1WX7A

Solution structure of the n-terminal ubiquitin-like domain in the human ubiquilin 3 (ubqln3)
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
106
structure length
106
Chain Sequence
b'GSSGSSGSPAPVQDPHLIKVTVKTPKDKEDFSVTDTCTIQQLKEEISQRFKAHPDQLVLIFAGKILKDPDSLAQCGVRDGLTVHLVIKRQHRAMGNECPASGPSSG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ubiquilin 3
publication title Solution Structure of the N-terminal Ubiquitin-like Domain in the Human Ubiquilin 3 (UBQLN3)
rcsb
source organism Homo sapiens
molecule tags Structural genomics, unknown function
total genus 13
structure length 106
sequence length 106
ec nomenclature
pdb deposition date 2005-01-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00240 ubiquitin Ubiquitin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 1wx7A01
4HPMB 4F7ZA 3APCA 3VAWA 5L95C 5J18A 2K1FA 2NBWB 2MX2A 4XC2A 4TKNA 1L7YA 5J2RA 4HWIB 2L76A 4B6WA 2FCSA 2G4SA 4IM0A 3A4RA 1NDDA 4HVBA 1RRBA 3O65B 2DZKA 2KWVB 1KJTA 5DPSA 1LM8B 1V81A 4MM3A 2ZVOA 3HM3A 5JZEB 2JZZA 4K7SA 1EO6A 4PS8A 3VXWA 5JH5C 3A9KA 2KVRA 2LVQA 4W9CA 2MBHA 4JIOU 4NQLB 5JHAA 2K39A 3N30A 4DHJB 4II2B 2D2QA 3VUXA 2KFKA 3PSEB 1WRDB 4I6PA 4EZJA 2L8JA 2MBEA 4AJWA 2M8SA 4ASWC 2BYVE 3GOEA 3H1UA 3PREA 3M3JA 4IWQA 3SU8X 3T9LA 4DWFA 2FNJB 4GDKB 2L00B 1KM7A 2LRWA 3WAPA 4ICVA 3OJ4B 3A1QA 2NCNA 2C7HA 3NY5A 1KLVA 4DHJD 5CTRC 3DPDA 1WR1A 2C60A 2KHWB 2YLMA 1WIAA 4MEMA 2GBNA 2BKFA 1GG3A 2KO3A 4NQKE 5DPWA 3IHPC 1OEYJ 5DPTA 3UF8A 1WM3A 3SD5A 3V6EB 4BFRA 2CHWA 2DZJA 1WJ4A 2ZCBA 3QCAA 4URKA 2O6VA 4DHZB 4IC7B 2KX0A 4G0NB 1WX7A 4FN2A 2GMIC 4AUQC 1WJUA 2KC2A 4MJSA 2IO3B 4BKTA 3PRPB 4EEWA 3ZTCA 3SDLC 2ASQA 4FULA 4HK2A 3W1SC 1SIFA 3WA0A 4JL9A 4AP4C 1NI2A 2LVOA 2KFKB 4A3PA 3W1YA 3WIMA 4A20A 3PRZA 3QARA 3ZO5B 2J7QB 4MH0E 3APDA 2R2QA 2N1WA 3UIOB 3JW0X 2K6QA 5AEKB 4HXDA 3RULA 2DAFA 4BKGA 4AOFA 2C7NB 4W9EA 4E3CA 4NNJB 4EZLA 1YX6B 2PPHA 3KUZA 3L08A 1VD2A 4KDIC 2MCNB 3HIZA 4WJNA 4ICUA 3H7PA 1P3QU 2AWTA 3AU5A 4G3XB 5E6PA 4G11A 2G3QB 3Q3JA 2LXCA 1SE9A 3S2AA 3K9PB 1TTNA 3ZDMC 2LI5A 1WF9A 2IYDB 2FAZA 4TV3A 2BYEA 2CS4A 2PEAA 3DVNU 3QIJA 2N1VA 1E8WA 1U4AA 2HTHA 2O6VB 3U30A 1I42A 2JRHA 4NY0A 2R2OA 2D3GA 4P7IA 1IPGA 2N7DA 5JHBA 2DAJA 4MGIE 3ZKJC 3KVFB 1OEYA 1V6EA 2L05A 2O6VD 1WM2A 4GB9A 3K9OB 2BWES 2BWFA 3QJZA 1WYWB 4OVVA 3RT3B 1YD8U 2GBJA 2JXXA 1HE8A 2ZVNA 3PHXB 1E5WA 2KDFB 4K7UA 4KVGB 2IO0B 2NPTA 3QA8A 4FHKA 4W9HA 4BBNF 2N9EB 2IBIB 4FHJA 3MJWA 2K25A 3L17A 1UGMA 1Q0WB 3SHQA 3ZVVA 2AYOB 4TQ0A 1WGYA 2CR5A 3UGBB 3EECA 2IO1B 3IFWB 1WXMA 4MELA 2KDBA 3RCZA 4B9KA 4ANWA 4F8CB 1V5TA 2FIFA 3B08A 5CHWA 2BYFA 2DENB 3AI5A 4I6LB 3KYDD 3L16A 4NJ6A 2BF8B 5DPRA 4DDID 3VTWA 3VDZA 4J6IA 2OJRA 4GDKA 4HPLB 5FR6A 4HJKA 1C3TA 1E90A 2MWSB 2V3SA 2ZPYA 2MRPA 4II3B 4ANVA 1EUVB 3BINA 3GZNI 3TIXA 2KKCA 3RYTA 2KMAA 2LGXA 2KOXA 4M8NA 5LXIB 3HM6X 4OVUA 2FCNA 5E6NA 3IVFA 1V9JA 3PT2B 3I3TB 4MSMB 4MGKE 2NPTB 3VFKA 2MSED 2N9XA 1TZ1A 4RM9A 3TMPB 2KK8A 4PS3A 3WALA 3PS6A 4LDTB 2MBQA 3DBRI 2Y5BB 4JLCA 2DHZA 2I1JA 2KDEB 4KSKC 1E7VA 3UIPB 4E74A 2ZCCA 4DBGA 1CMXB 2JUOA 3LJ3A 3U7DA 2V1YA 3ZUNA 3VTVA 2C7MB 1LFDA 3ECIA 3ZTDA 2DX5B 3DVGX 1L2NA 1J8CA 4LDTD 2N9PC 2MLBA 2NBVB 3PLVA 3V6CB 4ANUA 2MW5A 4W9FA 2K8HA 5LLIA 1YX5B 2VRRB 1WGRA 4FBJB 3PLUA 3B0AA 1WY8A 1GNUA 3MHSD 4WJPA 1R4NI 1WGDA 4YL8A 4A3OA 2G45B 3RUIB 3CSFA 3D32A 3R66C 3A9JB 1V86A 3ZRFA 1H8CA 2WWZA 4XZ4A 5TR5A 2CU1A 2W9NA 1R4MI 2K8CA 3WAOA 3DOWA 2JVCA 1LXDA 3CSTA 2K6DB 2FCQA 2KN5A 2D11A 2HE7A 2RR9A 1WGHA 5J17A 1KOTA 4WWOA 2RD0A 3PTFC 4JGHB 2KTRA 3VVWB 3ZNGC 2MBBB 1GC7A 3ML8A 4I6NB 4W9GA 1E7UA 5EDSA 3ZNID 1WE7A 3DVGY 3RD2A 1QZEA 3W1SA 5KHQA 2L7RA 3L13A 3DDCB 4KDLB 3RZFA 2B3AA 3L0WB 3KYCD 2C9WB 3C0RB 5D7GA 1H4RA 2LXAA 1WE6A 1EF1A 2MP2B 3JYUA 4X57B 2BKRB 4WJQA 5AZHA 3V62A 4B95A 4IG7B 2J0KA 4PYUA 4CHKA 2BPSA 4FLHA 4K81A 2M17A 1TGZB 2KX3A 3DBSA 5KHOA 3PZDA 1E8ZA 2KTFA 5IA7A 1V49A 2LJ5A 2MA9B 1RAXA 4KSLC 1UH6A 3OJ3A 3EHVA 1RLFA 4EZKA 3QWZB 3QAQA 2K8BA 2KFJA 3EC8A 2PJHA 3TL5A 4W9KA 4BKSD 3Q3FA 4GSWA 1Y8RC 2KTRB 2M4NA 2ZEQA 1WMHA 1P0RA 1WJNA 3JSVA 2A4ZA 3PV1A 3ZNZB 4TUUA 1S1QB 2L3ZA 4FJZA 1UBIA 1ZGUB 1UZXB 3JVZX 3PRMB 3ZIMA 2KXJA 1IYFA 1P98A 1C1YB 3ALBA 3BY4B 2KJRA 1J19A 4GGQA 4TQ1A 2PE9A 2A5UA 3KW5B 2KD0A 2KJ6A 2D10A 2JWZA 3M63B 1PQSA 3EFUA 3QC8B 2LGDA 5BO4B 5G55A 2N7EA 4FA6A 1P1AA 2LVPA 3PGEA 3UINB 4IUMB 5DCNA 3VQIA 4LJPB 1M94A 3R3MA 1WXVA 1Q5WB 1EF5A 1D3ZA 2KANA 4FJYA 3VHTC 4DHZE 3H9DA 3OLMD 4KZ0A 1E8YA 2CHXA 1BT0A 1UELA 2JF5A 2KWUB 1NBFC 4W9DA 5G2NA 3X23A 3PHWB 1TBEA 2WDTB 4M8MA 3V60A 3VH3B 1WMHB 3JSVB 2XBBC 2V4LA 4K1RB 2JPHA 3UQBA 4IWOA 2KNBA 4GXBA 2AL3A 1V5OA 3A9JA 1WGGA 1GC6A 1Z5SB 3A33B 4NAWA 4BVUC 2Z59B 4CO7A 1WFYA 2EMTA 2FIDA 3N3KB 2LUEA 2YVCA 2WX1A 4GMVA 2WYQA 3R7QA 3WAMA 4N9F4 1YJ1A 2G4DB 4DDGD 2BGFA 4NPNA 4WJOA 4M0WB 3H6NA 2AEHA 3M95A 1MG8A 2KWCA 3RZWC 2GOWA 3B1LX 3L10B 5IAAC 1V2YA 2FCMA 4NJ7A 2LZ6A 4FADA 3HK0A 4IW0A 3OAWA 3QX1A 3U8ZA 1WH3A 2REXA 3VTUA 2KC1A 1AARA 3ENEA 2MQJA 3DQVA 4GDLB 2KMCA 2DZIA 4KIKA 2IZVB 2UWQA 2MP2A 2KQ7A 4WQOB 3H7SA 2ZZPB 4BKSA 3P2BA 3ML9A 2ZPNA 3X0WA 2GBKA 2C5LC 4NAWB 5AZGA 4AJYB 1WZ3A 4HDOA 1OTRB 1T0YA 3ZNHB 1WXAA 3UQAA 5CX3A 4KV2A 2M1MA 4ZRJA 2QHOA 3TCAA 4W9LA 2Z0EB 2DYMA 2KZRA 1WJ6A 3PVLA 2JT4B 3DBLI 3NOBA 2KJHB 5D6JB 2NBUA 2CHZA 2DYOA 3AU4A 2WX0A 4IM3A 4WAAA 4AWJA 2ZNVC 2DZMA 3CF6E 2EKEC 1P9DU 2O2VA 2UYZB 1OQYA 3QQ8B 3V61A 4GU2A 2GBRA 2AL6A 4ANXA 1Z2MA 2LASA 1S3SG 3AULA 3NHEB 4KIKB 4ZYNA 4GOCA 3VUYA 3L54A 3QK0A 5D2MB 3PPAA 4MGZE 3ZRCA 4EUTA 2LD9A 4XX5A 4K7WA 4GN1A 3CMMB 4BOZB 3A9KB 4BOSC 4EOYA 4KZCA 2KQSA 4JQWC 1ISNA 5C1ZA 1IP9A 3T8MA 3KH0A 4GIVA 2ZJDA 2NR2A 3VUWA 5L83A 2J0JA 4PYZA 1LQBA 1RFAA 5HKHA 2RPQA 1OGWA 3WANA 1I35A 1SGHA 1WXSA 1YQBA 3NS8A 3A1QB 2KLGA 3QHTA 4ZRKA 1WI0A 2N4FA 1VCBA 2IY1B 2IY0B 3AXCA 3MTNB 3DCGA 1UD7A 1XQQA 1JRUA 2LGYA 2XEWA 2NVUI 1GUAB 2XK5A 3IG3A 1ZW7A 2NS5A 1GJZA 3ZLZA 2LWPA 3ZDTA 4IWPA 2O2VB 4W9JA 2DYBA 3R7RA 4PS7A 5CHFA 2M0XA 1WR6E 2ZNVB 3NZUA 2CKHB 2LRUA 4ZRIA 4EFOA 4MSQB 2PE6B 2JY6A 2OOBB 2EMSA 4CYEA 5C23A 3NZSA 3TBLD 4F1SA 4MJSB 3ONSA 4HCPB 1K8RB 1WX9A 4IM2A 3A4SC 2MBOA 5GMVA 4DXAB 1YIWA 4WWNA 2HD5B 1F9JA 1UBQA 2FUHB 2JZ3B 3IBEA 1XD3B 2D07B 3ZW3A 5E6OA 5CHVC 4E71A 4MDKE 4EKUA 4HCNB 2KDIA 1WX8A 4RM8A 5AZFA 2RSUA 1G6JA 4ZDVA 4FJVB 4GDLA 1FXTB 3KUDB 1J0GA 4BBNC 2Z0DB 4WWPA 1XT9B 3H7PB 3VH4B 4DK5A 4LJOB 2XK5B 2L0FA 1V80A 1ZKHA 2KLCA 2I1KA 2L0TA 3DBHI 3DVNV 1E8XA 2IO2B 2GBMA 4RMAA 3HHMA 4W9IA 4HLEA 2J0MA 4MGYE 3TJPA 3M62B 1Q1OA 3KUCB 4HDQA 1A5RA 5LXHA 4G50A 5D94A 2JRIB 3LDZE 3N32A 3APFA 1WZ0A 1X1MA 2RGFA 4LCDE 2HJ8A
chains in the Genus database with same CATH superfamily
5BYSA 2FCSA 2WXHA 1JRPA 2ZVOA 2JZZA 4RCOA 2RMMA 3A9KA 4W9CA 3N30A 3NVZA 2L8JA 3GOEA 4RGTA 3AE7B 3SU8X 1SSNA 2FNJB 4ZOHC 4GDKB 1I4XA 3WAPA 2ON8A 2C7HA 2ONQA 3AEFB 3P63A 1R4NB 2HTME 4JWUC 2GBNA 2BKFA 1JWSD 1GG3A 2KO3A 2LMCA 4NQKE 2JYTA 3IHPC 3OG5A 2KDMA 2H89B 2CHWA 1R4MB 1WJ4A 2EKIA 3QCAA 4URKA 2OEDA 2BB6A 1I4QA 2ASQA 4FULA 2QIEB 4A20A 3ZO5B 3QARA 3HUIA 4MT5A 3APDA 2R2QA 3JW0X 2K6QA 5AEKB 2DAFA 4AOFA 3ZYYX 1YX6B 2QILA 3NVWA 2MCNB 4WJNA 2FE8A 1P3QU 3AU5A 3KQ4A 5E6PA 4G11A 2G3QB 3Q3JA 2LXCA 1SE9A 3S2AA 2IYDB 1JWAD 3BVGA 2E6XA 5C2TB 1E8WA 2O6VB 2JRHA 4NY0A 4LNIA 4P7IA 2BS2B 5JHBA 3RI7C 2D3CA 1V6EA 2L05A 3SFEB 4GB9A 3QJZA 1WYGA 4HRSA 1E5WA 1TKEA 3RPFC 4FHJA 3L17A 3ZVVA 2CR5A 1BMLC 2LEKA 3UGBB 3NVVA 3VR8B 1LO5D 3HVDA 2ICIA 4F8CB 1DYQA 5CHWA 3W5UB 2GRIA 4NJ6A 4J6IA 2OJRA 1E10A 4OZAA 3MFGA 2MRPA 4TSSA 1EUVB 3NZ3A 2QSDA 4US8A 3BVZA 3GZNI 2K3UA 1K51A 3Q8EA 4UDUC 3HM6X 4OVUA 1V1PA 2PIAA 2NPTB 2KMMA 1J7CA 2MSED 3VFKA 3RFZB 1FXIA 1YQ3B 2PW9A 2MBQA 2Y5BB 2I1JA 1CMXB 1KLGD 4P16A 2WHIA 2JSVX 1J8CA 2N9PC 1F1HA 2B76B 2NBVB 3PLVA 4Q2JA 1T0QC 2MW5A 4W9FA 2K8HA 5LLIA 2VRRB 3NJTA 1WY8A 4WJPA 1R4NI 4A3OA 1N5XA 2WQYB 2BS3B 1H8CA 3ZRFA 2WWZA 1DGJA 4ZHPA 2W9NA 1R4MI 2K8CA 2DLBA 1C9FA 2KN5A 2HE7A 5MPOA 4ZRQA 1VZ6A 2KTRA 3ZNGC 4I6NB 2LHEA 1E7UA 3U7ZA 4RF0A 1WE7A 2QEJC 4WAFA 1QZEA 3W1SA 5KHQA 3DDCB 4N58A 1IBXA 4KKIA 3MC9A 2LXAA 3LXFA 4FXCA 3AE1B 2ZW0A 2MP2B 3JYUA 2BKRB 3V62A 4PYUA 2BPSA 4K81A 3FC4A 1VZ8A 2M17A 1C77A 2KTFA 5IA7A 4KSLC 1UH6A 1NENB 2BS4B 3QAQA 2PJHA 1YJIA 3AEBB 1TY0A 1Y8RC 2ZEQA 1WMHA 4FJZA 3URYA 1UBIA 3ZIMA 2KXJA 2INNE 3N1XC 1J19A 2PE9A 2A5UA 1VZ7A 3RMKC 1FEHA 2WXMA 4FA6A 1P1AA 4YSYB 1SBBB 1QOFA 1EF5A 4ARCA 4WWMA 3PZ7A 3H9DA 2CJNA 2NMQA 1I4GA 1KH0A 2J53A 3VH3B 1JQ4A 4J3OD 2WXFA 2INDC 2SAKA 1WGGA 1WFYA 2FUG1 1HTQA 1C4CA 2WYQA 3WAMA 1CK1A 2G4DB 4DDGD 4NPNA 4WJOA 3W2DA 3M95A 3GP7A 3RNAC 2KWCA 3RZWC 1F52A 2KN4A 2FCMA 1ZXIA 2HJ1A 1B9RA 1XLNA 2TSSA 3ENEA 1JALA 2IZVB 2IPKD 4HROA 2BW2A 2K5PA 3H7SA 1ZP0B 1UWXA 4NAWB 1Q10A 2KQ4X 5CX3A 1KFYB 2QHOA 1PYWD 2NTSA 5IP4D 1WJ6A 3PVLA 2KJHB 2DZMA 2O2VA 1ET6A 5FKAC 1ZDVA 3RNGC 1SE4A 2SEBD 2LGIA 2V0GA 1EM7A 3L54A 3FILA 2G9HD 3QK0A 5D2MB 2LD9A 4EOYA 1PUTA 4JQWC 5BMIA 5C1ZA 1IP9A 2CJOA 3I5JC 2ZJDA 5L83A 4KX6B 1I35A 2D3AA 1SGHA 1WXSA 4ZRKA 2KLGA 2OJWA 3MTNB 3AEEB 2XEWA 1GUAB 1M4VA 3ZLZA 3AEDB 2LWPA 4YSZB 4IWPA 1N60A 4PS7A 5CHFA 4ZRIA 1L0VB 4MSQB 2JY6A 1P7EA 2W3SA 2JXTA 2OOBB 5IKCM 4F1SA 1QQRA 1WX9A 1NYQA 1UBQA 1OQRA 2FUHB 3IBEA 1XD3B 3SEBA 3Q3OC 3ZW3A 3Q3NC 1FCCC 1WX8A 4RM8A 5AZFA 1G6JA 3KUDB 3VH4B 4BZAA 1J7AA 5LNK1 3DVNV 4B0EA 4M00A 2IO2B 1BUIC 3TJPA 5T8IA 3GS2A 1Q1OA 3KUCB 4HDQA 1A5RA 5LXHA 5D94A 3Q69A 3APCA 1NI3A 2K1FA 3GE3C 4HWIB 3LYYA 2G4SA 3A4RA 4YWGG 1NDDA 2DZKA 5DPSA 3WCQA 3HM3A 4N59A 5JZEB 4OVZA 3AMZA 4PS8A 5D3IB 3ZJUA 4C80A 4II2B 4YTPB 2MBEA 2BYVE 2X38A 1SXTA 2NTTA 3ZQ4A 4DWFA 1KM7A 2INPE 3RNBC 2LRWA 2JQRB 3ETRA 4LNOA 1IGDA 3NY5A 3V05A 3DPDA 4C56C 2KT7A 2YLMA 1WIAA 2IDYA 3UF8A 3SD5A 1ZOYB 4DQOC 2ZCBA 3N20C 2O6VA 4DHZB 1Y56A 4MM3B 3SFDB 4FN2A 4PK1A 1WJUA 2KC2A 4MJSA 2DWQA 4BKTA 3ZTCA 3W1SC 4JL9A 4A3PA 2J7QB 3UIOB 4HXDA 3RULA 4BKGA 4W9EA 4E3CA 1N63A 4NNJB 4EZLA 1FM0D 1TIFA 2PPHA 3KUZA 1VD2A 4MACA 3BZDB 4ICUA 1QT9A 2AWTA 4G3XB 2LI5A 3Q3MC 2JU6X 1WF9A 2Y5PA 4AQ7A 1U4AA 2I38A 4L2YA 1F2RI 3ZKJC 3U4EG 2BWFA 1WYWB 4YT0B 4OVVA 3PHXB 4KVGB 1YNTE 2IO0B 2NPTA 1HA5A 2DBYA 4FHKA 4W9HA 2N9EB 4BBNF 1N5WA 1MI0A 2K25A 2N9LA 2AYOB 4TQ0A 2IO1B 1YMHE 1WXMA 3RCZA 4ANWA 4IOIE 1V5TA 3B08A 3E56A 1UWMA 3AI5A 4I6LB 3KYDD 5DPRA 3HRDD 4DDID 2WXQA 3VDZA 4HPLB 5FR6A 4JWSC 2WXLA 1E90A 2ZPYA 1I7HA 3BINA 2WGSA 3VRBB 2LGXA 1JWUD 4XYCA 4LNKA 4O1NA 5E6NA 3ZXRA 4MSMB 4MGKE 1FO4A 3WALA 5HHDG 3IAS1 4JLCA 4KSKC 2BVCA 1E7VA 3J9CA 4US9A 2JUOA 2V1YA 2AQ3B 1N61A 3DVGX 4EE2A 1L2NA 4LDTD 3Q8BA 3V6CB 3ZJVA 3ZGZA 4A9AA 1FCLA 4A6QA 1WGRA 1WGDA 2PLPA 4LK0M 3R66C 3A9JB 1XLOA 2DNFA 4XZ4A 2CU1A 2BQQA 2JVCA 3C8YA 1A70A 3BVMA 2D11A 2RR9A 1WGHA 4WWOA 3H8HA 3P4SB 4JGHB 3VVWB 5AUKA 5EDSA 5EE0A 3ZNID 3DVGY 4ITKA 2M56B 4KDLB 3DWGC 2C9WB 3C0RB 4ZHOA 3HVZA 2EELA 1L4DB 2J0KA 5HI1A 1VJKA 3P4QB 3Q6BA 5KHOA 1E8ZA 3OJ3A 3EHVA 1GB4A 1QKZA 1TY2A 1RLFA 4LTUA 3QWZB 1YN5A 2KFJA 3EUB2 3TL5A 4YTNB 1XLPA 3DHIC 4TUUA 1P7FA 3JVZX 3PRMB 1L5PA 2WP9B 1P98A 3ALBA 4YXDB 2KJRA 4GGQA 5HG2A 5JXVA 1EWCA 4XDDA 2D10A 3M63B 2LGDA 5BO4B 2N9KA 2LVPA 3ZJTA 3R3MA 4JE3B 3TEYA 4DHZE 3AE9B 4KZ0A 2CHXA 5G2NA 1NBFC 1JROA 1AWDA 4M8MA 2WS3B 3V60A 4XWTA 3JSVB 4IWOA 1KF6B 4GXBA 1Z5SB 1GC6A 4NAWA 4CO7A 4XWWA 1UUPA 2EMTA 2Y3AA 4RGMA 3N3KB 1E6EB 2YVCA 1L4ZB 2BGFA 3AE5B 4M0WB 2AEHA 4HPPA 3E9SA 2GOWA 2BYTA 3MC0B 1V2YA 1YOVB 4NJ7A 2LZ6A 4FADA 3U8ZA 3OAWA 1FNUA 2REXA 4RNAA 3Q14C 2MQJA 3DQVA 1TKGA 2DZIA 4RH6A 1GOZA 1SJED 5G5HA 2PVOD 1XLQA 4BKSA 2ZPNA 3X0WA 2GBKA 2W82A 4HDOA 1OTRB 1T0YA 3MJ5A 4RGOS 2JZPA 4W9LA 2Z0EB 1SIJA 2WXPA 3NOBA 2VZKD 1VDVA 4IM3A 5G5GA 3P42A 2EKEC 4ZYSA 4ANXA 1RM6C 2W55A 1KRHA 3NHEB 4KIKB 1EWYC 1PDXA 1WWTA 4MGZE 3ZRCA 4XE0A 4DXFA 4K7WA 3A9KB 4BOSC 2GB1A 3T8MA 2YEPF 1RFAA 1VRAB 1T3QA 1OGWA 4GLSC 3WANA 1YQBA 1WI0A 2LGYA 1MJDA 1FD6A 1SJHD 3IG3A 1ZW7A 4YTMB 4N6EB 4W9JA 2KAJA 2L52A 2IJ0A 2CKHB 2LRUA 2PE6B 3RNCC 1FNWA 2LJIA 4HCPB 3EA6A 3A4SC 2WLBA 4WWNA 4QAYA 1MHHE 3MP9A 2LHDA 2WXRA 1UGJA 2LUMA 1HEZE 4A55A 4GDLA 2D3BA 2V3NA 3AE2B 1NEKB 2YEPB 1XT9B 4DK5A 2M0AA 2XK5B 3BYYB 1ENFA 4RFBA 4W9IA 1YJJA 2VH2A 3C19A 3AE3B 1F77A 3LDZE 1WZ0A 1X1MA 4LCDE 3KLSX 4F7ZA 1E9MA 2WXIA 1UNSA 3RNEC 2NBWB 5J18A 4TKNA 1L7YA 4B6WA 4NJCA 2RDHA 4HVBA 2AX5A 3O65B 2KWVB 3N1YC 1LM8B 1V81A 4MM3A 1SF0A 5IN7A 1EO6A 3AE6B 5JH5C 2KVRA 2LVQA 1CQVA 2G1EA 2MBHA 4JIOU 5JHAA 2K39A 2D2QA 1JWMD 3PSEB 1WRDB 3M3JA 1MVKA 4ICVA 3A1QA 1KLVA 4DHJD 2KHWB 4MEMA 1ROEA 5IO9A 1AW7A 5DPWA 1OEYJ 2M19A 5DPTA 2Q5WD 3FAHA 3W5VB 3CWIA 2R61A 2RPVA 1L6UA 1WX7A 4AUQC 2IO3B 3SDLC 4HK2A 2PMVA 4WIPA 2KFKB 1TJEA 3W1YA 4MH0E 2N1WA 2Z8LA 3MHZA 1V8CA 1FFVA 3L08A 4KDIC 1L0YB 4KGSA 3I57A 3H7PA 2GLSA 1OFFA 2JWUA 4KKJA 3K9PB 1TTNA 4LNFA 2MEKA 4TV3A 2BYEA 2CS4A 2N1VA 4LLGM 3U30A 2HTHA 1LGRA 2QDFA 2N0SB 2E3TA 2BT6A 4ACFA 2W3RA 3U2SC 1IPGA 2N7DA 2W54A 2D5GA 1MPEA 1WM2A 3K9OB 3RN9C 2GBJA 2JXXA 1IBXB 2KDFB 3QA8A 3T3OA 3MJWA 3SHQA 1UGMA 5E6JA 4MELA 2KDBA 4B9KA 3BWUD 2FIFA 2WDVB 1JMLA 4HEA1 1FRDA 1QOAA 1HQRD 1XO3A 2BF8B 4PT5A 4GDKA 1C3TA 4HJKA 4TMAB 2V3SA 1D6EC 1CZPA 4II3B 4ANVA 1I4PA 2KKCA 3RYTA 1QILA 2FCNA 3IVFA 1T6BX 1JWBD 3I3TB 1TZ1A 1PGAA 4RM9A 2WU5B 4M01A 4P1CC 1FIQA 4LDTB 2DHZA 2KDEB 3TEWA 2ZCCA 3AV8A 3LJ3A 1FFUA 2WDQB 2OHFA 3ZUNA 3VTVA 2DX5B 2MLBA 1ZE3D 4NAMA 1FXAA 4ANUA 2KVZA 3PLUA 4P6VF 3MHSD 3MC8A 4K3CA 1MG4A 2G45B 3RUIB 3CSFA 3D32A 2HDEA 1ESFA 2V3PA 3WAOA 1LXDA 3AH7A 3CSTA 4S0RA 5J17A 1KOTA 3DBLB 2MBBB 1GC7A 3ML8A 4D2KA 4W9GA 3RNFC 2UU7A 1RYJA 3RD2A 4ARIA 2L7RA 3L13A 2B3AA 2KYWA 1H4RA 1WE6A 1EF1A 2X8XX 1F2RC 4B95A 1D5XC 1HZ5A 1TGZB 1T5XD 3O13A 3P1MA 3PZDA 1V49A 4C00A 4EZKA 2FBWB 4HKQA 4BKSD 4ZRPA 1P0RA 1WJNA 3JSVA 3AECB 2A4ZA 3B9JA 5EE9A 3PV1A 3ZNZB 1S1QB 2L3ZA 1IYFA 1C1YB 2LGSA 3LB8C 2KD0A 4P1BC 3FILB 3P4RB 1T0SC 3IT4B 1GPXA 1PQSA 1FMAD 3Q8FA 4OW0A 2WXKA 2V9HA 5G55A 3PGEA 1TT5B 5DCNA 3VQIA 1QF6A 1Q5WB 1D3ZA 2KANA 4FJYA 3VHTC 3OLMD 2L32A 3N9YC 1E8YA 4RGNA 2KWUB 1BT0A 3X23A 1TBEA 2WDTB 3VRAB 2IGHA 4REZA 3DBHB 2KNBA 2AL3A 3A33B 2LUEA 2WX1A 3R7QA 5I4DA 4N9F4 5D3DA 3AN1A 3Q8AA 5FR3A 3GZNB 1UF0A 2RDGA 3B1LX 3NG0A 1SB3C 3L10B 5IAAC 2QMTA 3U52E 3HK0A 4IW0A 1TZOA 3VTUA 1FPYA 4KIKA 3IXSA 3TEZA 1IGCA 2MP2A 3R2IA 1L0XB 2ZZPB 1VR9A 2C5LC 1WXAA 4WH4A 3UQAA 2VZKB 4KV2A 2M1MA 4JX1C 2BTEA 3DHHC 1XXGA 3TCAA 2DYMA 2IGGA 2KZRA 2JT4B 3DBLI 5D6JB 2DYOA 1B1ZA 3AU4A 2WX0A 3Q8CA 2K9XA 2ZNVC 3EGRA 1K52A 1P9DU 1PGBA 2UYZB 2AL6A 1Z2MA 3BYTB 2LASA 1S3SG 3AULA 4L1BA 4KGRA 1SE2A 4XX5A 4GN1A 3CMMB 5EE3A 4BOZB 3NS1A 1J7BA 2KQSA 1WXQA 3IAM1 3KH0A 3VUWA 4A8XC 2J0JA 1MHXA 1LQBA 5HKHA 3NS8A 3QHTA 2N4FA 1DOIA 1VCBA 1STEA 2IY0B 2IY1B 3AXCA 1UD7A 2XK5A 2NS5A 3Q2AC 2L83A 2M0XA 3NZUA 4EFOA 2MH7A 2WXOA 2XNAC 2EMSA 4S17A 4WURA 5C23A 3NZSA 3TBLD 4MJSB 1D4BA 3KWVA 1ET9A 1K8RB 5GMVA 3AE4B 2HD5B 5CHVC 4MDKE 4EKUA 4HCNB 2KDIA 3AEAB 1C78A 2RSUA 4FJVB 1FXTB 1J0GA 4BBNC 3L4PA 4LJOB 4C4VB 2L0FA 1V80A 2KLCA 2L0TA 2I1KA 3DBHI 2PKOA 1ACCA 1E8XA 1QOBA 4MH8A 4HLEA 4MGYE 1ZUD2 5BYQA 1YN3A 2J52A 4G50A 2JRIB 3N32A 3APFA 2RGFA 2HJ8A 1D5ZC 4HPMB 3VAWA 5L95C 4XC2A 2MX2A 4DXGA 5J2RA 2KWDA 2IGDA 2L76A 4IM0A 1RRBA 1KJTA 2WXJA 2WDRB 3DBRB 4K7SA 3VXWA 4IKGA 2XN9C 4NQLB 1C79A 4DHJB 3VUXA 2KFKA 4I6PA 5BMHA 5FK9C 4AJWA 4EZJA 2M8SA 4ASWC 3H1UA 3PREA 4HKZE 4IWQA 3T9LA 2L00B 1WRIA 4XDCA 3OJ4B 2NCNA 5CTRC 1WR1A 2C60A 2MJ3A 1TKYA 1C4AA 4H2AA 2JX5A 1WM3A 5BMGA 3V6EB 4BFRA 2DZJA 4IC7B 2KX0A 4G0NB 2GMIC 2Y5CA 1DOYA 1HZ6A 3VR9B 3PRPB 4EEWA 4B0MA 1SIFA 3WA0A 4AP4C 1NI2A 4USAA 2LVOA 3PO0A 3WIMA 3CIRB 2MJDA 3PRZA 1AYFA 2C7NB 3HIZA 2BB5A 2WXNA 3BIID 3ZDMC 2JYEA 2FAZA 2PEAA 3QIJA 3DVNU 2N7JA 1I42A 1TYGB 2AQ2B 4LNNA 2R2OA 2D3GA 2DAJA 4MGIE 3AB5A 3KVFB 1OEYA 2WNMA 4BAXA 2O6VD 1JCKB 3AE8B 4YSXB 2BWES 3RT3B 1YD8U 1HE8A 2ZVNA 4K7UA 3KWLA 1R7SA 2IBIB 1PFDA 1Q0WB 1XCTL 2QC8A 4OZBA 1KTKA 1WGYA 1GAQB 3EECA 3IFWB 1VLBA 1MFWA 1QLBB 2BYFA 2DENB 3AM9A 3L16A 4WQMA 3VTWA 1TS3A 2MWSB 1L6VA 3TIXA 2KMAA 2KOXA 4M8NA 5LXIB 2ACZB 1FNVA 1V9JA 2V4IB 3PT2B 2N9XA 1I4RA 2QJLA 3TMPB 2KK8A 4XGAB 4PS3A 3PS6A 1N62A 3DBRI 2AQ1B 3UIPB 1TS5A 1E0ZA 4E74A 4DBGA 1NYRA 3U7DA 2C7MB 1LFDA 3ECIA 3ZTDA 1XEEA 1NVID 1YX5B 1EU3A 4FBJB 3B0AA 1GNUA 4YL8A 2PTLA 1V1PB 1V86A 2PVGC 5TR5A 3DOWA 2K6DB 2FCQA 2INCC 1WSPA 2RD0A 2GI9A 3PTFC 3DHGC 4AS1A 5TSSA 4JPSA 4NZLB 3RZFA 3L0WB 5H8YE 3KYCD 1XF5L 5D7GA 1HTOA 1RWSA 4X57B 2J4XA 4WJQA 5AZHA 4IG7B 4CHKA 2MHJA 4FLHA 3TSSA 2KX3A 3DBSA 4C7ZA 2LJ5A 2MA9B 1RAXA 5AUIA 2K8BA 3EC8A 1F0ZA 4W9KA 3Q3FA 1EU4A 4GSWA 3W9CB 2KTRB 4RF1A 2M4NA 3TUOA 1ZGUB 1UZXB 2CU3A 1K53A 3BY4B 4TQ1A 3KW5B 2KJ6A 2JWZA 4HJGE 3EFUA 3QC8B 2N7EA 5C3JB 3AEGB 1HXYD 1OQQA 3UINB 4IUMB 3DWMA 1JW9D 4LJPB 1M94A 1WXVA 1ZDXA 3V3XA 2JF5A 1UELA 4W9DA 3PHWB 2VH1A 1WMHB 2XBBC 2V4LA 1SEBD 4K1RB 2JPHA 3UQBA 4K3BA 1QOGA 1V5OA 3A9JA 4BVUC 1AN8A 2Z59B 3P4PB 1TS2A 2FIDA 1ZPSA 4GMVA 1YJ1A 3H6NA 1MG8A 5EE1A 2RDBC 3I9V1 3QX1A 1WH3A 1FRRA 2KC1A 1AARA 1RFKA 1C76A 4GDLB 2KMCA 2MJEA 5BYRA 2WXGA 1I4HA 1V1OA 2UWQA 1IUEA 2KQ7A 4WQOB 1K50A 3P2BA 3ML9A 5AZGA 4AJYB 1WZ3A 3ZNHB 3N1ZC 3NUHB 4ZRJA 5HFYA 1CJEA 3BK1A 2NBUA 2CHZA 2H88B 4L23A 4WAAA 1SE3A 3B2GA 4AWJA 3B2FA 3CF6E 3R8BA 4OHJA 1BXTA 1OQYA 3QQ8B 3V61A 2J42A 2GBRA 4GU2A 3EFCA 2KACA 3VUYA 1E7PB 4GOCA 4ZYNA 4A90A 2L1AA 4EUTA 3PPAA 3SR6A 5H92C 3IT6B 4KZCA 3UI3A 1ISNA 1N6ZA 4GIVA 2NR2A 4PYZA 2RPQA 3T3NA 2WU2B 1YQ4B 2K22A 3A1QB 1V97A 3ABVB 2K0PA 1T0RC 1KLUD 3DCGA 1XQQA 1JRUA 2BBCA 2NVUI 4C4VA 1GJZA 1XCQL 3ZDTA 5IOIA 2O2VB 2DYBA 3R7RA 1WR6E 2ZNVB 4IDIA 3NVYA 1ZXHA 3TEXA 4CYEA 2ZW1A 4M0WA 2QCZA 4KGTA 1YN4A 3NRZA 3ONSA 4DXAB 4IM2A 2MBOA 1YIWA 1F9JA 2JZ3B 1D5MC 2D07B 5E6OA 4E71A 4C7YA 1WGKA 2I2YA 4ZDVA 1C4PA 4OZCA 2Z0DB 3PZ8A 3GB1A 4WWPA 3H7PB 1GB1A 4CQNA 3ZXVA 3GE8C 4R3DA 1PGXA 1ZKHA 3OWEB 2GBMA 4RMAA 3HHMA 2J0MA 3BK2A 1TS4A 3M62B 2LFIA 1DOXA 3FKYA 3I63C 4M02A 5GXGB 3R2TA
chains in the Genus database with same CATH topology
4HPMB 4F7ZA 3APCA 3VAWA 5L95C 5J18A 2K1FA 2NBWB 2MX2A 4XC2A 4TKNA 1L7YA 5J2RA 4HWIB 2L76A 4B6WA 2FCSA 2G4SA 4IM0A 3A4RA 1NDDA 4HVBA 1RRBA 3O65B 2DZKA 2KWVB 1KJTA 5DPSA 1LM8B 1V81A 4MM3A 2ZVOA 3HM3A 5JZEB 2JZZA 4K7SA 1EO6A 4PS8A 3VXWA 5JH5C 3A9KA 2KVRA 2LVQA 4W9CA 2MBHA 4JIOU 4NQLB 5JHAA 2K39A 3N30A 4DHJB 4II2B 2D2QA 3VUXA 2KFKA 3PSEB 1WRDB 4I6PA 4EZJA 2L8JA 2MBEA 4AJWA 2M8SA 4ASWC 2BYVE 3GOEA 3H1UA 3PREA 3M3JA 4IWQA 3SU8X 3T9LA 4DWFA 2FNJB 4GDKB 2L00B 1KM7A 2LRWA 3WAPA 4ICVA 3OJ4B 3A1QA 2NCNA 2C7HA 3NY5A 1KLVA 4DHJD 5CTRC 3DPDA 1WR1A 2C60A 2KHWB 2YLMA 1WIAA 4MEMA 2GBNA 2BKFA 1GG3A 2KO3A 4NQKE 5DPWA 3IHPC 1OEYJ 5DPTA 3UF8A 1WM3A 3SD5A 3V6EB 4BFRA 2CHWA 2DZJA 1WJ4A 2ZCBA 3QCAA 4URKA 2O6VA 4DHZB 4IC7B 2KX0A 4G0NB 1WX7A 4FN2A 2GMIC 4AUQC 1WJUA 2KC2A 4MJSA 2IO3B 4BKTA 3PRPB 4EEWA 3ZTCA 3SDLC 2ASQA 4FULA 4HK2A 3W1SC 1SIFA 3WA0A 4JL9A 4AP4C 1NI2A 2LVOA 2KFKB 4A3PA 3W1YA 3WIMA 4A20A 3PRZA 3QARA 3ZO5B 2J7QB 4MH0E 3APDA 2R2QA 2N1WA 3UIOB 3JW0X 2K6QA 5AEKB 4HXDA 3RULA 2DAFA 4BKGA 4AOFA 2C7NB 4W9EA 4E3CA 4NNJB 4EZLA 1YX6B 2PPHA 3KUZA 3L08A 1VD2A 4KDIC 2MCNB 3HIZA 4WJNA 4ICUA 3H7PA 1P3QU 2AWTA 3AU5A 4G3XB 5E6PA 4G11A 2G3QB 3Q3JA 2LXCA 1SE9A 3S2AA 3K9PB 1TTNA 3ZDMC 2LI5A 1WF9A 2IYDB 2FAZA 4TV3A 2BYEA 2CS4A 2PEAA 3DVNU 3QIJA 2N1VA 1E8WA 1U4AA 2HTHA 2O6VB 3U30A 1I42A 2JRHA 4NY0A 2R2OA 2D3GA 4P7IA 1IPGA 2N7DA 5JHBA 2DAJA 4MGIE 3ZKJC 3KVFB 1OEYA 1V6EA 2L05A 2O6VD 1WM2A 4GB9A 3K9OB 2BWES 2BWFA 3QJZA 1WYWB 4OVVA 3RT3B 1YD8U 2GBJA 2JXXA 1HE8A 2ZVNA 3PHXB 1E5WA 2KDFB 4K7UA 4KVGB 2IO0B 2NPTA 3QA8A 4FHKA 4W9HA 4BBNF 2N9EB 2IBIB 4FHJA 3MJWA 2K25A 3L17A 1UGMA 1Q0WB 3SHQA 3ZVVA 2AYOB 4TQ0A 1WGYA 2CR5A 3UGBB 3EECA 2IO1B 3IFWB 1WXMA 4MELA 2KDBA 3RCZA 4B9KA 4ANWA 4F8CB 1V5TA 2FIFA 3B08A 5CHWA 2BYFA 2DENB 3AI5A 4I6LB 3KYDD 3L16A 4NJ6A 2BF8B 5DPRA 4DDID 3VTWA 3VDZA 4J6IA 2OJRA 4GDKA 4HPLB 5FR6A 4HJKA 1C3TA 1E90A 2MWSB 2V3SA 2ZPYA 2MRPA 4II3B 4ANVA 1EUVB 3BINA 3GZNI 3TIXA 2KKCA 3RYTA 2KMAA 2LGXA 2KOXA 4M8NA 5LXIB 3HM6X 4OVUA 2FCNA 5E6NA 3IVFA 1V9JA 3PT2B 3I3TB 4MSMB 4MGKE 2NPTB 3VFKA 2MSED 2N9XA 1TZ1A 4RM9A 3TMPB 2KK8A 4PS3A 3WALA 3PS6A 4LDTB 2MBQA 3DBRI 2Y5BB 4JLCA 2DHZA 2I1JA 2KDEB 4KSKC 1E7VA 3UIPB 4E74A 2ZCCA 4DBGA 1CMXB 2JUOA 3LJ3A 3U7DA 2V1YA 3ZUNA 3VTVA 2C7MB 1LFDA 3ECIA 3ZTDA 2DX5B 3DVGX 1L2NA 1J8CA 4LDTD 2N9PC 2MLBA 2NBVB 3PLVA 3V6CB 4ANUA 2MW5A 4W9FA 2K8HA 5LLIA 1YX5B 2VRRB 1WGRA 4FBJB 3PLUA 3B0AA 1WY8A 1GNUA 3MHSD 4WJPA 1R4NI 1WGDA 4YL8A 4A3OA 2G45B 3RUIB 3CSFA 3D32A 3R66C 3A9JB 1V86A 3ZRFA 1H8CA 2WWZA 4XZ4A 5TR5A 2CU1A 2W9NA 1R4MI 2K8CA 3WAOA 3DOWA 2JVCA 1LXDA 3CSTA 2K6DB 2FCQA 2KN5A 2D11A 2HE7A 2RR9A 1WGHA 5J17A 1KOTA 4WWOA 2RD0A 3PTFC 4JGHB 2KTRA 3VVWB 3ZNGC 2MBBB 1GC7A 3ML8A 4I6NB 4W9GA 1E7UA 5EDSA 3ZNID 1WE7A 3DVGY 3RD2A 1QZEA 3W1SA 5KHQA 2L7RA 3L13A 3DDCB 4KDLB 3RZFA 2B3AA 3L0WB 3KYCD 2C9WB 3C0RB 5D7GA 1H4RA 2LXAA 1WE6A 1EF1A 2MP2B 3JYUA 4X57B 2BKRB 4WJQA 5AZHA 3V62A 4B95A 4IG7B 2J0KA 4PYUA 4CHKA 2BPSA 4FLHA 4K81A 2M17A 1TGZB 2KX3A 3DBSA 5KHOA 3PZDA 1E8ZA 2KTFA 5IA7A 1V49A 2LJ5A 2MA9B 1RAXA 4KSLC 1UH6A 3OJ3A 3EHVA 1RLFA 4EZKA 3QWZB 3QAQA 2K8BA 2KFJA 3EC8A 2PJHA 3TL5A 4W9KA 4BKSD 3Q3FA 4GSWA 1Y8RC 2KTRB 2M4NA 2ZEQA 1WMHA 1P0RA 1WJNA 3JSVA 2A4ZA 3PV1A 3ZNZB 4TUUA 1S1QB 2L3ZA 4FJZA 1UBIA 1ZGUB 1UZXB 3JVZX 3PRMB 3ZIMA 2KXJA 1IYFA 1P98A 1C1YB 3ALBA 3BY4B 2KJRA 1J19A 4GGQA 4TQ1A 2PE9A 2A5UA 3KW5B 2KD0A 2KJ6A 2D10A 2JWZA 3M63B 1PQSA 3EFUA 3QC8B 2LGDA 5BO4B 5G55A 2N7EA 4FA6A 1P1AA 2LVPA 3PGEA 3UINB 4IUMB 5DCNA 3VQIA 4LJPB 1M94A 3R3MA 1WXVA 1Q5WB 1EF5A 1D3ZA 2KANA 4FJYA 3VHTC 4DHZE 3H9DA 3OLMD 4KZ0A 1E8YA 2CHXA 1BT0A 1UELA 2JF5A 2KWUB 1NBFC 4W9DA 5G2NA 3X23A 3PHWB 1TBEA 2WDTB 4M8MA 3V60A 3VH3B 1WMHB 3JSVB 2XBBC 2V4LA 4K1RB 2JPHA 3UQBA 4IWOA 2KNBA 4GXBA 2AL3A 1V5OA 3A9JA 1WGGA 1GC6A 1Z5SB 3A33B 4NAWA 4BVUC 2Z59B 4CO7A 1WFYA 2EMTA 2FIDA 3N3KB 2LUEA 2YVCA 2WX1A 4GMVA 2WYQA 3R7QA 3WAMA 4N9F4 1YJ1A 2G4DB 4DDGD 2BGFA 4NPNA 4WJOA 4M0WB 3H6NA 2AEHA 3M95A 1MG8A 2KWCA 3RZWC 2GOWA 3B1LX 3L10B 5IAAC 1V2YA 2FCMA 4NJ7A 2LZ6A 4FADA 3HK0A 4IW0A 3OAWA 3QX1A 3U8ZA 1WH3A 2REXA 3VTUA 2KC1A 1AARA 3ENEA 2MQJA 3DQVA 4GDLB 2KMCA 2DZIA 4KIKA 2IZVB 2UWQA 2MP2A 2KQ7A 4WQOB 3H7SA 2ZZPB 4BKSA 3P2BA 3ML9A 2ZPNA 3X0WA 2GBKA 2C5LC 4NAWB 5AZGA 4AJYB 1WZ3A 4HDOA 1OTRB 1T0YA 3ZNHB 1WXAA 3UQAA 5CX3A 4KV2A 2M1MA 4ZRJA 2QHOA 3TCAA 4W9LA 2Z0EB 2DYMA 2KZRA 1WJ6A 3PVLA 2JT4B 3DBLI 3NOBA 2KJHB 5D6JB 2NBUA 2CHZA 2DYOA 3AU4A 2WX0A 4IM3A 4WAAA 4AWJA 2ZNVC 2DZMA 3CF6E 2EKEC 1P9DU 2O2VA 2UYZB 1OQYA 3QQ8B 3V61A 4GU2A 2GBRA 2AL6A 4ANXA 1Z2MA 2LASA 1S3SG 3AULA 3NHEB 4KIKB 4ZYNA 4GOCA 3VUYA 3L54A 3QK0A 5D2MB 3PPAA 4MGZE 3ZRCA 4EUTA 2LD9A 4XX5A 4K7WA 4GN1A 3CMMB 4BOZB 3A9KB 4BOSC 4EOYA 4KZCA 2KQSA 4JQWC 1ISNA 5C1ZA 1IP9A 3T8MA 3KH0A 4GIVA 2ZJDA 2NR2A 3VUWA 5L83A 2J0JA 4PYZA 1LQBA 1RFAA 5HKHA 2RPQA 1OGWA 3WANA 1I35A 1SGHA 1WXSA 1YQBA 3NS8A 3A1QB 2KLGA 3QHTA 4ZRKA 1WI0A 2N4FA 1VCBA 2IY1B 2IY0B 3AXCA 3MTNB 3DCGA 1UD7A 1XQQA 1JRUA 2LGYA 2XEWA 2NVUI 1GUAB 2XK5A 3IG3A 1ZW7A 2NS5A 1GJZA 3ZLZA 2LWPA 3ZDTA 4IWPA 2O2VB 4W9JA 2DYBA 3R7RA 4PS7A 5CHFA 2M0XA 1WR6E 2ZNVB 3NZUA 2CKHB 2LRUA 4ZRIA 4EFOA 4MSQB 2PE6B 2JY6A 2OOBB 2EMSA 4CYEA 5C23A 3NZSA 3TBLD 4F1SA 4MJSB 3ONSA 4HCPB 1K8RB 1WX9A 4IM2A 3A4SC 2MBOA 5GMVA 4DXAB 1YIWA 4WWNA 2HD5B 1F9JA 1UBQA 2FUHB 2JZ3B 3IBEA 1XD3B 2D07B 3ZW3A 5E6OA 5CHVC 4E71A 4MDKE 4EKUA 4HCNB 2KDIA 1WX8A 4RM8A 5AZFA 2RSUA 1G6JA 4ZDVA 4FJVB 4GDLA 1FXTB 3KUDB 1J0GA 4BBNC 2Z0DB 4WWPA 1XT9B 3H7PB 3VH4B 4DK5A 4LJOB 2XK5B 2L0FA 1V80A 1ZKHA 2KLCA 2I1KA 2L0TA 3DBHI 3DVNV 1E8XA 2IO2B 2GBMA 4RMAA 3HHMA 4W9IA 4HLEA 2J0MA 4MGYE 3TJPA 3M62B 1Q1OA 3KUCB 4HDQA 1A5RA 5LXHA 4G50A 5D94A 2JRIB 3LDZE 3N32A 3APFA 1WZ0A 1X1MA 2RGFA 4LCDE 2HJ8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4HPM B;  4F7Z A;  3APC A;  3VAW A;  5L95 C;  5J18 A;  2K1F A;  2NBW B;  2MX2 A;  4XC2 A;  4TKN A;  1L7Y A;  5J2R A;  4HWI B;  2L76 A;  4B6W A;  2FCS A;  2G4S A;  4IM0 A;  3A4R A;  1NDD A;  4HVB A;  1RRB A;  3O65 B;  2DZK A;  2KWV B;  1KJT A;  5DPS A;  1LM8 B;  1V81 A;  4MM3 A;  2ZVO A;  3HM3 A;  5JZE B;  2JZZ A;  4K7S A;  1EO6 A;  4PS8 A;  3VXW A;  5JH5 C;  3A9K A;  2KVR A;  2LVQ A;  4W9C A;  2MBH A;  4JIO U;  4NQL B;  5JHA A;  2K39 A;  3N30 A;  4DHJ B;  4II2 B;  2D2Q A;  3VUX A;  2KFK A;  3PSE B;  1WRD B;  4I6P A;  4EZJ A;  2L8J A;  2MBE A;  4AJW A;  2M8S A;  4ASW C;  2BYV E;  3GOE A;  3H1U A;  3PRE A;  3M3J A;  4IWQ A;  3SU8 X;  3T9L A;  4DWF A;  2FNJ B;  4GDK B;  2L00 B;  1KM7 A;  2LRW A;  3WAP A;  4ICV A;  3OJ4 B;  3A1Q A;  2NCN A;  2C7H A;  3NY5 A;  1KLV A;  4DHJ D;  5CTR C;  3DPD A;  1WR1 A;  2C60 A;  2KHW B;  2YLM A;  1WIA A;  4MEM A;  2GBN A;  2BKF A;  1GG3 A;  2KO3 A;  4NQK E;  5DPW A;  3IHP C;  1OEY J;  5DPT A;  3UF8 A;  1WM3 A;  3SD5 A;  3V6E B;  4BFR A;  2CHW A;  2DZJ A;  1WJ4 A;  2ZCB A;  3QCA A;  4URK A;  2O6V A;  4DHZ B;  4IC7 B;  2KX0 A;  4G0N B;  1WX7 A;  4FN2 A;  2GMI C;  4AUQ C;  1WJU A;  2KC2 A;  4MJS A;  2IO3 B;  4BKT A;  3PRP B;  4EEW A;  3ZTC A;  3SDL C;  2ASQ A;  4FUL A;  4HK2 A;  3W1S C;  1SIF A;  3WA0 A;  4JL9 A;  4AP4 C;  1NI2 A;  2LVO A;  2KFK B;  4A3P A;  3W1Y A;  3WIM A;  4A20 A;  3PRZ A;  3QAR A;  3ZO5 B;  2J7Q B;  4MH0 E;  3APD A;  2R2Q A;  2N1W A;  3UIO B;  3JW0 X;  2K6Q A;  5AEK B;  4HXD A;  3RUL A;  2DAF A;  4BKG A;  4AOF A;  2C7N B;  4W9E A;  4E3C A;  4NNJ B;  4EZL A;  1YX6 B;  2PPH A;  3KUZ A;  3L08 A;  1VD2 A;  4KDI C;  2MCN B;  3HIZ A;  4WJN A;  4ICU A;  3H7P A;  1P3Q U;  2AWT A;  3AU5 A;  4G3X B;  5E6P A;  4G11 A;  2G3Q B;  3Q3J A;  2LXC A;  1SE9 A;  3S2A A;  3K9P B;  1TTN A;  3ZDM C;  2LI5 A;  1WF9 A;  2IYD B;  2FAZ A;  4TV3 A;  2BYE A;  2CS4 A;  2PEA A;  3DVN U;  3QIJ A;  2N1V A;  1E8W A;  1U4A A;  2HTH A;  2O6V B;  3U30 A;  1I42 A;  2JRH A;  4NY0 A;  2R2O A;  2D3G A;  4P7I A;  1IPG A;  2N7D A;  5JHB A;  2DAJ A;  4MGI E;  3ZKJ C;  3KVF B;  1OEY A;  1V6E A;  2L05 A;  2O6V D;  1WM2 A;  4GB9 A;  3K9O B;  2BWE S;  2BWF A;  3QJZ A;  1WYW B;  4OVV A;  3RT3 B;  1YD8 U;  2GBJ A;  2JXX A;  1HE8 A;  2ZVN A;  3PHX B;  1E5W A;  2KDF B;  4K7U A;  4KVG B;  2IO0 B;  2NPT A;  3QA8 A;  4FHK A;  4W9H A;  4BBN F;  2N9E B;  2IBI B;  4FHJ A;  3MJW A;  2K25 A;  3L17 A;  1UGM A;  1Q0W B;  3SHQ A;  3ZVV A;  2AYO B;  4TQ0 A;  1WGY A;  2CR5 A;  3UGB B;  3EEC A;  2IO1 B;  3IFW B;  1WXM A;  4MEL A;  2KDB A;  3RCZ A;  4B9K A;  4ANW A;  4F8C B;  1V5T A;  2FIF A;  3B08 A;  5CHW A;  2BYF A;  2DEN B;  3AI5 A;  4I6L B;  3KYD D;  3L16 A;  4NJ6 A;  2BF8 B;  5DPR A;  4DDI D;  3VTW A;  3VDZ A;  4J6I A;  2OJR A;  4GDK A;  4HPL B;  5FR6 A;  4HJK A;  1C3T A;  1E90 A;  2MWS B;  2V3S A;  2ZPY A;  2MRP A;  4II3 B;  4ANV A;  1EUV B;  3BIN A;  3GZN I;  3TIX A;  2KKC A;  3RYT A;  2KMA A;  2LGX A;  2KOX A;  4M8N A;  5LXI B;  3HM6 X;  4OVU A;  2FCN A;  5E6N A;  3IVF A;  1V9J A;  3PT2 B;  3I3T B;  4MSM B;  4MGK E;  2NPT B;  3VFK A;  2MSE D;  2N9X A;  1TZ1 A;  4RM9 A;  3TMP B;  2KK8 A;  4PS3 A;  3WAL A;  3PS6 A;  4LDT B;  2MBQ A;  3DBR I;  2Y5B B;  4JLC A;  2DHZ A;  2I1J A;  2KDE B;  4KSK C;  1E7V A;  3UIP B;  4E74 A;  2ZCC A;  4DBG A;  1CMX B;  2JUO A;  3LJ3 A;  3U7D A;  2V1Y A;  3ZUN A;  3VTV A;  2C7M B;  1LFD A;  3ECI A;  3ZTD A;  2DX5 B;  3DVG X;  1L2N A;  1J8C A;  4LDT D;  2N9P C;  2MLB A;  2NBV B;  3PLV A;  3V6C B;  4ANU A;  2MW5 A;  4W9F A;  2K8H A;  5LLI A;  1YX5 B;  2VRR B;  1WGR A;  4FBJ B;  3PLU A;  3B0A A;  1WY8 A;  1GNU A;  3MHS D;  4WJP A;  1R4N I;  1WGD A;  4YL8 A;  4A3O A;  2G45 B;  3RUI B;  3CSF A;  3D32 A;  3R66 C;  3A9J B;  1V86 A;  3ZRF A;  1H8C A;  2WWZ A;  4XZ4 A;  5TR5 A;  2CU1 A;  2W9N A;  1R4M I;  2K8C A;  3WAO A;  3DOW A;  2JVC A;  1LXD A;  3CST A;  2K6D B;  2FCQ A;  2KN5 A;  2D11 A;  2HE7 A;  2RR9 A;  1WGH A;  5J17 A;  1KOT A;  4WWO A;  2RD0 A;  3PTF C;  4JGH B;  2KTR A;  3VVW B;  3ZNG C;  2MBB B;  1GC7 A;  3ML8 A;  4I6N B;  4W9G A;  1E7U A;  5EDS A;  3ZNI D;  1WE7 A;  3DVG Y;  3RD2 A;  1QZE A;  3W1S A;  5KHQ A;  2L7R A;  3L13 A;  3DDC B;  4KDL B;  3RZF A;  2B3A A;  3L0W B;  3KYC D;  2C9W B;  3C0R B;  5D7G A;  1H4R A;  2LXA A;  1WE6 A;  1EF1 A;  2MP2 B;  3JYU A;  4X57 B;  2BKR B;  4WJQ A;  5AZH A;  3V62 A;  4B95 A;  4IG7 B;  2J0K A;  4PYU A;  4CHK A;  2BPS A;  4FLH A;  4K81 A;  2M17 A;  1TGZ B;  2KX3 A;  3DBS A;  5KHO A;  3PZD A;  1E8Z A;  2KTF A;  5IA7 A;  1V49 A;  2LJ5 A;  2MA9 B;  1RAX A;  4KSL C;  1UH6 A;  3OJ3 A;  3EHV A;  1RLF A;  4EZK A;  3QWZ B;  3QAQ A;  2K8B A;  2KFJ A;  3EC8 A;  2PJH A;  3TL5 A;  4W9K A;  4BKS D;  3Q3F A;  4GSW A;  1Y8R C;  2KTR B;  2M4N A;  2ZEQ A;  1WMH A;  1P0R A;  1WJN A;  3JSV A;  2A4Z A;  3PV1 A;  3ZNZ B;  4TUU A;  1S1Q B;  2L3Z A;  4FJZ A;  1UBI A;  1ZGU B;  1UZX B;  3JVZ X;  3PRM B;  3ZIM A;  2KXJ A;  1IYF A;  1P98 A;  1C1Y B;  3ALB A;  3BY4 B;  2KJR A;  1J19 A;  4GGQ A;  4TQ1 A;  2PE9 A;  2A5U A;  3KW5 B;  2KD0 A;  2KJ6 A;  2D10 A;  2JWZ A;  3M63 B;  1PQS A;  3EFU A;  3QC8 B;  2LGD A;  5BO4 B;  5G55 A;  2N7E A;  4FA6 A;  1P1A A;  2LVP A;  3PGE A;  3UIN B;  4IUM B;  5DCN A;  3VQI A;  4LJP B;  1M94 A;  3R3M A;  1WXV A;  1Q5W B;  1EF5 A;  1D3Z A;  2KAN A;  4FJY A;  3VHT C;  4DHZ E;  3H9D A;  3OLM D;  4KZ0 A;  1E8Y A;  2CHX A;  1BT0 A;  1UEL A;  2JF5 A;  2KWU B;  1NBF C;  4W9D A;  5G2N A;  3X23 A;  3PHW B;  1TBE A;  2WDT B;  4M8M A;  3V60 A;  3VH3 B;  1WMH B;  3JSV B;  2XBB C;  2V4L A;  4K1R B;  2JPH A;  3UQB A;  4IWO A;  2KNB A;  4GXB A;  2AL3 A;  1V5O A;  3A9J A;  1WGG A;  1GC6 A;  1Z5S B;  3A33 B;  4NAW A;  4BVU C;  2Z59 B;  4CO7 A;  1WFY A;  2EMT A;  2FID A;  3N3K B;  2LUE A;  2YVC A;  2WX1 A;  4GMV A;  2WYQ A;  3R7Q A;  3WAM A;  4N9F 4;  1YJ1 A;  2G4D B;  4DDG D;  2BGF A;  4NPN A;  4WJO A;  4M0W B;  3H6N A;  2AEH A;  3M95 A;  1MG8 A;  2KWC A;  3RZW C;  2GOW A;  3B1L X;  3L10 B;  5IAA C;  1V2Y A;  2FCM A;  4NJ7 A;  2LZ6 A;  4FAD A;  3HK0 A;  4IW0 A;  3OAW A;  3QX1 A;  3U8Z A;  1WH3 A;  2REX A;  3VTU A;  2KC1 A;  1AAR A;  3ENE A;  2MQJ A;  3DQV A;  4GDL B;  2KMC A;  2DZI A;  4KIK A;  2IZV B;  2UWQ A;  2MP2 A;  2KQ7 A;  4WQO B;  3H7S A;  2ZZP B;  4BKS A;  3P2B A;  3ML9 A;  2ZPN A;  3X0W A;  2GBK A;  2C5L C;  4NAW B;  5AZG A;  4AJY B;  1WZ3 A;  4HDO A;  1OTR B;  1T0Y A;  3ZNH B;  1WXA A;  3UQA A;  5CX3 A;  4KV2 A;  2M1M A;  4ZRJ A;  2QHO A;  3TCA A;  4W9L A;  2Z0E B;  2DYM A;  2KZR A;  1WJ6 A;  3PVL A;  2JT4 B;  3DBL I;  3NOB A;  2KJH B;  5D6J B;  2NBU A;  2CHZ A;  2DYO A;  3AU4 A;  2WX0 A;  4IM3 A;  4WAA A;  4AWJ A;  2ZNV C;  2DZM A;  3CF6 E;  2EKE C;  1P9D U;  2O2V A;  2UYZ B;  1OQY A;  3QQ8 B;  3V61 A;  4GU2 A;  2GBR A;  2AL6 A;  4ANX A;  1Z2M A;  2LAS A;  1S3S G;  3AUL A;  3NHE B;  4KIK B;  4ZYN A;  4GOC A;  3VUY A;  3L54 A;  3QK0 A;  5D2M B;  3PPA A;  4MGZ E;  3ZRC A;  4EUT A;  2LD9 A;  4XX5 A;  4K7W A;  4GN1 A;  3CMM B;  4BOZ B;  3A9K B;  4BOS C;  4EOY A;  4KZC A;  2KQS A;  4JQW C;  1ISN A;  5C1Z A;  1IP9 A;  3T8M A;  3KH0 A;  4GIV A;  2ZJD A;  2NR2 A;  3VUW A;  5L83 A;  2J0J A;  4PYZ A;  1LQB A;  1RFA A;  5HKH A;  2RPQ A;  1OGW A;  3WAN A;  1I35 A;  1SGH A;  1WXS A;  1YQB A;  3NS8 A;  3A1Q B;  2KLG A;  3QHT A;  4ZRK A;  1WI0 A;  2N4F A;  1VCB A;  2IY1 B;  2IY0 B;  3AXC A;  3MTN B;  3DCG A;  1UD7 A;  1XQQ A;  1JRU A;  2LGY A;  2XEW A;  2NVU I;  1GUA B;  2XK5 A;  3IG3 A;  1ZW7 A;  2NS5 A;  1GJZ A;  3ZLZ A;  2LWP A;  3ZDT A;  4IWP A;  2O2V B;  4W9J A;  2DYB A;  3R7R A;  4PS7 A;  5CHF A;  2M0X A;  1WR6 E;  2ZNV B;  3NZU A;  2CKH B;  2LRU A;  4ZRI A;  4EFO A;  4MSQ B;  2PE6 B;  2JY6 A;  2OOB B;  2EMS A;  4CYE A;  5C23 A;  3NZS A;  3TBL D;  4F1S A;  4MJS B;  3ONS A;  4HCP B;  1K8R B;  1WX9 A;  4IM2 A;  3A4S C;  2MBO A;  5GMV A;  4DXA B;  1YIW A;  4WWN A;  2HD5 B;  1F9J A;  1UBQ A;  2FUH B;  2JZ3 B;  3IBE A;  1XD3 B;  2D07 B;  3ZW3 A;  5E6O A;  5CHV C;  4E71 A;  4MDK E;  4EKU A;  4HCN B;  2KDI A;  1WX8 A;  4RM8 A;  5AZF A;  2RSU A;  1G6J A;  4ZDV A;  4FJV B;  4GDL A;  1FXT B;  3KUD B;  1J0G A;  4BBN C;  2Z0D B;  4WWP A;  1XT9 B;  3H7P B;  3VH4 B;  4DK5 A;  4LJO B;  2XK5 B;  2L0F A;  1V80 A;  1ZKH A;  2KLC A;  2I1K A;  2L0T A;  3DBH I;  3DVN V;  1E8X A;  2IO2 B;  2GBM A;  4RMA A;  3HHM A;  4W9I A;  4HLE A;  2J0M A;  4MGY E;  3TJP A;  3M62 B;  1Q1O A;  3KUC B;  4HDQ A;  1A5R A;  5LXH A;  4G50 A;  5D94 A;  2JRI B;  3LDZ E;  3N32 A;  3APF A;  1WZ0 A;  1X1M A;  2RGF A;  4LCD E;  2HJ8 A; 
#chains in the Genus database with same CATH topology
 5BYS A;  2FCS A;  2WXH A;  1JRP A;  2ZVO A;  2JZZ A;  4RCO A;  2RMM A;  3A9K A;  4W9C A;  3N30 A;  3NVZ A;  2L8J A;  3GOE A;  4RGT A;  3AE7 B;  3SU8 X;  1SSN A;  2FNJ B;  4ZOH C;  4GDK B;  1I4X A;  3WAP A;  2ON8 A;  2C7H A;  2ONQ A;  3AEF B;  3P63 A;  1R4N B;  2HTM E;  4JWU C;  2GBN A;  2BKF A;  1JWS D;  1GG3 A;  2KO3 A;  2LMC A;  4NQK E;  2JYT A;  3IHP C;  3OG5 A;  2KDM A;  2H89 B;  2CHW A;  1R4M B;  1WJ4 A;  2EKI A;  3QCA A;  4URK A;  2OED A;  2BB6 A;  1I4Q A;  2ASQ A;  4FUL A;  2QIE B;  4A20 A;  3ZO5 B;  3QAR A;  3HUI A;  4MT5 A;  3APD A;  2R2Q A;  3JW0 X;  2K6Q A;  5AEK B;  2DAF A;  4AOF A;  3ZYY X;  1YX6 B;  2QIL A;  3NVW A;  2MCN B;  4WJN A;  2FE8 A;  1P3Q U;  3AU5 A;  3KQ4 A;  5E6P A;  4G11 A;  2G3Q B;  3Q3J A;  2LXC A;  1SE9 A;  3S2A A;  2IYD B;  1JWA D;  3BVG A;  2E6X A;  5C2T B;  1E8W A;  2O6V B;  2JRH A;  4NY0 A;  4LNI A;  4P7I A;  2BS2 B;  5JHB A;  3RI7 C;  2D3C A;  1V6E A;  2L05 A;  3SFE B;  4GB9 A;  3QJZ A;  1WYG A;  4HRS A;  1E5W A;  1TKE A;  3RPF C;  4FHJ A;  3L17 A;  3ZVV A;  2CR5 A;  1BML C;  2LEK A;  3UGB B;  3NVV A;  3VR8 B;  1LO5 D;  3HVD A;  2ICI A;  4F8C B;  1DYQ A;  5CHW A;  3W5U B;  2GRI A;  4NJ6 A;  4J6I A;  2OJR A;  1E10 A;  4OZA A;  3MFG A;  2MRP A;  4TSS A;  1EUV B;  3NZ3 A;  2QSD A;  4US8 A;  3BVZ A;  3GZN I;  2K3U A;  1K51 A;  3Q8E A;  4UDU C;  3HM6 X;  4OVU A;  1V1P A;  2PIA A;  2NPT B;  2KMM A;  1J7C A;  2MSE D;  3VFK A;  3RFZ B;  1FXI A;  1YQ3 B;  2PW9 A;  2MBQ A;  2Y5B B;  2I1J A;  1CMX B;  1KLG D;  4P16 A;  2WHI A;  2JSV X;  1J8C A;  2N9P C;  1F1H A;  2B76 B;  2NBV B;  3PLV A;  4Q2J A;  1T0Q C;  2MW5 A;  4W9F A;  2K8H A;  5LLI A;  2VRR B;  3NJT A;  1WY8 A;  4WJP A;  1R4N I;  4A3O A;  1N5X A;  2WQY B;  2BS3 B;  1H8C A;  3ZRF A;  2WWZ A;  1DGJ A;  4ZHP A;  2W9N A;  1R4M I;  2K8C A;  2DLB A;  1C9F A;  2KN5 A;  2HE7 A;  5MPO A;  4ZRQ A;  1VZ6 A;  2KTR A;  3ZNG C;  4I6N B;  2LHE A;  1E7U A;  3U7Z A;  4RF0 A;  1WE7 A;  2QEJ C;  4WAF A;  1QZE A;  3W1S A;  5KHQ A;  3DDC B;  4N58 A;  1IBX A;  4KKI A;  3MC9 A;  2LXA A;  3LXF A;  4FXC A;  3AE1 B;  2ZW0 A;  2MP2 B;  3JYU A;  2BKR B;  3V62 A;  4PYU A;  2BPS A;  4K81 A;  3FC4 A;  1VZ8 A;  2M17 A;  1C77 A;  2KTF A;  5IA7 A;  4KSL C;  1UH6 A;  1NEN B;  2BS4 B;  3QAQ A;  2PJH A;  1YJI A;  3AEB B;  1TY0 A;  1Y8R C;  2ZEQ A;  1WMH A;  4FJZ A;  3URY A;  1UBI A;  3ZIM A;  2KXJ A;  2INN E;  3N1X C;  1J19 A;  2PE9 A;  2A5U A;  1VZ7 A;  3RMK C;  1FEH A;  2WXM A;  4FA6 A;  1P1A A;  4YSY B;  1SBB B;  1QOF A;  1EF5 A;  4ARC A;  4WWM A;  3PZ7 A;  3H9D A;  2CJN A;  2NMQ A;  1I4G A;  1KH0 A;  2J53 A;  3VH3 B;  1JQ4 A;  4J3O D;  2WXF A;  2IND C;  2SAK A;  1WGG A;  1WFY A;  2FUG 1;  1HTQ A;  1C4C A;  2WYQ A;  3WAM A;  1CK1 A;  2G4D B;  4DDG D;  4NPN A;  4WJO A;  3W2D A;  3M95 A;  3GP7 A;  3RNA C;  2KWC A;  3RZW C;  1F52 A;  2KN4 A;  2FCM A;  1ZXI A;  2HJ1 A;  1B9R A;  1XLN A;  2TSS A;  3ENE A;  1JAL A;  2IZV B;  2IPK D;  4HRO A;  2BW2 A;  2K5P A;  3H7S A;  1ZP0 B;  1UWX A;  4NAW B;  1Q10 A;  2KQ4 X;  5CX3 A;  1KFY B;  2QHO A;  1PYW D;  2NTS A;  5IP4 D;  1WJ6 A;  3PVL A;  2KJH B;  2DZM A;  2O2V A;  1ET6 A;  5FKA C;  1ZDV A;  3RNG C;  1SE4 A;  2SEB D;  2LGI A;  2V0G A;  1EM7 A;  3L54 A;  3FIL A;  2G9H D;  3QK0 A;  5D2M B;  2LD9 A;  4EOY A;  1PUT A;  4JQW C;  5BMI A;  5C1Z A;  1IP9 A;  2CJO A;  3I5J C;  2ZJD A;  5L83 A;  4KX6 B;  1I35 A;  2D3A A;  1SGH A;  1WXS A;  4ZRK A;  2KLG A;  2OJW A;  3MTN B;  3AEE B;  2XEW A;  1GUA B;  1M4V A;  3ZLZ A;  3AED B;  2LWP A;  4YSZ B;  4IWP A;  1N60 A;  4PS7 A;  5CHF A;  4ZRI A;  1L0V B;  4MSQ B;  2JY6 A;  1P7E A;  2W3S A;  2JXT A;  2OOB B;  5IKC M;  4F1S A;  1QQR A;  1WX9 A;  1NYQ A;  1UBQ A;  1OQR A;  2FUH B;  3IBE A;  1XD3 B;  3SEB A;  3Q3O C;  3ZW3 A;  3Q3N C;  1FCC C;  1WX8 A;  4RM8 A;  5AZF A;  1G6J A;  3KUD B;  3VH4 B;  4BZA A;  1J7A A;  5LNK 1;  3DVN V;  4B0E A;  4M00 A;  2IO2 B;  1BUI C;  3TJP A;  5T8I A;  3GS2 A;  1Q1O A;  3KUC B;  4HDQ A;  1A5R A;  5LXH A;  5D94 A;  3Q69 A;  3APC A;  1NI3 A;  2K1F A;  3GE3 C;  4HWI B;  3LYY A;  2G4S A;  3A4R A;  4YWG G;  1NDD A;  2DZK A;  5DPS A;  3WCQ A;  3HM3 A;  4N59 A;  5JZE B;  4OVZ A;  3AMZ A;  4PS8 A;  5D3I B;  3ZJU A;  4C80 A;  4II2 B;  4YTP B;  2MBE A;  2BYV E;  2X38 A;  1SXT A;  2NTT A;  3ZQ4 A;  4DWF A;  1KM7 A;  2INP E;  3RNB C;  2LRW A;  2JQR B;  3ETR A;  4LNO A;  1IGD A;  3NY5 A;  3V05 A;  3DPD A;  4C56 C;  2KT7 A;  2YLM A;  1WIA A;  2IDY A;  3UF8 A;  3SD5 A;  1ZOY B;  4DQO C;  2ZCB A;  3N20 C;  2O6V A;  4DHZ B;  1Y56 A;  4MM3 B;  3SFD B;  4FN2 A;  4PK1 A;  1WJU A;  2KC2 A;  4MJS A;  2DWQ A;  4BKT A;  3ZTC A;  3W1S C;  4JL9 A;  4A3P A;  2J7Q B;  3UIO B;  4HXD A;  3RUL A;  4BKG A;  4W9E A;  4E3C A;  1N63 A;  4NNJ B;  4EZL A;  1FM0 D;  1TIF A;  2PPH A;  3KUZ A;  1VD2 A;  4MAC A;  3BZD B;  4ICU A;  1QT9 A;  2AWT A;  4G3X B;  2LI5 A;  3Q3M C;  2JU6 X;  1WF9 A;  2Y5P A;  4AQ7 A;  1U4A A;  2I38 A;  4L2Y A;  1F2R I;  3ZKJ C;  3U4E G;  2BWF A;  1WYW B;  4YT0 B;  4OVV A;  3PHX B;  4KVG B;  1YNT E;  2IO0 B;  2NPT A;  1HA5 A;  2DBY A;  4FHK A;  4W9H A;  2N9E B;  4BBN F;  1N5W A;  1MI0 A;  2K25 A;  2N9L A;  2AYO B;  4TQ0 A;  2IO1 B;  1YMH E;  1WXM A;  3RCZ A;  4ANW A;  4IOI E;  1V5T A;  3B08 A;  3E56 A;  1UWM A;  3AI5 A;  4I6L B;  3KYD D;  5DPR A;  3HRD D;  4DDI D;  2WXQ A;  3VDZ A;  4HPL B;  5FR6 A;  4JWS C;  2WXL A;  1E90 A;  2ZPY A;  1I7H A;  3BIN A;  2WGS A;  3VRB B;  2LGX A;  1JWU D;  4XYC A;  4LNK A;  4O1N A;  5E6N A;  3ZXR A;  4MSM B;  4MGK E;  1FO4 A;  3WAL A;  5HHD G;  3IAS 1;  4JLC A;  4KSK C;  2BVC A;  1E7V A;  3J9C A;  4US9 A;  2JUO A;  2V1Y A;  2AQ3 B;  1N61 A;  3DVG X;  4EE2 A;  1L2N A;  4LDT D;  3Q8B A;  3V6C B;  3ZJV A;  3ZGZ A;  4A9A A;  1FCL A;  4A6Q A;  1WGR A;  1WGD A;  2PLP A;  4LK0 M;  3R66 C;  3A9J B;  1XLO A;  2DNF A;  4XZ4 A;  2CU1 A;  2BQQ A;  2JVC A;  3C8Y A;  1A70 A;  3BVM A;  2D11 A;  2RR9 A;  1WGH A;  4WWO A;  3H8H A;  3P4S B;  4JGH B;  3VVW B;  5AUK A;  5EDS A;  5EE0 A;  3ZNI D;  3DVG Y;  4ITK A;  2M56 B;  4KDL B;  3DWG C;  2C9W B;  3C0R B;  4ZHO A;  3HVZ A;  2EEL A;  1L4D B;  2J0K A;  5HI1 A;  1VJK A;  3P4Q B;  3Q6B A;  5KHO A;  1E8Z A;  3OJ3 A;  3EHV A;  1GB4 A;  1QKZ A;  1TY2 A;  1RLF A;  4LTU A;  3QWZ B;  1YN5 A;  2KFJ A;  3EUB 2;  3TL5 A;  4YTN B;  1XLP A;  3DHI C;  4TUU A;  1P7F A;  3JVZ X;  3PRM B;  1L5P A;  2WP9 B;  1P98 A;  3ALB A;  4YXD B;  2KJR A;  4GGQ A;  5HG2 A;  5JXV A;  1EWC A;  4XDD A;  2D10 A;  3M63 B;  2LGD A;  5BO4 B;  2N9K A;  2LVP A;  3ZJT A;  3R3M A;  4JE3 B;  3TEY A;  4DHZ E;  3AE9 B;  4KZ0 A;  2CHX A;  5G2N A;  1NBF C;  1JRO A;  1AWD A;  4M8M A;  2WS3 B;  3V60 A;  4XWT A;  3JSV B;  4IWO A;  1KF6 B;  4GXB A;  1Z5S B;  1GC6 A;  4NAW A;  4CO7 A;  4XWW A;  1UUP A;  2EMT A;  2Y3A A;  4RGM A;  3N3K B;  1E6E B;  2YVC A;  1L4Z B;  2BGF A;  3AE5 B;  4M0W B;  2AEH A;  4HPP A;  3E9S A;  2GOW A;  2BYT A;  3MC0 B;  1V2Y A;  1YOV B;  4NJ7 A;  2LZ6 A;  4FAD A;  3U8Z A;  3OAW A;  1FNU A;  2REX A;  4RNA A;  3Q14 C;  2MQJ A;  3DQV A;  1TKG A;  2DZI A;  4RH6 A;  1GOZ A;  1SJE D;  5G5H A;  2PVO D;  1XLQ A;  4BKS A;  2ZPN A;  3X0W A;  2GBK A;  2W82 A;  4HDO A;  1OTR B;  1T0Y A;  3MJ5 A;  4RGO S;  2JZP A;  4W9L A;  2Z0E B;  1SIJ A;  2WXP A;  3NOB A;  2VZK D;  1VDV A;  4IM3 A;  5G5G A;  3P42 A;  2EKE C;  4ZYS A;  4ANX A;  1RM6 C;  2W55 A;  1KRH A;  3NHE B;  4KIK B;  1EWY C;  1PDX A;  1WWT A;  4MGZ E;  3ZRC A;  4XE0 A;  4DXF A;  4K7W A;  3A9K B;  4BOS C;  2GB1 A;  3T8M A;  2YEP F;  1RFA A;  1VRA B;  1T3Q A;  1OGW A;  4GLS C;  3WAN A;  1YQB A;  1WI0 A;  2LGY A;  1MJD A;  1FD6 A;  1SJH D;  3IG3 A;  1ZW7 A;  4YTM B;  4N6E B;  4W9J A;  2KAJ A;  2L52 A;  2IJ0 A;  2CKH B;  2LRU A;  2PE6 B;  3RNC C;  1FNW A;  2LJI A;  4HCP B;  3EA6 A;  3A4S C;  2WLB A;  4WWN A;  4QAY A;  1MHH E;  3MP9 A;  2LHD A;  2WXR A;  1UGJ A;  2LUM A;  1HEZ E;  4A55 A;  4GDL A;  2D3B A;  2V3N A;  3AE2 B;  1NEK B;  2YEP B;  1XT9 B;  4DK5 A;  2M0A A;  2XK5 B;  3BYY B;  1ENF A;  4RFB A;  4W9I A;  1YJJ A;  2VH2 A;  3C19 A;  3AE3 B;  1F77 A;  3LDZ E;  1WZ0 A;  1X1M A;  4LCD E;  3KLS X;  4F7Z A;  1E9M A;  2WXI A;  1UNS A;  3RNE C;  2NBW B;  5J18 A;  4TKN A;  1L7Y A;  4B6W A;  4NJC A;  2RDH A;  4HVB A;  2AX5 A;  3O65 B;  2KWV B;  3N1Y C;  1LM8 B;  1V81 A;  4MM3 A;  1SF0 A;  5IN7 A;  1EO6 A;  3AE6 B;  5JH5 C;  2KVR A;  2LVQ A;  1CQV A;  2G1E A;  2MBH A;  4JIO U;  5JHA A;  2K39 A;  2D2Q A;  1JWM D;  3PSE B;  1WRD B;  3M3J A;  1MVK A;  4ICV A;  3A1Q A;  1KLV A;  4DHJ D;  2KHW B;  4MEM A;  1ROE A;  5IO9 A;  1AW7 A;  5DPW A;  1OEY J;  2M19 A;  5DPT A;  2Q5W D;  3FAH A;  3W5V B;  3CWI A;  2R61 A;  2RPV A;  1L6U A;  1WX7 A;  4AUQ C;  2IO3 B;  3SDL C;  4HK2 A;  2PMV A;  4WIP A;  2KFK B;  1TJE A;  3W1Y A;  4MH0 E;  2N1W A;  2Z8L A;  3MHZ A;  1V8C A;  1FFV A;  3L08 A;  4KDI C;  1L0Y B;  4KGS A;  3I57 A;  3H7P A;  2GLS A;  1OFF A;  2JWU A;  4KKJ A;  3K9P B;  1TTN A;  4LNF A;  2MEK A;  4TV3 A;  2BYE A;  2CS4 A;  2N1V A;  4LLG M;  3U30 A;  2HTH A;  1LGR A;  2QDF A;  2N0S B;  2E3T A;  2BT6 A;  4ACF A;  2W3R A;  3U2S C;  1IPG A;  2N7D A;  2W54 A;  2D5G A;  1MPE A;  1WM2 A;  3K9O B;  3RN9 C;  2GBJ A;  2JXX A;  1IBX B;  2KDF B;  3QA8 A;  3T3O A;  3MJW A;  3SHQ A;  1UGM A;  5E6J A;  4MEL A;  2KDB A;  4B9K A;  3BWU D;  2FIF A;  2WDV B;  1JML A;  4HEA 1;  1FRD A;  1QOA A;  1HQR D;  1XO3 A;  2BF8 B;  4PT5 A;  4GDK A;  1C3T A;  4HJK A;  4TMA B;  2V3S A;  1D6E C;  1CZP A;  4II3 B;  4ANV A;  1I4P A;  2KKC A;  3RYT A;  1QIL A;  2FCN A;  3IVF A;  1T6B X;  1JWB D;  3I3T B;  1TZ1 A;  1PGA A;  4RM9 A;  2WU5 B;  4M01 A;  4P1C C;  1FIQ A;  4LDT B;  2DHZ A;  2KDE B;  3TEW A;  2ZCC A;  3AV8 A;  3LJ3 A;  1FFU A;  2WDQ B;  2OHF A;  3ZUN A;  3VTV A;  2DX5 B;  2MLB A;  1ZE3 D;  4NAM A;  1FXA A;  4ANU A;  2KVZ A;  3PLU A;  4P6V F;  3MHS D;  3MC8 A;  4K3C A;  1MG4 A;  2G45 B;  3RUI B;  3CSF A;  3D32 A;  2HDE A;  1ESF A;  2V3P A;  3WAO A;  1LXD A;  3AH7 A;  3CST A;  4S0R A;  5J17 A;  1KOT A;  3DBL B;  2MBB B;  1GC7 A;  3ML8 A;  4D2K A;  4W9G A;  3RNF C;  2UU7 A;  1RYJ A;  3RD2 A;  4ARI A;  2L7R A;  3L13 A;  2B3A A;  2KYW A;  1H4R A;  1WE6 A;  1EF1 A;  2X8X X;  1F2R C;  4B95 A;  1D5X C;  1HZ5 A;  1TGZ B;  1T5X D;  3O13 A;  3P1M A;  3PZD A;  1V49 A;  4C00 A;  4EZK A;  2FBW B;  4HKQ A;  4BKS D;  4ZRP A;  1P0R A;  1WJN A;  3JSV A;  3AEC B;  2A4Z A;  3B9J A;  5EE9 A;  3PV1 A;  3ZNZ B;  1S1Q B;  2L3Z A;  1IYF A;  1C1Y B;  2LGS A;  3LB8 C;  2KD0 A;  4P1B C;  3FIL B;  3P4R B;  1T0S C;  3IT4 B;  1GPX A;  1PQS A;  1FMA D;  3Q8F A;  4OW0 A;  2WXK A;  2V9H A;  5G55 A;  3PGE A;  1TT5 B;  5DCN A;  3VQI A;  1QF6 A;  1Q5W B;  1D3Z A;  2KAN A;  4FJY A;  3VHT C;  3OLM D;  2L32 A;  3N9Y C;  1E8Y A;  4RGN A;  2KWU B;  1BT0 A;  3X23 A;  1TBE A;  2WDT B;  3VRA B;  2IGH A;  4REZ A;  3DBH B;  2KNB A;  2AL3 A;  3A33 B;  2LUE A;  2WX1 A;  3R7Q A;  5I4D A;  4N9F 4;  5D3D A;  3AN1 A;  3Q8A A;  5FR3 A;  3GZN B;  1UF0 A;  2RDG A;  3B1L X;  3NG0 A;  1SB3 C;  3L10 B;  5IAA C;  2QMT A;  3U52 E;  3HK0 A;  4IW0 A;  1TZO A;  3VTU A;  1FPY A;  4KIK A;  3IXS A;  3TEZ A;  1IGC A;  2MP2 A;  3R2I A;  1L0X B;  2ZZP B;  1VR9 A;  2C5L C;  1WXA A;  4WH4 A;  3UQA A;  2VZK B;  4KV2 A;  2M1M A;  4JX1 C;  2BTE A;  3DHH C;  1XXG A;  3TCA A;  2DYM A;  2IGG A;  2KZR A;  2JT4 B;  3DBL I;  5D6J B;  2DYO A;  1B1Z A;  3AU4 A;  2WX0 A;  3Q8C A;  2K9X A;  2ZNV C;  3EGR A;  1K52 A;  1P9D U;  1PGB A;  2UYZ B;  2AL6 A;  1Z2M A;  3BYT B;  2LAS A;  1S3S G;  3AUL A;  4L1B A;  4KGR A;  1SE2 A;  4XX5 A;  4GN1 A;  3CMM B;  5EE3 A;  4BOZ B;  3NS1 A;  1J7B A;  2KQS A;  1WXQ A;  3IAM 1;  3KH0 A;  3VUW A;  4A8X C;  2J0J A;  1MHX A;  1LQB A;  5HKH A;  3NS8 A;  3QHT A;  2N4F A;  1DOI A;  1VCB A;  1STE A;  2IY0 B;  2IY1 B;  3AXC A;  1UD7 A;  2XK5 A;  2NS5 A;  3Q2A C;  2L83 A;  2M0X A;  3NZU A;  4EFO A;  2MH7 A;  2WXO A;  2XNA C;  2EMS A;  4S17 A;  4WUR A;  5C23 A;  3NZS A;  3TBL D;  4MJS B;  1D4B A;  3KWV A;  1ET9 A;  1K8R B;  5GMV A;  3AE4 B;  2HD5 B;  5CHV C;  4MDK E;  4EKU A;  4HCN B;  2KDI A;  3AEA B;  1C78 A;  2RSU A;  4FJV B;  1FXT B;  1J0G A;  4BBN C;  3L4P A;  4LJO B;  4C4V B;  2L0F A;  1V80 A;  2KLC A;  2L0T A;  2I1K A;  3DBH I;  2PKO A;  1ACC A;  1E8X A;  1QOB A;  4MH8 A;  4HLE A;  4MGY E;  1ZUD 2;  5BYQ A;  1YN3 A;  2J52 A;  4G50 A;  2JRI B;  3N32 A;  3APF A;  2RGF A;  2HJ8 A;  1D5Z C;  4HPM B;  3VAW A;  5L95 C;  4XC2 A;  2MX2 A;  4DXG A;  5J2R A;  2KWD A;  2IGD A;  2L76 A;  4IM0 A;  1RRB A;  1KJT A;  2WXJ A;  2WDR B;  3DBR B;  4K7S A;  3VXW A;  4IKG A;  2XN9 C;  4NQL B;  1C79 A;  4DHJ B;  3VUX A;  2KFK A;  4I6P A;  5BMH A;  5FK9 C;  4AJW A;  4EZJ A;  2M8S A;  4ASW C;  3H1U A;  3PRE A;  4HKZ E;  4IWQ A;  3T9L A;  2L00 B;  1WRI A;  4XDC A;  3OJ4 B;  2NCN A;  5CTR C;  1WR1 A;  2C60 A;  2MJ3 A;  1TKY A;  1C4A A;  4H2A A;  2JX5 A;  1WM3 A;  5BMG A;  3V6E B;  4BFR A;  2DZJ A;  4IC7 B;  2KX0 A;  4G0N B;  2GMI C;  2Y5C A;  1DOY A;  1HZ6 A;  3VR9 B;  3PRP B;  4EEW A;  4B0M A;  1SIF A;  3WA0 A;  4AP4 C;  1NI2 A;  4USA A;  2LVO A;  3PO0 A;  3WIM A;  3CIR B;  2MJD A;  3PRZ A;  1AYF A;  2C7N B;  3HIZ A;  2BB5 A;  2WXN A;  3BII D;  3ZDM C;  2JYE A;  2FAZ A;  2PEA A;  3QIJ A;  3DVN U;  2N7J A;  1I42 A;  1TYG B;  2AQ2 B;  4LNN A;  2R2O A;  2D3G A;  2DAJ A;  4MGI E;  3AB5 A;  3KVF B;  1OEY A;  2WNM A;  4BAX A;  2O6V D;  1JCK B;  3AE8 B;  4YSX B;  2BWE S;  3RT3 B;  1YD8 U;  1HE8 A;  2ZVN A;  4K7U A;  3KWL A;  1R7S A;  2IBI B;  1PFD A;  1Q0W B;  1XCT L;  2QC8 A;  4OZB A;  1KTK A;  1WGY A;  1GAQ B;  3EEC A;  3IFW B;  1VLB A;  1MFW A;  1QLB B;  2BYF A;  2DEN B;  3AM9 A;  3L16 A;  4WQM A;  3VTW A;  1TS3 A;  2MWS B;  1L6V A;  3TIX A;  2KMA A;  2KOX A;  4M8N A;  5LXI B;  2ACZ B;  1FNV A;  1V9J A;  2V4I B;  3PT2 B;  2N9X A;  1I4R A;  2QJL A;  3TMP B;  2KK8 A;  4XGA B;  4PS3 A;  3PS6 A;  1N62 A;  3DBR I;  2AQ1 B;  3UIP B;  1TS5 A;  1E0Z A;  4E74 A;  4DBG A;  1NYR A;  3U7D A;  2C7M B;  1LFD A;  3ECI A;  3ZTD A;  1XEE A;  1NVI D;  1YX5 B;  1EU3 A;  4FBJ B;  3B0A A;  1GNU A;  4YL8 A;  2PTL A;  1V1P B;  1V86 A;  2PVG C;  5TR5 A;  3DOW A;  2K6D B;  2FCQ A;  2INC C;  1WSP A;  2RD0 A;  2GI9 A;  3PTF C;  3DHG C;  4AS1 A;  5TSS A;  4JPS A;  4NZL B;  3RZF A;  3L0W B;  5H8Y E;  3KYC D;  1XF5 L;  5D7G A;  1HTO A;  1RWS A;  4X57 B;  2J4X A;  4WJQ A;  5AZH A;  4IG7 B;  4CHK A;  2MHJ A;  4FLH A;  3TSS A;  2KX3 A;  3DBS A;  4C7Z A;  2LJ5 A;  2MA9 B;  1RAX A;  5AUI A;  2K8B A;  3EC8 A;  1F0Z A;  4W9K A;  3Q3F A;  1EU4 A;  4GSW A;  3W9C B;  2KTR B;  4RF1 A;  2M4N A;  3TUO A;  1ZGU B;  1UZX B;  2CU3 A;  1K53 A;  3BY4 B;  4TQ1 A;  3KW5 B;  2KJ6 A;  2JWZ A;  4HJG E;  3EFU A;  3QC8 B;  2N7E A;  5C3J B;  3AEG B;  1HXY D;  1OQQ A;  3UIN B;  4IUM B;  3DWM A;  1JW9 D;  4LJP B;  1M94 A;  1WXV A;  1ZDX A;  3V3X A;  2JF5 A;  1UEL A;  4W9D A;  3PHW B;  2VH1 A;  1WMH B;  2XBB C;  2V4L A;  1SEB D;  4K1R B;  2JPH A;  3UQB A;  4K3B A;  1QOG A;  1V5O A;  3A9J A;  4BVU C;  1AN8 A;  2Z59 B;  3P4P B;  1TS2 A;  2FID A;  1ZPS A;  4GMV A;  1YJ1 A;  3H6N A;  1MG8 A;  5EE1 A;  2RDB C;  3I9V 1;  3QX1 A;  1WH3 A;  1FRR A;  2KC1 A;  1AAR A;  1RFK A;  1C76 A;  4GDL B;  2KMC A;  2MJE A;  5BYR A;  2WXG A;  1I4H A;  1V1O A;  2UWQ A;  1IUE A;  2KQ7 A;  4WQO B;  1K50 A;  3P2B A;  3ML9 A;  5AZG A;  4AJY B;  1WZ3 A;  3ZNH B;  3N1Z C;  3NUH B;  4ZRJ A;  5HFY A;  1CJE A;  3BK1 A;  2NBU A;  2CHZ A;  2H88 B;  4L23 A;  4WAA A;  1SE3 A;  3B2G A;  4AWJ A;  3B2F A;  3CF6 E;  3R8B A;  4OHJ A;  1BXT A;  1OQY A;  3QQ8 B;  3V61 A;  2J42 A;  2GBR A;  4GU2 A;  3EFC A;  2KAC A;  3VUY A;  1E7P B;  4GOC A;  4ZYN A;  4A90 A;  2L1A A;  4EUT A;  3PPA A;  3SR6 A;  5H92 C;  3IT6 B;  4KZC A;  3UI3 A;  1ISN A;  1N6Z A;  4GIV A;  2NR2 A;  4PYZ A;  2RPQ A;  3T3N A;  2WU2 B;  1YQ4 B;  2K22 A;  3A1Q B;  1V97 A;  3ABV B;  2K0P A;  1T0R C;  1KLU D;  3DCG A;  1XQQ A;  1JRU A;  2BBC A;  2NVU I;  4C4V A;  1GJZ A;  1XCQ L;  3ZDT A;  5IOI A;  2O2V B;  2DYB A;  3R7R A;  1WR6 E;  2ZNV B;  4IDI A;  3NVY A;  1ZXH A;  3TEX A;  4CYE A;  2ZW1 A;  4M0W A;  2QCZ A;  4KGT A;  1YN4 A;  3NRZ A;  3ONS A;  4DXA B;  4IM2 A;  2MBO A;  1YIW A;  1F9J A;  2JZ3 B;  1D5M C;  2D07 B;  5E6O A;  4E71 A;  4C7Y A;  1WGK A;  2I2Y A;  4ZDV A;  1C4P A;  4OZC A;  2Z0D B;  3PZ8 A;  3GB1 A;  4WWP A;  3H7P B;  1GB1 A;  4CQN A;  3ZXV A;  3GE8 C;  4R3D A;  1PGX A;  1ZKH A;  3OWE B;  2GBM A;  4RMA A;  3HHM A;  2J0M A;  3BK2 A;  1TS4 A;  3M62 B;  2LFI A;  1DOX A;  3FKY A;  3I63 C;  4M02 A;  5GXG B;  3R2T A; 
#chains in the Genus database with same CATH homology
 4HPM B;  4F7Z A;  3APC A;  3VAW A;  5L95 C;  5J18 A;  2K1F A;  2NBW B;  2MX2 A;  4XC2 A;  4TKN A;  1L7Y A;  5J2R A;  4HWI B;  2L76 A;  4B6W A;  2FCS A;  2G4S A;  4IM0 A;  3A4R A;  1NDD A;  4HVB A;  1RRB A;  3O65 B;  2DZK A;  2KWV B;  1KJT A;  5DPS A;  1LM8 B;  1V81 A;  4MM3 A;  2ZVO A;  3HM3 A;  5JZE B;  2JZZ A;  4K7S A;  1EO6 A;  4PS8 A;  3VXW A;  5JH5 C;  3A9K A;  2KVR A;  2LVQ A;  4W9C A;  2MBH A;  4JIO U;  4NQL B;  5JHA A;  2K39 A;  3N30 A;  4DHJ B;  4II2 B;  2D2Q A;  3VUX A;  2KFK A;  3PSE B;  1WRD B;  4I6P A;  4EZJ A;  2L8J A;  2MBE A;  4AJW A;  2M8S A;  4ASW C;  2BYV E;  3GOE A;  3H1U A;  3PRE A;  3M3J A;  4IWQ A;  3SU8 X;  3T9L A;  4DWF A;  2FNJ B;  4GDK B;  2L00 B;  1KM7 A;  2LRW A;  3WAP A;  4ICV A;  3OJ4 B;  3A1Q A;  2NCN A;  2C7H A;  3NY5 A;  1KLV A;  4DHJ D;  5CTR C;  3DPD A;  1WR1 A;  2C60 A;  2KHW B;  2YLM A;  1WIA A;  4MEM A;  2GBN A;  2BKF A;  1GG3 A;  2KO3 A;  4NQK E;  5DPW A;  3IHP C;  1OEY J;  5DPT A;  3UF8 A;  1WM3 A;  3SD5 A;  3V6E B;  4BFR A;  2CHW A;  2DZJ A;  1WJ4 A;  2ZCB A;  3QCA A;  4URK A;  2O6V A;  4DHZ B;  4IC7 B;  2KX0 A;  4G0N B;  1WX7 A;  4FN2 A;  2GMI C;  4AUQ C;  1WJU A;  2KC2 A;  4MJS A;  2IO3 B;  4BKT A;  3PRP B;  4EEW A;  3ZTC A;  3SDL C;  2ASQ A;  4FUL A;  4HK2 A;  3W1S C;  1SIF A;  3WA0 A;  4JL9 A;  4AP4 C;  1NI2 A;  2LVO A;  2KFK B;  4A3P A;  3W1Y A;  3WIM A;  4A20 A;  3PRZ A;  3QAR A;  3ZO5 B;  2J7Q B;  4MH0 E;  3APD A;  2R2Q A;  2N1W A;  3UIO B;  3JW0 X;  2K6Q A;  5AEK B;  4HXD A;  3RUL A;  2DAF A;  4BKG A;  4AOF A;  2C7N B;  4W9E A;  4E3C A;  4NNJ B;  4EZL A;  1YX6 B;  2PPH A;  3KUZ A;  3L08 A;  1VD2 A;  4KDI C;  2MCN B;  3HIZ A;  4WJN A;  4ICU A;  3H7P A;  1P3Q U;  2AWT A;  3AU5 A;  4G3X B;  5E6P A;  4G11 A;  2G3Q B;  3Q3J A;  2LXC A;  1SE9 A;  3S2A A;  3K9P B;  1TTN A;  3ZDM C;  2LI5 A;  1WF9 A;  2IYD B;  2FAZ A;  4TV3 A;  2BYE A;  2CS4 A;  2PEA A;  3DVN U;  3QIJ A;  2N1V A;  1E8W A;  1U4A A;  2HTH A;  2O6V B;  3U30 A;  1I42 A;  2JRH A;  4NY0 A;  2R2O A;  2D3G A;  4P7I A;  1IPG A;  2N7D A;  5JHB A;  2DAJ A;  4MGI E;  3ZKJ C;  3KVF B;  1OEY A;  1V6E A;  2L05 A;  2O6V D;  1WM2 A;  4GB9 A;  3K9O B;  2BWE S;  2BWF A;  3QJZ A;  1WYW B;  4OVV A;  3RT3 B;  1YD8 U;  2GBJ A;  2JXX A;  1HE8 A;  2ZVN A;  3PHX B;  1E5W A;  2KDF B;  4K7U A;  4KVG B;  2IO0 B;  2NPT A;  3QA8 A;  4FHK A;  4W9H A;  4BBN F;  2N9E B;  2IBI B;  4FHJ A;  3MJW A;  2K25 A;  3L17 A;  1UGM A;  1Q0W B;  3SHQ A;  3ZVV A;  2AYO B;  4TQ0 A;  1WGY A;  2CR5 A;  3UGB B;  3EEC A;  2IO1 B;  3IFW B;  1WXM A;  4MEL A;  2KDB A;  3RCZ A;  4B9K A;  4ANW A;  4F8C B;  1V5T A;  2FIF A;  3B08 A;  5CHW A;  2BYF A;  2DEN B;  3AI5 A;  4I6L B;  3KYD D;  3L16 A;  4NJ6 A;  2BF8 B;  5DPR A;  4DDI D;  3VTW A;  3VDZ A;  4J6I A;  2OJR A;  4GDK A;  4HPL B;  5FR6 A;  4HJK A;  1C3T A;  1E90 A;  2MWS B;  2V3S A;  2ZPY A;  2MRP A;  4II3 B;  4ANV A;  1EUV B;  3BIN A;  3GZN I;  3TIX A;  2KKC A;  3RYT A;  2KMA A;  2LGX A;  2KOX A;  4M8N A;  5LXI B;  3HM6 X;  4OVU A;  2FCN A;  5E6N A;  3IVF A;  1V9J A;  3PT2 B;  3I3T B;  4MSM B;  4MGK E;  2NPT B;  3VFK A;  2MSE D;  2N9X A;  1TZ1 A;  4RM9 A;  3TMP B;  2KK8 A;  4PS3 A;  3WAL A;  3PS6 A;  4LDT B;  2MBQ A;  3DBR I;  2Y5B B;  4JLC A;  2DHZ A;  2I1J A;  2KDE B;  4KSK C;  1E7V A;  3UIP B;  4E74 A;  2ZCC A;  4DBG A;  1CMX B;  2JUO A;  3LJ3 A;  3U7D A;  2V1Y A;  3ZUN A;  3VTV A;  2C7M B;  1LFD A;  3ECI A;  3ZTD A;  2DX5 B;  3DVG X;  1L2N A;  1J8C A;  4LDT D;  2N9P C;  2MLB A;  2NBV B;  3PLV A;  3V6C B;  4ANU A;  2MW5 A;  4W9F A;  2K8H A;  5LLI A;  1YX5 B;  2VRR B;  1WGR A;  4FBJ B;  3PLU A;  3B0A A;  1WY8 A;  1GNU A;  3MHS D;  4WJP A;  1R4N I;  1WGD A;  4YL8 A;  4A3O A;  2G45 B;  3RUI B;  3CSF A;  3D32 A;  3R66 C;  3A9J B;  1V86 A;  3ZRF A;  1H8C A;  2WWZ A;  4XZ4 A;  5TR5 A;  2CU1 A;  2W9N A;  1R4M I;  2K8C A;  3WAO A;  3DOW A;  2JVC A;  1LXD A;  3CST A;  2K6D B;  2FCQ A;  2KN5 A;  2D11 A;  2HE7 A;  2RR9 A;  1WGH A;  5J17 A;  1KOT A;  4WWO A;  2RD0 A;  3PTF C;  4JGH B;  2KTR A;  3VVW B;  3ZNG C;  2MBB B;  1GC7 A;  3ML8 A;  4I6N B;  4W9G A;  1E7U A;  5EDS A;  3ZNI D;  1WE7 A;  3DVG Y;  3RD2 A;  1QZE A;  3W1S A;  5KHQ A;  2L7R A;  3L13 A;  3DDC B;  4KDL B;  3RZF A;  2B3A A;  3L0W B;  3KYC D;  2C9W B;  3C0R B;  5D7G A;  1H4R A;  2LXA A;  1WE6 A;  1EF1 A;  2MP2 B;  3JYU A;  4X57 B;  2BKR B;  4WJQ A;  5AZH A;  3V62 A;  4B95 A;  4IG7 B;  2J0K A;  4PYU A;  4CHK A;  2BPS A;  4FLH A;  4K81 A;  2M17 A;  1TGZ B;  2KX3 A;  3DBS A;  5KHO A;  3PZD A;  1E8Z A;  2KTF A;  5IA7 A;  1V49 A;  2LJ5 A;  2MA9 B;  1RAX A;  4KSL C;  1UH6 A;  3OJ3 A;  3EHV A;  1RLF A;  4EZK A;  3QWZ B;  3QAQ A;  2K8B A;  2KFJ A;  3EC8 A;  2PJH A;  3TL5 A;  4W9K A;  4BKS D;  3Q3F A;  4GSW A;  1Y8R C;  2KTR B;  2M4N A;  2ZEQ A;  1WMH A;  1P0R A;  1WJN A;  3JSV A;  2A4Z A;  3PV1 A;  3ZNZ B;  4TUU A;  1S1Q B;  2L3Z A;  4FJZ A;  1UBI A;  1ZGU B;  1UZX B;  3JVZ X;  3PRM B;  3ZIM A;  2KXJ A;  1IYF A;  1P98 A;  1C1Y B;  3ALB A;  3BY4 B;  2KJR A;  1J19 A;  4GGQ A;  4TQ1 A;  2PE9 A;  2A5U A;  3KW5 B;  2KD0 A;  2KJ6 A;  2D10 A;  2JWZ A;  3M63 B;  1PQS A;  3EFU A;  3QC8 B;  2LGD A;  5BO4 B;  5G55 A;  2N7E A;  4FA6 A;  1P1A A;  2LVP A;  3PGE A;  3UIN B;  4IUM B;  5DCN A;  3VQI A;  4LJP B;  1M94 A;  3R3M A;  1WXV A;  1Q5W B;  1EF5 A;  1D3Z A;  2KAN A;  4FJY A;  3VHT C;  4DHZ E;  3H9D A;  3OLM D;  4KZ0 A;  1E8Y A;  2CHX A;  1BT0 A;  1UEL A;  2JF5 A;  2KWU B;  1NBF C;  4W9D A;  5G2N A;  3X23 A;  3PHW B;  1TBE A;  2WDT B;  4M8M A;  3V60 A;  3VH3 B;  1WMH B;  3JSV B;  2XBB C;  2V4L A;  4K1R B;  2JPH A;  3UQB A;  4IWO A;  2KNB A;  4GXB A;  2AL3 A;  1V5O A;  3A9J A;  1WGG A;  1GC6 A;  1Z5S B;  3A33 B;  4NAW A;  4BVU C;  2Z59 B;  4CO7 A;  1WFY A;  2EMT A;  2FID A;  3N3K B;  2LUE A;  2YVC A;  2WX1 A;  4GMV A;  2WYQ A;  3R7Q A;  3WAM A;  4N9F 4;  1YJ1 A;  2G4D B;  4DDG D;  2BGF A;  4NPN A;  4WJO A;  4M0W B;  3H6N A;  2AEH A;  3M95 A;  1MG8 A;  2KWC A;  3RZW C;  2GOW A;  3B1L X;  3L10 B;  5IAA C;  1V2Y A;  2FCM A;  4NJ7 A;  2LZ6 A;  4FAD A;  3HK0 A;  4IW0 A;  3OAW A;  3QX1 A;  3U8Z A;  1WH3 A;  2REX A;  3VTU A;  2KC1 A;  1AAR A;  3ENE A;  2MQJ A;  3DQV A;  4GDL B;  2KMC A;  2DZI A;  4KIK A;  2IZV B;  2UWQ A;  2MP2 A;  2KQ7 A;  4WQO B;  3H7S A;  2ZZP B;  4BKS A;  3P2B A;  3ML9 A;  2ZPN A;  3X0W A;  2GBK A;  2C5L C;  4NAW B;  5AZG A;  4AJY B;  1WZ3 A;  4HDO A;  1OTR B;  1T0Y A;  3ZNH B;  1WXA A;  3UQA A;  5CX3 A;  4KV2 A;  2M1M A;  4ZRJ A;  2QHO A;  3TCA A;  4W9L A;  2Z0E B;  2DYM A;  2KZR A;  1WJ6 A;  3PVL A;  2JT4 B;  3DBL I;  3NOB A;  2KJH B;  5D6J B;  2NBU A;  2CHZ A;  2DYO A;  3AU4 A;  2WX0 A;  4IM3 A;  4WAA A;  4AWJ A;  2ZNV C;  2DZM A;  3CF6 E;  2EKE C;  1P9D U;  2O2V A;  2UYZ B;  1OQY A;  3QQ8 B;  3V61 A;  4GU2 A;  2GBR A;  2AL6 A;  4ANX A;  1Z2M A;  2LAS A;  1S3S G;  3AUL A;  3NHE B;  4KIK B;  4ZYN A;  4GOC A;  3VUY A;  3L54 A;  3QK0 A;  5D2M B;  3PPA A;  4MGZ E;  3ZRC A;  4EUT A;  2LD9 A;  4XX5 A;  4K7W A;  4GN1 A;  3CMM B;  4BOZ B;  3A9K B;  4BOS C;  4EOY A;  4KZC A;  2KQS A;  4JQW C;  1ISN A;  5C1Z A;  1IP9 A;  3T8M A;  3KH0 A;  4GIV A;  2ZJD A;  2NR2 A;  3VUW A;  5L83 A;  2J0J A;  4PYZ A;  1LQB A;  1RFA A;  5HKH A;  2RPQ A;  1OGW A;  3WAN A;  1I35 A;  1SGH A;  1WXS A;  1YQB A;  3NS8 A;  3A1Q B;  2KLG A;  3QHT A;  4ZRK A;  1WI0 A;  2N4F A;  1VCB A;  2IY1 B;  2IY0 B;  3AXC A;  3MTN B;  3DCG A;  1UD7 A;  1XQQ A;  1JRU A;  2LGY A;  2XEW A;  2NVU I;  1GUA B;  2XK5 A;  3IG3 A;  1ZW7 A;  2NS5 A;  1GJZ A;  3ZLZ A;  2LWP A;  3ZDT A;  4IWP A;  2O2V B;  4W9J A;  2DYB A;  3R7R A;  4PS7 A;  5CHF A;  2M0X A;  1WR6 E;  2ZNV B;  3NZU A;  2CKH B;  2LRU A;  4ZRI A;  4EFO A;  4MSQ B;  2PE6 B;  2JY6 A;  2OOB B;  2EMS A;  4CYE A;  5C23 A;  3NZS A;  3TBL D;  4F1S A;  4MJS B;  3ONS A;  4HCP B;  1K8R B;  1WX9 A;  4IM2 A;  3A4S C;  2MBO A;  5GMV A;  4DXA B;  1YIW A;  4WWN A;  2HD5 B;  1F9J A;  1UBQ A;  2FUH B;  2JZ3 B;  3IBE A;  1XD3 B;  2D07 B;  3ZW3 A;  5E6O A;  5CHV C;  4E71 A;  4MDK E;  4EKU A;  4HCN B;  2KDI A;  1WX8 A;  4RM8 A;  5AZF A;  2RSU A;  1G6J A;  4ZDV A;  4FJV B;  4GDL A;  1FXT B;  3KUD B;  1J0G A;  4BBN C;  2Z0D B;  4WWP A;  1XT9 B;  3H7P B;  3VH4 B;  4DK5 A;  4LJO B;  2XK5 B;  2L0F A;  1V80 A;  1ZKH A;  2KLC A;  2I1K A;  2L0T A;  3DBH I;  3DVN V;  1E8X A;  2IO2 B;  2GBM A;  4RMA A;  3HHM A;  4W9I A;  4HLE A;  2J0M A;  4MGY E;  3TJP A;  3M62 B;  1Q1O A;  3KUC B;  4HDQ A;  1A5R A;  5LXH A;  4G50 A;  5D94 A;  2JRI B;  3LDZ E;  3N32 A;  3APF A;  1WZ0 A;  1X1M A;  2RGF A;  4LCD E;  2HJ8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...