3S G;  1V2Y A;  2RR9 A;  5G2N A;  1V86 A;  3IHP C;  1Z2M A;  3KH0 A;  1Q0W B;  1LXD A;  2JVC A;  2KDE B;  2MBE A;  3VUW A;  4GMV A;  4HDO A;  1WJN A;  1P1A A;  4RM8 A;  3ZDM C;  3EEC A;  3HK0 A;  2ZNV C;  3UQB A;  3ALB A;  3A9J A;  4HDQ A;  1AAR A;  2I1K A;  3QC8 B;  2NBW B;  3Q3F A;  1IP9 A;  2KX0 A;  4XX5 A;  2BYV E;  2NBU A;  4BKT A;  5BO4 B;  3GOE A;  3WAM A;  4JL9 A;  1V6E A;  4M8N A;  3A9K A;  1SE9 A;  1PQS A;  4NJ7 A;  2J0K A;  3OJ4 B;  3DVG X;  3MHS D;  2CR5 A;  4EZL A;  1J8C A;  1MG8 A;  1RLF A;  1UBI A;  3ZUN A;  3RD2 A;  3V6C B;  3IG3 A;  1WYW B;  2FAZ A;  2G4S A;  3RZW C;  4ANU A;  3APC A;  4DBG A;  3DBH I;  4HXD A;  2JF5 A;  2O2V A;  4K81 A;  1V81 A;  3VTW A;  3W1Y A;  2KNB A;  5L95 C;  2LZ6 A;  2FID A;  3PLU A;  5EDS A;  4GDL B;  4W9H A;  4BKS A;  1WIA A;  4MH0 E;  1WX7 A;  2Y5B B;  2MSE D;  3N3K B;  2LUE A;  2L05 A;  2C60 A;  2O6V A;  2J7Q B;  5FR6 A;  2DX5 B;  3H9D A;  1WRD B;  5KHO A;  4E71 A;  3PRM B;  3ZTC A;  3DOW A;  2LGY A;  3M3J A;  3O65 B;  4BVU C;  1V5O A;  2WWZ A;  2IO2 B;  3A9J B;  1ZKH A;  3NZS A;  2KQ7 A;  3S2A A;  3PSE B;  2KTF A;  1WX9 A;  2B3A A;  1WXV A;  2NVU I;  5G55 A;  1E7U A;  5IA7 A;  2ZJD A;  2N1V A;  2HJ8 A;  3A9K B;  4OVU A;  3BIN A;  4AWJ A;  2L0F A;  1YIW A;  2CS4 A;  4KDI C;  5GMV A;  4GB9 A;  4PS8 A;  2LAS A;  4ANV A;  3K9P B;  4EZK A;  1TGZ B;  1UBQ A;  3AXC A;  2O2V B;  2G4D B;  3CMM B;  4FJZ A;  1YX5 B;  3A1Q A;  4MGK E;  1GG3 A;  1WGH A;  3ONS A;  4KVG B;  5CTR C;  4HCP B;  4WAA A;  2N9E B;  5JHB A;  4BOS C;  2KAN A;  1R4M I;  2RGF A;  3UIN B;  1WF9 A;  1YJ1 A;  2WX1 A;  1VD2 A;  2MA9 B;  3U8Z A;  2C7H A;  1EF1 A;  2DYB A;  4ZDV A;  2KOX A;  1UEL A;  2BYF A;  3HIZ A;  3X23 A;  4II3 B;  2DZK A;  4ZYN A;  4DWF A;  3IVF A;  3DVN V;  1WJ4 A;  1LQB A;  3L13 A;  3WAN A;  2GBM A;  3RUL A;  1J19 A;  1ZW7 A;  2BPS A;  2AL3 A;  2KJR A;  4N9F 4;  1D3Z A;  4DK5 A;  3IBE A;  3WAO A;  2G45 B;  2ZEQ A;  1I42 A;  1OGW A;  2M4N A;  1RFA A;  3EHV A;  3PRE A;  2KMA A;  3CSF A;  4TUU A;  1T0Y A;  3PRP B;  4KDL B;  1TTN A;  2KK8 A;  2XBB C;  3L0W B;  1V49 A;  3PGE A;  5D94 A;  3VH3 B;  1J0G A;  3A1Q B;  2Z0E B;  3VDZ A;  4BBN F;  4LJP B;  4PYU A;  1YX6 B;  5IAA C;  3L17 A;  2M8S A;  4WJQ A;  2KLC A;  5AZF A;  3VAW A;  3PHW B;  3M62 B;  4ZRJ A;  2AYO B;  2MBO A;  2A5U A;  3ZIM A;  1A5R A;  2FIF A;  4URK A;  2D2Q A;  5J2R A;  3VVW B;  2FUH B;  4ANX A;  2RSU A;  3PVL A;  3VQI A;  3KYD D;  3H6N A;  3PLV A;  3PZD A;  2AWT A;  3TL5 A;  2YVC A;  1E8Y A;  2OOB B;  2KFK A;  1Q5W B;  5D7G A;  5CHW A;  1QZE A;  2LRW A;  3JVZ X;  2L7R A;  4HLE A;  1RRB A;  1UD7 A;  4GGQ A;  2MBH A;  1P3Q U;  3M95 A;  2RPQ A;  3QA8 A;  2ZZP B;  2DZJ A;  1WGG A;  3HM3 A;  3Q3J A;  1KM7 A;  1TBE A;  2DAF A;  3JW0 X;  1H8C A;  1WGR A;  2KDI A;  4DHZ E;  4IM3 A;  2IBI B;  4K1R B;  3ZLZ A;  2NR2 A;  1G6J A;  1XQQ A;  1F9J A;  2BF8 B;  4NJ6 A;  2DZM A;  3ZKJ C;  5KHQ A;  2LXA A;  2LGD A;  2C7N B;  3QAR A;  1UH6 A;  1TZ1 A;  2KMC A;  3LJ3 A;  4KIK A;  4HVB A;  2V3S A;  4A20 A;  1WXS A;  3TCA A;  2OJR A;  1RAX A;  2KFJ A;  2M17 A;  4G11 A;  2K6Q A;  3DBR I;  4HJK A;  4W9K A;  3DVG Y;  3P2B A;  2CU1 A;  5CHF A;  5D6J B;  4I6N B;  4II2 B;  4W9G A;  3PTF C;  2FNJ B;  3L10 B;  2QHO A;  2L76 A;  3L08 A;  2CHX A;  4RMA A;  4W9J A;  5D2M B;  2PJH A;  2L00 B;  4TQ1 A;  3WAL A;  4CO7 A;  4FHJ A;  3U30 A;  2KFK B;  2NPT A;  2DZI A;  4LJO B;  3PT2 B;  4RM9 A;  3MJW A;  4W9I A;  3SDL C;  2ZPY A;  3PS6 A;  1WMH A;  3ZNG C;  4CHK A;  4GIV A;  2XK5 A;  1E8X A;  1EO6 A;  2KHW B;  2KWV B;  4NNJ B;  1UZX B;  2K1F A;  4IC7 B;  2DHZ A;  2KD0 A;  1WJ6 A;  3ML8 A;  4GN1 A;  4WWN A;  3ZW3 A;  1XD3 B;  1GC7 A;  2JRI B;  4B9K A;  1GNU A;  1OQY A;  2LWP A;  3UIP B;  3B1L X;  2WX0 A;  4EEW A;  2KKC A;  3IFW B;  4MGY E;  1WE6 A;  3B08 A;  2N4F A;  4K7W A;  3ZRF A;  2LJ5 A;  3TIX A;  3AU4 A;  4KIK B;  2MRP A;  4LCD E;  3SU8 X;  1WI0 A;  2VRR B;  4FA6 A;  4E74 A;  2BKF A;  4FN2 A;  2KVR A;  2R2Q A;  3MTN B;  5CHV C;  4MEL A;  2IO3 B;  4MSQ B;  2EMT A;  2MP2 A;  4J6I A;  2A4Z A;  2AEH A;  2AL6 A;  4GXB A;  2IY0 B;  4CYE A;  2ZCC A;  2NPT B;  3SHQ A;  2GBN A;  3R66 C;  2EMS A;  4KSK C;  3DQV A;  3SD5 A;  3VXW A;  1WMH B;  3VTU A;  2D3G A;  1FXT B;  2C7M B;  3C0R B;  2XK5 B;  3PHX B;  2KX3 A;  4AJY B;  4BKG A;  4FLH A;  4OVV A;  4F7Z A;  4IUM B;  2GBJ A;  2GBK A;  3PRZ A;  4GDK A;  4HK2 A;  4A3O A;  5LXI B;  2HTH A;  3H7P A;  2D10 A;  3LDZ E;  2XEW A;  5DPW A;  1WX8 A;  2KTR A;  2CHZ A;  1OTR B;  4NPN A;  2J0J A;  4AOF A;  2MQJ A;  4F8C B;  1L7Y A;  3KYC D;  3W1S C;  4TV3 A;  5E6N A;  3W1S A;  4WJP A;  4EOY A;  3QHT A;  3JSV A;  2BWE S;  3OAW A;  3HM6 X;  5DCN A;  2MX2 A;  2Z59 B;  2K6D B;  3KVF B;  1YD8 U;  3VH4 B;  4DHJ D;  2I1J A;  2ZVN A;  1I35 A;  3L54 A;  4NAW A;  1CMX B;  3OLM D;  4G50 A;  5AZG A;  3V61 A;  4IW0 A;  4WJO A;  1NBF C;  2MP2 B;  2K8H A;  1NI2 A;  4W9F A;  2NS5 A;  4XZ4 A;  4LDT D;  3DBS A;  1ISN A;  3ML9 A;  4FUL A;  3BY4 B;  3VUX A;  4MGZ E;  4G3X B;  2IZV B;  2DYM A;  4G0N B;  3L16 A;  2JPH A;  3CST A;  3NS8 A;  4DHJ B;  2LXC A;  2MWS B;  1VCB A;  2WDT B;  5AEK B;  4GDK B;  4YL8 A;  3ZVV A;  2IY1 B;  3QCA A;  2DYO A;  2GOW A;  3H7P B;  3QJZ A;  1KLV A;  1SIF A;  1WGD A;  3DCG A;  3DPD A;  2KTR B;  4LDT B;  4WWO A;  4HCN B;  1LFD A;  3TJP A;  4K7U A;  4IWQ A;  2W9N A;  2KQS A;  4GSW A;  4NQL B;  3UF8 A;  2GBR A;  2IO1 B;  4NQK E;  1X1M A;  2N7E A;  5C1Z A;  1P0R A;  1H4R A;  3JSV B;  2V1Y A;  1E90 A;  2GMI C;  3NOB A;  3NY5 A;  4W9C A;  2IYD B;  4PS7 A;  2DAJ A;  3NZU A;  3A33 B;  3N32 A;  5L83 A;  1C1Y B;  4NAW B;  3A4S C;  2KZR A;  4FHK A;  2JUO A;  2BYE A;  4DDI D;  3UQA A;  3PV1 A;  4AP4 C;  5HKH A;  3N30 A;  2LI5 A;  3ENE A;  4A3P A;  2JT4 B;  3VFK A;  4JIO U;  5AZH A;  2CKH B;  1WH3 A;  3H1U A;  1OEY J;  1R4N I;  2J0M A;  4GOC A;  4WQO B;  1NDD A;  1WE7 A;  4IWO A;  3RT3 B;  4F1S A;  1WZ0 A;  2KC2 A;  5TR5 A;  1WR6 E;  4KZC A;  1EUV B;  1P98 A;  4MSM B;  2JRH A;  2KLG A;  3R7Q A;  1U4A A;  2MBQ A;  2PE6 B;  2UWQ A;  4BBN C;  2PEA A;  3TMP B;  3VTV A;  1WGY A;  2KO3 A;  3V6E B;  3APF A;  3EFU A;  3ZNI D;  4ANW A;  2ZCB A;  5DPS A;  2R2O A;  3EC8 A;  3VHT C;  1WM2 A;  2FCN A;  3HHM A;  4DXA B;  1L2N A;  2JZ3 B;  2FCM A;  2CHW A;  2REX A;  3DDC B;  2DEN B;  2ASQ A;  2N9P C;  2HD5 B;  2LRU A;  3V62 A;  2KC1 A;  1WM3 A;  2KXJ A;  4KSL C;  1ZGU B;  2D11 A;  2KDB A;  2K39 A;  5E6O A;  3V60 A;  3RCZ A;  3RYT A;  4FJV B;  2JWZ A;  4JQW C;  3VUY A;  1IYF A;  5DPR A;  5J18 A;  1WR1 A;  1WFY A;  3T9L A;  4DHZ B;  4KV2 A;  2MW5 A;  2LVP A;  4MEM A;  2C9W B;  4K7S A;  3WA0 A;  3ZO5 B;  3A4R A;  4MDK E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...