1WX7A

Solution structure of the n-terminal ubiquitin-like domain in the human ubiquilin 3 (ubqln3)
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
106
structure length
106
Chain Sequence
GSSGSSGSPAPVQDPHLIKVTVKTPKDKEDFSVTDTCTIQQLKEEISQRFKAHPDQLVLIFAGKILKDPDSLAQCGVRDGLTVHLVIKRQHRAMGNECPASGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution Structure of the N-terminal Ubiquitin-like Domain in the Human Ubiquilin 3 (UBQLN3)
rcsb
source organism Homo sapiens
molecule tags Structural genomics, unknown function
molecule keywords Ubiquilin 3
total genus 13
structure length 106
sequence length 106
ec nomenclature
pdb deposition date 2005-01-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00240 ubiquitin Ubiquitin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 1wx7A01
4GOCA 1P1AA 3H6NA 2FIDA 2KQSA 5CX3A 1WE6A 2IO2B 4LCDE 4WJQA 2N1WA 1LFDA 2MBOA 5G2NA 3WANA 5JZEB 4IG7B 1YQBA 4K7UA 4BKSA 2Y5BB 4J6IA 3EHVA 3A1QB 3UINB 3ZVVA 1V9JA 2MWSB 3QA8A 4F8CB 4CO7A 1V86A 5CHWA 3ZNZB 3V6CB 4CHKA 3TL5A 3DVGY 2BYFA 1KLVA 4FULA 3PHXB 3ZTDA 4BOZB 3JW0X 4JL9A 4KZCA 3M95A 1VCBA 1YD8U 3A9KA 3PRPB 2MA9B 4NQLB 3V6EB 4WJOA 3ZTCA 3LDZE 1AARA 2L0TA 3MJWA 4EZLA 1GUAB 3BY4B 1Q5WB 4II2B 2LWPA 4IUMB 4OVUA 4ANUA 2ZCBA 1I42A 4IM0A 4W9LA 2DYMA 3JSVB 4HDQA 1GJZA 1UH6A 1NDDA 1WGHA 1XQQA 4GMVA 4E3CA 1V49A 4GIVA 4KIKA 1P0RA 2M4NA 4KZ0A 3NS8A 3JVZX 3K9PB 4MGYE 1FXTB 3ZDTA 2N9PC 3NHEB 4DK5A 3OLMD 3R3MA 5L95C 1ISNA 3U8ZA 3H7PA 1P98A 2KDFB 1NBFC 3W1YA 2CR5A 2HD5B 3IFWB 4HJKA 2IBIB 4ANXA 3B1LX 4ICUA 4PS3A 4EZKA 4BBNC 4EOYA 1OQYA 4WWOA 2AL3A 3MTNB 4E74A 1P3QU 2BYVE 4MJSB 3DBHI 3H1UA 2KFJA 1T0YA 4EZJA 4AWJA 1TGZB 5E6OA 1U4AA 1WGYA 3CSTA 4A3OA 4NQKE 4TUUA 2CHZA 4W9GA 1RFAA 4IWPA 3GZNI 2CU1A 3Q3FA 2KC2A 1OEYA 2O6VB 3HM6X 1S3SG 2EMTA 2G4DB 2K8BA 2LRWA 4MSQB 2KMAA 2QHOA 1X1MA 3PRMB 2ASQA 3ECIA 2GBMA 4PYUA 4E71A 2N7EA 2O6VD 3QHTA 1IYFA 4ICVA 3V62A 3W1SA 4BKTA 1RRBA 4JLCA 5L83A 3ZDMC 2I1JA 3QC8B 2NS5A 3A9KB 2HE7A 1E8WA 1CMXB 3TJPA 3VTUA 4B6WA 4HLEA 3VXWA 2FCMA 3OJ3A 4N9F4 3HIZA 4GDKB 3SD5A 1V80A 1WJ4A 4M8MA 2CKHB 2RD0A 1UBIA 1YIWA 1K8RB 1S1QB 3DPDA 1BT0A 2K39A 4M0WB 4DHZE 3DVGX 2DZJA 4I6LB 2BF8B 4RMAA 3VUWA 2R2OA 2JT4B 5DPSA 1NI2A 3KUDB 2M17A 2C7NB 2OJRA 2BKRB 2RSUA 2C7HA 2FCQA 5DPTA 4WWPA 4YL8A 5J17A 2NVUI 2JRIB 3ZRCA 2BKFA 1L7YA 4TKNA 2AYOB 1PQSA 4FN2A 1OEYJ 3B0AA 1XT9B 2KC1A 2GMIC 2KDEB 1I35A 4URKA 3PS6A 4FBJB 3QCAA 1TTNA 2GBRA 3R7QA 4PYZA 1E8YA 4AOFA 4FLHA 4WWNA 3ZNID 3L17A 4BVUC 4DBGA 4RM9A 4A3PA 2DZMA 4DWFA 3VH4B 5DCNA 3ZUNA 3QARA 2D3GA 4PS7A 4ZYNA 3ZIMA 1WMHA 2WDTB 1YX6B 4B9KA 2YLMA 3N3KB 2WX0A 1EO6A 3PSEB 4ZDVA 3H9DA 4KIKB 1SE9A 2MCNB 4TQ0A 1V6EA 2BGFA 3UQAA 3T8MA 5GMVA 3QQ8B 3ZNGC 3PT2B 3M3JA 2BWES 4A20A 3M63B 3VDZA 5E6PA 2KQ7A 3KW5B 2DYOA 4II3B 4HPLB 3IHPC 1EF5A 1OTRB 1JRUA 4K81A 5JHBA 3CF6E 2K1FA 3PZDA 3A33B 3KVFB 1V5TA 4NPNA 1UD7A 2EMSA 2KWUB 1WIAA 4ZRKA 3PLVA 3KH0A 3I3TB 2JF5A 2KWVB 1L2NA 3UGBB 3S2AA 3VAWA 3RUIB 2LGYA 1EF1A 2DX5B 1WXVA 2KJ6A 1A5RA 3A1QA 4I6NB 1WXSA 5C23A 4BKGA 3DVNU 3PGEA 4BFRA 1UELA 3RCZA 3L10B 3K9OB 3EECA 3L13A 2KTFA 1LM8B 2L0FA 3V61A 5TR5A 3H7SA 1GG3A 2JZZA 3DDCB 4GDLA 2PEAA 1WI0A 5J18A 3IBEA 4JGHB 3DBSA 3VH3B 2LVPA 2D2QA 2ZVNA 2C5LC 2J0KA 2ZPNA 4LJPB 4LJOB 2XK5A 3JSVA 1E7VA 2G45B 2NBWB 2Z0EB 4G0NB 3AXCA 2L00B 2HJ8A 4GN1A 2KO3A 2KJHB 3PPAA 4NNJB 3MHSD 2MBEA 3OAWA 3PV1A 2XK5B 3X0WA 2JPHA 1KOTA 2IZVB 2Z59B 3EC8A 4DDID 2ZNVC 2KNBA 5HKHA 1Z2MA 4FJVB 1WRDB 4FHKA 3O65B 3U7DA 4DDGD 2REXA 3KYDD 2LD9A 4MDKE 3QX1A 1WYWB 2DHZA 1UBQA 4HPMB 3A9JB 2IY0B 5CHFA 5FR6A 5KHOA 3TIXA 3WAPA 4P7IA 1V2YA 2RPQA 4GDKA 2C9WB 3W1SC 1UZXB 4XZ4A 2DZKA 1WM3A 4HWIB 2ZNVB 2W9NA 1WJ6A 2M0XA 3AULA 3VQIA 3L54A 2CHXA 3HM3A 3ML9A 3Q3JA 4GB9A 3PHWB 5IA7A 3APFA 4MJSA 3VUYA 2N4FA 4NY0A 1WY8A 4GU2A 3WALA 2CS4A 1KM7A 3PREA 2KD0A 3T9LA 3ZW3A 3QJZA 2PJHA 4WQOB 2FCSA 3RD2A 1WR1A 1WR6E 2G4SA 1H4RA 4K7WA 4MGIE 2KJRA 2KLCA 2J0JA 2AEHA 3DCGA 1E7UA 1R4NI 2KMCA 2DAJA 3ZNHB 2K6QA 2IO1B 4IW0A 5JHAA 1Y8RC 2O2VA 2KXJA 4JIOU 5DPWA 2J0MA 1RAXA 4KSLC 5KHQA 5D2MB 5G55A 1J19A 2JZ3B 2IO0B 1Z5SB 2MQJA 2LUEA 1OGWA 1WX8A 3LJ3A 4HDOA 1WFYA 3VHTC 4DHZB 4F1SA 3ALBA 2MLBA 4MSMB 2KZRA 2LASA 4KSKC 4NAWA 3NZSA 4AP4C 4HK2A 2BYEA 3ONSA 4EEWA 4K7SA 3U30A 3AU5A 4IM2A 4KDIC 4WJNA 4ASWC 2JVCA 3ZKJC 3ZRFA 2KTRA 4ZRIA 1C1YB 2MRPA 2D10A 3UQBA 2FIFA 4W9IA 2GBKA 1WZ3A 1WXMA 2LGXA 2MP2A 2LRUA 1WX7A 4MM3A 4DXAB 4ANWA 3TMPB 1WJUA 3M62B 4IC7B 4I6PA 4XC2A 3UF8A 4MGKE 4W9CA 2OOBB 5D94A 2Z0DB 3DBRI 1GC6A 1WGDA 2LI5A 2KANA 4DHJD 3IG3A 4NAWB 1WH3A 3RYTA 4W9KA 3JYUA 1C3TA 3PVLA 1J8CA 2LXAA 2KK8A 3N32A 3NOBA 2KDBA 2WYQA 3X23A 1J0GA 2ZZPB 4RM8A 2UWQA 2C7MB 2CHWA 3CSFA 3L0WB 3WAOA 3R7RA 5DPRA 4HCNB 2JUOA 2KVRA 3IVFA 2NPTB 1V5OA 3WAMA 2DZIA 2MBQA 3OJ4B 2AL6A 1HE8A 1LXDA 2O6VA 1P9DU 3QAQA 3L08A 4X57B 2D07B 3AI5A 3BINA 4GXBA 2L8JA 2EKEC 3UIOB 2LJ5A 3RT3B 2L05A 3QIJA 2KX3A 3PTFC 5CHVC 4GSWA 4DHJB 2K8CA 2C60A 4HVBA 5IAAC 3VUXA 4PS8A 3DOWA 1WE7A 4KVGB 2KDIA 4G3XB 2A4ZA 1F9JA 2KFKB 1VD2A 1WXAA 1H8CA 4WJPA 2MSED 2N9XA 2MX2A 2GBNA 4EUTA 3NY5A 2NBVB 2ZEQA 4FJYA 4LDTD 2MBBB 3SU8X 2FCNA 4FJZA 4B95A 3EFUA 5CTRC 5LXIB 3ZO5B 1G6JA 4OVVA 2JXXA 5D6JB 2NBUA 3QWZB 1WJNA 3RZFA 4BKSD 3VFKA 1KJTA 2V4LA 1UGMA 2G3QB 1TZ1A 2KLGA 2YVCA 4W9EA 4W9JA 3WIMA 2KTRB 2UYZB 5EDSA 4XX5A 3DBLI 4ZRJA 1WZ0A 1E90A 2DAFA 2LGDA 4M8NA 3NZUA 2MBHA 3A4SC 5C1ZA 3C0RB 3PRZA 2MW5A 3RZWC 3D32A 4AJWA 2NPTA 1YX5B 1EUVB 1RLFA 1LQBA 4EKUA 4G11A 4W9HA 2XEWA 3CMMB 1E5WA 4HCPB 2JRHA 2LVQA 4HXDA 4IM3A 1ZW7A 1IP9A 5AZHA 4BBNF 1IPGA 1WF9A 2IO3B 1Q0WB 2O2VB 4NJ7A 5E6NA 1ZGUB 3QK0A 5LLIA 4LDTB 5JH5C 2DENB 3UIPB 3P2BA 3H7PB 2ZVOA 4MELA 1E8ZA 4CYEA 2FNJB 1ZKHA 3PLUA 1QZEA 2V1YA 2XBBC 4G50A 4GGQA 4GDLB 1XD3B 1MG8A 2I1KA 1M94A 4MEMA 3HHMA 3R66C 4IWQA 4AUQC 4EFOA 2GOWA 2MP2B 2AWTA 3DVNV 4KDLB 1GNUA 2ZJDA 1R4MI 2WWZA 3HK0A 2ZCCA 3APDA 3ENEA 4ANVA 1D3ZA 4TV3A 4WAAA 3KUZA 4JQWC 2N7DA 2M8SA 2BWFA 3VTWA 2RR9A 1E8XA 2LXCA 1GC7A 2J7QB 2L76A 2VRRB 3ZLZA 4TQ1A 2RGFA 5D7GA 2L7RA 5AZGA 4FHJA 3WA0A 1SGHA 3B08A 3DQVA 1WGRA 3RULA 3GOEA 2JWZA 2V3SA 2KHWB 2PE9A 3A4RA 2KFKA 2N1VA 2DYBA 3AU4A 3KYCD 1Q1OA 2L3ZA 2BPSA 2NCNA 3A9JA 5AZFA 2K25A 2PE6B 4MGZE 4IWOA 2K8HA 2D11A 4FADA 1YJ1A 3APCA 2ZPYA 2KWCA 3V60A 4FA6A 5J2RA 2IYDB 4AJYB 1SIFA 2KOXA 4F7ZA 2N9EB 2IY1B 4W9FA 2KN5A 4BOSC 5AEKB 3SDLC 3KUCB 1V81A 1WMHB 2JY6A 2LVOA 3VTVA 1WM2A 4K1RB 2LZ6A 3ML8A 1WX9A 3SHQA 3L16A 3VVWB 4NJ6A 2R2QA 2K6DB 5LXHA 3N30A 4MH0E 2B3AA 2NR2A 2M1MA 1TBEA 3TBLD 4KV2A 2GBJA 2PPHA 2A5UA 5BO4B 2KX0A 2WX1A 2HTHA 2KKCA 4W9DA 1WGGA 2FAZA 2FUHB 3TCAA
chains in the Genus database with same CATH superfamily
1P1AA 3H6NA 2K3UA 1WE6A 3NVZA 1LFDA 3WANA 4J6IA 3UINB 2MWSB 2BB5A 3ZNZB 3TL5A 1SIJA 3M95A 2RPVA 4WJOA 4II2B 4OVUA 1I42A 4C7YA 1AWDA 1ZXIA 2NMQA 1T3QA 4W9LA 2DYMA 1WWTA 4M00A 4LNIA 1NDDA 1XQQA 2LEKA 1L0XB 2RDBC 2W3RA 3OLMD 2KDFB 3W1YA 1YNTE 1TT5B 3IXSA 4ICUA 4PS3A 4WWOA 1NYQA 2N9KA 2PLPA 3H1UA 1U4AA 3ZJTA 4DXFA 2GI9A 2CHZA 1E0ZA 2CU1A 2BS4B 2O6VB 3GP7A 1S3SG 5H92C 2K8BA 4XWWA 4HKZE 4US8A 5TSSA 2JYTA 1KLUD 1RRBA 4LNKA 2NS5A 1F1HA 3A9KB 1CMXB 4HLEA 2FCMA 2PKOA 3OJ3A 4N9F4 3SD5A 4GDKB 2BTEA 4C4VB 1UBIA 4M0WB 3DVGX 2DZJA 2BF8B 2JXTA 4RMAA 3VUWA 2PTLA 5DPSA 3KUDB 1I4XA 2OJRA 1XLNA 4YL8A 1FFUA 3DWMA 4TKNA 4FN2A 1OEYJ 4L1BA 2SEBD 1I35A 3PS6A 1UF0A 5IKCM 4AOFA 4BVUC 2WXHA 3IAS1 4DWFA 3ZUNA 3QARA 4ZYNA 4C00A 1QT9A 1EO6A 1SE3A 3T8MA 2EKIA 1AYFA 3M3JA 1FO4A 2IJ0A 5E6PA 2KQ7A 1I4RA 2DYOA 1EF5A 1OTRB 1K53A 5JHBA 3PZDA 2WDVB 3A33B 2JSVX 4NPNA 4ZRKA 3I3TB 2Y3AA 1PGBA 2KAJA 1I4QA 2JF5A 1QKZA 1JWUD 1WXVA 2IDYA 1ZUD2 4BFRA 3RCZA 3K9OB 3V61A 5TR5A 3NZ3A 3DDCB 1TYGB 4YTMB 3P4RB 4B0EA 2D2QA 1R4NB 2ZPNA 3T3OA 2XK5A 3JSVA 2CJOA 4GN1A 2HJ8A 1D4BA 1C79A 1GAQB 3PPAA 1GB1A 4YTNB 1K52A 1KF6B 1KOTA 2IZVB 3EC8A 1SB3C 2KNBA 5HKHA 1B9RA 4IOIE 2DLBA 3O65B 5G5HA 5C2TB 2REXA 3KYDD 4MDKE 3RNBC 1R4MB 3ABVB 2WS3B 5KHOA 5FR6A 4P7IA 3W1SC 1UZXB 4XZ4A 3MC9A 4HWIB 2ZNVB 2W9NA 1WJ6A 2WXPA 2CHXA 3APFA 3VUYA 3PREA 3T9LA 2BYTA 3ZW3A 3AB5A 2FCSA 3LYYA 1WR6E 3RPFC 4REZA 2PIAA 3ZJUA 4WH4A 3DCGA 1R4NI 3AEBB 2NTSA 2BVCA 2KXJA 5DPWA 4KSLC 3FKYA 2DBYA 2IO0B 1OGWA 3VHTC 3FC4A 3N1XC 3ALBA 4A9AA 4KSKC 4NAWA 4P6VF 3NZSA 2BYEA 3ONSA 3Q8CA 2DNFA 1XCQL 3KLSX 1KLGD 1D5MC 1PYWD 2KTRA 1C1YB 3UQBA 2FIFA 3V3XA 3BZDB 1WZ3A 2LGXA 4I6PA 3AEFB 3Q14C 3IG3A 1C3TA 2G9HD 2LXAA 1TY0A 3X23A 4ZRQA 4RM8A 2UWQA 4HCNB 1V5OA 2KN4A 2DZIA 2MBQA 1P9DU 4RCOA 1QOBA 4X57B 1IBXA 3UIOB 3PTFC 4DHJB 5IAAC 1GB4A 3DOWA 1VD2A 5AUIA 3TEWA 4WJPA 3AEGB 2M19A 3NY5A 2JXXA 4C7ZA 2Y5PA 3QWZB 5BYQA 3RZFA 1I4PA 2ZW0A 1XXGA 2G3QB 2UYZB 3DBLI 5GXGB 2LGDA 1L0VB 4KKIA 2W54A 3C0RB 3PRZA 1L4DB 2MW5A 3D32A 3EUB2 3L4PA 3Q2AC 1EUVB 2ICIA 4IDIA 4EKUA 4G11A 1D5ZC 1WGKA 2XEWA 3CMMB 4HCPB 4HXDA 1ZW7A 4BBNF 2IO3B 1ZGUB 4Q2JA 4BAXA 2DENB 3P2BA 2I2YA 2ZVOA 4S17A 4ARCA 4GGQA 1KRHA 2V1YA 5HFYA 4ACFA 1MG8A 1JWBD 1BUIC 3R66C 3LXFA 2GOWA 2MP2B 3NVWA 2AWTA 3DVNV 2ZJDA 3APDA 3ENEA 4ANVA 4TV3A 2WU2B 4TMAB 4XWTA 4JQWC 2M8SA 3U4EG 3VRBB 2L76A 5D7GA 4FHJA 1ROEA 3GOEA 2V3SA 1SBBB 1Q1OA 2V4IB 3BVZA 2BPSA 2NCNA 3A9JA 2K25A 4IWOA 2K8HA 3NVVA 2D11A 3V60A 2INPE 4FA6A 3Q8AA 1DOIA 4W9FA 3P4SB 3MJ5A 3KUCB 1WMHB 4K1RB 4B0MA 4WQMA 1SF0A 1WX9A 1VLBA 3SHQA 3MFGA 3N30A 2NR2A 5G5GA 4YSXB 2PPHA 2K22A 3DHHC 1YN5A 1DOYA 1NYRA 2KX0A 2HTHA 3AE7B 2FIDA 3U7ZA 2ACZB 1SSNA 5G2NA 1EU3A 4BKSA 4YTPB 4KGRA 1FCLA 1FM0D 2VH2A 4K3BA 3EFCA 1F52A 4CO7A 1TS2A 3DVGY 3WCQA 2BYFA 5LNK1 4JL9A 4KZCA 2INNE 1ACCA 1BMLC 3HVDA 3Q3OC 2MA9B 4NQLB 1YN3A 3SFDB 4LNNA 3RMKC 3ZTCA 3MJWA 3BY4B 4NZLB 4IM0A 4HDQA 3PO0A 4GMVA 2M4NA 3NHEB 4DK5A 4ZRPA 1ISNA 3U8ZA 3H7PA 2HD5B 3HRDD 3B1LX 1NENB 3Q69A 4EZKA 3NRZA 4BBNC 3TSSA 1L0YB 1P3QU 1ZPSA 3DBHI 2WHIA 1T0YA 4AWJA 1TGZB 3CSTA 1OQRA 4IWPA 3GZNI 3KQ4A 4LK0M 1OEYA 3HM6X 4MSQB 3PZ8A 3B2GA 1XLQA 1X1MA 3PRMB 1UUPA 3VRAB 2ASQA 2GBMA 2KQ4X 1I4GA 3QHTA 4BKTA 4JLCA 3PZ7A 2D3BA 2I1JA 3QC8B 4AS1A 2BS2B 1VZ8A 1HA5A 1V80A 4M8MA 2RD0A 1K8RB 3DPDA 1SE4A 4JPSA 4M02A 4OHJA 2R2OA 4OZAA 3NVYA 2RSUA 2B76B 5DPTA 2V3NA 2BKFA 1L7YA 2AYOB 1WYGA 3GZNB 2KC1A 2KDEB 4URKA 2JQRB 3QCAA 2GBRA 4H2AA 1VZ6A 1N63A 4WWNA 4DBGA 4RM9A 4A3PA 2DZMA 5DCNA 3N9YC 1WXQA 2WDTB 3I63C 1YX6B 2YLMA 1MI0A 3PSEB 2PVOD 3BK1A 2BGFA 3UQAA 2QDFA 5GMVA 3TUOA 3W5UB 1TY2A 3IHPC 1MJDA 3MC0B 2PVGC 1V5TA 1UD7A 2EMSA 3V05A 1P7FA 1L2NA 4P1CC 3UGBB 3S2AA 1NEKB 4K3CA 2Z8LA 3RUIB 1Y56A 1FXAA 2KJ6A 2WDQB 1UWMA 1WXSA 2JU6X 3PGEA 3C19A 3B9JA 2JWUA 3EECA 3L13A 2KTFA 1VDVA 4KGTA 5IOIA 4GDLA 4JGHB 2LVPA 4RH6A 3BVGA 5BMIA 4G0NB 3W2DA 3AXCA 4ZHPA 1NI3A 1ET6A 2RDGA 4KX6B 1E7PB 3X0WA 1E9MA 2Z59B 4DDID 3URYA 3NS1A 4HEA1 2LD9A 3QX1A 2HJ1A 3TIXA 3HUIA 3EA6A 1F77A 3N1ZC 4GDKA 2C9WB 1ENFA 1TKGA 4RF0A 1SEBD 3VQIA 3L54A 3ML9A 4MJSA 1WY8A 3H8HA 2PJHA 3RD2A 3SR6A 4HPPA 2FUG1 2SAKA 1QQRA 3BK2A 3TEZA 2AEHA 3R2TA 2DAJA 3ZNHB 2K6QA 2QILA 1MG4A 4JIOU 1ZP0B 5KHQA 4XE0A 1PFDA 2LUEA 1WFYA 1QILA 4DQOC 2KZRA 1WSPA 2JX5A 4P16A 4MACA 2JVCA 2V3PA 4ZRIA 2CJNA 1MHHE 2MP2A 4MM3A 1WX7A 4ANWA 2N7JA 4YWGG 3AEAB 3UF8A 4XC2A 4MGKE 4HROA 2OOBB 5D94A 3DBRI 1WGDA 2KANA 1C78A 1F2RI 3RYTA 4W9KA 2FBWB 2RDHA 1J8CA 3ZQ4A 2WXQA 4LNOA 2C7MB 2CHWA 3R7RA 1C9FA 2M56B 1C4CA 3OJ4B 3AV8A 4BZAA 1KTKA 1MFWA 4L23A 1IUEA 4NAMA 3RT3B 5CHVC 4GSWA 2K8CA 4HVBA 2INDC 3Q8FA 3VUXA 4KVGB 2AQ2B 1TIFA 1WXAA 1GOZA 4IKGA 1OFFA 3DHIC 2KMMA 1EWCA 1P7EA 4LDTD 3SU8X 4B95A 3ZO5B 3AE2B 4WAFA 3AEEB 2E6XA 4XX5A 1FXIA 4XYCA 5BMGA 2MBHA 3A4SC 1V1OA 3IT4B 4KKJA 4LNFA 1YX5B 1C77A 2JRHA 1IPGA 5FR3A 2O2VB 5E6NA 3QK0A 3UIPB 3VR8B 4CYEA 1SJHD 1ZKHA 3PLUA 3OWEB 4G50A 4GDLB 5I4DA 1I7HA 4RF1A 4IWQA 4AUQC 1PGXA 2QIEB 2W55A 2WWZA 3AM9A 1VR9A 2LXCA 2J7QB 2VRRB 3ZLZA 2RGFA 2MHJA 1N62A 2E3TA 1JWSD 5AZGA 3DWGC 3WA0A 1SGHA 3B08A 2PE9A 3KYCD 2PE6B 1V1PA 2GRIA 2BS3B 4FADA 1FRRA 2LMCA 2KWCA 2IYDB 3O13A 5HG2A 2KN5A 1I4HA 3SDLC 3W9CB 1BXTA 3ZJVA 3VVWB 1E10A 5LXHA 4MH0E 1N5WA 2B3AA 3RFZB 2M1MA 3AE1B 1TBEA 1L6VA 1J7AA 1JROA 1WGGA 2X8XX 3TCAA 2X38A 1TJEA 2KQSA 5CX3A 2IO2B 4LCDE 2N1WA 2MBOA 1R7SA 4IG7B 1YQBA 4MM3B 2Y5BB 3A1QB 1V9JA 4F8CB 3P42A 5CHWA 3V6CB 3C8YA 1QLBB 2IGDA 3KWLA 1KLVA 4FULA 3ZTDA 3JW0X 2BBCA 1VCBA 3PRPB 3V6EB 1AARA 4EZLA 1GUAB 1Q5WB 5HHDG 4KGSA 5AUKA 4ANUA 4C80A 1XEEA 2KYWA 2ZCBA 4A55A 2OJWA 3Q8BA 3JSVB 1GJZA 1UH6A 2QJLA 1WGHA 4E3CA 4GIVA 4KIKA 2BB6A 3DBHB 3NS8A 3TEXA 1C4PA 3AN1A 5L95C 3IT6B 3UI3A 1EM7A 3IFWB 2IBIB 4ANXA 2R61A 2KWDA 1IGDA 2TSSA 3MTNB 4E74A 1LGRA 1ZDXA 1PGAA 2BYVE 2RMMA 4MJSB 4A3OA 4NQKE 2WDRB 4W9GA 1RFAA 2KC2A 4S0RA 2EMTA 4RGOS 2KMAA 2QHOA 2XN9C 2O6VD 4OZBA 1IYFA 5L83A 5EE9A 2ON8A 3ZDMC 2KVZA 2WP9B 2HE7A 3TJPA 3VTUA 4B6WA 3VXWA 1A70A 1WJ4A 1HEZE 4JWSC 1YIWA 4A6QA 1LO5D 4I6LB 2JT4B 1NI2A 1TKEA 2C7NB 2BKRB 4MH8A 4RFBA 1QOFA 2C7HA 3ZXVA 1MPEA 4CQNA 2D5GA 2WU5B 3B0AA 1UGJA 1XT9B 2GMIC 1TTNA 3R7QA 4PYZA 1E8YA 4FLHA 3L17A 4M0WA 4C4VA 3VH4B 4PS7A 3ZIMA 1KFYB 1WMHA 3N3KB 2WX0A 4NJCA 4KIKB 1SE9A 5D3IB 1V6EA 1FEHA 3ZNGC 3IAM1 3PT2B 4A20A 1HTQA 2LUMA 4N6EB 4LTUA 3KW5B 3CF6E 2K1FA 3BWUD 3KVFB 1WRIA 1FCCC 4ZOHC 3GB1A 1JQ4A 3PLVA 3KH0A 4YSYB 2YEPB 1PDXA 2LFIA 3VAWA 3A1QA 4BKGA 4QAYA 3AE4B 3L10B 1XLOA 1DGJA 2L0FA 5IN7A 1GG3A 2JZZA 2PEAA 1WI0A 3DBSA 3VH3B 1VRAB 2ZVNA 4O1NA 2C5LC 2J0KA 4LJPB 1N6ZA 2G45B 2L00B 2KO3A 2L83A 3MHSD 2MBEA 2XK5B 2JPHA 1FFVA 4PK1A 2ZNVC 4RNAA 4HKQA 4FJVB 1WRDB 1QOGA 4FHKA 2G1EA 1WYWB 2DHZA 4HPMB 1XF5L 2IY0B 3WAPA 1V2YA 2RPQA 5BYSA 2WXMA 4J3OD 4L2YA 3U52E 1DOXA 2DZKA 4RGNA 3HM3A 3PHWB 5IA7A 1L5PA 4GU2A 3WALA 3RNFC 1KM7A 2WXLA 2KD0A 4PT5A 4WQOB 1WR1A 1FD6A 4K7WA 4ITKA 4N59A 2QSDA 3ZYYX 3TEYA 2J0JA 1PUTA 1FIQA 1E7UA 3I57A 5JHAA 1Y8RC 2O2VA 4GLSC 1HQRD 5D2MB 5G55A 4HDOA 4ARIA 1V8CA 2WGSA 5JXVA 2WXGA 3U30A 2QMTA 4IM2A 4KDIC 4ASWC 3RN9C 3ZKJC 3ZRFA 5C3JB 2W82A 5IP4D 4W9IA 1WXMA 3E56A 4WURA 2LRUA 4DXAB 3TMPB 1WJUA 3M62B 5EE3A 3I5JC 4W9CA 5BMHA 4YSZB 1YQ4B 4NAWB 3KWVA 1WH3A 4XGAB 3PVLA 2KK8A 3N32A 1AN8A 2WYQA 2K5PA 3AMZA 1L6UA 3L0WB 5DPRA 2KT7A 2IGHA 3IVFA 2NPTB 1D5XC 3WAMA 2AL6A 2O6VA 3QAQA 2KACA 3AI5A 4GXBA 2FE8A 2L8JA 2LJ5A 2L05A 3QIJA 4USAA 1YJJA 3EGRA 2LJIA 5FKAC 1AW7A 2C60A 2H89B 4PS8A 2KDIA 4G3XB 2A4ZA 3GE3C 3DBRB 1XLPA 2MSED 2K0PA 2MX2A 2GBNA 3FAHA 2ZEQA 4FJYA 2MBBB 3ETRA 4FJZA 3R8BA 5CTRC 1G6JA 5D6JB 4BKSD 3VFKA 1KJTA 5E6JA 4C56C 1KH0A 3WIMA 4ZRJA 2BQQA 1JWAD 2DAFA 2N0SB 2J4XA 4AQ7A 2Y5CA 4AJWA 2DWQA 1RLFA 4A8XC 4W9HA 4FXCA 1E5WA 1FNWA 2LVQA 4RGTA 5AZHA 1WF9A 1Q0WB 1NVID 4NJ7A 5LLIA 2GLSA 4MELA 2FNJB 2XBBC 1YN4A 2J42A 1XD3B 2V0GA 2I1KA 3VR9B 1M94A 4MEMA 3E9SA 2KDMA 3CIRB 3Q8EA 2N9LA 4KDLB 1GNUA 2WXOA 1FMAD 1JRPA 1RFKA 2LHEA 3KUZA 1FPYA 2N7DA 3VTWA 1GC7A 4TQ1A 2L7RA 1GPXA 3NG0A 1WGRA 2KHWB 1CQVA 1ZE3D 3N1YC 4MGZE 2AX5A 3APCA 2ZPYA 5J2RA 1JCKB 1SIFA 2KOXA 2WXRA 4BOSC 3AE9B 1B1ZA 2LZ6A 3ML8A 3AE5B 2K6DB 3TBLD 4KV2A 2YEPF 2A5UA 3RI7C 3GE8C 3RNGC 2BW2A 2KKCA 2FUHB 2FAZA 2WLBA 4GOCA 3AE6B 4WJQA 5JZEB 3SEBA 4K7UA 1CK1A 3Q6BA 4M01A 3EHVA 3ZVVA 3QA8A 3RNEC 1V86A 4CHKA 4US9A 3PHXB 4BOZB 1RYJA 1YD8U 3A9KA 3P1MA 2MEKA 3DBLB 3LDZE 2ONQA 2L0TA 2WXKA 2LWPA 4IUMB 1Q10A 1YQ3B 1T0RC 2JYEA 1V49A 2IPKD 1P0RA 3Q3NC 4KZ0A 3JVZX 3K9PB 4MGYE 1C4AA 1FXTB 2UU7A 1F2RC 4DXGA 3ZDTA 2N9PC 3R3MA 1ZOYB 1P98A 2WXJA 1NBFC 2CR5A 1T0QC 4HJKA 2GB1A 4R3DA 4WIPA 1UWXA 2W3SA 4EOYA 1OQYA 2AL3A 4ZHOA 2KFJA 4ZYSA 4EZJA 5E6OA 1FNVA 1T0SC 1WGYA 2NTTA 4UDUC 4TUUA 5EE0A 2Q5WD 3Q3FA 5IO9A 2OHFA 2G4DB 2LRWA 2QEJC 1TS5A 2D3AA 3GS2A 1K50A 3ECIA 4PYUA 4YT0B 2N7EA 4E71A 4ICVA 3V62A 3W1SA 3P4PB 2H88B 1T6BX 3J9CA 1JW9D 1OQQA 3MC8A 2VZKB 1E8WA 3HIZA 5T8IA 1J7BA 2CKHB 1S1QB 1BT0A 2K39A 3BYTB 4DHZE 1IGCA 4N58A 3HVZA 1EU4A 2M17A 3OG5A 3R2IA 2V9HA 2M0AA 2FCQA 2AQ1B 4WWPA 5J17A 2NVUI 2JRIB 3ZRCA 1N60A 1PQSA 2CU3A 4FBJB 1K51A 2EELA 2I38A 3ZNID 1STEA 4WWMA 1JMLA 1TKYA 2D3GA 4B9KA 3Q3MC 4ZDVA 3H9DA 2MCNB 4TQ0A 5D3DA 3P63A 3QQ8B 4D2KA 2BWES 3M63B 3VDZA 4II3B 4K81A 4HPLB 1JRUA 1VJKA 1T5XD 3AEDB 2J52A 4OVZA 2KWUB 5H8YE 1WIAA 2LGIA 2KWVB 2ZW1A 4XDDA 1RM6C 2VH1A 2LGYA 5HI1A 1EF1A 2DX5B 1A5RA 4I6NB 4YXDB 5C23A 3DVNU 1UELA 1LM8B 3H7SA 2JZPA 2XNAC 5J18A 3IBEA 1HZ6A 1C76A 4OZCA 4LJOB 1N61A 1E7VA 2NBWB 2Z0EB 2KJHB 4NNJB 3OAWA 3PV1A 1FRDA 1SXTA 1QF6A 2QC8A 1Z2MA 3U7DA 4DDGD 3B2FA 1HZ5A 1F0ZA 1UBQA 3A9JB 5CHFA 4JWUC 3SFEB 1CZPA 1WM3A 2WXIA 3AULA 2M0XA 3Q3JA 4GB9A 1XCTL 3AECB 2N4FA 3NUHB 4NY0A 2QCZA 2CS4A 3QJZA 4LLGM 3NJTA 2G4SA 1H4RA 3FILA 4MGIE 1YMHE 2KJRA 2KLCA 2J53A 2KMCA 2IO1B 4IW0A 1J7CA 2MJ3A 2J0MA 1RAXA 2MH7A 1J19A 2JZ3B 1Z5SB 3LJ3A 1QOAA 2MQJA 1WX8A 4F1SA 2MJDA 4HRSA 4DHZB 2MLBA 4MSMB 1VZ7A 1HXYD 2LASA 4AP4C 4HK2A 4EEWA 2MJEA 4K7SA 3AU5A 2BT6A 4WJNA 4RGMA 2MRPA 2D10A 1DYQA 2GBKA 2LHDA 4IC7B 1UNSA 1FNUA 2Z0DB 1GC6A 2LI5A 4DHJD 1YOVB 3JYUA 2PW9A 2WQYB 1MVKA 3NOBA 2KDBA 3U2SC 2VZKD 4HJGE 1J0GA 2ZZPB 3CSFA 3WAOA 1YJIA 4A90A 5FK9C 4JE3B 2JUOA 2KVRA 1RWSA 4XDCA 1HE8A 1LXDA 1IBXB 3FILB 1ZXHA 3L08A 2D07B 3BINA 1D6EC 2EKEC 2KX3A 3AE3B 5MPOA 2L52A 1WE7A 2LGSA 1F9JA 2KFKB 1ZDVA 1H8CA 2N9XA 2WNMA 4EUTA 2NBVB 2FCNA 3EFUA 5LXIB 4OVVA 2WXNA 2NBUA 3RNAC 1WJNA 2V4LA 1UGMA 2L32A 1E6EB 1TZ1A 2KLGA 1V1PB 1JALA 2YVCA 4W9EA 4W9JA 4JX1C 2KTRB 4MT5A 5EDSA 1N5XA 1WZ0A 2INCC 1E90A 4M8NA 3NZUA 3I9V1 5C1ZA 3T3NA 1TS4A 3RZWC 2NPTA 1LQBA 3RNCC 3ZGZA 3W5VB 1L4ZB 4IM3A 1IP9A 2HTME 3P4QB 5JH5C 4LDTB 3MHZA 3H7PB 1CJEA 1E8ZA 3MP9A 1QZEA 3AE8B 3BVMA 1JWMD 3ZXRA 3HHMA 4EFOA 2WXFA 3BIID 1R4MI 3HK0A 2ZCCA 1D3ZA 4WAAA 3LB8C 2BWFA 2K9XA 2IGGA 2RR9A 1E8XA 1EWYC 3CWIA 2HDEA 1TZOA 4EE2A 2PMVA 3DQVA 3RULA 1ESFA 3AH7A 2JWZA 4P1BC 1M4VA 3A4RA 2KFKA 1TS3A 2N1VA 2DYBA 3AU4A 1MHXA 2L3ZA 5EE1A 5AZFA 4OW0A 4TSSA 1YJ1A 5BYRA 4AJYB 1SJED 4F7ZA 2N9EB 2IY1B 5AEKB 1SE2A 1HTOA 1V81A 2JY6A 2OEDA 2LVOA 3DHGC 1WM2A 3VTVA 2AQ3B 3L16A 4NJ6A 2R2QA 1ET9A 3BYYB 1XO3A 2GBJA 2D3CA 5BO4B 1V97A 2WX1A 4W9DA 2L1AA 3N20C
chains in the Genus database with same CATH topology
4GOCA 1P1AA 3H6NA 2FIDA 2KQSA 5CX3A 1WE6A 2IO2B 4LCDE 4WJQA 2N1WA 1LFDA 2MBOA 5G2NA 3WANA 5JZEB 4IG7B 1YQBA 4K7UA 4BKSA 2Y5BB 4J6IA 3EHVA 3A1QB 3UINB 3ZVVA 1V9JA 2MWSB 3QA8A 4F8CB 4CO7A 1V86A 5CHWA 3ZNZB 3V6CB 4CHKA 3TL5A 3DVGY 2BYFA 1KLVA 4FULA 3PHXB 3ZTDA 4BOZB 3JW0X 4JL9A 4KZCA 3M95A 1VCBA 1YD8U 3A9KA 3PRPB 2MA9B 4NQLB 3V6EB 4WJOA 3ZTCA 3LDZE 1AARA 2L0TA 3MJWA 4EZLA 1GUAB 3BY4B 1Q5WB 4II2B 2LWPA 4IUMB 4OVUA 4ANUA 2ZCBA 1I42A 4IM0A 4W9LA 2DYMA 3JSVB 4HDQA 1GJZA 1UH6A 1NDDA 1WGHA 1XQQA 4GMVA 4E3CA 1V49A 4GIVA 4KIKA 1P0RA 2M4NA 4KZ0A 3NS8A 3JVZX 3K9PB 4MGYE 1FXTB 3ZDTA 2N9PC 3NHEB 4DK5A 3OLMD 3R3MA 5L95C 1ISNA 3U8ZA 3H7PA 1P98A 2KDFB 1NBFC 3W1YA 2CR5A 2HD5B 3IFWB 4HJKA 2IBIB 4ANXA 3B1LX 4ICUA 4PS3A 4EZKA 4BBNC 4EOYA 1OQYA 4WWOA 2AL3A 3MTNB 4E74A 1P3QU 2BYVE 4MJSB 3DBHI 3H1UA 2KFJA 1T0YA 4EZJA 4AWJA 1TGZB 5E6OA 1U4AA 1WGYA 3CSTA 4A3OA 4NQKE 4TUUA 2CHZA 4W9GA 1RFAA 4IWPA 3GZNI 2CU1A 3Q3FA 2KC2A 1OEYA 2O6VB 3HM6X 1S3SG 2EMTA 2G4DB 2K8BA 2LRWA 4MSQB 2KMAA 2QHOA 1X1MA 3PRMB 2ASQA 3ECIA 2GBMA 4PYUA 4E71A 2N7EA 2O6VD 3QHTA 1IYFA 4ICVA 3V62A 3W1SA 4BKTA 1RRBA 4JLCA 5L83A 3ZDMC 2I1JA 3QC8B 2NS5A 3A9KB 2HE7A 1E8WA 1CMXB 3TJPA 3VTUA 4B6WA 4HLEA 3VXWA 2FCMA 3OJ3A 4N9F4 3HIZA 4GDKB 3SD5A 1V80A 1WJ4A 4M8MA 2CKHB 2RD0A 1UBIA 1YIWA 1K8RB 1S1QB 3DPDA 1BT0A 2K39A 4M0WB 4DHZE 3DVGX 2DZJA 4I6LB 2BF8B 4RMAA 3VUWA 2R2OA 2JT4B 5DPSA 1NI2A 3KUDB 2M17A 2C7NB 2OJRA 2BKRB 2RSUA 2C7HA 2FCQA 5DPTA 4WWPA 4YL8A 5J17A 2NVUI 2JRIB 3ZRCA 2BKFA 1L7YA 4TKNA 2AYOB 1PQSA 4FN2A 1OEYJ 3B0AA 1XT9B 2KC1A 2GMIC 2KDEB 1I35A 4URKA 3PS6A 4FBJB 3QCAA 1TTNA 2GBRA 3R7QA 4PYZA 1E8YA 4AOFA 4FLHA 4WWNA 3ZNID 3L17A 4BVUC 4DBGA 4RM9A 4A3PA 2DZMA 4DWFA 3VH4B 5DCNA 3ZUNA 3QARA 2D3GA 4PS7A 4ZYNA 3ZIMA 1WMHA 2WDTB 1YX6B 4B9KA 2YLMA 3N3KB 2WX0A 1EO6A 3PSEB 4ZDVA 3H9DA 4KIKB 1SE9A 2MCNB 4TQ0A 1V6EA 2BGFA 3UQAA 3T8MA 5GMVA 3QQ8B 3ZNGC 3PT2B 3M3JA 2BWES 4A20A 3M63B 3VDZA 5E6PA 2KQ7A 3KW5B 2DYOA 4II3B 4HPLB 3IHPC 1EF5A 1OTRB 1JRUA 4K81A 5JHBA 3CF6E 2K1FA 3PZDA 3A33B 3KVFB 1V5TA 4NPNA 1UD7A 2EMSA 2KWUB 1WIAA 4ZRKA 3PLVA 3KH0A 3I3TB 2JF5A 2KWVB 1L2NA 3UGBB 3S2AA 3VAWA 3RUIB 2LGYA 1EF1A 2DX5B 1WXVA 2KJ6A 1A5RA 3A1QA 4I6NB 1WXSA 5C23A 4BKGA 3DVNU 3PGEA 4BFRA 1UELA 3RCZA 3L10B 3K9OB 3EECA 3L13A 2KTFA 1LM8B 2L0FA 3V61A 5TR5A 3H7SA 1GG3A 2JZZA 3DDCB 4GDLA 2PEAA 1WI0A 5J18A 3IBEA 4JGHB 3DBSA 3VH3B 2LVPA 2D2QA 2ZVNA 2C5LC 2J0KA 2ZPNA 4LJPB 4LJOB 2XK5A 3JSVA 1E7VA 2G45B 2NBWB 2Z0EB 4G0NB 3AXCA 2L00B 2HJ8A 4GN1A 2KO3A 2KJHB 3PPAA 4NNJB 3MHSD 2MBEA 3OAWA 3PV1A 2XK5B 3X0WA 2JPHA 1KOTA 2IZVB 2Z59B 3EC8A 4DDID 2ZNVC 2KNBA 5HKHA 1Z2MA 4FJVB 1WRDB 4FHKA 3O65B 3U7DA 4DDGD 2REXA 3KYDD 2LD9A 4MDKE 3QX1A 1WYWB 2DHZA 1UBQA 4HPMB 3A9JB 2IY0B 5CHFA 5FR6A 5KHOA 3TIXA 3WAPA 4P7IA 1V2YA 2RPQA 4GDKA 2C9WB 3W1SC 1UZXB 4XZ4A 2DZKA 1WM3A 4HWIB 2ZNVB 2W9NA 1WJ6A 2M0XA 3AULA 3VQIA 3L54A 2CHXA 3HM3A 3ML9A 3Q3JA 4GB9A 3PHWB 5IA7A 3APFA 4MJSA 3VUYA 2N4FA 4NY0A 1WY8A 4GU2A 3WALA 2CS4A 1KM7A 3PREA 2KD0A 3T9LA 3ZW3A 3QJZA 2PJHA 4WQOB 2FCSA 3RD2A 1WR1A 1WR6E 2G4SA 1H4RA 4K7WA 4MGIE 2KJRA 2KLCA 2J0JA 2AEHA 3DCGA 1E7UA 1R4NI 2KMCA 2DAJA 3ZNHB 2K6QA 2IO1B 4IW0A 5JHAA 1Y8RC 2O2VA 2KXJA 4JIOU 5DPWA 2J0MA 1RAXA 4KSLC 5KHQA 5D2MB 5G55A 1J19A 2JZ3B 2IO0B 1Z5SB 2MQJA 2LUEA 1OGWA 1WX8A 3LJ3A 4HDOA 1WFYA 3VHTC 4DHZB 4F1SA 3ALBA 2MLBA 4MSMB 2KZRA 2LASA 4KSKC 4NAWA 3NZSA 4AP4C 4HK2A 2BYEA 3ONSA 4EEWA 4K7SA 3U30A 3AU5A 4IM2A 4KDIC 4WJNA 4ASWC 2JVCA 3ZKJC 3ZRFA 2KTRA 4ZRIA 1C1YB 2MRPA 2D10A 3UQBA 2FIFA 4W9IA 2GBKA 1WZ3A 1WXMA 2LGXA 2MP2A 2LRUA 1WX7A 4MM3A 4DXAB 4ANWA 3TMPB 1WJUA 3M62B 4IC7B 4I6PA 4XC2A 3UF8A 4MGKE 4W9CA 2OOBB 5D94A 2Z0DB 3DBRI 1GC6A 1WGDA 2LI5A 2KANA 4DHJD 3IG3A 4NAWB 1WH3A 3RYTA 4W9KA 3JYUA 1C3TA 3PVLA 1J8CA 2LXAA 2KK8A 3N32A 3NOBA 2KDBA 2WYQA 3X23A 1J0GA 2ZZPB 4RM8A 2UWQA 2C7MB 2CHWA 3CSFA 3L0WB 3WAOA 3R7RA 5DPRA 4HCNB 2JUOA 2KVRA 3IVFA 2NPTB 1V5OA 3WAMA 2DZIA 2MBQA 3OJ4B 2AL6A 1HE8A 1LXDA 2O6VA 1P9DU 3QAQA 3L08A 4X57B 2D07B 3AI5A 3BINA 4GXBA 2L8JA 2EKEC 3UIOB 2LJ5A 3RT3B 2L05A 3QIJA 2KX3A 3PTFC 5CHVC 4GSWA 4DHJB 2K8CA 2C60A 4HVBA 5IAAC 3VUXA 4PS8A 3DOWA 1WE7A 4KVGB 2KDIA 4G3XB 2A4ZA 1F9JA 2KFKB 1VD2A 1WXAA 1H8CA 4WJPA 2MSED 2N9XA 2MX2A 2GBNA 4EUTA 3NY5A 2NBVB 2ZEQA 4FJYA 4LDTD 2MBBB 3SU8X 2FCNA 4FJZA 4B95A 3EFUA 5CTRC 5LXIB 3ZO5B 1G6JA 4OVVA 2JXXA 5D6JB 2NBUA 3QWZB 1WJNA 3RZFA 4BKSD 3VFKA 1KJTA 2V4LA 1UGMA 2G3QB 1TZ1A 2KLGA 2YVCA 4W9EA 4W9JA 3WIMA 2KTRB 2UYZB 5EDSA 4XX5A 3DBLI 4ZRJA 1WZ0A 1E90A 2DAFA 2LGDA 4M8NA 3NZUA 2MBHA 3A4SC 5C1ZA 3C0RB 3PRZA 2MW5A 3RZWC 3D32A 4AJWA 2NPTA 1YX5B 1EUVB 1RLFA 1LQBA 4EKUA 4G11A 4W9HA 2XEWA 3CMMB 1E5WA 4HCPB 2JRHA 2LVQA 4HXDA 4IM3A 1ZW7A 1IP9A 5AZHA 4BBNF 1IPGA 1WF9A 2IO3B 1Q0WB 2O2VB 4NJ7A 5E6NA 1ZGUB 3QK0A 5LLIA 4LDTB 5JH5C 2DENB 3UIPB 3P2BA 3H7PB 2ZVOA 4MELA 1E8ZA 4CYEA 2FNJB 1ZKHA 3PLUA 1QZEA 2V1YA 2XBBC 4G50A 4GGQA 4GDLB 1XD3B 1MG8A 2I1KA 1M94A 4MEMA 3HHMA 3R66C 4IWQA 4AUQC 4EFOA 2GOWA 2MP2B 2AWTA 3DVNV 4KDLB 1GNUA 2ZJDA 1R4MI 2WWZA 3HK0A 2ZCCA 3APDA 3ENEA 4ANVA 1D3ZA 4TV3A 4WAAA 3KUZA 4JQWC 2N7DA 2M8SA 2BWFA 3VTWA 2RR9A 1E8XA 2LXCA 1GC7A 2J7QB 2L76A 2VRRB 3ZLZA 4TQ1A 2RGFA 5D7GA 2L7RA 5AZGA 4FHJA 3WA0A 1SGHA 3B08A 3DQVA 1WGRA 3RULA 3GOEA 2JWZA 2V3SA 2KHWB 2PE9A 3A4RA 2KFKA 2N1VA 2DYBA 3AU4A 3KYCD 1Q1OA 2L3ZA 2BPSA 2NCNA 3A9JA 5AZFA 2K25A 2PE6B 4MGZE 4IWOA 2K8HA 2D11A 4FADA 1YJ1A 3APCA 2ZPYA 2KWCA 3V60A 4FA6A 5J2RA 2IYDB 4AJYB 1SIFA 2KOXA 4F7ZA 2N9EB 2IY1B 4W9FA 2KN5A 4BOSC 5AEKB 3SDLC 3KUCB 1V81A 1WMHB 2JY6A 2LVOA 3VTVA 1WM2A 4K1RB 2LZ6A 3ML8A 1WX9A 3SHQA 3L16A 3VVWB 4NJ6A 2R2QA 2K6DB 5LXHA 3N30A 4MH0E 2B3AA 2NR2A 2M1MA 1TBEA 3TBLD 4KV2A 2GBJA 2PPHA 2A5UA 5BO4B 2KX0A 2WX1A 2HTHA 2KKCA 4W9DA 1WGGA 2FAZA 2FUHB 3TCAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4GOC A;  1P1A A;  3H6N A;  2FID A;  2KQS A;  5CX3 A;  1WE6 A;  2IO2 B;  4LCD E;  4WJQ A;  2N1W A;  1LFD A;  2MBO A;  5G2N A;  3WAN A;  5JZE B;  4IG7 B;  1YQB A;  4K7U A;  4BKS A;  2Y5B B;  4J6I A;  3EHV A;  3A1Q B;  3UIN B;  3ZVV A;  1V9J A;  2MWS B;  3QA8 A;  4F8C B;  4CO7 A;  1V86 A;  5CHW A;  3ZNZ B;  3V6C B;  4CHK A;  3TL5 A;  3DVG Y;  2BYF A;  1KLV A;  4FUL A;  3PHX B;  3ZTD A;  4BOZ B;  3JW0 X;  4JL9 A;  4KZC A;  3M95 A;  1VCB A;  1YD8 U;  3A9K A;  3PRP B;  2MA9 B;  4NQL B;  3V6E B;  4WJO A;  3ZTC A;  3LDZ E;  1AAR A;  2L0T A;  3MJW A;  4EZL A;  1GUA B;  3BY4 B;  1Q5W B;  4II2 B;  2LWP A;  4IUM B;  4OVU A;  4ANU A;  2ZCB A;  1I42 A;  4IM0 A;  4W9L A;  2DYM A;  3JSV B;  4HDQ A;  1GJZ A;  1UH6 A;  1NDD A;  1WGH A;  1XQQ A;  4GMV A;  4E3C A;  1V49 A;  4GIV A;  4KIK A;  1P0R A;  2M4N A;  4KZ0 A;  3NS8 A;  3JVZ X;  3K9P B;  4MGY E;  1FXT B;  3ZDT A;  2N9P C;  3NHE B;  4DK5 A;  3OLM D;  3R3M A;  5L95 C;  1ISN A;  3U8Z A;  3H7P A;  1P98 A;  2KDF B;  1NBF C;  3W1Y A;  2CR5 A;  2HD5 B;  3IFW B;  4HJK A;  2IBI B;  4ANX A;  3B1L X;  4ICU A;  4PS3 A;  4EZK A;  4BBN C;  4EOY A;  1OQY A;  4WWO A;  2AL3 A;  3MTN B;  4E74 A;  1P3Q U;  2BYV E;  4MJS B;  3DBH I;  3H1U A;  2KFJ A;  1T0Y A;  4EZJ A;  4AWJ A;  1TGZ B;  5E6O A;  1U4A A;  1WGY A;  3CST A;  4A3O A;  4NQK E;  4TUU A;  2CHZ A;  4W9G A;  1RFA A;  4IWP A;  3GZN I;  2CU1 A;  3Q3F A;  2KC2 A;  1OEY A;  2O6V B;  3HM6 X;  1S3S G;  2EMT A;  2G4D B;  2K8B A;  2LRW A;  4MSQ B;  2KMA A;  2QHO A;  1X1M A;  3PRM B;  2ASQ A;  3ECI A;  2GBM A;  4PYU A;  4E71 A;  2N7E A;  2O6V D;  3QHT A;  1IYF A;  4ICV A;  3V62 A;  3W1S A;  4BKT A;  1RRB A;  4JLC A;  5L83 A;  3ZDM C;  2I1J A;  3QC8 B;  2NS5 A;  3A9K B;  2HE7 A;  1E8W A;  1CMX B;  3TJP A;  3VTU A;  4B6W A;  4HLE A;  3VXW A;  2FCM A;  3OJ3 A;  4N9F 4;  3HIZ A;  4GDK B;  3SD5 A;  1V80 A;  1WJ4 A;  4M8M A;  2CKH B;  2RD0 A;  1UBI A;  1YIW A;  1K8R B;  1S1Q B;  3DPD A;  1BT0 A;  2K39 A;  4M0W B;  4DHZ E;  3DVG X;  2DZJ A;  4I6L B;  2BF8 B;  4RMA A;  3VUW A;  2R2O A;  2JT4 B;  5DPS A;  1NI2 A;  3KUD B;  2M17 A;  2C7N B;  2OJR A;  2BKR B;  2RSU A;  2C7H A;  2FCQ A;  5DPT A;  4WWP A;  4YL8 A;  5J17 A;  2NVU I;  2JRI B;  3ZRC A;  2BKF A;  1L7Y A;  4TKN A;  2AYO B;  1PQS A;  4FN2 A;  1OEY J;  3B0A A;  1XT9 B;  2KC1 A;  2GMI C;  2KDE B;  1I35 A;  4URK A;  3PS6 A;  4FBJ B;  3QCA A;  1TTN A;  2GBR A;  3R7Q A;  4PYZ A;  1E8Y A;  4AOF A;  4FLH A;  4WWN A;  3ZNI D;  3L17 A;  4BVU C;  4DBG A;  4RM9 A;  4A3P A;  2DZM A;  4DWF A;  3VH4 B;  5DCN A;  3ZUN A;  3QAR A;  2D3G A;  4PS7 A;  4ZYN A;  3ZIM A;  1WMH A;  2WDT B;  1YX6 B;  4B9K A;  2YLM A;  3N3K B;  2WX0 A;  1EO6 A;  3PSE B;  4ZDV A;  3H9D A;  4KIK B;  1SE9 A;  2MCN B;  4TQ0 A;  1V6E A;  2BGF A;  3UQA A;  3T8M A;  5GMV A;  3QQ8 B;  3ZNG C;  3PT2 B;  3M3J A;  2BWE S;  4A20 A;  3M63 B;  3VDZ A;  5E6P A;  2KQ7 A;  3KW5 B;  2DYO A;  4II3 B;  4HPL B;  3IHP C;  1EF5 A;  1OTR B;  1JRU A;  4K81 A;  5JHB A;  3CF6 E;  2K1F A;  3PZD A;  3A33 B;  3KVF B;  1V5T A;  4NPN A;  1UD7 A;  2EMS A;  2KWU B;  1WIA A;  4ZRK A;  3PLV A;  3KH0 A;  3I3T B;  2JF5 A;  2KWV B;  1L2N A;  3UGB B;  3S2A A;  3VAW A;  3RUI B;  2LGY A;  1EF1 A;  2DX5 B;  1WXV A;  2KJ6 A;  1A5R A;  3A1Q A;  4I6N B;  1WXS A;  5C23 A;  4BKG A;  3DVN U;  3PGE A;  4BFR A;  1UEL A;  3RCZ A;  3L10 B;  3K9O B;  3EEC A;  3L13 A;  2KTF A;  1LM8 B;  2L0F A;  3V61 A;  5TR5 A;  3H7S A;  1GG3 A;  2JZZ A;  3DDC B;  4GDL A;  2PEA A;  1WI0 A;  5J18 A;  3IBE A;  4JGH B;  3DBS A;  3VH3 B;  2LVP A;  2D2Q A;  2ZVN A;  2C5L C;  2J0K A;  2ZPN A;  4LJP B;  4LJO B;  2XK5 A;  3JSV A;  1E7V A;  2G45 B;  2NBW B;  2Z0E B;  4G0N B;  3AXC A;  2L00 B;  2HJ8 A;  4GN1 A;  2KO3 A;  2KJH B;  3PPA A;  4NNJ B;  3MHS D;  2MBE A;  3OAW A;  3PV1 A;  2XK5 B;  3X0W A;  2JPH A;  1KOT A;  2IZV B;  2Z59 B;  3EC8 A;  4DDI D;  2ZNV C;  2KNB A;  5HKH A;  1Z2M A;  4FJV B;  1WRD B;  4FHK A;  3O65 B;  3U7D A;  4DDG D;  2REX A;  3KYD D;  2LD9 A;  4MDK E;  3QX1 A;  1WYW B;  2DHZ A;  1UBQ A;  4HPM B;  3A9J B;  2IY0 B;  5CHF A;  5FR6 A;  5KHO A;  3TIX A;  3WAP A;  4P7I A;  1V2Y A;  2RPQ A;  4GDK A;  2C9W B;  3W1S C;  1UZX B;  4XZ4 A;  2DZK A;  1WM3 A;  4HWI B;  2ZNV B;  2W9N A;  1WJ6 A;  2M0X A;  3AUL A;  3VQI A;  3L54 A;  2CHX A;  3HM3 A;  3ML9 A;  3Q3J A;  4GB9 A;  3PHW B;  5IA7 A;  3APF A;  4MJS A;  3VUY A;  2N4F A;  4NY0 A;  1WY8 A;  4GU2 A;  3WAL A;  2CS4 A;  1KM7 A;  3PRE A;  2KD0 A;  3T9L A;  3ZW3 A;  3QJZ A;  2PJH A;  4WQO B;  2FCS A;  3RD2 A;  1WR1 A;  1WR6 E;  2G4S A;  1H4R A;  4K7W A;  4MGI E;  2KJR A;  2KLC A;  2J0J A;  2AEH A;  3DCG A;  1E7U A;  1R4N I;  2KMC A;  2DAJ A;  3ZNH B;  2K6Q A;  2IO1 B;  4IW0 A;  5JHA A;  1Y8R C;  2O2V A;  2KXJ A;  4JIO U;  5DPW A;  2J0M A;  1RAX A;  4KSL C;  5KHQ A;  5D2M B;  5G55 A;  1J19 A;  2JZ3 B;  2IO0 B;  1Z5S B;  2MQJ A;  2LUE A;  1OGW A;  1WX8 A;  3LJ3 A;  4HDO A;  1WFY A;  3VHT C;  4DHZ B;  4F1S A;  3ALB A;  2MLB A;  4MSM B;  2KZR A;  2LAS A;  4KSK C;  4NAW A;  3NZS A;  4AP4 C;  4HK2 A;  2BYE A;  3ONS A;  4EEW A;  4K7S A;  3U30 A;  3AU5 A;  4IM2 A;  4KDI C;  4WJN A;  4ASW C;  2JVC A;  3ZKJ C;  3ZRF A;  2KTR A;  4ZRI A;  1C1Y B;  2MRP A;  2D10 A;  3UQB A;  2FIF A;  4W9I A;  2GBK A;  1WZ3 A;  1WXM A;  2LGX A;  2MP2 A;  2LRU A;  1WX7 A;  4MM3 A;  4DXA B;  4ANW A;  3TMP B;  1WJU A;  3M62 B;  4IC7 B;  4I6P A;  4XC2 A;  3UF8 A;  4MGK E;  4W9C A;  2OOB B;  5D94 A;  2Z0D B;  3DBR I;  1GC6 A;  1WGD A;  2LI5 A;  2KAN A;  4DHJ D;  3IG3 A;  4NAW B;  1WH3 A;  3RYT A;  4W9K A;  3JYU A;  1C3T A;  3PVL A;  1J8C A;  2LXA A;  2KK8 A;  3N32 A;  3NOB A;  2KDB A;  2WYQ A;  3X23 A;  1J0G A;  2ZZP B;  4RM8 A;  2UWQ A;  2C7M B;  2CHW A;  3CSF A;  3L0W B;  3WAO A;  3R7R A;  5DPR A;  4HCN B;  2JUO A;  2KVR A;  3IVF A;  2NPT B;  1V5O A;  3WAM A;  2DZI A;  2MBQ A;  3OJ4 B;  2AL6 A;  1HE8 A;  1LXD A;  2O6V A;  1P9D U;  3QAQ A;  3L08 A;  4X57 B;  2D07 B;  3AI5 A;  3BIN A;  4GXB A;  2L8J A;  2EKE C;  3UIO B;  2LJ5 A;  3RT3 B;  2L05 A;  3QIJ A;  2KX3 A;  3PTF C;  5CHV C;  4GSW A;  4DHJ B;  2K8C A;  2C60 A;  4HVB A;  5IAA C;  3VUX A;  4PS8 A;  3DOW A;  1WE7 A;  4KVG B;  2KDI A;  4G3X B;  2A4Z A;  1F9J A;  2KFK B;  1VD2 A;  1WXA A;  1H8C A;  4WJP A;  2MSE D;  2N9X A;  2MX2 A;  2GBN A;  4EUT A;  3NY5 A;  2NBV B;  2ZEQ A;  4FJY A;  4LDT D;  2MBB B;  3SU8 X;  2FCN A;  4FJZ A;  4B95 A;  3EFU A;  5CTR C;  5LXI B;  3ZO5 B;  1G6J A;  4OVV A;  2JXX A;  5D6J B;  2NBU A;  3QWZ B;  1WJN A;  3RZF A;  4BKS D;  3VFK A;  1KJT A;  2V4L A;  1UGM A;  2G3Q B;  1TZ1 A;  2KLG A;  2YVC A;  4W9E A;  4W9J A;  3WIM A;  2KTR B;  2UYZ B;  5EDS A;  4XX5 A;  3DBL I;  4ZRJ A;  1WZ0 A;  1E90 A;  2DAF A;  2LGD A;  4M8N A;  3NZU A;  2MBH A;  3A4S C;  5C1Z A;  3C0R B;  3PRZ A;  2MW5 A;  3RZW C;  3D32 A;  4AJW A;  2NPT A;  1YX5 B;  1EUV B;  1RLF A;  1LQB A;  4EKU A;  4G11 A;  4W9H A;  2XEW A;  3CMM B;  1E5W A;  4HCP B;  2JRH A;  2LVQ A;  4HXD A;  4IM3 A;  1ZW7 A;  1IP9 A;  5AZH A;  4BBN F;  1IPG A;  1WF9 A;  2IO3 B;  1Q0W B;  2O2V B;  4NJ7 A;  5E6N A;  1ZGU B;  3QK0 A;  5LLI A;  4LDT B;  5JH5 C;  2DEN B;  3UIP B;  3P2B A;  3H7P B;  2ZVO A;  4MEL A;  1E8Z A;  4CYE A;  2FNJ B;  1ZKH A;  3PLU A;  1QZE A;  2V1Y A;  2XBB C;  4G50 A;  4GGQ A;  4GDL B;  1XD3 B;  1MG8 A;  2I1K A;  1M94 A;  4MEM A;  3HHM A;  3R66 C;  4IWQ A;  4AUQ C;  4EFO A;  2GOW A;  2MP2 B;  2AWT A;  3DVN V;  4KDL B;  1GNU A;  2ZJD A;  1R4M I;  2WWZ A;  3HK0 A;  2ZCC A;  3APD A;  3ENE A;  4ANV A;  1D3Z A;  4TV3 A;  4WAA A;  3KUZ A;  4JQW C;  2N7D A;  2M8S A;  2BWF A;  3VTW A;  2RR9 A;  1E8X A;  2LXC A;  1GC7 A;  2J7Q B;  2L76 A;  2VRR B;  3ZLZ A;  4TQ1 A;  2RGF A;  5D7G A;  2L7R A;  5AZG A;  4FHJ A;  3WA0 A;  1SGH A;  3B08 A;  3DQV A;  1WGR A;  3RUL A;  3GOE A;  2JWZ A;  2V3S A;  2KHW B;  2PE9 A;  3A4R A;  2KFK A;  2N1V A;  2DYB A;  3AU4 A;  3KYC D;  1Q1O A;  2L3Z A;  2BPS A;  2NCN A;  3A9J A;  5AZF A;  2K25 A;  2PE6 B;  4MGZ E;  4IWO A;  2K8H A;  2D11 A;  4FAD A;  1YJ1 A;  3APC A;  2ZPY A;  2KWC A;  3V60 A;  4FA6 A;  5J2R A;  2IYD B;  4AJY B;  1SIF A;  2KOX A;  4F7Z A;  2N9E B;  2IY1 B;  4W9F A;  2KN5 A;  4BOS C;  5AEK B;  3SDL C;  3KUC B;  1V81 A;  1WMH B;  2JY6 A;  2LVO A;  3VTV A;  1WM2 A;  4K1R B;  2LZ6 A;  3ML8 A;  1WX9 A;  3SHQ A;  3L16 A;  3VVW B;  4NJ6 A;  2R2Q A;  2K6D B;  5LXH A;  3N30 A;  4MH0 E;  2B3A A;  2NR2 A;  2M1M A;  1TBE A;  3TBL D;  4KV2 A;  2GBJ A;  2PPH A;  2A5U A;  5BO4 B;  2KX0 A;  2WX1 A;  2HTH A;  2KKC A;  4W9D A;  1WGG A;  2FAZ A;  2FUH B;  3TCA A; 
#chains in the Genus database with same CATH topology
 1P1A A;  3H6N A;  2K3U A;  1WE6 A;  3NVZ A;  1LFD A;  3WAN A;  4J6I A;  3UIN B;  2MWS B;  2BB5 A;  3ZNZ B;  3TL5 A;  1SIJ A;  3M95 A;  2RPV A;  4WJO A;  4II2 B;  4OVU A;  1I42 A;  4C7Y A;  1AWD A;  1ZXI A;  2NMQ A;  1T3Q A;  4W9L A;  2DYM A;  1WWT A;  4M00 A;  4LNI A;  1NDD A;  1XQQ A;  2LEK A;  1L0X B;  2RDB C;  2W3R A;  3OLM D;  2KDF B;  3W1Y A;  1YNT E;  1TT5 B;  3IXS A;  4ICU A;  4PS3 A;  4WWO A;  1NYQ A;  2N9K A;  2PLP A;  3H1U A;  1U4A A;  3ZJT A;  4DXF A;  2GI9 A;  2CHZ A;  1E0Z A;  2CU1 A;  2BS4 B;  2O6V B;  3GP7 A;  1S3S G;  5H92 C;  2K8B A;  4XWW A;  4HKZ E;  4US8 A;  5TSS A;  2JYT A;  1KLU D;  1RRB A;  4LNK A;  2NS5 A;  1F1H A;  3A9K B;  1CMX B;  4HLE A;  2FCM A;  2PKO A;  3OJ3 A;  4N9F 4;  3SD5 A;  4GDK B;  2BTE A;  4C4V B;  1UBI A;  4M0W B;  3DVG X;  2DZJ A;  2BF8 B;  2JXT A;  4RMA A;  3VUW A;  2PTL A;  5DPS A;  3KUD B;  1I4X A;  2OJR A;  1XLN A;  4YL8 A;  1FFU A;  3DWM A;  4TKN A;  4FN2 A;  1OEY J;  4L1B A;  2SEB D;  1I35 A;  3PS6 A;  1UF0 A;  5IKC M;  4AOF A;  4BVU C;  2WXH A;  3IAS 1;  4DWF A;  3ZUN A;  3QAR A;  4ZYN A;  4C00 A;  1QT9 A;  1EO6 A;  1SE3 A;  3T8M A;  2EKI A;  1AYF A;  3M3J A;  1FO4 A;  2IJ0 A;  5E6P A;  2KQ7 A;  1I4R A;  2DYO A;  1EF5 A;  1OTR B;  1K53 A;  5JHB A;  3PZD A;  2WDV B;  3A33 B;  2JSV X;  4NPN A;  4ZRK A;  3I3T B;  2Y3A A;  1PGB A;  2KAJ A;  1I4Q A;  2JF5 A;  1QKZ A;  1JWU D;  1WXV A;  2IDY A;  1ZUD 2;  4BFR A;  3RCZ A;  3K9O B;  3V61 A;  5TR5 A;  3NZ3 A;  3DDC B;  1TYG B;  4YTM B;  3P4R B;  4B0E A;  2D2Q A;  1R4N B;  2ZPN A;  3T3O A;  2XK5 A;  3JSV A;  2CJO A;  4GN1 A;  2HJ8 A;  1D4B A;  1C79 A;  1GAQ B;  3PPA A;  1GB1 A;  4YTN B;  1K52 A;  1KF6 B;  1KOT A;  2IZV B;  3EC8 A;  1SB3 C;  2KNB A;  5HKH A;  1B9R A;  4IOI E;  2DLB A;  3O65 B;  5G5H A;  5C2T B;  2REX A;  3KYD D;  4MDK E;  3RNB C;  1R4M B;  3ABV B;  2WS3 B;  5KHO A;  5FR6 A;  4P7I A;  3W1S C;  1UZX B;  4XZ4 A;  3MC9 A;  4HWI B;  2ZNV B;  2W9N A;  1WJ6 A;  2WXP A;  2CHX A;  3APF A;  3VUY A;  3PRE A;  3T9L A;  2BYT A;  3ZW3 A;  3AB5 A;  2FCS A;  3LYY A;  1WR6 E;  3RPF C;  4REZ A;  2PIA A;  3ZJU A;  4WH4 A;  3DCG A;  1R4N I;  3AEB B;  2NTS A;  2BVC A;  2KXJ A;  5DPW A;  4KSL C;  3FKY A;  2DBY A;  2IO0 B;  1OGW A;  3VHT C;  3FC4 A;  3N1X C;  3ALB A;  4A9A A;  4KSK C;  4NAW A;  4P6V F;  3NZS A;  2BYE A;  3ONS A;  3Q8C A;  2DNF A;  1XCQ L;  3KLS X;  1KLG D;  1D5M C;  1PYW D;  2KTR A;  1C1Y B;  3UQB A;  2FIF A;  3V3X A;  3BZD B;  1WZ3 A;  2LGX A;  4I6P A;  3AEF B;  3Q14 C;  3IG3 A;  1C3T A;  2G9H D;  2LXA A;  1TY0 A;  3X23 A;  4ZRQ A;  4RM8 A;  2UWQ A;  4HCN B;  1V5O A;  2KN4 A;  2DZI A;  2MBQ A;  1P9D U;  4RCO A;  1QOB A;  4X57 B;  1IBX A;  3UIO B;  3PTF C;  4DHJ B;  5IAA C;  1GB4 A;  3DOW A;  1VD2 A;  5AUI A;  3TEW A;  4WJP A;  3AEG B;  2M19 A;  3NY5 A;  2JXX A;  4C7Z A;  2Y5P A;  3QWZ B;  5BYQ A;  3RZF A;  1I4P A;  2ZW0 A;  1XXG A;  2G3Q B;  2UYZ B;  3DBL I;  5GXG B;  2LGD A;  1L0V B;  4KKI A;  2W54 A;  3C0R B;  3PRZ A;  1L4D B;  2MW5 A;  3D32 A;  3EUB 2;  3L4P A;  3Q2A C;  1EUV B;  2ICI A;  4IDI A;  4EKU A;  4G11 A;  1D5Z C;  1WGK A;  2XEW A;  3CMM B;  4HCP B;  4HXD A;  1ZW7 A;  4BBN F;  2IO3 B;  1ZGU B;  4Q2J A;  4BAX A;  2DEN B;  3P2B A;  2I2Y A;  2ZVO A;  4S17 A;  4ARC A;  4GGQ A;  1KRH A;  2V1Y A;  5HFY A;  4ACF A;  1MG8 A;  1JWB D;  1BUI C;  3R66 C;  3LXF A;  2GOW A;  2MP2 B;  3NVW A;  2AWT A;  3DVN V;  2ZJD A;  3APD A;  3ENE A;  4ANV A;  4TV3 A;  2WU2 B;  4TMA B;  4XWT A;  4JQW C;  2M8S A;  3U4E G;  3VRB B;  2L76 A;  5D7G A;  4FHJ A;  1ROE A;  3GOE A;  2V3S A;  1SBB B;  1Q1O A;  2V4I B;  3BVZ A;  2BPS A;  2NCN A;  3A9J A;  2K25 A;  4IWO A;  2K8H A;  3NVV A;  2D11 A;  3V60 A;  2INP E;  4FA6 A;  3Q8A A;  1DOI A;  4W9F A;  3P4S B;  3MJ5 A;  3KUC B;  1WMH B;  4K1R B;  4B0M A;  4WQM A;  1SF0 A;  1WX9 A;  1VLB A;  3SHQ A;  3MFG A;  3N30 A;  2NR2 A;  5G5G A;  4YSX B;  2PPH A;  2K22 A;  3DHH C;  1YN5 A;  1DOY A;  1NYR A;  2KX0 A;  2HTH A;  3AE7 B;  2FID A;  3U7Z A;  2ACZ B;  1SSN A;  5G2N A;  1EU3 A;  4BKS A;  4YTP B;  4KGR A;  1FCL A;  1FM0 D;  2VH2 A;  4K3B A;  3EFC A;  1F52 A;  4CO7 A;  1TS2 A;  3DVG Y;  3WCQ A;  2BYF A;  5LNK 1;  4JL9 A;  4KZC A;  2INN E;  1ACC A;  1BML C;  3HVD A;  3Q3O C;  2MA9 B;  4NQL B;  1YN3 A;  3SFD B;  4LNN A;  3RMK C;  3ZTC A;  3MJW A;  3BY4 B;  4NZL B;  4IM0 A;  4HDQ A;  3PO0 A;  4GMV A;  2M4N A;  3NHE B;  4DK5 A;  4ZRP A;  1ISN A;  3U8Z A;  3H7P A;  2HD5 B;  3HRD D;  3B1L X;  1NEN B;  3Q69 A;  4EZK A;  3NRZ A;  4BBN C;  3TSS A;  1L0Y B;  1P3Q U;  1ZPS A;  3DBH I;  2WHI A;  1T0Y A;  4AWJ A;  1TGZ B;  3CST A;  1OQR A;  4IWP A;  3GZN I;  3KQ4 A;  4LK0 M;  1OEY A;  3HM6 X;  4MSQ B;  3PZ8 A;  3B2G A;  1XLQ A;  1X1M A;  3PRM B;  1UUP A;  3VRA B;  2ASQ A;  2GBM A;  2KQ4 X;  1I4G A;  3QHT A;  4BKT A;  4JLC A;  3PZ7 A;  2D3B A;  2I1J A;  3QC8 B;  4AS1 A;  2BS2 B;  1VZ8 A;  1HA5 A;  1V80 A;  4M8M A;  2RD0 A;  1K8R B;  3DPD A;  1SE4 A;  4JPS A;  4M02 A;  4OHJ A;  2R2O A;  4OZA A;  3NVY A;  2RSU A;  2B76 B;  5DPT A;  2V3N A;  2BKF A;  1L7Y A;  2AYO B;  1WYG A;  3GZN B;  2KC1 A;  2KDE B;  4URK A;  2JQR B;  3QCA A;  2GBR A;  4H2A A;  1VZ6 A;  1N63 A;  4WWN A;  4DBG A;  4RM9 A;  4A3P A;  2DZM A;  5DCN A;  3N9Y C;  1WXQ A;  2WDT B;  3I63 C;  1YX6 B;  2YLM A;  1MI0 A;  3PSE B;  2PVO D;  3BK1 A;  2BGF A;  3UQA A;  2QDF A;  5GMV A;  3TUO A;  3W5U B;  1TY2 A;  3IHP C;  1MJD A;  3MC0 B;  2PVG C;  1V5T A;  1UD7 A;  2EMS A;  3V05 A;  1P7F A;  1L2N A;  4P1C C;  3UGB B;  3S2A A;  1NEK B;  4K3C A;  2Z8L A;  3RUI B;  1Y56 A;  1FXA A;  2KJ6 A;  2WDQ B;  1UWM A;  1WXS A;  2JU6 X;  3PGE A;  3C19 A;  3B9J A;  2JWU A;  3EEC A;  3L13 A;  2KTF A;  1VDV A;  4KGT A;  5IOI A;  4GDL A;  4JGH B;  2LVP A;  4RH6 A;  3BVG A;  5BMI A;  4G0N B;  3W2D A;  3AXC A;  4ZHP A;  1NI3 A;  1ET6 A;  2RDG A;  4KX6 B;  1E7P B;  3X0W A;  1E9M A;  2Z59 B;  4DDI D;  3URY A;  3NS1 A;  4HEA 1;  2LD9 A;  3QX1 A;  2HJ1 A;  3TIX A;  3HUI A;  3EA6 A;  1F77 A;  3N1Z C;  4GDK A;  2C9W B;  1ENF A;  1TKG A;  4RF0 A;  1SEB D;  3VQI A;  3L54 A;  3ML9 A;  4MJS A;  1WY8 A;  3H8H A;  2PJH A;  3RD2 A;  3SR6 A;  4HPP A;  2FUG 1;  2SAK A;  1QQR A;  3BK2 A;  3TEZ A;  2AEH A;  3R2T A;  2DAJ A;  3ZNH B;  2K6Q A;  2QIL A;  1MG4 A;  4JIO U;  1ZP0 B;  5KHQ A;  4XE0 A;  1PFD A;  2LUE A;  1WFY A;  1QIL A;  4DQO C;  2KZR A;  1WSP A;  2JX5 A;  4P16 A;  4MAC A;  2JVC A;  2V3P A;  4ZRI A;  2CJN A;  1MHH E;  2MP2 A;  4MM3 A;  1WX7 A;  4ANW A;  2N7J A;  4YWG G;  3AEA B;  3UF8 A;  4XC2 A;  4MGK E;  4HRO A;  2OOB B;  5D94 A;  3DBR I;  1WGD A;  2KAN A;  1C78 A;  1F2R I;  3RYT A;  4W9K A;  2FBW B;  2RDH A;  1J8C A;  3ZQ4 A;  2WXQ A;  4LNO A;  2C7M B;  2CHW A;  3R7R A;  1C9F A;  2M56 B;  1C4C A;  3OJ4 B;  3AV8 A;  4BZA A;  1KTK A;  1MFW A;  4L23 A;  1IUE A;  4NAM A;  3RT3 B;  5CHV C;  4GSW A;  2K8C A;  4HVB A;  2IND C;  3Q8F A;  3VUX A;  4KVG B;  2AQ2 B;  1TIF A;  1WXA A;  1GOZ A;  4IKG A;  1OFF A;  3DHI C;  2KMM A;  1EWC A;  1P7E A;  4LDT D;  3SU8 X;  4B95 A;  3ZO5 B;  3AE2 B;  4WAF A;  3AEE B;  2E6X A;  4XX5 A;  1FXI A;  4XYC A;  5BMG A;  2MBH A;  3A4S C;  1V1O A;  3IT4 B;  4KKJ A;  4LNF A;  1YX5 B;  1C77 A;  2JRH A;  1IPG A;  5FR3 A;  2O2V B;  5E6N A;  3QK0 A;  3UIP B;  3VR8 B;  4CYE A;  1SJH D;  1ZKH A;  3PLU A;  3OWE B;  4G50 A;  4GDL B;  5I4D A;  1I7H A;  4RF1 A;  4IWQ A;  4AUQ C;  1PGX A;  2QIE B;  2W55 A;  2WWZ A;  3AM9 A;  1VR9 A;  2LXC A;  2J7Q B;  2VRR B;  3ZLZ A;  2RGF A;  2MHJ A;  1N62 A;  2E3T A;  1JWS D;  5AZG A;  3DWG C;  3WA0 A;  1SGH A;  3B08 A;  2PE9 A;  3KYC D;  2PE6 B;  1V1P A;  2GRI A;  2BS3 B;  4FAD A;  1FRR A;  2LMC A;  2KWC A;  2IYD B;  3O13 A;  5HG2 A;  2KN5 A;  1I4H A;  3SDL C;  3W9C B;  1BXT A;  3ZJV A;  3VVW B;  1E10 A;  5LXH A;  4MH0 E;  1N5W A;  2B3A A;  3RFZ B;  2M1M A;  3AE1 B;  1TBE A;  1L6V A;  1J7A A;  1JRO A;  1WGG A;  2X8X X;  3TCA A;  2X38 A;  1TJE A;  2KQS A;  5CX3 A;  2IO2 B;  4LCD E;  2N1W A;  2MBO A;  1R7S A;  4IG7 B;  1YQB A;  4MM3 B;  2Y5B B;  3A1Q B;  1V9J A;  4F8C B;  3P42 A;  5CHW A;  3V6C B;  3C8Y A;  1QLB B;  2IGD A;  3KWL A;  1KLV A;  4FUL A;  3ZTD A;  3JW0 X;  2BBC A;  1VCB A;  3PRP B;  3V6E B;  1AAR A;  4EZL A;  1GUA B;  1Q5W B;  5HHD G;  4KGS A;  5AUK A;  4ANU A;  4C80 A;  1XEE A;  2KYW A;  2ZCB A;  4A55 A;  2OJW A;  3Q8B A;  3JSV B;  1GJZ A;  1UH6 A;  2QJL A;  1WGH A;  4E3C A;  4GIV A;  4KIK A;  2BB6 A;  3DBH B;  3NS8 A;  3TEX A;  1C4P A;  3AN1 A;  5L95 C;  3IT6 B;  3UI3 A;  1EM7 A;  3IFW B;  2IBI B;  4ANX A;  2R61 A;  2KWD A;  1IGD A;  2TSS A;  3MTN B;  4E74 A;  1LGR A;  1ZDX A;  1PGA A;  2BYV E;  2RMM A;  4MJS B;  4A3O A;  4NQK E;  2WDR B;  4W9G A;  1RFA A;  2KC2 A;  4S0R A;  2EMT A;  4RGO S;  2KMA A;  2QHO A;  2XN9 C;  2O6V D;  4OZB A;  1IYF A;  5L83 A;  5EE9 A;  2ON8 A;  3ZDM C;  2KVZ A;  2WP9 B;  2HE7 A;  3TJP A;  3VTU A;  4B6W A;  3VXW A;  1A70 A;  1WJ4 A;  1HEZ E;  4JWS C;  1YIW A;  4A6Q A;  1LO5 D;  4I6L B;  2JT4 B;  1NI2 A;  1TKE A;  2C7N B;  2BKR B;  4MH8 A;  4RFB A;  1QOF A;  2C7H A;  3ZXV A;  1MPE A;  4CQN A;  2D5G A;  2WU5 B;  3B0A A;  1UGJ A;  1XT9 B;  2GMI C;  1TTN A;  3R7Q A;  4PYZ A;  1E8Y A;  4FLH A;  3L17 A;  4M0W A;  4C4V A;  3VH4 B;  4PS7 A;  3ZIM A;  1KFY B;  1WMH A;  3N3K B;  2WX0 A;  4NJC A;  4KIK B;  1SE9 A;  5D3I B;  1V6E A;  1FEH A;  3ZNG C;  3IAM 1;  3PT2 B;  4A20 A;  1HTQ A;  2LUM A;  4N6E B;  4LTU A;  3KW5 B;  3CF6 E;  2K1F A;  3BWU D;  3KVF B;  1WRI A;  1FCC C;  4ZOH C;  3GB1 A;  1JQ4 A;  3PLV A;  3KH0 A;  4YSY B;  2YEP B;  1PDX A;  2LFI A;  3VAW A;  3A1Q A;  4BKG A;  4QAY A;  3AE4 B;  3L10 B;  1XLO A;  1DGJ A;  2L0F A;  5IN7 A;  1GG3 A;  2JZZ A;  2PEA A;  1WI0 A;  3DBS A;  3VH3 B;  1VRA B;  2ZVN A;  4O1N A;  2C5L C;  2J0K A;  4LJP B;  1N6Z A;  2G45 B;  2L00 B;  2KO3 A;  2L83 A;  3MHS D;  2MBE A;  2XK5 B;  2JPH A;  1FFV A;  4PK1 A;  2ZNV C;  4RNA A;  4HKQ A;  4FJV B;  1WRD B;  1QOG A;  4FHK A;  2G1E A;  1WYW B;  2DHZ A;  4HPM B;  1XF5 L;  2IY0 B;  3WAP A;  1V2Y A;  2RPQ A;  5BYS A;  2WXM A;  4J3O D;  4L2Y A;  3U52 E;  1DOX A;  2DZK A;  4RGN A;  3HM3 A;  3PHW B;  5IA7 A;  1L5P A;  4GU2 A;  3WAL A;  3RNF C;  1KM7 A;  2WXL A;  2KD0 A;  4PT5 A;  4WQO B;  1WR1 A;  1FD6 A;  4K7W A;  4ITK A;  4N59 A;  2QSD A;  3ZYY X;  3TEY A;  2J0J A;  1PUT A;  1FIQ A;  1E7U A;  3I57 A;  5JHA A;  1Y8R C;  2O2V A;  4GLS C;  1HQR D;  5D2M B;  5G55 A;  4HDO A;  4ARI A;  1V8C A;  2WGS A;  5JXV A;  2WXG A;  3U30 A;  2QMT A;  4IM2 A;  4KDI C;  4ASW C;  3RN9 C;  3ZKJ C;  3ZRF A;  5C3J B;  2W82 A;  5IP4 D;  4W9I A;  1WXM A;  3E56 A;  4WUR A;  2LRU A;  4DXA B;  3TMP B;  1WJU A;  3M62 B;  5EE3 A;  3I5J C;  4W9C A;  5BMH A;  4YSZ B;  1YQ4 B;  4NAW B;  3KWV A;  1WH3 A;  4XGA B;  3PVL A;  2KK8 A;  3N32 A;  1AN8 A;  2WYQ A;  2K5P A;  3AMZ A;  1L6U A;  3L0W B;  5DPR A;  2KT7 A;  2IGH A;  3IVF A;  2NPT B;  1D5X C;  3WAM A;  2AL6 A;  2O6V A;  3QAQ A;  2KAC A;  3AI5 A;  4GXB A;  2FE8 A;  2L8J A;  2LJ5 A;  2L05 A;  3QIJ A;  4USA A;  1YJJ A;  3EGR A;  2LJI A;  5FKA C;  1AW7 A;  2C60 A;  2H89 B;  4PS8 A;  2KDI A;  4G3X B;  2A4Z A;  3GE3 C;  3DBR B;  1XLP A;  2MSE D;  2K0P A;  2MX2 A;  2GBN A;  3FAH A;  2ZEQ A;  4FJY A;  2MBB B;  3ETR A;  4FJZ A;  3R8B A;  5CTR C;  1G6J A;  5D6J B;  4BKS D;  3VFK A;  1KJT A;  5E6J A;  4C56 C;  1KH0 A;  3WIM A;  4ZRJ A;  2BQQ A;  1JWA D;  2DAF A;  2N0S B;  2J4X A;  4AQ7 A;  2Y5C A;  4AJW A;  2DWQ A;  1RLF A;  4A8X C;  4W9H A;  4FXC A;  1E5W A;  1FNW A;  2LVQ A;  4RGT A;  5AZH A;  1WF9 A;  1Q0W B;  1NVI D;  4NJ7 A;  5LLI A;  2GLS A;  4MEL A;  2FNJ B;  2XBB C;  1YN4 A;  2J42 A;  1XD3 B;  2V0G A;  2I1K A;  3VR9 B;  1M94 A;  4MEM A;  3E9S A;  2KDM A;  3CIR B;  3Q8E A;  2N9L A;  4KDL B;  1GNU A;  2WXO A;  1FMA D;  1JRP A;  1RFK A;  2LHE A;  3KUZ A;  1FPY A;  2N7D A;  3VTW A;  1GC7 A;  4TQ1 A;  2L7R A;  1GPX A;  3NG0 A;  1WGR A;  2KHW B;  1CQV A;  1ZE3 D;  3N1Y C;  4MGZ E;  2AX5 A;  3APC A;  2ZPY A;  5J2R A;  1JCK B;  1SIF A;  2KOX A;  2WXR A;  4BOS C;  3AE9 B;  1B1Z A;  2LZ6 A;  3ML8 A;  3AE5 B;  2K6D B;  3TBL D;  4KV2 A;  2YEP F;  2A5U A;  3RI7 C;  3GE8 C;  3RNG C;  2BW2 A;  2KKC A;  2FUH B;  2FAZ A;  2WLB A;  4GOC A;  3AE6 B;  4WJQ A;  5JZE B;  3SEB A;  4K7U A;  1CK1 A;  3Q6B A;  4M01 A;  3EHV A;  3ZVV A;  3QA8 A;  3RNE C;  1V86 A;  4CHK A;  4US9 A;  3PHX B;  4BOZ B;  1RYJ A;  1YD8 U;  3A9K A;  3P1M A;  2MEK A;  3DBL B;  3LDZ E;  2ONQ A;  2L0T A;  2WXK A;  2LWP A;  4IUM B;  1Q10 A;  1YQ3 B;  1T0R C;  2JYE A;  1V49 A;  2IPK D;  1P0R A;  3Q3N C;  4KZ0 A;  3JVZ X;  3K9P B;  4MGY E;  1C4A A;  1FXT B;  2UU7 A;  1F2R C;  4DXG A;  3ZDT A;  2N9P C;  3R3M A;  1ZOY B;  1P98 A;  2WXJ A;  1NBF C;  2CR5 A;  1T0Q C;  4HJK A;  2GB1 A;  4R3D A;  4WIP A;  1UWX A;  2W3S A;  4EOY A;  1OQY A;  2AL3 A;  4ZHO A;  2KFJ A;  4ZYS A;  4EZJ A;  5E6O A;  1FNV A;  1T0S C;  1WGY A;  2NTT A;  4UDU C;  4TUU A;  5EE0 A;  2Q5W D;  3Q3F A;  5IO9 A;  2OHF A;  2G4D B;  2LRW A;  2QEJ C;  1TS5 A;  2D3A A;  3GS2 A;  1K50 A;  3ECI A;  4PYU A;  4YT0 B;  2N7E A;  4E71 A;  4ICV A;  3V62 A;  3W1S A;  3P4P B;  2H88 B;  1T6B X;  3J9C A;  1JW9 D;  1OQQ A;  3MC8 A;  2VZK B;  1E8W A;  3HIZ A;  5T8I A;  1J7B A;  2CKH B;  1S1Q B;  1BT0 A;  2K39 A;  3BYT B;  4DHZ E;  1IGC A;  4N58 A;  3HVZ A;  1EU4 A;  2M17 A;  3OG5 A;  3R2I A;  2V9H A;  2M0A A;  2FCQ A;  2AQ1 B;  4WWP A;  5J17 A;  2NVU I;  2JRI B;  3ZRC A;  1N60 A;  1PQS A;  2CU3 A;  4FBJ B;  1K51 A;  2EEL A;  2I38 A;  3ZNI D;  1STE A;  4WWM A;  1JML A;  1TKY A;  2D3G A;  4B9K A;  3Q3M C;  4ZDV A;  3H9D A;  2MCN B;  4TQ0 A;  5D3D A;  3P63 A;  3QQ8 B;  4D2K A;  2BWE S;  3M63 B;  3VDZ A;  4II3 B;  4K81 A;  4HPL B;  1JRU A;  1VJK A;  1T5X D;  3AED B;  2J52 A;  4OVZ A;  2KWU B;  5H8Y E;  1WIA A;  2LGI A;  2KWV B;  2ZW1 A;  4XDD A;  1RM6 C;  2VH1 A;  2LGY A;  5HI1 A;  1EF1 A;  2DX5 B;  1A5R A;  4I6N B;  4YXD B;  5C23 A;  3DVN U;  1UEL A;  1LM8 B;  3H7S A;  2JZP A;  2XNA C;  5J18 A;  3IBE A;  1HZ6 A;  1C76 A;  4OZC A;  4LJO B;  1N61 A;  1E7V A;  2NBW B;  2Z0E B;  2KJH B;  4NNJ B;  3OAW A;  3PV1 A;  1FRD A;  1SXT A;  1QF6 A;  2QC8 A;  1Z2M A;  3U7D A;  4DDG D;  3B2F A;  1HZ5 A;  1F0Z A;  1UBQ A;  3A9J B;  5CHF A;  4JWU C;  3SFE B;  1CZP A;  1WM3 A;  2WXI A;  3AUL A;  2M0X A;  3Q3J A;  4GB9 A;  1XCT L;  3AEC B;  2N4F A;  3NUH B;  4NY0 A;  2QCZ A;  2CS4 A;  3QJZ A;  4LLG M;  3NJT A;  2G4S A;  1H4R A;  3FIL A;  4MGI E;  1YMH E;  2KJR A;  2KLC A;  2J53 A;  2KMC A;  2IO1 B;  4IW0 A;  1J7C A;  2MJ3 A;  2J0M A;  1RAX A;  2MH7 A;  1J19 A;  2JZ3 B;  1Z5S B;  3LJ3 A;  1QOA A;  2MQJ A;  1WX8 A;  4F1S A;  2MJD A;  4HRS A;  4DHZ B;  2MLB A;  4MSM B;  1VZ7 A;  1HXY D;  2LAS A;  4AP4 C;  4HK2 A;  4EEW A;  2MJE A;  4K7S A;  3AU5 A;  2BT6 A;  4WJN A;  4RGM A;  2MRP A;  2D10 A;  1DYQ A;  2GBK A;  2LHD A;  4IC7 B;  1UNS A;  1FNU A;  2Z0D B;  1GC6 A;  2LI5 A;  4DHJ D;  1YOV B;  3JYU A;  2PW9 A;  2WQY B;  1MVK A;  3NOB A;  2KDB A;  3U2S C;  2VZK D;  4HJG E;  1J0G A;  2ZZP B;  3CSF A;  3WAO A;  1YJI A;  4A90 A;  5FK9 C;  4JE3 B;  2JUO A;  2KVR A;  1RWS A;  4XDC A;  1HE8 A;  1LXD A;  1IBX B;  3FIL B;  1ZXH A;  3L08 A;  2D07 B;  3BIN A;  1D6E C;  2EKE C;  2KX3 A;  3AE3 B;  5MPO A;  2L52 A;  1WE7 A;  2LGS A;  1F9J A;  2KFK B;  1ZDV A;  1H8C A;  2N9X A;  2WNM A;  4EUT A;  2NBV B;  2FCN A;  3EFU A;  5LXI B;  4OVV A;  2WXN A;  2NBU A;  3RNA C;  1WJN A;  2V4L A;  1UGM A;  2L32 A;  1E6E B;  1TZ1 A;  2KLG A;  1V1P B;  1JAL A;  2YVC A;  4W9E A;  4W9J A;  4JX1 C;  2KTR B;  4MT5 A;  5EDS A;  1N5X A;  1WZ0 A;  2INC C;  1E90 A;  4M8N A;  3NZU A;  3I9V 1;  5C1Z A;  3T3N A;  1TS4 A;  3RZW C;  2NPT A;  1LQB A;  3RNC C;  3ZGZ A;  3W5V B;  1L4Z B;  4IM3 A;  1IP9 A;  2HTM E;  3P4Q B;  5JH5 C;  4LDT B;  3MHZ A;  3H7P B;  1CJE A;  1E8Z A;  3MP9 A;  1QZE A;  3AE8 B;  3BVM A;  1JWM D;  3ZXR A;  3HHM A;  4EFO A;  2WXF A;  3BII D;  1R4M I;  3HK0 A;  2ZCC A;  1D3Z A;  4WAA A;  3LB8 C;  2BWF A;  2K9X A;  2IGG A;  2RR9 A;  1E8X A;  1EWY C;  3CWI A;  2HDE A;  1TZO A;  4EE2 A;  2PMV A;  3DQV A;  3RUL A;  1ESF A;  3AH7 A;  2JWZ A;  4P1B C;  1M4V A;  3A4R A;  2KFK A;  1TS3 A;  2N1V A;  2DYB A;  3AU4 A;  1MHX A;  2L3Z A;  5EE1 A;  5AZF A;  4OW0 A;  4TSS A;  1YJ1 A;  5BYR A;  4AJY B;  1SJE D;  4F7Z A;  2N9E B;  2IY1 B;  5AEK B;  1SE2 A;  1HTO A;  1V81 A;  2JY6 A;  2OED A;  2LVO A;  3DHG C;  1WM2 A;  3VTV A;  2AQ3 B;  3L16 A;  4NJ6 A;  2R2Q A;  1ET9 A;  3BYY B;  1XO3 A;  2GBJ A;  2D3C A;  5BO4 B;  1V97 A;  2WX1 A;  4W9D A;  2L1A A;  3N20 C; 
#chains in the Genus database with same CATH homology
 4GOC A;  1P1A A;  3H6N A;  2FID A;  2KQS A;  5CX3 A;  1WE6 A;  2IO2 B;  4LCD E;  4WJQ A;  2N1W A;  1LFD A;  2MBO A;  5G2N A;  3WAN A;  5JZE B;  4IG7 B;  1YQB A;  4K7U A;  4BKS A;  2Y5B B;  4J6I A;  3EHV A;  3A1Q B;  3UIN B;  3ZVV A;  1V9J A;  2MWS B;  3QA8 A;  4F8C B;  4CO7 A;  1V86 A;  5CHW A;  3ZNZ B;  3V6C B;  4CHK A;  3TL5 A;  3DVG Y;  2BYF A;  1KLV A;  4FUL A;  3PHX B;  3ZTD A;  4BOZ B;  3JW0 X;  4JL9 A;  4KZC A;  3M95 A;  1VCB A;  1YD8 U;  3A9K A;  3PRP B;  2MA9 B;  4NQL B;  3V6E B;  4WJO A;  3ZTC A;  3LDZ E;  1AAR A;  2L0T A;  3MJW A;  4EZL A;  1GUA B;  3BY4 B;  1Q5W B;  4II2 B;  2LWP A;  4IUM B;  4OVU A;  4ANU A;  2ZCB A;  1I42 A;  4IM0 A;  4W9L A;  2DYM A;  3JSV B;  4HDQ A;  1GJZ A;  1UH6 A;  1NDD A;  1WGH A;  1XQQ A;  4GMV A;  4E3C A;  1V49 A;  4GIV A;  4KIK A;  1P0R A;  2M4N A;  4KZ0 A;  3NS8 A;  3JVZ X;  3K9P B;  4MGY E;  1FXT B;  3ZDT A;  2N9P C;  3NHE B;  4DK5 A;  3OLM D;  3R3M A;  5L95 C;  1ISN A;  3U8Z A;  3H7P A;  1P98 A;  2KDF B;  1NBF C;  3W1Y A;  2CR5 A;  2HD5 B;  3IFW B;  4HJK A;  2IBI B;  4ANX A;  3B1L X;  4ICU A;  4PS3 A;  4EZK A;  4BBN C;  4EOY A;  1OQY A;  4WWO A;  2AL3 A;  3MTN B;  4E74 A;  1P3Q U;  2BYV E;  4MJS B;  3DBH I;  3H1U A;  2KFJ A;  1T0Y A;  4EZJ A;  4AWJ A;  1TGZ B;  5E6O A;  1U4A A;  1WGY A;  3CST A;  4A3O A;  4NQK E;  4TUU A;  2CHZ A;  4W9G A;  1RFA A;  4IWP A;  3GZN I;  2CU1 A;  3Q3F A;  2KC2 A;  1OEY A;  2O6V B;  3HM6 X;  1S3S G;  2EMT A;  2G4D B;  2K8B A;  2LRW A;  4MSQ B;  2KMA A;  2QHO A;  1X1M A;  3PRM B;  2ASQ A;  3ECI A;  2GBM A;  4PYU A;  4E71 A;  2N7E A;  2O6V D;  3QHT A;  1IYF A;  4ICV A;  3V62 A;  3W1S A;  4BKT A;  1RRB A;  4JLC A;  5L83 A;  3ZDM C;  2I1J A;  3QC8 B;  2NS5 A;  3A9K B;  2HE7 A;  1E8W A;  1CMX B;  3TJP A;  3VTU A;  4B6W A;  4HLE A;  3VXW A;  2FCM A;  3OJ3 A;  4N9F 4;  3HIZ A;  4GDK B;  3SD5 A;  1V80 A;  1WJ4 A;  4M8M A;  2CKH B;  2RD0 A;  1UBI A;  1YIW A;  1K8R B;  1S1Q B;  3DPD A;  1BT0 A;  2K39 A;  4M0W B;  4DHZ E;  3DVG X;  2DZJ A;  4I6L B;  2BF8 B;  4RMA A;  3VUW A;  2R2O A;  2JT4 B;  5DPS A;  1NI2 A;  3KUD B;  2M17 A;  2C7N B;  2OJR A;  2BKR B;  2RSU A;  2C7H A;  2FCQ A;  5DPT A;  4WWP A;  4YL8 A;  5J17 A;  2NVU I;  2JRI B;  3ZRC A;  2BKF A;  1L7Y A;  4TKN A;  2AYO B;  1PQS A;  4FN2 A;  1OEY J;  3B0A A;  1XT9 B;  2KC1 A;  2GMI C;  2KDE B;  1I35 A;  4URK A;  3PS6 A;  4FBJ B;  3QCA A;  1TTN A;  2GBR A;  3R7Q A;  4PYZ A;  1E8Y A;  4AOF A;  4FLH A;  4WWN A;  3ZNI D;  3L17 A;  4BVU C;  4DBG A;  4RM9 A;  4A3P A;  2DZM A;  4DWF A;  3VH4 B;  5DCN A;  3ZUN A;  3QAR A;  2D3G A;  4PS7 A;  4ZYN A;  3ZIM A;  1WMH A;  2WDT B;  1YX6 B;  4B9K A;  2YLM A;  3N3K B;  2WX0 A;  1EO6 A;  3PSE B;  4ZDV A;  3H9D A;  4KIK B;  1SE9 A;  2MCN B;  4TQ0 A;  1V6E A;  2BGF A;  3UQA A;  3T8M A;  5GMV A;  3QQ8 B;  3ZNG C;  3PT2 B;  3M3J A;  2BWE S;  4A20 A;  3M63 B;  3VDZ A;  5E6P A;  2KQ7 A;  3KW5 B;  2DYO A;  4II3 B;  4HPL B;  3IHP C;  1EF5 A;  1OTR B;  1JRU A;  4K81 A;  5JHB A;  3CF6 E;  2K1F A;  3PZD A;  3A33 B;  3KVF B;  1V5T A;  4NPN A;  1UD7 A;  2EMS A;  2KWU B;  1WIA A;  4ZRK A;  3PLV A;  3KH0 A;  3I3T B;  2JF5 A;  2KWV B;  1L2N A;  3UGB B;  3S2A A;  3VAW A;  3RUI B;  2LGY A;  1EF1 A;  2DX5 B;  1WXV A;  2KJ6 A;  1A5R A;  3A1Q A;  4I6N B;  1WXS A;  5C23 A;  4BKG A;  3DVN U;  3PGE A;  4BFR A;  1UEL A;  3RCZ A;  3L10 B;  3K9O B;  3EEC A;  3L13 A;  2KTF A;  1LM8 B;  2L0F A;  3V61 A;  5TR5 A;  3H7S A;  1GG3 A;  2JZZ A;  3DDC B;  4GDL A;  2PEA A;  1WI0 A;  5J18 A;  3IBE A;  4JGH B;  3DBS A;  3VH3 B;  2LVP A;  2D2Q A;  2ZVN A;  2C5L C;  2J0K A;  2ZPN A;  4LJP B;  4LJO B;  2XK5 A;  3JSV A;  1E7V A;  2G45 B;  2NBW B;  2Z0E B;  4G0N B;  3AXC A;  2L00 B;  2HJ8 A;  4GN1 A;  2KO3 A;  2KJH B;  3PPA A;  4NNJ B;  3MHS D;  2MBE A;  3OAW A;  3PV1 A;  2XK5 B;  3X0W A;  2JPH A;  1KOT A;  2IZV B;  2Z59 B;  3EC8 A;  4DDI D;  2ZNV C;  2KNB A;  5HKH A;  1Z2M A;  4FJV B;  1WRD B;  4FHK A;  3O65 B;  3U7D A;  4DDG D;  2REX A;  3KYD D;  2LD9 A;  4MDK E;  3QX1 A;  1WYW B;  2DHZ A;  1UBQ A;  4HPM B;  3A9J B;  2IY0 B;  5CHF A;  5FR6 A;  5KHO A;  3TIX A;  3WAP A;  4P7I A;  1V2Y A;  2RPQ A;  4GDK A;  2C9W B;  3W1S C;  1UZX B;  4XZ4 A;  2DZK A;  1WM3 A;  4HWI B;  2ZNV B;  2W9N A;  1WJ6 A;  2M0X A;  3AUL A;  3VQI A;  3L54 A;  2CHX A;  3HM3 A;  3ML9 A;  3Q3J A;  4GB9 A;  3PHW B;  5IA7 A;  3APF A;  4MJS A;  3VUY A;  2N4F A;  4NY0 A;  1WY8 A;  4GU2 A;  3WAL A;  2CS4 A;  1KM7 A;  3PRE A;  2KD0 A;  3T9L A;  3ZW3 A;  3QJZ A;  2PJH A;  4WQO B;  2FCS A;  3RD2 A;  1WR1 A;  1WR6 E;  2G4S A;  1H4R A;  4K7W A;  4MGI E;  2KJR A;  2KLC A;  2J0J A;  2AEH A;  3DCG A;  1E7U A;  1R4N I;  2KMC A;  2DAJ A;  3ZNH B;  2K6Q A;  2IO1 B;  4IW0 A;  5JHA A;  1Y8R C;  2O2V A;  2KXJ A;  4JIO U;  5DPW A;  2J0M A;  1RAX A;  4KSL C;  5KHQ A;  5D2M B;  5G55 A;  1J19 A;  2JZ3 B;  2IO0 B;  1Z5S B;  2MQJ A;  2LUE A;  1OGW A;  1WX8 A;  3LJ3 A;  4HDO A;  1WFY A;  3VHT C;  4DHZ B;  4F1S A;  3ALB A;  2MLB A;  4MSM B;  2KZR A;  2LAS A;  4KSK C;  4NAW A;  3NZS A;  4AP4 C;  4HK2 A;  2BYE A;  3ONS A;  4EEW A;  4K7S A;  3U30 A;  3AU5 A;  4IM2 A;  4KDI C;  4WJN A;  4ASW C;  2JVC A;  3ZKJ C;  3ZRF A;  2KTR A;  4ZRI A;  1C1Y B;  2MRP A;  2D10 A;  3UQB A;  2FIF A;  4W9I A;  2GBK A;  1WZ3 A;  1WXM A;  2LGX A;  2MP2 A;  2LRU A;  1WX7 A;  4MM3 A;  4DXA B;  4ANW A;  3TMP B;  1WJU A;  3M62 B;  4IC7 B;  4I6P A;  4XC2 A;  3UF8 A;  4MGK E;  4W9C A;  2OOB B;  5D94 A;  2Z0D B;  3DBR I;  1GC6 A;  1WGD A;  2LI5 A;  2KAN A;  4DHJ D;  3IG3 A;  4NAW B;  1WH3 A;  3RYT A;  4W9K A;  3JYU A;  1C3T A;  3PVL A;  1J8C A;  2LXA A;  2KK8 A;  3N32 A;  3NOB A;  2KDB A;  2WYQ A;  3X23 A;  1J0G A;  2ZZP B;  4RM8 A;  2UWQ A;  2C7M B;  2CHW A;  3CSF A;  3L0W B;  3WAO A;  3R7R A;  5DPR A;  4HCN B;  2JUO A;  2KVR A;  3IVF A;  2NPT B;  1V5O A;  3WAM A;  2DZI A;  2MBQ A;  3OJ4 B;  2AL6 A;  1HE8 A;  1LXD A;  2O6V A;  1P9D U;  3QAQ A;  3L08 A;  4X57 B;  2D07 B;  3AI5 A;  3BIN A;  4GXB A;  2L8J A;  2EKE C;  3UIO B;  2LJ5 A;  3RT3 B;  2L05 A;  3QIJ A;  2KX3 A;  3PTF C;  5CHV C;  4GSW A;  4DHJ B;  2K8C A;  2C60 A;  4HVB A;  5IAA C;  3VUX A;  4PS8 A;  3DOW A;  1WE7 A;  4KVG B;  2KDI A;  4G3X B;  2A4Z A;  1F9J A;  2KFK B;  1VD2 A;  1WXA A;  1H8C A;  4WJP A;  2MSE D;  2N9X A;  2MX2 A;  2GBN A;  4EUT A;  3NY5 A;  2NBV B;  2ZEQ A;  4FJY A;  4LDT D;  2MBB B;  3SU8 X;  2FCN A;  4FJZ A;  4B95 A;  3EFU A;  5CTR C;  5LXI B;  3ZO5 B;  1G6J A;  4OVV A;  2JXX A;  5D6J B;  2NBU A;  3QWZ B;  1WJN A;  3RZF A;  4BKS D;  3VFK A;  1KJT A;  2V4L A;  1UGM A;  2G3Q B;  1TZ1 A;  2KLG A;  2YVC A;  4W9E A;  4W9J A;  3WIM A;  2KTR B;  2UYZ B;  5EDS A;  4XX5 A;  3DBL I;  4ZRJ A;  1WZ0 A;  1E90 A;  2DAF A;  2LGD A;  4M8N A;  3NZU A;  2MBH A;  3A4S C;  5C1Z A;  3C0R B;  3PRZ A;  2MW5 A;  3RZW C;  3D32 A;  4AJW A;  2NPT A;  1YX5 B;  1EUV B;  1RLF A;  1LQB A;  4EKU A;  4G11 A;  4W9H A;  2XEW A;  3CMM B;  1E5W A;  4HCP B;  2JRH A;  2LVQ A;  4HXD A;  4IM3 A;  1ZW7 A;  1IP9 A;  5AZH A;  4BBN F;  1IPG A;  1WF9 A;  2IO3 B;  1Q0W B;  2O2V B;  4NJ7 A;  5E6N A;  1ZGU B;  3QK0 A;  5LLI A;  4LDT B;  5JH5 C;  2DEN B;  3UIP B;  3P2B A;  3H7P B;  2ZVO A;  4MEL A;  1E8Z A;  4CYE A;  2FNJ B;  1ZKH A;  3PLU A;  1QZE A;  2V1Y A;  2XBB C;  4G50 A;  4GGQ A;  4GDL B;  1XD3 B;  1MG8 A;  2I1K A;  1M94 A;  4MEM A;  3HHM A;  3R66 C;  4IWQ A;  4AUQ C;  4EFO A;  2GOW A;  2MP2 B;  2AWT A;  3DVN V;  4KDL B;  1GNU A;  2ZJD A;  1R4M I;  2WWZ A;  3HK0 A;  2ZCC A;  3APD A;  3ENE A;  4ANV A;  1D3Z A;  4TV3 A;  4WAA A;  3KUZ A;  4JQW C;  2N7D A;  2M8S A;  2BWF A;  3VTW A;  2RR9 A;  1E8X A;  2LXC A;  1GC7 A;  2J7Q B;  2L76 A;  2VRR B;  3ZLZ A;  4TQ1 A;  2RGF A;  5D7G A;  2L7R A;  5AZG A;  4FHJ A;  3WA0 A;  1SGH A;  3B08 A;  3DQV A;  1WGR A;  3RUL A;  3GOE A;  2JWZ A;  2V3S A;  2KHW B;  2PE9 A;  3A4R A;  2KFK A;  2N1V A;  2DYB A;  3AU4 A;  3KYC D;  1Q1O A;  2L3Z A;  2BPS A;  2NCN A;  3A9J A;  5AZF A;  2K25 A;  2PE6 B;  4MGZ E;  4IWO A;  2K8H A;  2D11 A;  4FAD A;  1YJ1 A;  3APC A;  2ZPY A;  2KWC A;  3V60 A;  4FA6 A;  5J2R A;  2IYD B;  4AJY B;  1SIF A;  2KOX A;  4F7Z A;  2N9E B;  2IY1 B;  4W9F A;  2KN5 A;  4BOS C;  5AEK B;  3SDL C;  3KUC B;  1V81 A;  1WMH B;  2JY6 A;  2LVO A;  3VTV A;  1WM2 A;  4K1R B;  2LZ6 A;  3ML8 A;  1WX9 A;  3SHQ A;  3L16 A;  3VVW B;  4NJ6 A;  2R2Q A;  2K6D B;  5LXH A;  3N30 A;  4MH0 E;  2B3A A;  2NR2 A;  2M1M A;  1TBE A;  3TBL D;  4KV2 A;  2GBJ A;  2PPH A;  2A5U A;  5BO4 B;  2KX0 A;  2WX1 A;  2HTH A;  2KKC A;  4W9D A;  1WGG A;  2FAZ A;  2FUH B;  3TCA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...