1WX7A

Solution structure of the n-terminal ubiquitin-like domain in the human ubiquilin 3 (ubqln3)
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
106
structure length
106
Chain Sequence
GSSGSSGSPAPVQDPHLIKVTVKTPKDKEDFSVTDTCTIQQLKEEISQRFKAHPDQLVLIFAGKILKDPDSLAQCGVRDGLTVHLVIKRQHRAMGNECPASGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution Structure of the N-terminal Ubiquitin-like Domain in the Human Ubiquilin 3 (UBQLN3)
rcsb
source organism Homo sapiens
molecule tags Structural genomics, unknown function
molecule keywords Ubiquilin 3
total genus 13
structure length 106
sequence length 106
ec nomenclature
pdb deposition date 2005-01-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00240 ubiquitin Ubiquitin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 1wx7A01
2NPTB 2KFKA 4IUMB 4DWFA 3DBRI 4M8MA 1RLFA 5JH5C 4NY0A 2MBQA 2KOXA 4GIVA 1J19A 2IY0B 2KVRA 5DPWA 1WXSA 3EFUA 3C0RB 4ZDVA 4AUQC 4DK5A 4AWJA 2NCNA 4PYZA 1R4NI 1XT9B 2KDBA 4I6LB 4NJ7A 4G3XB 3WA0A 4EEWA 1EUVB 4FJVB 4XZ4A 2KZRA 2V4LA 2ZNVB 3HHMA 1EO6A 4M0WB 5DCNA 2W9NA 1RFAA 1X1MA 2IO1B 2IO3B 4KVGB 4MELA 2VRRB 2M17A 2GBRA 1WJNA 4ANWA 3VUXA 4KZ0A 2JZZA 2MSED 3NY5A 2CHWA 2FIDA 1R4MI 2NR2A 4MEMA 1WGDA 4RMAA 3K9OB 1NDDA 4MGYE 3W1SA 3AU5A 1GG3A 3DVNU 4BOZB 2KWCA 1YIWA 1Q5WB 3H1UA 3UF8A 1H4RA 1SGHA 3WALA 4AJWA 1SE9A 2KJHB 2KXJA 2K8BA 1WGGA 4TUUA 2C9WB 3DPDA 4WAAA 5G55A 3RT3B 2L00B 1NI2A 2GBJA 1E8ZA 2O2VB 2LUEA 4GB9A 1V6EA 1OEYA 2KWUB 4MGIE 1P1AA 2HJ8A 1V9JA 4K7SA 1Q1OA 1WR1A 3A9KA 4K7WA 4ANVA 2MLBA 1LFDA 3PREA 2K1FA 2EKEC 2AL3A 3ZIMA 4ZRIA 1WRDB 3QARA 3RYTA 2D11A 2DAJA 3IFWB 4MDKE 3ZNZB 3QC8B 1L2NA 1V5TA 1D3ZA 1UGMA 5TR5A 1WZ3A 2BYVE 3A33B 3QIJA 3NZUA 3W1YA 2K6DB 4F1SA 3PS6A 4MGKE 3L08A 2DYOA 2JRHA 4DHJB 1VCBA 2PPHA 4A3OA 1WYWB 2FUHB 3KUCB 4F8CB 2KQ7A 4FHJA 1WY8A 2ZPNA 1WH3A 1P3QU 2IO0B 2RGFA 3CSTA 2HD5B 1V81A 1S1QB 2DX5B 3JSVB 3N32A 1TGZB 2BF8B 2C7HA 4KSLC 4XC2A 2IBIB 3OJ3A 4EZKA 3ZNID 3KW5B 3QQ8B 4EZJA 3VTUA 1ISNA 3UGBB 5L95C 3QCAA 3ALBA 4I6PA 5HKHA 4RM8A 1UZXB 3RZFA 1Q0WB 2BKFA 2G4SA 1P98A 5D6JB 3AULA 3L54A 4BKTA 4KZCA 3SD5A 3R66C 1UD7A 2NBWB 2MBHA 3PSEB 2FNJB 3IHPC 4BOSC 3TBLD 2GMIC 3VUWA 2K8CA 2KKCA 3CMMB 3L17A 3VH4B 5C1ZA 1NBFC 2O2VA 4HXDA 2DAFA 4IW0A 3NHEB 2LXAA 2MRPA 2DYBA 3NOBA 4PS3A 3ONSA 2MP2B 4MSQB 2J0MA 3DBSA 5CHFA 4HK2A 3KUDB 2NVUI 1TTNA 3MTNB 3KVFB 4EFOA 2DZIA 3LDZE 1V49A 2C7NB 5LXHA 3VUYA 3DBHI 4GN1A 2O6VD 3PHWB 1E8YA 4GU2A 3RCZA 3RD2A 4B95A 2RSUA 4G50A 2JWZA 3ZNGC 4FHKA 1U4AA 3A1QA 5IA7A 2LASA 4G0NB 1WGYA 2I1KA 2K8HA 2MA9B 3V62A 2GBNA 1YD8U 1YX5B 2NPTA 2PEAA 2V3SA 2ZVNA 3LJ3A 3VTWA 3ZRCA 1I35A 1ZW7A 4HWIB 1UBQA 2GBMA 1UH6A 2L0TA 3VVWB 4HDOA 3UIPB 4XX5A 3VH3B 3S2AA 2JT4B 3WAOA 3SHQA 5JHBA 3D32A 4II3B 4LCDE 2MW5A 4NAWB 2ZPYA 4WWOA 2K6QA 3AXCA 2QHOA 1H8CA 2LD9A 1UBIA 3MJWA 3X0WA 1P0RA 4E3CA 3A4RA 2LRUA 2L05A 4ZRJA 1EF1A 1WE7A 3V6EB 2JPHA 4WWPA 2KLGA 2KLCA 3H6NA 1LXDA 4TV3A 2ZCBA 3QWZB 5CTRC 2AWTA 2ZEQA 3CSFA 3JYUA 3M3JA 5GMVA 1TBEA 4EZLA 3JW0X 2N1VA 4KIKA 4E71A 4JQWC 1WM2A 4JGHB 3V6CB 1F9JA 4IG7B 2WX0A 3IVFA 5JZEB 4URKA 1RRBA 4DHJD 4DDID 3A9KB 4HJKA 2CR5A 4GOCA 2BPSA 3GOEA 3ZDMC 2D10A 5D94A 2D3GA 2G3QB 4DDGD 1WJ4A 3SU8X 3PHXB 5EDSA 2M8SA 3L13A 4FULA 1XD3B 4HCPB 4EOYA 4W9LA 1YQBA 3ZNHB 2NBUA 2YLMA 4NQKE 3T9LA 3UIOB 3VQIA 4IWPA 4K81A 4EUTA 4MSMB 1G6JA 5E6NA 2L8JA 4W9EA 3ZTDA 1TZ1A 2XEWA 4PS8A 2LVQA 2JY6A 4BKSA 4AOFA 1J0GA 1WMHA 1LQBA 5E6PA 1Y8RC 5J2RA 5G2NA 2L76A 1S3SG 2KDIA 3VXWA 2UYZB 3UINB 4JL9A 2R2QA 3T8MA 2K39A 3PRZA 2KWVB 2HTHA 1KM7A 2O6VA 2KANA 3ZDTA 1WX8A 2KC1A 2KO3A 2CKHB 4IWOA 2G45B 3APDA 3NZSA 1E7UA 5AZFA 1C3TA 4WQOB 4KV2A 3PPAA 3WANA 4NNJB 5E6OA 3TL5A 2C7MB 2N9EB 4GDKB 2BKRB 4FADA 4MJSA 3WIMA 5KHQA 3RZWC 2MBBB 1PQSA 3APCA 4W9DA 4BBNF 2KFJA 2DZJA 2ZJDA 4HPMB 2KFKB 3OJ4B 3EECA 2HE7A 3P2BA 4IM2A 4TQ1A 2AEHA 3L10B 3U30A 3GZNI 4BVUC 2Y5BB 3H7SA 2CU1A 1Z5SB 3PRMB 4MJSB 2L0FA 3VHTC 1OGWA 2Z0EB 1IYFA 2D07B 2PE6B 2N7DA 4ANXA 5DPTA 2N9PC 5BO4B 3K9PB 2NS5A 1VD2A 2N1WA 4WJQA 1E90A 3Q3FA 2I1JA 4K7UA 2WWZA 3HM6X 3TMPB 2M0XA 1GJZA 2KTRB 4AP4C 5C23A 2A5UA 1ZGUB 3QHTA 3QAQA 4FLHA 2MCNB 3V61A 3CF6E 3HM3A 3L16A 5IAAC 4ZYNA 3ZKJC 4FJZA 3ML9A 2XBBC 3PLVA 4GMVA 2M4NA 3IG3A 1AARA 1GUAB 2KJ6A 3ENEA 2JF5A 2FCSA 2N9XA 2KQSA 4NJ6A 4EKUA 2REXA 4PS7A 3R7QA 3OAWA 4CO7A 2AYOB 3DBLI 1ZKHA 5CHVC 4WJPA 2BGFA 2LI5A 2GOWA 3PLUA 4MGZE 3BINA 3R3MA 1YX6B 4II2B 3OLMD 4JLCA 1OQYA 4LDTD 5AZHA 3ZO5B 2IO2B 4OVVA 1WXMA 2EMTA 1K8RB 3N3KB 4GGQA 3N30A 1FXTB 4W9JA 3R7RA 1QZEA 3B08A 2KX3A 2MWSB 5DPRA 4KIKB 4B6WA 4YL8A 3QJZA 2NBVB 4RM9A 4X57B 5J17A 3ECIA 2DZKA 4HCNB 1WXAA 3H7PB 3M95A 2CHXA 4ZRKA 1WZ0A 4WWNA 2BYFA 2UWQA 4GSWA 2DZMA 4CHKA 2FIFA 3KYDD 4NAWA 5L83A 4LJPB 2XK5B 2L7RA 1WIAA 1WJUA 1V5OA 2G4DB 3DOWA 3DCGA 2AL6A 3DVGX 1OTRB 4ANUA 4M8NA 2LVPA 3BY4B 3ZRFA 3U7DA 5CX3A 2N7EA 2WX1A 4NQLB 1BT0A 2R2OA 4IM0A 2JZ3B 4FN2A 4HVBA 2LVOA 4A20A 1WX7A 2LGXA 2XK5A 1OEYJ 2OOBB 2JXXA 4IC7B 3A9JB 3HK0A 2CHZA 1J8CA 4FBJB 2WDTB 2KJRA 2KC2A 3V60A 4DXAB 4F7ZA 2C60A 4JIOU 3DVNV 2D2QA 2O6VB 1E8WA 1WX9A 3JVZX 2CS4A 2GBKA 1P9DU 2KX0A 5D7GA 2MX2A 3VDZA 3VFKA 2Z59B 4KSKC 3ML8A 2ZNVC 1GNUA 2LZ6A 3AU4A 5CHWA 4WJOA 4PYUA 3ZUNA 4ICVA 4BKSD 2J7QB 1KLVA 2LRWA 3M62B 1WGHA 5LXIB 1E8XA 2JVCA 3KYCD 2KK8A 1WXVA 3DQVA 3W1SC 1XQQA 1WGRA 2KD0A 3EC8A 1MG8A 2KMAA 4CYEA 3VTVA 1T0YA 3PRPB 1WF9A 3VAWA 3ZLZA 2WYQA 2ZVOA 2ASQA 3APFA 4NPNA 4A3PA 4HLEA 4W9IA 3ZW3A 3QX1A 4W9CA 4K1RB 2DYMA 2KNBA 1CMXB 1WR6E 4ICUA 4N9F4 1Z2MA 2RD0A 2Z0DB 3JSVA 4B9KA 3PVLA 4GXBA 3QA8A 1A5RA 4ASWC 3SDLC 3A4SC 3UQBA 4DHZB 1WI0A 1RAXA 2OJRA 4MH0E 3KH0A 2C5LC 1WMHB 5JHAA 3ZTCA 3AI5A 5LLIA 5J18A 2V1YA 3EHVA 4GDKA 3ZVVA 4MM3A 1SIFA 3PZDA 1E7VA 4AJYB 3RULA 1JRUA 1GC6A 2JUOA 2A4ZA 2KMCA 3HIZA 4GDLB 4BKGA 3U8ZA 3Q3JA 2KDFB 4P7IA 2BWES 4KDLB 2BWFA 2IYDB 4WJNA 5FR6A 2EMSA 2FCMA 2J0JA 3A1QB 2LGYA 2RPQA 3IBEA 3M63B 4W9KA 5DPSA 1C1YB 1V86A 4W9HA 3RUIB 5KHOA 2KTFA 2YVCA 1KJTA 3I3TB 4HPLB 2N4FA 3WAMA 2IZVB 4IWQA 2DENB 4FJYA 4BFRA 2MP2A 1WM3A 2KN5A 2KTRA 4G11A 2FAZA 2KDEB 1I42A 1KOTA 1V2YA 2FCQA 2ZCCA 2LGDA 4KDIC 4DHZE 5AEKB 2PE9A 1IP9A 2PJHA 1GC7A 1IPGA 3UQAA 3PTFC 1V80A 2LJ5A 1UELA 4DBGA 4OVUA 1LM8B 2MBOA 3KUZA 4BBNC 3TJPA 3B0AA 3TIXA 1HE8A 3DDCB 4W9FA 2J0KA 1WFYA 3L0WB 4I6NB 1YJ1A 4J6IA 1EF5A 2L3ZA 1WJ6A 2LXCA 2JRIB 3MHSD 3NS8A 2IY1B 2KHWB 4TQ0A 3PV1A 3WAPA 2DHZA 3X23A 3B1LX 1WE6A 3PT2B 3A9JA 1M94A 2MBEA 4LJOB 1E5WA 3DVGY 4GDLA 2RR9A 4HDQA 4W9GA 2FCNA 2K25A 2B3AA 5AZGA 1L7YA 3H9DA 5D2MB 2M1MA 2BYEA 2MQJA 4IM3A 4FA6A 3H7PA 4E74A 4TKNA 2LWPA 3TCAA 2ZZPB 3O65B 4LDTB 3PGEA 3QK0A
chains in the Genus database with same CATH superfamily
2KFKA 4DWFA 1T0RC 1K51A 3AEDB 4P6VF 1FD6A 1MJDA 1BUIC 4RFBA 1YQ4B 1WXSA 4ZDVA 4AWJA 4G3XB 3CWIA 2KZRA 5DCNA 1JQ4A 3DBHB 2QEJC 4MELA 3AEAB 2QC8A 5E6JA 1C4CA 2JZZA 2MSED 4RMAA 4MEMA 3K9OB 4MGYE 4XE0A 1EU3A 2B76B 1GG3A 2H89B 2BB6A 3DVNU 1Q5WB 3WALA 2K8BA 1WGGA 2C9WB 1NI2A 2KWUB 4PT5A 4K7SA 3A9KA 2I2YA 2K1FA 1ENFA 1PGAA 3GP7A 5EE3A 5TR5A 1WZ3A 2OEDA 4IOIE 4IDIA 4A3OA 1V8CA 1YOVB 2FUHB 4F8CB 2IDYA 1E10A 1WH3A 1P3QU 2IO0B 3R8BA 1V81A 2DX5B 4XC2A 2IBIB 3ZNID 5FKAC 3UGBB 4JWUC 1UGJA 3ETRA 4I6PA 2YEPB 2VZKB 3R66C 4D2KA 2MBHA 3PSEB 1GB1A 3IHPC 1C4AA 3VUWA 1FEHA 1NBFC 3P4RB 3AEGB 3BZDB 3NHEB 4NZLB 2LXAA 1SSNA 2DYBA 3NOBA 3ONSA 3Q3OC 5CHFA 1IGDA 2LHDA 2NTTA 3I57A 1V49A 2C7NB 2WP9B 4RGOS 3LB8C 1NEKB 3EGRA 4G50A 2LMCA 2V3PA 1WGYA 1SJED 1YX5B 5D3DA 2PEAA 4HWIB 3VVWB 3NVWA 3IT6B 3NVVA 3VH3B 4MH8A 1A70A 3OWEB 1AN8A 4NAWB 3RNFC 4WWOA 4NJCA 1H8CA 3A4RA 2LRUA 2L05A 2FUG1 1WE7A 3AEFB 2KLGA 2PW9A 3JYUA 2MJEA 5GMVA 5G5GA 4EZLA 4KIKA 2DLBA 5JZEB 4IG7B 3IVFA 4URKA 1RRBA 1T5XD 2J42A 2CR5A 2BPSA 3GOEA 2WXRA 3RN9C 2K5PA 2G3QB 5MPOA 4R3DA 3SU8X 3DWMA 3PHXB 1AW7A 3GE3C 3RI7C 4HROA 3UIOB 2X8XX 1QKZA 1TZ1A 2XEWA 1TIFA 4PS8A 2LVQA 4TMAB 2AQ1B 1J0GA 2JSVX 2JQRB 1C77A 5G2NA 2PMVA 2KDIA 3VXWA 4JL9A 4K3CA 2O6VA 2KO3A 4IWOA 3V05A 2G45B 3NZSA 3PPAA 3WANA 3VRBB 3TL5A 3RNEC 5KHQA 1NVID 1GB4A 1R7SA 1E9MA 4HPMB 5C3JB 2BS4B 2KFKB 3OJ4B 3EECA 2HE7A 4IM2A 1J7BA 3L10B 4OVZA 1MFWA 3PRMB 2W3RA 2WXQA 2N9PC 2KACA 1WYGA 2N1WA 3Q3FA 1ZOYB 2M0XA 3DWGC 2KTRB 4WIPA 2A5UA 3QHTA 2MCNB 1UWMA 3R2IA 1XLQA 3RNCC 3BVGA 2XBBC 3HRDD 1GUAB 2N9XA 3Q8EA 1FFVA 2QCZA 5CHVC 3NS1A 4MGZE 3BINA 4JLCA 1OQYA 5AZHA 5HG2A 4US8A 1K50A 1ZE3D 4KKJA 2V9HA 3EFCA 4YL8A 3QJZA 4X57B 5J17A 1SXTA 3L4PA 4LNFA 2CHXA 1WZ0A 2UWQA 4RCOA 4NAWA 1JCKB 3DOWA 2G4DB 3DCGA 3BVMA 3N9YC 4ANUA 2N7EA 2R2OA 1FXIA 1WX7A 1OEYJ 3HK0A 2WDTB 3BK1A 2KJRA 3V60A 1T3QA 1WX9A 3VFKA 2MX2A 5H92C 3ML8A 3AU4A 1R4MB 2JXTA 3J9CA 5CHWA 4WJOA 2KDMA 3SFDB 1ZP0B 2WNMA 3W1SC 3VTVA 1T0YA 3PRPB 2OHFA 3APFA 2ASQA 2ZW1A 2N9KA 4HLEA 1CZPA 3GZNB 5LNK1 1WR6E 4ICUA 1L0XB 3TEYA 5IKCM 4B9KA 3PVLA 3WCQA 2SEBD 3Q69A 4ASWC 1YMHE 4DHZB 2VH1A 1I4HA 1ACCA 1RAXA 4ZOHC 2OJRA 5HHDG 1I4GA 1E7PB 5JHAA 3ZTCA 3ZQ4A 1J7AA 1N62A 2V1YA 1E7VA 1GC6A 3HIZA 3Q3JA 2KDFB 1FM0D 4P7IA 1PUTA 4WJNA 2RPQA 3GB1A 4W9HA 3FAHA 2EKIA 4A55A 4M00A 4ZHPA 1JWSD 2BB5A 3Q6BA 2DENB 4BFRA 2MP2A 2KTRA 1I42A 4MACA 2LGDA 1KTKA 1IP9A 2PJHA 3P4PB 1TKGA 1LM8B 4OVUA 4KGTA 3KUZA 4BBNC 2E6XA 3L0WB 2JZPA 4J6IA 2KYWA 2LXCA 4TQ0A 3PV1A 3WAPA 2DNFA 3A9JA 4LJOB 1IGCA 3DVGY 2RR9A 2FCNA 5G5HA 2QILA 2LGIA 2M1MA 2BYEA 4FA6A 4E74A 1ZUD2 3TCAA 3O65B 1JRPA 3URYA 3QK0A 1TYGB 2ON8A 1IBXA 4GIVA 2IY0B 5DPWA 3C0RB 4DK5A 4LTUA 1R4NI 4NJ7A 5IP4D 2PTLA 1FCCC 1HA5A 1EUVB 2L1AA 4XZ4A 2ZNVB 2IO3B 1HZ6A 1HTOA 1SE2A 2EELA 1WJNA 3VUXA 1R4MI 3AE1B 1WGDA 1NDDA 2L52A 3AU5A 4BOZB 3UF8A 1H4RA 2V0GA 1K52A 4AJWA 5BYRA 2CJOA 5IO9A 2KVZA 3Q8FA 2LUEA 1V6EA 3AE2B 1OEYA 1FPYA 1Q1OA 2GLSA 1LFDA 4IKGA 2J53A 1XF5L 2NTSA 3EUB2 4ZRIA 1WRDB 3QARA 2DAJA 2K9XA 5EE0A 3QC8B 4YT0B 1D3ZA 1UGMA 2BYVE 3QIJA 3W1YA 4QAYA 2ZW0A 4F1SA 4REZA 1STEA 1VDVA 4UDUC 3CSTA 3JSVB 5I4DA 2C7HA 1GPXA 4EZKA 3QQ8B 1ET9A 1ISNA 3ALBA 1UZXB 2G4SA 3AECB 3SD5A 2JYTA 3TBLD 2GMIC 3L17A 3VH4B 1KLUD 2O2VA 2WS3B 3B2GA 4HXDA 2DAFA 3I63C 2AX5A 4JE3B 4MSQB 2MP2B 4LNIA 4WURA 3KVFB 2DZIA 5LXHA 4LLGM 1E8YA 4ZRQA 1SJHD 4G0NB 2I1KA 2WXGA 3AEBB 1YD8U 2NPTA 3ZRCA 3LJ3A 2MJDA 1I35A 1ZW7A 2JYEA 2CJNA 4XX5A 3W5VB 2W3SA 3TEZA 5JHBA 3D32A 4II3B 2QIEB 2ZPYA 2K6QA 3AXCA 3AE4B 1P0RA 1PDXA 2JPHA 4WWPA 3MP9A 1JWBD 3H6NA 2ZCBA 2HTME 1N6ZA 2N1VA 4JQWC 1WM2A 1FNWA 1F9JA 4DDID 1TKYA 3A9KB 4GOCA 3ZDMC 2D3GA 5EDSA 2M8SA 3L13A 1UWXA 4HCPB 4W9LA 3ZNHB 4NQKE 1RWSA 4IWPA 3W5UB 4K81A 4MSMB 1G6JA 5E6NA 2WXFA 3P1MA 1D6EC 3ZTDA 1SE3A 2JY6A 1WMHA 1LQBA 4MT5A 2K22A 2L76A 1I4QA 2KT7A 2MJ3A 1OQRA 1PGXA 2KWVB 5EE1A 3E56A 1XCQL 1WX8A 1XEEA 5AUIA 1VZ8A 1GAQB 1I4XA 1M4VA 1E7UA 4KGSA 5AZFA 4NNJB 5E6OA 4GDKB 4FADA 3RZWC 3EA6A 2DZJA 2XNAC 1T0SC 1TS2A 2WXLA 3GZNI 2L83A 1MG4A 2Z0EB 1Q10A 2N7DA 5DPTA 1OFFA 1TT5B 2D5GA 2BS3B 4WAFA 2KN4A 3SFEB 4AP4C 5C23A 4FLHA 1NI3A 3V61A 3HM3A 3L16A 1N5WA 4FJZA 4YSZB 4DQOC 1AARA 2INDC 3RFZB 4RGMA 2JF5A 4DXGA 4PS7A 4CO7A 3OAWA 4N6EB 3NVZA 3Q3NC 3PLUA 2GOWA 1N60A 4LDTD 3R3MA 3OLMD 2WXKA 1MI0A 2IO2B 5D3IB 3SEBA 2EMTA 4GGQA 3RNGC 4W9JA 2KX3A 1HXYD 3N20C 3GE8C 1ZDVA 1YN4A 3ZYYX 1SF0A 1WRIA 2DZMA 2WXIA 4CHKA 1NYQA 2XK5B 2L7RA 1WJUA 2AL6A 3DVGX 1E0ZA 3ZRFA 5CX3A 2WX1A 2JZ3B 3CIRB 2XK5A 2JXXA 2E3TA 3A9JB 2CHZA 1J8CA 1YJIA 2GI9A 4YXDB 1B1ZA 2LHEA 2O6VB 3JVZX 1P9DU 2Z59B 1FRDA 4C56C 1TS4A 1WXQA 2N7JA 3I9V1 1GNUA 2LZ6A 1XCTL 4HJGE 2L32A 1RYJA 1VRAB 2LRWA 5JXVA 1QF6A 3M62B 5LXIB 2BVCA 4ACFA 1XQQA 1WGRA 3EC8A 3BYYB 3VR9B 1JMLA 1C76A 1B9RA 3AE7B 4W9IA 3RNBC 4ZHOA 3TUOA 2KNBA 4WH4A 2Z0DB 4C7ZA 4EE2A 3QA8A 3C8YA 3SDLC 3UQBA 1WI0A 4ZRPA 1WMHB 4GDKA 3ZVVA 1SIFA 3MC0B 1TY2A 3RULA 3VR8B 1JRUA 3H8HA 3U8ZA 4P16A 2FCMA 3A1QB 3M63B 5T8IA 3GS2A 5AUKA 4C4VB 2KTFA 4HPLB 2N4FA 2IZVB 1XLPA 4IWQA 2KDEB 1V2YA 2V4IB 1F52A 2FCQA 3PZ8A 1XO3A 4KDIC 4DHZE 3DHGC 1KLGD 3PTFC 2LJ5A 1L6VA 1UELA 1CJEA 3BVZA 1HE8A 3DDCB 4W9FA 1WFYA 4I6NB 1MHHE 3DBLB 4BZAA 2HJ1A 2N9LA 3MHSD 2IY1B 2KHWB 3B1LX 1WE6A 3Q8CA 4O1NA 3AM9A 4LK0M 1ET6A 2K25A 2B3AA 3R2TA 2M19A 1L6UA 1L7YA 2LFIA 2VH2A 4JWSC 4USAA 4YTMB 3Q8AA 4US9A 2LWPA 3HVDA 4LDTB 3PGEA 1R4NB 2BYTA 3T3NA 2NPTB 4M8MA 1RLFA 5JH5C 2MEKA 4NY0A 2G1EA 2KVRA 3OG5A 2I38A 4AUQC 2WQYB 2NCNA 2KDBA 1EWYC 4FJVB 2V4LA 3HHMA 2WDRB 2W9NA 1RFAA 4KVGB 2WDVB 2RPVA 3B2FA 2VRRB 4OHJA 2CHWA 2FIDA 2M0AA 2Y3AA 3MFGA 2ONQA 2BTEA 1SE9A 3KWLA 4WAAA 3DPDA 3RT3B 2L00B 4CQNA 2UU7A 2GBJA 1E8ZA 3DHHC 2O2VB 1DYQA 4GB9A 3AH7A 2Y5CA 4MGIE 2HJ8A 2EKEC 2NMQA 4MDKE 3ZNZB 2IGHA 3A33B 3NZUA 3DHIC 4XDCA 3PS6A 3KUCB 1WY8A 2RGFA 2HD5B 1S1QB 1TGZB 2BF8B 2YEPF 1LGRA 1D5XC 4YWGG 3KW5B 4EZJA 1LO5D 3QCAA 4S17A 2BKFA 3L54A 4BKTA 3BWUD 2NBWB 4BOSC 1DOXA 2K8CA 3CMMB 4B0MA 4IW0A 1P7EA 2MRPA 4PS3A 3DBSA 4HK2A 3FC4A 1OQQA 1TTNA 4EFOA 1I4PA 1JWUD 2QSDA 3VUYA 3DBHI 1QLBB 4GU2A 3RCZA 3RD2A 4B95A 2RSUA 1EM7A 2JWZA 1U4AA 3A1QA 5IA7A 1UUPA 2LASA 2K8HA 4XGAB 2GBNA 2ZVNA 2MHJA 2W55A 2GBMA 2L0TA 4HDOA 3UIPB 2JT4B 3P42A 4LCDE 1PYWD 1RFKA 2WDQB 2LD9A 1UBIA 3MJWA 4MM3B 2KLCA 2KAJA 1LXDA 4TV3A 1NYRA 3QWZB 5CTRC 3M3JA 4B0EA 3JW0X 4JGHB 3N1YC 3V6CB 2PVOD 2LEKA 3TEWA 5D94A 2GRIA 4FULA 4WWMA 1DOYA 2NBUA 3T9LA 2D3AA 2D3BA 4EUTA 4TSSA 2L8JA 1VZ7A 1ROEA 4AOFA 3AE3B 4J3OD 3T3OA 1HZ5A 1S3SG 2RDBC 1J7CA 4LNNA 1EU4A 2Z8LA 3T8MA 3BYTB 4RNAA 2HTHA 1KM7A 1VJKA 2WLBA 3ZDTA 2KC1A 3TEXA 2CKHB 3APDA 4HKQA 3TSSA 4L1BA 4WQOB 4KV2A 3AE5B 1FIQA 2N9EB 1QOBA 2BKRB 4MJSA 1SB3C 3APCA 4W9DA 2KFJA 2ZJDA 2DBYA 4ZYSA 3P2BA 4TQ1A 2AEHA 3U30A 4BVUC 2Y5BB 3FKYA 3H7SA 2QJLA 4MJSB 2L0FA 1OGWA 2PE6B 4ANXA 3K9PB 3RMKC 1TJEA 4WJQA 3TMPB 4K7UA 1PFDA 1GJZA 1UF0A 1IUEA 1KRHA 1YN3A 3KLSX 1FMAD 1L5PA 2M4NA 3IG3A 2TSSA 1HQRD 3ENEA 2WGSA 1QOFA 1N63A 3AMZA 4RF0A 3U52E 1QQRA 2REXA 3R7QA 4OZBA 2AYOB 1YN5A 1ZKHA 3IAM1 1D5MC 2PKOA 4FXCA 4WJPA 1D5ZC 2DWQA 2PLPA 2BGFA 2VZKD 4II2B 1YX6B 2BS2B 2AQ2B 3ZO5B 1K53A 1VLBA 3R7RA 1QZEA 3B08A 5DPRA 2NBVB 2KQ4X 4XWTA 2BBCA 4KGRA 3ECIA 2DZKA 4XDDA 1WXAA 3H7PB 4ZRKA 4WWNA 4GSWA 5L83A 4LJPB 3Q14C 1V5OA 5HI1A 4M8NA 2LVPA 3BY4B 1BT0A 4IM0A 4FN2A 4HVBA 2LVOA 2LGXA 3P4SB 4IC7B 5BMIA 2KC2A 4P1CC 2WXNA 1SEBD 1F77A 2CS4A 2GBKA 2KX0A 5D7GA 3VDZA 1ZDXA 4KSKC 1JROA 2G9HD 4Q2JA 2ZNVC 2K3UA 2RDHA 3RNAC 4PYUA 2OJWA 4ICVA 4BKSD 1KLVA 2ACZB 4C4VA 1YNTE 5IN7A 1E8XA 3KYCD 1WXVA 1MG8A 2KMAA 2WXPA 4XYCA 2RMMA 2WYQA 2ZVOA 1GOZA 3NJTA 2KMMA 3Q2AC 1CMXB 4N9F4 4LNOA 3RPFC 3JSVA 1V1PB 1ZXHA 1NENB 1A5RA 3AB5A 4A6QA 2C5LC 4RGNA 2J4XA 2BT6A 1V1PA 3LXFA 4MM3A 1N61A 4AJYB 1DOIA 1L4DB 1FFUA 2JUOA 2KMCA 2A4ZA 4BKGA 4NAMA 4RF1A 2BWES 4KDLB 2LGYA 4W9KA 3IBEA 5DPSA 1V86A 3RUIB 1WGKA 1HTQA 3ZGZA 3I3TB 3WAMA 1YJJA 4FJYA 3IAS1 1C78A 1WM3A 2KN5A 2M56B 2ZCCA 3Q3MC 2PE9A 2Q5WD 1GC7A 3N1XC 2GB1A 2Y5PA 3PZ7A 4DBGA 2IGGA 2MBOA 1V1OA 1T6BX 3B0AA 3TIXA 1YJ1A 2WU2B 1EF5A 1FCLA 3FILA 1AYFA 3PT2B 5H8YE 1M94A 1ZXIA 4GDLA 1F1HA 3NRZA 3H9DA 5D2MB 2MQJA 4IM3A 3H7PA 4TKNA 2ZZPB 3RZFA 4N59A 4IUMB 3DBRI 1I7HA 3MC9A 5EE9A 2MBQA 1AWDA 2KOXA 1TKEA 1J19A 3EFUA 4YSXB 3ABVB 3WA0A 1XLOA 1RM6C 1XT9B 4GLSC 4I6LB 4PYZA 4EEWA 1F2RI 1EO6A 4M0WB 3BK2A 1X1MA 2IO1B 1BXTA 4RH6A 3C19A 2M17A 2GBRA 4ANWA 4KZ0A 3NY5A 2NR2A 3MHZA 3W1SA 5GXGB 2KWCA 1YIWA 3H1UA 1Y56A 1SGHA 3NG0A 2KJHB 2KXJA 5G55A 4TUUA 3ZJVA 4HPPA 4BAXA 5C2TB 3Q8BA 1P1AA 1V9JA 1WR1A 4K7WA 4ANVA 2MLBA 3PREA 2AL3A 3ZIMA 3RYTA 2D11A 3IFWB 4K3BA 1L2NA 1V5TA 3SR6A 4ARIA 5FR3A 2AQ3B 3P63A 2K6DB 2MH7A 3U7ZA 1P7FA 3KQ4A 4MGKE 3L08A 2DYOA 2JRHA 4M01A 4DHJB 1VCBA 2PPHA 3AE8B 1WYWB 2KQ7A 4FHJA 2ZPNA 4C00A 3N32A 4KSLC 2W54A 3OJ3A 1UNSA 1QILA 3VTUA 5L95C 2LUMA 5HKHA 4RM8A 1Q0WB 2WHIA 1P98A 5D6JB 3AULA 4P1BC 4KZCA 1UD7A 1PGBA 2FNJB 3N1ZC 1N5XA 2KKCA 3AV8A 5C1ZA 1QOGA 2IGDA 4JX1C 2J0MA 1L0VB 3LYYA 3MJ5A 3KUDB 2NVUI 3MTNB 3E9SA 3BIID 3LDZE 4GN1A 3NUHB 2O6VD 3PHWB 4A9AA 3ZNGC 4FHKA 2MA9B 4PK1A 3V62A 2IPKD 4M02A 2V3SA 3VTWA 1VZ6A 1UBQA 1UH6A 1ESFA 3AE9B 3W2DA 1T0QC 3U4EG 1CK1A 3DBRB 3S2AA 3WAOA 3SHQA 1FNVA 2MW5A 3FILB 3NVYA 4L2YA 2QHOA 3X0WA 4E3CA 4ZRJA 3B9JA 1EF1A 3V6EB 4H2AA 3HVZA 3IXSA 2AWTA 2ZEQA 3CSFA 1TBEA 4E71A 1C4PA 1BMLC 2QMTA 2WX0A 4DHJD 3ZXVA 2WXHA 4HJKA 3W9CB 3AE6B 1D4BA 3UI3A 4JPSA 2D10A 3HUIA 4DDGD 1WJ4A 5TSSA 5HFYA 1MPEA 1XD3B 4EOYA 1YQBA 2YLMA 3VQIA 2INPE 1KF6B 4W9EA 4BKSA 2J52A 2INNE 5E6PA 1Y8RC 3U2SC 2JU6X 5J2RA 1V97A 2LGSA 2UYZB 3UINB 2R2QA 2K39A 3PRZA 2PIAA 2KANA 2WXMA 4OZAA 1JALA 1C3TA 5BYQA 2C7MB 5BMHA 1L4ZB 3WIMA 1PQSA 2MBBB 2RDGA 4BBNF 1XLNA 1C9FA 1JW9D 1TS3A 2H88B 2CU1A 1Z5SB 2R61A 4A8XC 1IYFA 3VHTC 2D07B 3NZ3A 5BO4B 2ICIA 2NS5A 1VD2A 1E90A 2JWUA 2I1JA 2BQQA 2WWZA 3HM6X 4YSYB 2XN9C 1ZGUB 3QAQA 3CF6E 5IAAC 4ZYNA 3ZKJC 1L0YB 3ZXRA 3P4QB 4HEA1 3ML9A 3PLVA 4GMVA 1SE4A 2SAKA 2KJ6A 1TS5A 2KWDA 2FCSA 2KQSA 2FBWB 4NJ6A 2W82A 4EKUA 3DBLI 1FNUA 1QT9A 1WWTA 1F2RC 2LI5A 4OVVA 1WXMA 1K8RB 1ZPSA 3N3KB 3N30A 1FXTB 1QOAA 1JWMD 2MWSB 4KIKB 4B6WA 1CQVA 4RM9A 4HCNB 4RGTA 3M95A 3AEEB 2FE8A 2BYFA 4A90A 2QDFA 2FIFA 3KYDD 1WIAA 1I4RA 2K0PA 4YTNB 1OTRB 3U7DA 4NQLB 3I5JC 2WXJA 4C80A 4A20A 2OOBB 1F0ZA 5IOIA 4FBJB 2WU5B 4DXAB 4F7ZA 2C60A 4JIOU 3DVNV 5FK9C 2D2QA 1E8WA 4HRSA 1TZOA 1EWCA 4KX6B 4DXFA 1YQ3B 4YTPB 3ZUNA 3AN1A 2J7QB 4LNKA 2N0SB 4L23A 1WGHA 2JVCA 3VRAB 2KK8A 4KKIA 3DQVA 1IBXB 2KD0A 2JX5A 4CYEA 1WF9A 3VAWA 3ZLZA 4NPNA 1HEZE 4A3PA 1JWAD 2X38A 4HKZE 3ZW3A 3QX1A 4W9CA 4K1RB 2DYMA 4N58A 1Z2MA 3O13A 2RD0A 4GXBA 2CU3A 3A4SC 4MH0E 3KH0A 1KFYB 3AI5A 2WXOA 5LLIA 5J18A 1DGJA 3EHVA 3PZDA 1SIJA 3V3XA 4OZCA 4GDLB 1C79A 1MHXA 2BW2A 2IJ0A 4WQMA 1FRRA 2BWFA 2IYDB 2PVGC 5FR6A 2EMSA 2J0JA 1FXAA 2INCC 1XXGA 1C1YB 5KHOA 4AS1A 2YVCA 1KJTA 2V3NA 4S0RA 1MVKA 4G11A 2FAZA 4ITKA 1KOTA 5AEKB 1IPGA 3UQAA 1V80A 4M0WA 3TJPA 4AQ7A 3ZJTA 1KH0A 2J0KA 1WSPA 1VR9A 4C7YA 2L3ZA 1WJ6A 3MC8A 3PO0A 2JRIB 3NS8A 3KWVA 1TY0A 3X23A 2DHZA 3ZJUA 2MBEA 1E6EB 1E5WA 1SBBB 4HDQA 4W9GA 5BYSA 4XWWA 5AZGA 1FO4A 3IT4B 2HDEA 4OW0A 2LJIA 2D3CA 5BMGA 4ARCA
chains in the Genus database with same CATH topology
2NPTB 2KFKA 4IUMB 4DWFA 3DBRI 4M8MA 1RLFA 5JH5C 4NY0A 2MBQA 2KOXA 4GIVA 1J19A 2IY0B 2KVRA 5DPWA 1WXSA 3EFUA 3C0RB 4ZDVA 4AUQC 4DK5A 4AWJA 2NCNA 4PYZA 1R4NI 1XT9B 2KDBA 4I6LB 4NJ7A 4G3XB 3WA0A 4EEWA 1EUVB 4FJVB 4XZ4A 2KZRA 2V4LA 2ZNVB 3HHMA 1EO6A 4M0WB 5DCNA 2W9NA 1RFAA 1X1MA 2IO1B 2IO3B 4KVGB 4MELA 2VRRB 2M17A 2GBRA 1WJNA 4ANWA 3VUXA 4KZ0A 2JZZA 2MSED 3NY5A 2CHWA 2FIDA 1R4MI 2NR2A 4MEMA 1WGDA 4RMAA 3K9OB 1NDDA 4MGYE 3W1SA 3AU5A 1GG3A 3DVNU 4BOZB 2KWCA 1YIWA 1Q5WB 3H1UA 3UF8A 1H4RA 1SGHA 3WALA 4AJWA 1SE9A 2KJHB 2KXJA 2K8BA 1WGGA 4TUUA 2C9WB 3DPDA 4WAAA 5G55A 3RT3B 2L00B 1NI2A 2GBJA 1E8ZA 2O2VB 2LUEA 4GB9A 1V6EA 1OEYA 2KWUB 4MGIE 1P1AA 2HJ8A 1V9JA 4K7SA 1Q1OA 1WR1A 3A9KA 4K7WA 4ANVA 2MLBA 1LFDA 3PREA 2K1FA 2EKEC 2AL3A 3ZIMA 4ZRIA 1WRDB 3QARA 3RYTA 2D11A 2DAJA 3IFWB 4MDKE 3ZNZB 3QC8B 1L2NA 1V5TA 1D3ZA 1UGMA 5TR5A 1WZ3A 2BYVE 3A33B 3QIJA 3NZUA 3W1YA 2K6DB 4F1SA 3PS6A 4MGKE 3L08A 2DYOA 2JRHA 4DHJB 1VCBA 2PPHA 4A3OA 1WYWB 2FUHB 3KUCB 4F8CB 2KQ7A 4FHJA 1WY8A 2ZPNA 1WH3A 1P3QU 2IO0B 2RGFA 3CSTA 2HD5B 1V81A 1S1QB 2DX5B 3JSVB 3N32A 1TGZB 2BF8B 2C7HA 4KSLC 4XC2A 2IBIB 3OJ3A 4EZKA 3ZNID 3KW5B 3QQ8B 4EZJA 3VTUA 1ISNA 3UGBB 5L95C 3QCAA 3ALBA 4I6PA 5HKHA 4RM8A 1UZXB 3RZFA 1Q0WB 2BKFA 2G4SA 1P98A 5D6JB 3AULA 3L54A 4BKTA 4KZCA 3SD5A 3R66C 1UD7A 2NBWB 2MBHA 3PSEB 2FNJB 3IHPC 4BOSC 3TBLD 2GMIC 3VUWA 2K8CA 2KKCA 3CMMB 3L17A 3VH4B 5C1ZA 1NBFC 2O2VA 4HXDA 2DAFA 4IW0A 3NHEB 2LXAA 2MRPA 2DYBA 3NOBA 4PS3A 3ONSA 2MP2B 4MSQB 2J0MA 3DBSA 5CHFA 4HK2A 3KUDB 2NVUI 1TTNA 3MTNB 3KVFB 4EFOA 2DZIA 3LDZE 1V49A 2C7NB 5LXHA 3VUYA 3DBHI 4GN1A 2O6VD 3PHWB 1E8YA 4GU2A 3RCZA 3RD2A 4B95A 2RSUA 4G50A 2JWZA 3ZNGC 4FHKA 1U4AA 3A1QA 5IA7A 2LASA 4G0NB 1WGYA 2I1KA 2K8HA 2MA9B 3V62A 2GBNA 1YD8U 1YX5B 2NPTA 2PEAA 2V3SA 2ZVNA 3LJ3A 3VTWA 3ZRCA 1I35A 1ZW7A 4HWIB 1UBQA 2GBMA 1UH6A 2L0TA 3VVWB 4HDOA 3UIPB 4XX5A 3VH3B 3S2AA 2JT4B 3WAOA 3SHQA 5JHBA 3D32A 4II3B 4LCDE 2MW5A 4NAWB 2ZPYA 4WWOA 2K6QA 3AXCA 2QHOA 1H8CA 2LD9A 1UBIA 3MJWA 3X0WA 1P0RA 4E3CA 3A4RA 2LRUA 2L05A 4ZRJA 1EF1A 1WE7A 3V6EB 2JPHA 4WWPA 2KLGA 2KLCA 3H6NA 1LXDA 4TV3A 2ZCBA 3QWZB 5CTRC 2AWTA 2ZEQA 3CSFA 3JYUA 3M3JA 5GMVA 1TBEA 4EZLA 3JW0X 2N1VA 4KIKA 4E71A 4JQWC 1WM2A 4JGHB 3V6CB 1F9JA 4IG7B 2WX0A 3IVFA 5JZEB 4URKA 1RRBA 4DHJD 4DDID 3A9KB 4HJKA 2CR5A 4GOCA 2BPSA 3GOEA 3ZDMC 2D10A 5D94A 2D3GA 2G3QB 4DDGD 1WJ4A 3SU8X 3PHXB 5EDSA 2M8SA 3L13A 4FULA 1XD3B 4HCPB 4EOYA 4W9LA 1YQBA 3ZNHB 2NBUA 2YLMA 4NQKE 3T9LA 3UIOB 3VQIA 4IWPA 4K81A 4EUTA 4MSMB 1G6JA 5E6NA 2L8JA 4W9EA 3ZTDA 1TZ1A 2XEWA 4PS8A 2LVQA 2JY6A 4BKSA 4AOFA 1J0GA 1WMHA 1LQBA 5E6PA 1Y8RC 5J2RA 5G2NA 2L76A 1S3SG 2KDIA 3VXWA 2UYZB 3UINB 4JL9A 2R2QA 3T8MA 2K39A 3PRZA 2KWVB 2HTHA 1KM7A 2O6VA 2KANA 3ZDTA 1WX8A 2KC1A 2KO3A 2CKHB 4IWOA 2G45B 3APDA 3NZSA 1E7UA 5AZFA 1C3TA 4WQOB 4KV2A 3PPAA 3WANA 4NNJB 5E6OA 3TL5A 2C7MB 2N9EB 4GDKB 2BKRB 4FADA 4MJSA 3WIMA 5KHQA 3RZWC 2MBBB 1PQSA 3APCA 4W9DA 4BBNF 2KFJA 2DZJA 2ZJDA 4HPMB 2KFKB 3OJ4B 3EECA 2HE7A 3P2BA 4IM2A 4TQ1A 2AEHA 3L10B 3U30A 3GZNI 4BVUC 2Y5BB 3H7SA 2CU1A 1Z5SB 3PRMB 4MJSB 2L0FA 3VHTC 1OGWA 2Z0EB 1IYFA 2D07B 2PE6B 2N7DA 4ANXA 5DPTA 2N9PC 5BO4B 3K9PB 2NS5A 1VD2A 2N1WA 4WJQA 1E90A 3Q3FA 2I1JA 4K7UA 2WWZA 3HM6X 3TMPB 2M0XA 1GJZA 2KTRB 4AP4C 5C23A 2A5UA 1ZGUB 3QHTA 3QAQA 4FLHA 2MCNB 3V61A 3CF6E 3HM3A 3L16A 5IAAC 4ZYNA 3ZKJC 4FJZA 3ML9A 2XBBC 3PLVA 4GMVA 2M4NA 3IG3A 1AARA 1GUAB 2KJ6A 3ENEA 2JF5A 2FCSA 2N9XA 2KQSA 4NJ6A 4EKUA 2REXA 4PS7A 3R7QA 3OAWA 4CO7A 2AYOB 3DBLI 1ZKHA 5CHVC 4WJPA 2BGFA 2LI5A 2GOWA 3PLUA 4MGZE 3BINA 3R3MA 1YX6B 4II2B 3OLMD 4JLCA 1OQYA 4LDTD 5AZHA 3ZO5B 2IO2B 4OVVA 1WXMA 2EMTA 1K8RB 3N3KB 4GGQA 3N30A 1FXTB 4W9JA 3R7RA 1QZEA 3B08A 2KX3A 2MWSB 5DPRA 4KIKB 4B6WA 4YL8A 3QJZA 2NBVB 4RM9A 4X57B 5J17A 3ECIA 2DZKA 4HCNB 1WXAA 3H7PB 3M95A 2CHXA 4ZRKA 1WZ0A 4WWNA 2BYFA 2UWQA 4GSWA 2DZMA 4CHKA 2FIFA 3KYDD 4NAWA 5L83A 4LJPB 2XK5B 2L7RA 1WIAA 1WJUA 1V5OA 2G4DB 3DOWA 3DCGA 2AL6A 3DVGX 1OTRB 4ANUA 4M8NA 2LVPA 3BY4B 3ZRFA 3U7DA 5CX3A 2N7EA 2WX1A 4NQLB 1BT0A 2R2OA 4IM0A 2JZ3B 4FN2A 4HVBA 2LVOA 4A20A 1WX7A 2LGXA 2XK5A 1OEYJ 2OOBB 2JXXA 4IC7B 3A9JB 3HK0A 2CHZA 1J8CA 4FBJB 2WDTB 2KJRA 2KC2A 3V60A 4DXAB 4F7ZA 2C60A 4JIOU 3DVNV 2D2QA 2O6VB 1E8WA 1WX9A 3JVZX 2CS4A 2GBKA 1P9DU 2KX0A 5D7GA 2MX2A 3VDZA 3VFKA 2Z59B 4KSKC 3ML8A 2ZNVC 1GNUA 2LZ6A 3AU4A 5CHWA 4WJOA 4PYUA 3ZUNA 4ICVA 4BKSD 2J7QB 1KLVA 2LRWA 3M62B 1WGHA 5LXIB 1E8XA 2JVCA 3KYCD 2KK8A 1WXVA 3DQVA 3W1SC 1XQQA 1WGRA 2KD0A 3EC8A 1MG8A 2KMAA 4CYEA 3VTVA 1T0YA 3PRPB 1WF9A 3VAWA 3ZLZA 2WYQA 2ZVOA 2ASQA 3APFA 4NPNA 4A3PA 4HLEA 4W9IA 3ZW3A 3QX1A 4W9CA 4K1RB 2DYMA 2KNBA 1CMXB 1WR6E 4ICUA 4N9F4 1Z2MA 2RD0A 2Z0DB 3JSVA 4B9KA 3PVLA 4GXBA 3QA8A 1A5RA 4ASWC 3SDLC 3A4SC 3UQBA 4DHZB 1WI0A 1RAXA 2OJRA 4MH0E 3KH0A 2C5LC 1WMHB 5JHAA 3ZTCA 3AI5A 5LLIA 5J18A 2V1YA 3EHVA 4GDKA 3ZVVA 4MM3A 1SIFA 3PZDA 1E7VA 4AJYB 3RULA 1JRUA 1GC6A 2JUOA 2A4ZA 2KMCA 3HIZA 4GDLB 4BKGA 3U8ZA 3Q3JA 2KDFB 4P7IA 2BWES 4KDLB 2BWFA 2IYDB 4WJNA 5FR6A 2EMSA 2FCMA 2J0JA 3A1QB 2LGYA 2RPQA 3IBEA 3M63B 4W9KA 5DPSA 1C1YB 1V86A 4W9HA 3RUIB 5KHOA 2KTFA 2YVCA 1KJTA 3I3TB 4HPLB 2N4FA 3WAMA 2IZVB 4IWQA 2DENB 4FJYA 4BFRA 2MP2A 1WM3A 2KN5A 2KTRA 4G11A 2FAZA 2KDEB 1I42A 1KOTA 1V2YA 2FCQA 2ZCCA 2LGDA 4KDIC 4DHZE 5AEKB 2PE9A 1IP9A 2PJHA 1GC7A 1IPGA 3UQAA 3PTFC 1V80A 2LJ5A 1UELA 4DBGA 4OVUA 1LM8B 2MBOA 3KUZA 4BBNC 3TJPA 3B0AA 3TIXA 1HE8A 3DDCB 4W9FA 2J0KA 1WFYA 3L0WB 4I6NB 1YJ1A 4J6IA 1EF5A 2L3ZA 1WJ6A 2LXCA 2JRIB 3MHSD 3NS8A 2IY1B 2KHWB 4TQ0A 3PV1A 3WAPA 2DHZA 3X23A 3B1LX 1WE6A 3PT2B 3A9JA 1M94A 2MBEA 4LJOB 1E5WA 3DVGY 4GDLA 2RR9A 4HDQA 4W9GA 2FCNA 2K25A 2B3AA 5AZGA 1L7YA 3H9DA 5D2MB 2M1MA 2BYEA 2MQJA 4IM3A 4FA6A 3H7PA 4E74A 4TKNA 2LWPA 3TCAA 2ZZPB 3O65B 4LDTB 3PGEA 3QK0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2NPT B;  2KFK A;  4IUM B;  4DWF A;  3DBR I;  4M8M A;  1RLF A;  5JH5 C;  4NY0 A;  2MBQ A;  2KOX A;  4GIV A;  1J19 A;  2IY0 B;  2KVR A;  5DPW A;  1WXS A;  3EFU A;  3C0R B;  4ZDV A;  4AUQ C;  4DK5 A;  4AWJ A;  2NCN A;  4PYZ A;  1R4N I;  1XT9 B;  2KDB A;  4I6L B;  4NJ7 A;  4G3X B;  3WA0 A;  4EEW A;  1EUV B;  4FJV B;  4XZ4 A;  2KZR A;  2V4L A;  2ZNV B;  3HHM A;  1EO6 A;  4M0W B;  5DCN A;  2W9N A;  1RFA A;  1X1M A;  2IO1 B;  2IO3 B;  4KVG B;  4MEL A;  2VRR B;  2M17 A;  2GBR A;  1WJN A;  4ANW A;  3VUX A;  4KZ0 A;  2JZZ A;  2MSE D;  3NY5 A;  2CHW A;  2FID A;  1R4M I;  2NR2 A;  4MEM A;  1WGD A;  4RMA A;  3K9O B;  1NDD A;  4MGY E;  3W1S A;  3AU5 A;  1GG3 A;  3DVN U;  4BOZ B;  2KWC A;  1YIW A;  1Q5W B;  3H1U A;  3UF8 A;  1H4R A;  1SGH A;  3WAL A;  4AJW A;  1SE9 A;  2KJH B;  2KXJ A;  2K8B A;  1WGG A;  4TUU A;  2C9W B;  3DPD A;  4WAA A;  5G55 A;  3RT3 B;  2L00 B;  1NI2 A;  2GBJ A;  1E8Z A;  2O2V B;  2LUE A;  4GB9 A;  1V6E A;  1OEY A;  2KWU B;  4MGI E;  1P1A A;  2HJ8 A;  1V9J A;  4K7S A;  1Q1O A;  1WR1 A;  3A9K A;  4K7W A;  4ANV A;  2MLB A;  1LFD A;  3PRE A;  2K1F A;  2EKE C;  2AL3 A;  3ZIM A;  4ZRI A;  1WRD B;  3QAR A;  3RYT A;  2D11 A;  2DAJ A;  3IFW B;  4MDK E;  3ZNZ B;  3QC8 B;  1L2N A;  1V5T A;  1D3Z A;  1UGM A;  5TR5 A;  1WZ3 A;  2BYV E;  3A33 B;  3QIJ A;  3NZU A;  3W1Y A;  2K6D B;  4F1S A;  3PS6 A;  4MGK E;  3L08 A;  2DYO A;  2JRH A;  4DHJ B;  1VCB A;  2PPH A;  4A3O A;  1WYW B;  2FUH B;  3KUC B;  4F8C B;  2KQ7 A;  4FHJ A;  1WY8 A;  2ZPN A;  1WH3 A;  1P3Q U;  2IO0 B;  2RGF A;  3CST A;  2HD5 B;  1V81 A;  1S1Q B;  2DX5 B;  3JSV B;  3N32 A;  1TGZ B;  2BF8 B;  2C7H A;  4KSL C;  4XC2 A;  2IBI B;  3OJ3 A;  4EZK A;  3ZNI D;  3KW5 B;  3QQ8 B;  4EZJ A;  3VTU A;  1ISN A;  3UGB B;  5L95 C;  3QCA A;  3ALB A;  4I6P A;  5HKH A;  4RM8 A;  1UZX B;  3RZF A;  1Q0W B;  2BKF A;  2G4S A;  1P98 A;  5D6J B;  3AUL A;  3L54 A;  4BKT A;  4KZC A;  3SD5 A;  3R66 C;  1UD7 A;  2NBW B;  2MBH A;  3PSE B;  2FNJ B;  3IHP C;  4BOS C;  3TBL D;  2GMI C;  3VUW A;  2K8C A;  2KKC A;  3CMM B;  3L17 A;  3VH4 B;  5C1Z A;  1NBF C;  2O2V A;  4HXD A;  2DAF A;  4IW0 A;  3NHE B;  2LXA A;  2MRP A;  2DYB A;  3NOB A;  4PS3 A;  3ONS A;  2MP2 B;  4MSQ B;  2J0M A;  3DBS A;  5CHF A;  4HK2 A;  3KUD B;  2NVU I;  1TTN A;  3MTN B;  3KVF B;  4EFO A;  2DZI A;  3LDZ E;  1V49 A;  2C7N B;  5LXH A;  3VUY A;  3DBH I;  4GN1 A;  2O6V D;  3PHW B;  1E8Y A;  4GU2 A;  3RCZ A;  3RD2 A;  4B95 A;  2RSU A;  4G50 A;  2JWZ A;  3ZNG C;  4FHK A;  1U4A A;  3A1Q A;  5IA7 A;  2LAS A;  4G0N B;  1WGY A;  2I1K A;  2K8H A;  2MA9 B;  3V62 A;  2GBN A;  1YD8 U;  1YX5 B;  2NPT A;  2PEA A;  2V3S A;  2ZVN A;  3LJ3 A;  3VTW A;  3ZRC A;  1I35 A;  1ZW7 A;  4HWI B;  1UBQ A;  2GBM A;  1UH6 A;  2L0T A;  3VVW B;  4HDO A;  3UIP B;  4XX5 A;  3VH3 B;  3S2A A;  2JT4 B;  3WAO A;  3SHQ A;  5JHB A;  3D32 A;  4II3 B;  4LCD E;  2MW5 A;  4NAW B;  2ZPY A;  4WWO A;  2K6Q A;  3AXC A;  2QHO A;  1H8C A;  2LD9 A;  1UBI A;  3MJW A;  3X0W A;  1P0R A;  4E3C A;  3A4R A;  2LRU A;  2L05 A;  4ZRJ A;  1EF1 A;  1WE7 A;  3V6E B;  2JPH A;  4WWP A;  2KLG A;  2KLC A;  3H6N A;  1LXD A;  4TV3 A;  2ZCB A;  3QWZ B;  5CTR C;  2AWT A;  2ZEQ A;  3CSF A;  3JYU A;  3M3J A;  5GMV A;  1TBE A;  4EZL A;  3JW0 X;  2N1V A;  4KIK A;  4E71 A;  4JQW C;  1WM2 A;  4JGH B;  3V6C B;  1F9J A;  4IG7 B;  2WX0 A;  3IVF A;  5JZE B;  4URK A;  1RRB A;  4DHJ D;  4DDI D;  3A9K B;  4HJK A;  2CR5 A;  4GOC A;  2BPS A;  3GOE A;  3ZDM C;  2D10 A;  5D94 A;  2D3G A;  2G3Q B;  4DDG D;  1WJ4 A;  3SU8 X;  3PHX B;  5EDS A;  2M8S A;  3L13 A;  4FUL A;  1XD3 B;  4HCP B;  4EOY A;  4W9L A;  1YQB A;  3ZNH B;  2NBU A;  2YLM A;  4NQK E;  3T9L A;  3UIO B;  3VQI A;  4IWP A;  4K81 A;  4EUT A;  4MSM B;  1G6J A;  5E6N A;  2L8J A;  4W9E A;  3ZTD A;  1TZ1 A;  2XEW A;  4PS8 A;  2LVQ A;  2JY6 A;  4BKS A;  4AOF A;  1J0G A;  1WMH A;  1LQB A;  5E6P A;  1Y8R C;  5J2R A;  5G2N A;  2L76 A;  1S3S G;  2KDI A;  3VXW A;  2UYZ B;  3UIN B;  4JL9 A;  2R2Q A;  3T8M A;  2K39 A;  3PRZ A;  2KWV B;  2HTH A;  1KM7 A;  2O6V A;  2KAN A;  3ZDT A;  1WX8 A;  2KC1 A;  2KO3 A;  2CKH B;  4IWO A;  2G45 B;  3APD A;  3NZS A;  1E7U A;  5AZF A;  1C3T A;  4WQO B;  4KV2 A;  3PPA A;  3WAN A;  4NNJ B;  5E6O A;  3TL5 A;  2C7M B;  2N9E B;  4GDK B;  2BKR B;  4FAD A;  4MJS A;  3WIM A;  5KHQ A;  3RZW C;  2MBB B;  1PQS A;  3APC A;  4W9D A;  4BBN F;  2KFJ A;  2DZJ A;  2ZJD A;  4HPM B;  2KFK B;  3OJ4 B;  3EEC A;  2HE7 A;  3P2B A;  4IM2 A;  4TQ1 A;  2AEH A;  3L10 B;  3U30 A;  3GZN I;  4BVU C;  2Y5B B;  3H7S A;  2CU1 A;  1Z5S B;  3PRM B;  4MJS B;  2L0F A;  3VHT C;  1OGW A;  2Z0E B;  1IYF A;  2D07 B;  2PE6 B;  2N7D A;  4ANX A;  5DPT A;  2N9P C;  5BO4 B;  3K9P B;  2NS5 A;  1VD2 A;  2N1W A;  4WJQ A;  1E90 A;  3Q3F A;  2I1J A;  4K7U A;  2WWZ A;  3HM6 X;  3TMP B;  2M0X A;  1GJZ A;  2KTR B;  4AP4 C;  5C23 A;  2A5U A;  1ZGU B;  3QHT A;  3QAQ A;  4FLH A;  2MCN B;  3V61 A;  3CF6 E;  3HM3 A;  3L16 A;  5IAA C;  4ZYN A;  3ZKJ C;  4FJZ A;  3ML9 A;  2XBB C;  3PLV A;  4GMV A;  2M4N A;  3IG3 A;  1AAR A;  1GUA B;  2KJ6 A;  3ENE A;  2JF5 A;  2FCS A;  2N9X A;  2KQS A;  4NJ6 A;  4EKU A;  2REX A;  4PS7 A;  3R7Q A;  3OAW A;  4CO7 A;  2AYO B;  3DBL I;  1ZKH A;  5CHV C;  4WJP A;  2BGF A;  2LI5 A;  2GOW A;  3PLU A;  4MGZ E;  3BIN A;  3R3M A;  1YX6 B;  4II2 B;  3OLM D;  4JLC A;  1OQY A;  4LDT D;  5AZH A;  3ZO5 B;  2IO2 B;  4OVV A;  1WXM A;  2EMT A;  1K8R B;  3N3K B;  4GGQ A;  3N30 A;  1FXT B;  4W9J A;  3R7R A;  1QZE A;  3B08 A;  2KX3 A;  2MWS B;  5DPR A;  4KIK B;  4B6W A;  4YL8 A;  3QJZ A;  2NBV B;  4RM9 A;  4X57 B;  5J17 A;  3ECI A;  2DZK A;  4HCN B;  1WXA A;  3H7P B;  3M95 A;  2CHX A;  4ZRK A;  1WZ0 A;  4WWN A;  2BYF A;  2UWQ A;  4GSW A;  2DZM A;  4CHK A;  2FIF A;  3KYD D;  4NAW A;  5L83 A;  4LJP B;  2XK5 B;  2L7R A;  1WIA A;  1WJU A;  1V5O A;  2G4D B;  3DOW A;  3DCG A;  2AL6 A;  3DVG X;  1OTR B;  4ANU A;  4M8N A;  2LVP A;  3BY4 B;  3ZRF A;  3U7D A;  5CX3 A;  2N7E A;  2WX1 A;  4NQL B;  1BT0 A;  2R2O A;  4IM0 A;  2JZ3 B;  4FN2 A;  4HVB A;  2LVO A;  4A20 A;  1WX7 A;  2LGX A;  2XK5 A;  1OEY J;  2OOB B;  2JXX A;  4IC7 B;  3A9J B;  3HK0 A;  2CHZ A;  1J8C A;  4FBJ B;  2WDT B;  2KJR A;  2KC2 A;  3V60 A;  4DXA B;  4F7Z A;  2C60 A;  4JIO U;  3DVN V;  2D2Q A;  2O6V B;  1E8W A;  1WX9 A;  3JVZ X;  2CS4 A;  2GBK A;  1P9D U;  2KX0 A;  5D7G A;  2MX2 A;  3VDZ A;  3VFK A;  2Z59 B;  4KSK C;  3ML8 A;  2ZNV C;  1GNU A;  2LZ6 A;  3AU4 A;  5CHW A;  4WJO A;  4PYU A;  3ZUN A;  4ICV A;  4BKS D;  2J7Q B;  1KLV A;  2LRW A;  3M62 B;  1WGH A;  5LXI B;  1E8X A;  2JVC A;  3KYC D;  2KK8 A;  1WXV A;  3DQV A;  3W1S C;  1XQQ A;  1WGR A;  2KD0 A;  3EC8 A;  1MG8 A;  2KMA A;  4CYE A;  3VTV A;  1T0Y A;  3PRP B;  1WF9 A;  3VAW A;  3ZLZ A;  2WYQ A;  2ZVO A;  2ASQ A;  3APF A;  4NPN A;  4A3P A;  4HLE A;  4W9I A;  3ZW3 A;  3QX1 A;  4W9C A;  4K1R B;  2DYM A;  2KNB A;  1CMX B;  1WR6 E;  4ICU A;  4N9F 4;  1Z2M A;  2RD0 A;  2Z0D B;  3JSV A;  4B9K A;  3PVL A;  4GXB A;  3QA8 A;  1A5R A;  4ASW C;  3SDL C;  3A4S C;  3UQB A;  4DHZ B;  1WI0 A;  1RAX A;  2OJR A;  4MH0 E;  3KH0 A;  2C5L C;  1WMH B;  5JHA A;  3ZTC A;  3AI5 A;  5LLI A;  5J18 A;  2V1Y A;  3EHV A;  4GDK A;  3ZVV A;  4MM3 A;  1SIF A;  3PZD A;  1E7V A;  4AJY B;  3RUL A;  1JRU A;  1GC6 A;  2JUO A;  2A4Z A;  2KMC A;  3HIZ A;  4GDL B;  4BKG A;  3U8Z A;  3Q3J A;  2KDF B;  4P7I A;  2BWE S;  4KDL B;  2BWF A;  2IYD B;  4WJN A;  5FR6 A;  2EMS A;  2FCM A;  2J0J A;  3A1Q B;  2LGY A;  2RPQ A;  3IBE A;  3M63 B;  4W9K A;  5DPS A;  1C1Y B;  1V86 A;  4W9H A;  3RUI B;  5KHO A;  2KTF A;  2YVC A;  1KJT A;  3I3T B;  4HPL B;  2N4F A;  3WAM A;  2IZV B;  4IWQ A;  2DEN B;  4FJY A;  4BFR A;  2MP2 A;  1WM3 A;  2KN5 A;  2KTR A;  4G11 A;  2FAZ A;  2KDE B;  1I42 A;  1KOT A;  1V2Y A;  2FCQ A;  2ZCC A;  2LGD A;  4KDI C;  4DHZ E;  5AEK B;  2PE9 A;  1IP9 A;  2PJH A;  1GC7 A;  1IPG A;  3UQA A;  3PTF C;  1V80 A;  2LJ5 A;  1UEL A;  4DBG A;  4OVU A;  1LM8 B;  2MBO A;  3KUZ A;  4BBN C;  3TJP A;  3B0A A;  3TIX A;  1HE8 A;  3DDC B;  4W9F A;  2J0K A;  1WFY A;  3L0W B;  4I6N B;  1YJ1 A;  4J6I A;  1EF5 A;  2L3Z A;  1WJ6 A;  2LXC A;  2JRI B;  3MHS D;  3NS8 A;  2IY1 B;  2KHW B;  4TQ0 A;  3PV1 A;  3WAP A;  2DHZ A;  3X23 A;  3B1L X;  1WE6 A;  3PT2 B;  3A9J A;  1M94 A;  2MBE A;  4LJO B;  1E5W A;  3DVG Y;  4GDL A;  2RR9 A;  4HDQ A;  4W9G A;  2FCN A;  2K25 A;  2B3A A;  5AZG A;  1L7Y A;  3H9D A;  5D2M B;  2M1M A;  2BYE A;  2MQJ A;  4IM3 A;  4FA6 A;  3H7P A;  4E74 A;  4TKN A;  2LWP A;  3TCA A;  2ZZP B;  3O65 B;  4LDT B;  3PGE A;  3QK0 A; 
#chains in the Genus database with same CATH topology
 2KFK A;  4DWF A;  1T0R C;  1K51 A;  3AED B;  4P6V F;  1FD6 A;  1MJD A;  1BUI C;  4RFB A;  1YQ4 B;  1WXS A;  4ZDV A;  4AWJ A;  4G3X B;  3CWI A;  2KZR A;  5DCN A;  1JQ4 A;  3DBH B;  2QEJ C;  4MEL A;  3AEA B;  2QC8 A;  5E6J A;  1C4C A;  2JZZ A;  2MSE D;  4RMA A;  4MEM A;  3K9O B;  4MGY E;  4XE0 A;  1EU3 A;  2B76 B;  1GG3 A;  2H89 B;  2BB6 A;  3DVN U;  1Q5W B;  3WAL A;  2K8B A;  1WGG A;  2C9W B;  1NI2 A;  2KWU B;  4PT5 A;  4K7S A;  3A9K A;  2I2Y A;  2K1F A;  1ENF A;  1PGA A;  3GP7 A;  5EE3 A;  5TR5 A;  1WZ3 A;  2OED A;  4IOI E;  4IDI A;  4A3O A;  1V8C A;  1YOV B;  2FUH B;  4F8C B;  2IDY A;  1E10 A;  1WH3 A;  1P3Q U;  2IO0 B;  3R8B A;  1V81 A;  2DX5 B;  4XC2 A;  2IBI B;  3ZNI D;  5FKA C;  3UGB B;  4JWU C;  1UGJ A;  3ETR A;  4I6P A;  2YEP B;  2VZK B;  3R66 C;  4D2K A;  2MBH A;  3PSE B;  1GB1 A;  3IHP C;  1C4A A;  3VUW A;  1FEH A;  1NBF C;  3P4R B;  3AEG B;  3BZD B;  3NHE B;  4NZL B;  2LXA A;  1SSN A;  2DYB A;  3NOB A;  3ONS A;  3Q3O C;  5CHF A;  1IGD A;  2LHD A;  2NTT A;  3I57 A;  1V49 A;  2C7N B;  2WP9 B;  4RGO S;  3LB8 C;  1NEK B;  3EGR A;  4G50 A;  2LMC A;  2V3P A;  1WGY A;  1SJE D;  1YX5 B;  5D3D A;  2PEA A;  4HWI B;  3VVW B;  3NVW A;  3IT6 B;  3NVV A;  3VH3 B;  4MH8 A;  1A70 A;  3OWE B;  1AN8 A;  4NAW B;  3RNF C;  4WWO A;  4NJC A;  1H8C A;  3A4R A;  2LRU A;  2L05 A;  2FUG 1;  1WE7 A;  3AEF B;  2KLG A;  2PW9 A;  3JYU A;  2MJE A;  5GMV A;  5G5G A;  4EZL A;  4KIK A;  2DLB A;  5JZE B;  4IG7 B;  3IVF A;  4URK A;  1RRB A;  1T5X D;  2J42 A;  2CR5 A;  2BPS A;  3GOE A;  2WXR A;  3RN9 C;  2K5P A;  2G3Q B;  5MPO A;  4R3D A;  3SU8 X;  3DWM A;  3PHX B;  1AW7 A;  3GE3 C;  3RI7 C;  4HRO A;  3UIO B;  2X8X X;  1QKZ A;  1TZ1 A;  2XEW A;  1TIF A;  4PS8 A;  2LVQ A;  4TMA B;  2AQ1 B;  1J0G A;  2JSV X;  2JQR B;  1C77 A;  5G2N A;  2PMV A;  2KDI A;  3VXW A;  4JL9 A;  4K3C A;  2O6V A;  2KO3 A;  4IWO A;  3V05 A;  2G45 B;  3NZS A;  3PPA A;  3WAN A;  3VRB B;  3TL5 A;  3RNE C;  5KHQ A;  1NVI D;  1GB4 A;  1R7S A;  1E9M A;  4HPM B;  5C3J B;  2BS4 B;  2KFK B;  3OJ4 B;  3EEC A;  2HE7 A;  4IM2 A;  1J7B A;  3L10 B;  4OVZ A;  1MFW A;  3PRM B;  2W3R A;  2WXQ A;  2N9P C;  2KAC A;  1WYG A;  2N1W A;  3Q3F A;  1ZOY B;  2M0X A;  3DWG C;  2KTR B;  4WIP A;  2A5U A;  3QHT A;  2MCN B;  1UWM A;  3R2I A;  1XLQ A;  3RNC C;  3BVG A;  2XBB C;  3HRD D;  1GUA B;  2N9X A;  3Q8E A;  1FFV A;  2QCZ A;  5CHV C;  3NS1 A;  4MGZ E;  3BIN A;  4JLC A;  1OQY A;  5AZH A;  5HG2 A;  4US8 A;  1K50 A;  1ZE3 D;  4KKJ A;  2V9H A;  3EFC A;  4YL8 A;  3QJZ A;  4X57 B;  5J17 A;  1SXT A;  3L4P A;  4LNF A;  2CHX A;  1WZ0 A;  2UWQ A;  4RCO A;  4NAW A;  1JCK B;  3DOW A;  2G4D B;  3DCG A;  3BVM A;  3N9Y C;  4ANU A;  2N7E A;  2R2O A;  1FXI A;  1WX7 A;  1OEY J;  3HK0 A;  2WDT B;  3BK1 A;  2KJR A;  3V60 A;  1T3Q A;  1WX9 A;  3VFK A;  2MX2 A;  5H92 C;  3ML8 A;  3AU4 A;  1R4M B;  2JXT A;  3J9C A;  5CHW A;  4WJO A;  2KDM A;  3SFD B;  1ZP0 B;  2WNM A;  3W1S C;  3VTV A;  1T0Y A;  3PRP B;  2OHF A;  3APF A;  2ASQ A;  2ZW1 A;  2N9K A;  4HLE A;  1CZP A;  3GZN B;  5LNK 1;  1WR6 E;  4ICU A;  1L0X B;  3TEY A;  5IKC M;  4B9K A;  3PVL A;  3WCQ A;  2SEB D;  3Q69 A;  4ASW C;  1YMH E;  4DHZ B;  2VH1 A;  1I4H A;  1ACC A;  1RAX A;  4ZOH C;  2OJR A;  5HHD G;  1I4G A;  1E7P B;  5JHA A;  3ZTC A;  3ZQ4 A;  1J7A A;  1N62 A;  2V1Y A;  1E7V A;  1GC6 A;  3HIZ A;  3Q3J A;  2KDF B;  1FM0 D;  4P7I A;  1PUT A;  4WJN A;  2RPQ A;  3GB1 A;  4W9H A;  3FAH A;  2EKI A;  4A55 A;  4M00 A;  4ZHP A;  1JWS D;  2BB5 A;  3Q6B A;  2DEN B;  4BFR A;  2MP2 A;  2KTR A;  1I42 A;  4MAC A;  2LGD A;  1KTK A;  1IP9 A;  2PJH A;  3P4P B;  1TKG A;  1LM8 B;  4OVU A;  4KGT A;  3KUZ A;  4BBN C;  2E6X A;  3L0W B;  2JZP A;  4J6I A;  2KYW A;  2LXC A;  4TQ0 A;  3PV1 A;  3WAP A;  2DNF A;  3A9J A;  4LJO B;  1IGC A;  3DVG Y;  2RR9 A;  2FCN A;  5G5H A;  2QIL A;  2LGI A;  2M1M A;  2BYE A;  4FA6 A;  4E74 A;  1ZUD 2;  3TCA A;  3O65 B;  1JRP A;  3URY A;  3QK0 A;  1TYG B;  2ON8 A;  1IBX A;  4GIV A;  2IY0 B;  5DPW A;  3C0R B;  4DK5 A;  4LTU A;  1R4N I;  4NJ7 A;  5IP4 D;  2PTL A;  1FCC C;  1HA5 A;  1EUV B;  2L1A A;  4XZ4 A;  2ZNV B;  2IO3 B;  1HZ6 A;  1HTO A;  1SE2 A;  2EEL A;  1WJN A;  3VUX A;  1R4M I;  3AE1 B;  1WGD A;  1NDD A;  2L52 A;  3AU5 A;  4BOZ B;  3UF8 A;  1H4R A;  2V0G A;  1K52 A;  4AJW A;  5BYR A;  2CJO A;  5IO9 A;  2KVZ A;  3Q8F A;  2LUE A;  1V6E A;  3AE2 B;  1OEY A;  1FPY A;  1Q1O A;  2GLS A;  1LFD A;  4IKG A;  2J53 A;  1XF5 L;  2NTS A;  3EUB 2;  4ZRI A;  1WRD B;  3QAR A;  2DAJ A;  2K9X A;  5EE0 A;  3QC8 B;  4YT0 B;  1D3Z A;  1UGM A;  2BYV E;  3QIJ A;  3W1Y A;  4QAY A;  2ZW0 A;  4F1S A;  4REZ A;  1STE A;  1VDV A;  4UDU C;  3CST A;  3JSV B;  5I4D A;  2C7H A;  1GPX A;  4EZK A;  3QQ8 B;  1ET9 A;  1ISN A;  3ALB A;  1UZX B;  2G4S A;  3AEC B;  3SD5 A;  2JYT A;  3TBL D;  2GMI C;  3L17 A;  3VH4 B;  1KLU D;  2O2V A;  2WS3 B;  3B2G A;  4HXD A;  2DAF A;  3I63 C;  2AX5 A;  4JE3 B;  4MSQ B;  2MP2 B;  4LNI A;  4WUR A;  3KVF B;  2DZI A;  5LXH A;  4LLG M;  1E8Y A;  4ZRQ A;  1SJH D;  4G0N B;  2I1K A;  2WXG A;  3AEB B;  1YD8 U;  2NPT A;  3ZRC A;  3LJ3 A;  2MJD A;  1I35 A;  1ZW7 A;  2JYE A;  2CJN A;  4XX5 A;  3W5V B;  2W3S A;  3TEZ A;  5JHB A;  3D32 A;  4II3 B;  2QIE B;  2ZPY A;  2K6Q A;  3AXC A;  3AE4 B;  1P0R A;  1PDX A;  2JPH A;  4WWP A;  3MP9 A;  1JWB D;  3H6N A;  2ZCB A;  2HTM E;  1N6Z A;  2N1V A;  4JQW C;  1WM2 A;  1FNW A;  1F9J A;  4DDI D;  1TKY A;  3A9K B;  4GOC A;  3ZDM C;  2D3G A;  5EDS A;  2M8S A;  3L13 A;  1UWX A;  4HCP B;  4W9L A;  3ZNH B;  4NQK E;  1RWS A;  4IWP A;  3W5U B;  4K81 A;  4MSM B;  1G6J A;  5E6N A;  2WXF A;  3P1M A;  1D6E C;  3ZTD A;  1SE3 A;  2JY6 A;  1WMH A;  1LQB A;  4MT5 A;  2K22 A;  2L76 A;  1I4Q A;  2KT7 A;  2MJ3 A;  1OQR A;  1PGX A;  2KWV B;  5EE1 A;  3E56 A;  1XCQ L;  1WX8 A;  1XEE A;  5AUI A;  1VZ8 A;  1GAQ B;  1I4X A;  1M4V A;  1E7U A;  4KGS A;  5AZF A;  4NNJ B;  5E6O A;  4GDK B;  4FAD A;  3RZW C;  3EA6 A;  2DZJ A;  2XNA C;  1T0S C;  1TS2 A;  2WXL A;  3GZN I;  2L83 A;  1MG4 A;  2Z0E B;  1Q10 A;  2N7D A;  5DPT A;  1OFF A;  1TT5 B;  2D5G A;  2BS3 B;  4WAF A;  2KN4 A;  3SFE B;  4AP4 C;  5C23 A;  4FLH A;  1NI3 A;  3V61 A;  3HM3 A;  3L16 A;  1N5W A;  4FJZ A;  4YSZ B;  4DQO C;  1AAR A;  2IND C;  3RFZ B;  4RGM A;  2JF5 A;  4DXG A;  4PS7 A;  4CO7 A;  3OAW A;  4N6E B;  3NVZ A;  3Q3N C;  3PLU A;  2GOW A;  1N60 A;  4LDT D;  3R3M A;  3OLM D;  2WXK A;  1MI0 A;  2IO2 B;  5D3I B;  3SEB A;  2EMT A;  4GGQ A;  3RNG C;  4W9J A;  2KX3 A;  1HXY D;  3N20 C;  3GE8 C;  1ZDV A;  1YN4 A;  3ZYY X;  1SF0 A;  1WRI A;  2DZM A;  2WXI A;  4CHK A;  1NYQ A;  2XK5 B;  2L7R A;  1WJU A;  2AL6 A;  3DVG X;  1E0Z A;  3ZRF A;  5CX3 A;  2WX1 A;  2JZ3 B;  3CIR B;  2XK5 A;  2JXX A;  2E3T A;  3A9J B;  2CHZ A;  1J8C A;  1YJI A;  2GI9 A;  4YXD B;  1B1Z A;  2LHE A;  2O6V B;  3JVZ X;  1P9D U;  2Z59 B;  1FRD A;  4C56 C;  1TS4 A;  1WXQ A;  2N7J A;  3I9V 1;  1GNU A;  2LZ6 A;  1XCT L;  4HJG E;  2L32 A;  1RYJ A;  1VRA B;  2LRW A;  5JXV A;  1QF6 A;  3M62 B;  5LXI B;  2BVC A;  4ACF A;  1XQQ A;  1WGR A;  3EC8 A;  3BYY B;  3VR9 B;  1JML A;  1C76 A;  1B9R A;  3AE7 B;  4W9I A;  3RNB C;  4ZHO A;  3TUO A;  2KNB A;  4WH4 A;  2Z0D B;  4C7Z A;  4EE2 A;  3QA8 A;  3C8Y A;  3SDL C;  3UQB A;  1WI0 A;  4ZRP A;  1WMH B;  4GDK A;  3ZVV A;  1SIF A;  3MC0 B;  1TY2 A;  3RUL A;  3VR8 B;  1JRU A;  3H8H A;  3U8Z A;  4P16 A;  2FCM A;  3A1Q B;  3M63 B;  5T8I A;  3GS2 A;  5AUK A;  4C4V B;  2KTF A;  4HPL B;  2N4F A;  2IZV B;  1XLP A;  4IWQ A;  2KDE B;  1V2Y A;  2V4I B;  1F52 A;  2FCQ A;  3PZ8 A;  1XO3 A;  4KDI C;  4DHZ E;  3DHG C;  1KLG D;  3PTF C;  2LJ5 A;  1L6V A;  1UEL A;  1CJE A;  3BVZ A;  1HE8 A;  3DDC B;  4W9F A;  1WFY A;  4I6N B;  1MHH E;  3DBL B;  4BZA A;  2HJ1 A;  2N9L A;  3MHS D;  2IY1 B;  2KHW B;  3B1L X;  1WE6 A;  3Q8C A;  4O1N A;  3AM9 A;  4LK0 M;  1ET6 A;  2K25 A;  2B3A A;  3R2T A;  2M19 A;  1L6U A;  1L7Y A;  2LFI A;  2VH2 A;  4JWS C;  4USA A;  4YTM B;  3Q8A A;  4US9 A;  2LWP A;  3HVD A;  4LDT B;  3PGE A;  1R4N B;  2BYT A;  3T3N A;  2NPT B;  4M8M A;  1RLF A;  5JH5 C;  2MEK A;  4NY0 A;  2G1E A;  2KVR A;  3OG5 A;  2I38 A;  4AUQ C;  2WQY B;  2NCN A;  2KDB A;  1EWY C;  4FJV B;  2V4L A;  3HHM A;  2WDR B;  2W9N A;  1RFA A;  4KVG B;  2WDV B;  2RPV A;  3B2F A;  2VRR B;  4OHJ A;  2CHW A;  2FID A;  2M0A A;  2Y3A A;  3MFG A;  2ONQ A;  2BTE A;  1SE9 A;  3KWL A;  4WAA A;  3DPD A;  3RT3 B;  2L00 B;  4CQN A;  2UU7 A;  2GBJ A;  1E8Z A;  3DHH C;  2O2V B;  1DYQ A;  4GB9 A;  3AH7 A;  2Y5C A;  4MGI E;  2HJ8 A;  2EKE C;  2NMQ A;  4MDK E;  3ZNZ B;  2IGH A;  3A33 B;  3NZU A;  3DHI C;  4XDC A;  3PS6 A;  3KUC B;  1WY8 A;  2RGF A;  2HD5 B;  1S1Q B;  1TGZ B;  2BF8 B;  2YEP F;  1LGR A;  1D5X C;  4YWG G;  3KW5 B;  4EZJ A;  1LO5 D;  3QCA A;  4S17 A;  2BKF A;  3L54 A;  4BKT A;  3BWU D;  2NBW B;  4BOS C;  1DOX A;  2K8C A;  3CMM B;  4B0M A;  4IW0 A;  1P7E A;  2MRP A;  4PS3 A;  3DBS A;  4HK2 A;  3FC4 A;  1OQQ A;  1TTN A;  4EFO A;  1I4P A;  1JWU D;  2QSD A;  3VUY A;  3DBH I;  1QLB B;  4GU2 A;  3RCZ A;  3RD2 A;  4B95 A;  2RSU A;  1EM7 A;  2JWZ A;  1U4A A;  3A1Q A;  5IA7 A;  1UUP A;  2LAS A;  2K8H A;  4XGA B;  2GBN A;  2ZVN A;  2MHJ A;  2W55 A;  2GBM A;  2L0T A;  4HDO A;  3UIP B;  2JT4 B;  3P42 A;  4LCD E;  1PYW D;  1RFK A;  2WDQ B;  2LD9 A;  1UBI A;  3MJW A;  4MM3 B;  2KLC A;  2KAJ A;  1LXD A;  4TV3 A;  1NYR A;  3QWZ B;  5CTR C;  3M3J A;  4B0E A;  3JW0 X;  4JGH B;  3N1Y C;  3V6C B;  2PVO D;  2LEK A;  3TEW A;  5D94 A;  2GRI A;  4FUL A;  4WWM A;  1DOY A;  2NBU A;  3T9L A;  2D3A A;  2D3B A;  4EUT A;  4TSS A;  2L8J A;  1VZ7 A;  1ROE A;  4AOF A;  3AE3 B;  4J3O D;  3T3O A;  1HZ5 A;  1S3S G;  2RDB C;  1J7C A;  4LNN A;  1EU4 A;  2Z8L A;  3T8M A;  3BYT B;  4RNA A;  2HTH A;  1KM7 A;  1VJK A;  2WLB A;  3ZDT A;  2KC1 A;  3TEX A;  2CKH B;  3APD A;  4HKQ A;  3TSS A;  4L1B A;  4WQO B;  4KV2 A;  3AE5 B;  1FIQ A;  2N9E B;  1QOB A;  2BKR B;  4MJS A;  1SB3 C;  3APC A;  4W9D A;  2KFJ A;  2ZJD A;  2DBY A;  4ZYS A;  3P2B A;  4TQ1 A;  2AEH A;  3U30 A;  4BVU C;  2Y5B B;  3FKY A;  3H7S A;  2QJL A;  4MJS B;  2L0F A;  1OGW A;  2PE6 B;  4ANX A;  3K9P B;  3RMK C;  1TJE A;  4WJQ A;  3TMP B;  4K7U A;  1PFD A;  1GJZ A;  1UF0 A;  1IUE A;  1KRH A;  1YN3 A;  3KLS X;  1FMA D;  1L5P A;  2M4N A;  3IG3 A;  2TSS A;  1HQR D;  3ENE A;  2WGS A;  1QOF A;  1N63 A;  3AMZ A;  4RF0 A;  3U52 E;  1QQR A;  2REX A;  3R7Q A;  4OZB A;  2AYO B;  1YN5 A;  1ZKH A;  3IAM 1;  1D5M C;  2PKO A;  4FXC A;  4WJP A;  1D5Z C;  2DWQ A;  2PLP A;  2BGF A;  2VZK D;  4II2 B;  1YX6 B;  2BS2 B;  2AQ2 B;  3ZO5 B;  1K53 A;  1VLB A;  3R7R A;  1QZE A;  3B08 A;  5DPR A;  2NBV B;  2KQ4 X;  4XWT A;  2BBC A;  4KGR A;  3ECI A;  2DZK A;  4XDD A;  1WXA A;  3H7P B;  4ZRK A;  4WWN A;  4GSW A;  5L83 A;  4LJP B;  3Q14 C;  1V5O A;  5HI1 A;  4M8N A;  2LVP A;  3BY4 B;  1BT0 A;  4IM0 A;  4FN2 A;  4HVB A;  2LVO A;  2LGX A;  3P4S B;  4IC7 B;  5BMI A;  2KC2 A;  4P1C C;  2WXN A;  1SEB D;  1F77 A;  2CS4 A;  2GBK A;  2KX0 A;  5D7G A;  3VDZ A;  1ZDX A;  4KSK C;  1JRO A;  2G9H D;  4Q2J A;  2ZNV C;  2K3U A;  2RDH A;  3RNA C;  4PYU A;  2OJW A;  4ICV A;  4BKS D;  1KLV A;  2ACZ B;  4C4V A;  1YNT E;  5IN7 A;  1E8X A;  3KYC D;  1WXV A;  1MG8 A;  2KMA A;  2WXP A;  4XYC A;  2RMM A;  2WYQ A;  2ZVO A;  1GOZ A;  3NJT A;  2KMM A;  3Q2A C;  1CMX B;  4N9F 4;  4LNO A;  3RPF C;  3JSV A;  1V1P B;  1ZXH A;  1NEN B;  1A5R A;  3AB5 A;  4A6Q A;  2C5L C;  4RGN A;  2J4X A;  2BT6 A;  1V1P A;  3LXF A;  4MM3 A;  1N61 A;  4AJY B;  1DOI A;  1L4D B;  1FFU A;  2JUO A;  2KMC A;  2A4Z A;  4BKG A;  4NAM A;  4RF1 A;  2BWE S;  4KDL B;  2LGY A;  4W9K A;  3IBE A;  5DPS A;  1V86 A;  3RUI B;  1WGK A;  1HTQ A;  3ZGZ A;  3I3T B;  3WAM A;  1YJJ A;  4FJY A;  3IAS 1;  1C78 A;  1WM3 A;  2KN5 A;  2M56 B;  2ZCC A;  3Q3M C;  2PE9 A;  2Q5W D;  1GC7 A;  3N1X C;  2GB1 A;  2Y5P A;  3PZ7 A;  4DBG A;  2IGG A;  2MBO A;  1V1O A;  1T6B X;  3B0A A;  3TIX A;  1YJ1 A;  2WU2 B;  1EF5 A;  1FCL A;  3FIL A;  1AYF A;  3PT2 B;  5H8Y E;  1M94 A;  1ZXI A;  4GDL A;  1F1H A;  3NRZ A;  3H9D A;  5D2M B;  2MQJ A;  4IM3 A;  3H7P A;  4TKN A;  2ZZP B;  3RZF A;  4N59 A;  4IUM B;  3DBR I;  1I7H A;  3MC9 A;  5EE9 A;  2MBQ A;  1AWD A;  2KOX A;  1TKE A;  1J19 A;  3EFU A;  4YSX B;  3ABV B;  3WA0 A;  1XLO A;  1RM6 C;  1XT9 B;  4GLS C;  4I6L B;  4PYZ A;  4EEW A;  1F2R I;  1EO6 A;  4M0W B;  3BK2 A;  1X1M A;  2IO1 B;  1BXT A;  4RH6 A;  3C19 A;  2M17 A;  2GBR A;  4ANW A;  4KZ0 A;  3NY5 A;  2NR2 A;  3MHZ A;  3W1S A;  5GXG B;  2KWC A;  1YIW A;  3H1U A;  1Y56 A;  1SGH A;  3NG0 A;  2KJH B;  2KXJ A;  5G55 A;  4TUU A;  3ZJV A;  4HPP A;  4BAX A;  5C2T B;  3Q8B A;  1P1A A;  1V9J A;  1WR1 A;  4K7W A;  4ANV A;  2MLB A;  3PRE A;  2AL3 A;  3ZIM A;  3RYT A;  2D11 A;  3IFW B;  4K3B A;  1L2N A;  1V5T A;  3SR6 A;  4ARI A;  5FR3 A;  2AQ3 B;  3P63 A;  2K6D B;  2MH7 A;  3U7Z A;  1P7F A;  3KQ4 A;  4MGK E;  3L08 A;  2DYO A;  2JRH A;  4M01 A;  4DHJ B;  1VCB A;  2PPH A;  3AE8 B;  1WYW B;  2KQ7 A;  4FHJ A;  2ZPN A;  4C00 A;  3N32 A;  4KSL C;  2W54 A;  3OJ3 A;  1UNS A;  1QIL A;  3VTU A;  5L95 C;  2LUM A;  5HKH A;  4RM8 A;  1Q0W B;  2WHI A;  1P98 A;  5D6J B;  3AUL A;  4P1B C;  4KZC A;  1UD7 A;  1PGB A;  2FNJ B;  3N1Z C;  1N5X A;  2KKC A;  3AV8 A;  5C1Z A;  1QOG A;  2IGD A;  4JX1 C;  2J0M A;  1L0V B;  3LYY A;  3MJ5 A;  3KUD B;  2NVU I;  3MTN B;  3E9S A;  3BII D;  3LDZ E;  4GN1 A;  3NUH B;  2O6V D;  3PHW B;  4A9A A;  3ZNG C;  4FHK A;  2MA9 B;  4PK1 A;  3V62 A;  2IPK D;  4M02 A;  2V3S A;  3VTW A;  1VZ6 A;  1UBQ A;  1UH6 A;  1ESF A;  3AE9 B;  3W2D A;  1T0Q C;  3U4E G;  1CK1 A;  3DBR B;  3S2A A;  3WAO A;  3SHQ A;  1FNV A;  2MW5 A;  3FIL B;  3NVY A;  4L2Y A;  2QHO A;  3X0W A;  4E3C A;  4ZRJ A;  3B9J A;  1EF1 A;  3V6E B;  4H2A A;  3HVZ A;  3IXS A;  2AWT A;  2ZEQ A;  3CSF A;  1TBE A;  4E71 A;  1C4P A;  1BML C;  2QMT A;  2WX0 A;  4DHJ D;  3ZXV A;  2WXH A;  4HJK A;  3W9C B;  3AE6 B;  1D4B A;  3UI3 A;  4JPS A;  2D10 A;  3HUI A;  4DDG D;  1WJ4 A;  5TSS A;  5HFY A;  1MPE A;  1XD3 B;  4EOY A;  1YQB A;  2YLM A;  3VQI A;  2INP E;  1KF6 B;  4W9E A;  4BKS A;  2J52 A;  2INN E;  5E6P A;  1Y8R C;  3U2S C;  2JU6 X;  5J2R A;  1V97 A;  2LGS A;  2UYZ B;  3UIN B;  2R2Q A;  2K39 A;  3PRZ A;  2PIA A;  2KAN A;  2WXM A;  4OZA A;  1JAL A;  1C3T A;  5BYQ A;  2C7M B;  5BMH A;  1L4Z B;  3WIM A;  1PQS A;  2MBB B;  2RDG A;  4BBN F;  1XLN A;  1C9F A;  1JW9 D;  1TS3 A;  2H88 B;  2CU1 A;  1Z5S B;  2R61 A;  4A8X C;  1IYF A;  3VHT C;  2D07 B;  3NZ3 A;  5BO4 B;  2ICI A;  2NS5 A;  1VD2 A;  1E90 A;  2JWU A;  2I1J A;  2BQQ A;  2WWZ A;  3HM6 X;  4YSY B;  2XN9 C;  1ZGU B;  3QAQ A;  3CF6 E;  5IAA C;  4ZYN A;  3ZKJ C;  1L0Y B;  3ZXR A;  3P4Q B;  4HEA 1;  3ML9 A;  3PLV A;  4GMV A;  1SE4 A;  2SAK A;  2KJ6 A;  1TS5 A;  2KWD A;  2FCS A;  2KQS A;  2FBW B;  4NJ6 A;  2W82 A;  4EKU A;  3DBL I;  1FNU A;  1QT9 A;  1WWT A;  1F2R C;  2LI5 A;  4OVV A;  1WXM A;  1K8R B;  1ZPS A;  3N3K B;  3N30 A;  1FXT B;  1QOA A;  1JWM D;  2MWS B;  4KIK B;  4B6W A;  1CQV A;  4RM9 A;  4HCN B;  4RGT A;  3M95 A;  3AEE B;  2FE8 A;  2BYF A;  4A90 A;  2QDF A;  2FIF A;  3KYD D;  1WIA A;  1I4R A;  2K0P A;  4YTN B;  1OTR B;  3U7D A;  4NQL B;  3I5J C;  2WXJ A;  4C80 A;  4A20 A;  2OOB B;  1F0Z A;  5IOI A;  4FBJ B;  2WU5 B;  4DXA B;  4F7Z A;  2C60 A;  4JIO U;  3DVN V;  5FK9 C;  2D2Q A;  1E8W A;  4HRS A;  1TZO A;  1EWC A;  4KX6 B;  4DXF A;  1YQ3 B;  4YTP B;  3ZUN A;  3AN1 A;  2J7Q B;  4LNK A;  2N0S B;  4L23 A;  1WGH A;  2JVC A;  3VRA B;  2KK8 A;  4KKI A;  3DQV A;  1IBX B;  2KD0 A;  2JX5 A;  4CYE A;  1WF9 A;  3VAW A;  3ZLZ A;  4NPN A;  1HEZ E;  4A3P A;  1JWA D;  2X38 A;  4HKZ E;  3ZW3 A;  3QX1 A;  4W9C A;  4K1R B;  2DYM A;  4N58 A;  1Z2M A;  3O13 A;  2RD0 A;  4GXB A;  2CU3 A;  3A4S C;  4MH0 E;  3KH0 A;  1KFY B;  3AI5 A;  2WXO A;  5LLI A;  5J18 A;  1DGJ A;  3EHV A;  3PZD A;  1SIJ A;  3V3X A;  4OZC A;  4GDL B;  1C79 A;  1MHX A;  2BW2 A;  2IJ0 A;  4WQM A;  1FRR A;  2BWF A;  2IYD B;  2PVG C;  5FR6 A;  2EMS A;  2J0J A;  1FXA A;  2INC C;  1XXG A;  1C1Y B;  5KHO A;  4AS1 A;  2YVC A;  1KJT A;  2V3N A;  4S0R A;  1MVK A;  4G11 A;  2FAZ A;  4ITK A;  1KOT A;  5AEK B;  1IPG A;  3UQA A;  1V80 A;  4M0W A;  3TJP A;  4AQ7 A;  3ZJT A;  1KH0 A;  2J0K A;  1WSP A;  1VR9 A;  4C7Y A;  2L3Z A;  1WJ6 A;  3MC8 A;  3PO0 A;  2JRI B;  3NS8 A;  3KWV A;  1TY0 A;  3X23 A;  2DHZ A;  3ZJU A;  2MBE A;  1E6E B;  1E5W A;  1SBB B;  4HDQ A;  4W9G A;  5BYS A;  4XWW A;  5AZG A;  1FO4 A;  3IT4 B;  2HDE A;  4OW0 A;  2LJI A;  2D3C A;  5BMG A;  4ARC A; 
#chains in the Genus database with same CATH homology
 2NPT B;  2KFK A;  4IUM B;  4DWF A;  3DBR I;  4M8M A;  1RLF A;  5JH5 C;  4NY0 A;  2MBQ A;  2KOX A;  4GIV A;  1J19 A;  2IY0 B;  2KVR A;  5DPW A;  1WXS A;  3EFU A;  3C0R B;  4ZDV A;  4AUQ C;  4DK5 A;  4AWJ A;  2NCN A;  4PYZ A;  1R4N I;  1XT9 B;  2KDB A;  4I6L B;  4NJ7 A;  4G3X B;  3WA0 A;  4EEW A;  1EUV B;  4FJV B;  4XZ4 A;  2KZR A;  2V4L A;  2ZNV B;  3HHM A;  1EO6 A;  4M0W B;  5DCN A;  2W9N A;  1RFA A;  1X1M A;  2IO1 B;  2IO3 B;  4KVG B;  4MEL A;  2VRR B;  2M17 A;  2GBR A;  1WJN A;  4ANW A;  3VUX A;  4KZ0 A;  2JZZ A;  2MSE D;  3NY5 A;  2CHW A;  2FID A;  1R4M I;  2NR2 A;  4MEM A;  1WGD A;  4RMA A;  3K9O B;  1NDD A;  4MGY E;  3W1S A;  3AU5 A;  1GG3 A;  3DVN U;  4BOZ B;  2KWC A;  1YIW A;  1Q5W B;  3H1U A;  3UF8 A;  1H4R A;  1SGH A;  3WAL A;  4AJW A;  1SE9 A;  2KJH B;  2KXJ A;  2K8B A;  1WGG A;  4TUU A;  2C9W B;  3DPD A;  4WAA A;  5G55 A;  3RT3 B;  2L00 B;  1NI2 A;  2GBJ A;  1E8Z A;  2O2V B;  2LUE A;  4GB9 A;  1V6E A;  1OEY A;  2KWU B;  4MGI E;  1P1A A;  2HJ8 A;  1V9J A;  4K7S A;  1Q1O A;  1WR1 A;  3A9K A;  4K7W A;  4ANV A;  2MLB A;  1LFD A;  3PRE A;  2K1F A;  2EKE C;  2AL3 A;  3ZIM A;  4ZRI A;  1WRD B;  3QAR A;  3RYT A;  2D11 A;  2DAJ A;  3IFW B;  4MDK E;  3ZNZ B;  3QC8 B;  1L2N A;  1V5T A;  1D3Z A;  1UGM A;  5TR5 A;  1WZ3 A;  2BYV E;  3A33 B;  3QIJ A;  3NZU A;  3W1Y A;  2K6D B;  4F1S A;  3PS6 A;  4MGK E;  3L08 A;  2DYO A;  2JRH A;  4DHJ B;  1VCB A;  2PPH A;  4A3O A;  1WYW B;  2FUH B;  3KUC B;  4F8C B;  2KQ7 A;  4FHJ A;  1WY8 A;  2ZPN A;  1WH3 A;  1P3Q U;  2IO0 B;  2RGF A;  3CST A;  2HD5 B;  1V81 A;  1S1Q B;  2DX5 B;  3JSV B;  3N32 A;  1TGZ B;  2BF8 B;  2C7H A;  4KSL C;  4XC2 A;  2IBI B;  3OJ3 A;  4EZK A;  3ZNI D;  3KW5 B;  3QQ8 B;  4EZJ A;  3VTU A;  1ISN A;  3UGB B;  5L95 C;  3QCA A;  3ALB A;  4I6P A;  5HKH A;  4RM8 A;  1UZX B;  3RZF A;  1Q0W B;  2BKF A;  2G4S A;  1P98 A;  5D6J B;  3AUL A;  3L54 A;  4BKT A;  4KZC A;  3SD5 A;  3R66 C;  1UD7 A;  2NBW B;  2MBH A;  3PSE B;  2FNJ B;  3IHP C;  4BOS C;  3TBL D;  2GMI C;  3VUW A;  2K8C A;  2KKC A;  3CMM B;  3L17 A;  3VH4 B;  5C1Z A;  1NBF C;  2O2V A;  4HXD A;  2DAF A;  4IW0 A;  3NHE B;  2LXA A;  2MRP A;  2DYB A;  3NOB A;  4PS3 A;  3ONS A;  2MP2 B;  4MSQ B;  2J0M A;  3DBS A;  5CHF A;  4HK2 A;  3KUD B;  2NVU I;  1TTN A;  3MTN B;  3KVF B;  4EFO A;  2DZI A;  3LDZ E;  1V49 A;  2C7N B;  5LXH A;  3VUY A;  3DBH I;  4GN1 A;  2O6V D;  3PHW B;  1E8Y A;  4GU2 A;  3RCZ A;  3RD2 A;  4B95 A;  2RSU A;  4G50 A;  2JWZ A;  3ZNG C;  4FHK A;  1U4A A;  3A1Q A;  5IA7 A;  2LAS A;  4G0N B;  1WGY A;  2I1K A;  2K8H A;  2MA9 B;  3V62 A;  2GBN A;  1YD8 U;  1YX5 B;  2NPT A;  2PEA A;  2V3S A;  2ZVN A;  3LJ3 A;  3VTW A;  3ZRC A;  1I35 A;  1ZW7 A;  4HWI B;  1UBQ A;  2GBM A;  1UH6 A;  2L0T A;  3VVW B;  4HDO A;  3UIP B;  4XX5 A;  3VH3 B;  3S2A A;  2JT4 B;  3WAO A;  3SHQ A;  5JHB A;  3D32 A;  4II3 B;  4LCD E;  2MW5 A;  4NAW B;  2ZPY A;  4WWO A;  2K6Q A;  3AXC A;  2QHO A;  1H8C A;  2LD9 A;  1UBI A;  3MJW A;  3X0W A;  1P0R A;  4E3C A;  3A4R A;  2LRU A;  2L05 A;  4ZRJ A;  1EF1 A;  1WE7 A;  3V6E B;  2JPH A;  4WWP A;  2KLG A;  2KLC A;  3H6N A;  1LXD A;  4TV3 A;  2ZCB A;  3QWZ B;  5CTR C;  2AWT A;  2ZEQ A;  3CSF A;  3JYU A;  3M3J A;  5GMV A;  1TBE A;  4EZL A;  3JW0 X;  2N1V A;  4KIK A;  4E71 A;  4JQW C;  1WM2 A;  4JGH B;  3V6C B;  1F9J A;  4IG7 B;  2WX0 A;  3IVF A;  5JZE B;  4URK A;  1RRB A;  4DHJ D;  4DDI D;  3A9K B;  4HJK A;  2CR5 A;  4GOC A;  2BPS A;  3GOE A;  3ZDM C;  2D10 A;  5D94 A;  2D3G A;  2G3Q B;  4DDG D;  1WJ4 A;  3SU8 X;  3PHX B;  5EDS A;  2M8S A;  3L13 A;  4FUL A;  1XD3 B;  4HCP B;  4EOY A;  4W9L A;  1YQB A;  3ZNH B;  2NBU A;  2YLM A;  4NQK E;  3T9L A;  3UIO B;  3VQI A;  4IWP A;  4K81 A;  4EUT A;  4MSM B;  1G6J A;  5E6N A;  2L8J A;  4W9E A;  3ZTD A;  1TZ1 A;  2XEW A;  4PS8 A;  2LVQ A;  2JY6 A;  4BKS A;  4AOF A;  1J0G A;  1WMH A;  1LQB A;  5E6P A;  1Y8R C;  5J2R A;  5G2N A;  2L76 A;  1S3S G;  2KDI A;  3VXW A;  2UYZ B;  3UIN B;  4JL9 A;  2R2Q A;  3T8M A;  2K39 A;  3PRZ A;  2KWV B;  2HTH A;  1KM7 A;  2O6V A;  2KAN A;  3ZDT A;  1WX8 A;  2KC1 A;  2KO3 A;  2CKH B;  4IWO A;  2G45 B;  3APD A;  3NZS A;  1E7U A;  5AZF A;  1C3T A;  4WQO B;  4KV2 A;  3PPA A;  3WAN A;  4NNJ B;  5E6O A;  3TL5 A;  2C7M B;  2N9E B;  4GDK B;  2BKR B;  4FAD A;  4MJS A;  3WIM A;  5KHQ A;  3RZW C;  2MBB B;  1PQS A;  3APC A;  4W9D A;  4BBN F;  2KFJ A;  2DZJ A;  2ZJD A;  4HPM B;  2KFK B;  3OJ4 B;  3EEC A;  2HE7 A;  3P2B A;  4IM2 A;  4TQ1 A;  2AEH A;  3L10 B;  3U30 A;  3GZN I;  4BVU C;  2Y5B B;  3H7S A;  2CU1 A;  1Z5S B;  3PRM B;  4MJS B;  2L0F A;  3VHT C;  1OGW A;  2Z0E B;  1IYF A;  2D07 B;  2PE6 B;  2N7D A;  4ANX A;  5DPT A;  2N9P C;  5BO4 B;  3K9P B;  2NS5 A;  1VD2 A;  2N1W A;  4WJQ A;  1E90 A;  3Q3F A;  2I1J A;  4K7U A;  2WWZ A;  3HM6 X;  3TMP B;  2M0X A;  1GJZ A;  2KTR B;  4AP4 C;  5C23 A;  2A5U A;  1ZGU B;  3QHT A;  3QAQ A;  4FLH A;  2MCN B;  3V61 A;  3CF6 E;  3HM3 A;  3L16 A;  5IAA C;  4ZYN A;  3ZKJ C;  4FJZ A;  3ML9 A;  2XBB C;  3PLV A;  4GMV A;  2M4N A;  3IG3 A;  1AAR A;  1GUA B;  2KJ6 A;  3ENE A;  2JF5 A;  2FCS A;  2N9X A;  2KQS A;  4NJ6 A;  4EKU A;  2REX A;  4PS7 A;  3R7Q A;  3OAW A;  4CO7 A;  2AYO B;  3DBL I;  1ZKH A;  5CHV C;  4WJP A;  2BGF A;  2LI5 A;  2GOW A;  3PLU A;  4MGZ E;  3BIN A;  3R3M A;  1YX6 B;  4II2 B;  3OLM D;  4JLC A;  1OQY A;  4LDT D;  5AZH A;  3ZO5 B;  2IO2 B;  4OVV A;  1WXM A;  2EMT A;  1K8R B;  3N3K B;  4GGQ A;  3N30 A;  1FXT B;  4W9J A;  3R7R A;  1QZE A;  3B08 A;  2KX3 A;  2MWS B;  5DPR A;  4KIK B;  4B6W A;  4YL8 A;  3QJZ A;  2NBV B;  4RM9 A;  4X57 B;  5J17 A;  3ECI A;  2DZK A;  4HCN B;  1WXA A;  3H7P B;  3M95 A;  2CHX A;  4ZRK A;  1WZ0 A;  4WWN A;  2BYF A;  2UWQ A;  4GSW A;  2DZM A;  4CHK A;  2FIF A;  3KYD D;  4NAW A;  5L83 A;  4LJP B;  2XK5 B;  2L7R A;  1WIA A;  1WJU A;  1V5O A;  2G4D B;  3DOW A;  3DCG A;  2AL6 A;  3DVG X;  1OTR B;  4ANU A;  4M8N A;  2LVP A;  3BY4 B;  3ZRF A;  3U7D A;  5CX3 A;  2N7E A;  2WX1 A;  4NQL B;  1BT0 A;  2R2O A;  4IM0 A;  2JZ3 B;  4FN2 A;  4HVB A;  2LVO A;  4A20 A;  1WX7 A;  2LGX A;  2XK5 A;  1OEY J;  2OOB B;  2JXX A;  4IC7 B;  3A9J B;  3HK0 A;  2CHZ A;  1J8C A;  4FBJ B;  2WDT B;  2KJR A;  2KC2 A;  3V60 A;  4DXA B;  4F7Z A;  2C60 A;  4JIO U;  3DVN V;  2D2Q A;  2O6V B;  1E8W A;  1WX9 A;  3JVZ X;  2CS4 A;  2GBK A;  1P9D U;  2KX0 A;  5D7G A;  2MX2 A;  3VDZ A;  3VFK A;  2Z59 B;  4KSK C;  3ML8 A;  2ZNV C;  1GNU A;  2LZ6 A;  3AU4 A;  5CHW A;  4WJO A;  4PYU A;  3ZUN A;  4ICV A;  4BKS D;  2J7Q B;  1KLV A;  2LRW A;  3M62 B;  1WGH A;  5LXI B;  1E8X A;  2JVC A;  3KYC D;  2KK8 A;  1WXV A;  3DQV A;  3W1S C;  1XQQ A;  1WGR A;  2KD0 A;  3EC8 A;  1MG8 A;  2KMA A;  4CYE A;  3VTV A;  1T0Y A;  3PRP B;  1WF9 A;  3VAW A;  3ZLZ A;  2WYQ A;  2ZVO A;  2ASQ A;  3APF A;  4NPN A;  4A3P A;  4HLE A;  4W9I A;  3ZW3 A;  3QX1 A;  4W9C A;  4K1R B;  2DYM A;  2KNB A;  1CMX B;  1WR6 E;  4ICU A;  4N9F 4;  1Z2M A;  2RD0 A;  2Z0D B;  3JSV A;  4B9K A;  3PVL A;  4GXB A;  3QA8 A;  1A5R A;  4ASW C;  3SDL C;  3A4S C;  3UQB A;  4DHZ B;  1WI0 A;  1RAX A;  2OJR A;  4MH0 E;  3KH0 A;  2C5L C;  1WMH B;  5JHA A;  3ZTC A;  3AI5 A;  5LLI A;  5J18 A;  2V1Y A;  3EHV A;  4GDK A;  3ZVV A;  4MM3 A;  1SIF A;  3PZD A;  1E7V A;  4AJY B;  3RUL A;  1JRU A;  1GC6 A;  2JUO A;  2A4Z A;  2KMC A;  3HIZ A;  4GDL B;  4BKG A;  3U8Z A;  3Q3J A;  2KDF B;  4P7I A;  2BWE S;  4KDL B;  2BWF A;  2IYD B;  4WJN A;  5FR6 A;  2EMS A;  2FCM A;  2J0J A;  3A1Q B;  2LGY A;  2RPQ A;  3IBE A;  3M63 B;  4W9K A;  5DPS A;  1C1Y B;  1V86 A;  4W9H A;  3RUI B;  5KHO A;  2KTF A;  2YVC A;  1KJT A;  3I3T B;  4HPL B;  2N4F A;  3WAM A;  2IZV B;  4IWQ A;  2DEN B;  4FJY A;  4BFR A;  2MP2 A;  1WM3 A;  2KN5 A;  2KTR A;  4G11 A;  2FAZ A;  2KDE B;  1I42 A;  1KOT A;  1V2Y A;  2FCQ A;  2ZCC A;  2LGD A;  4KDI C;  4DHZ E;  5AEK B;  2PE9 A;  1IP9 A;  2PJH A;  1GC7 A;  1IPG A;  3UQA A;  3PTF C;  1V80 A;  2LJ5 A;  1UEL A;  4DBG A;  4OVU A;  1LM8 B;  2MBO A;  3KUZ A;  4BBN C;  3TJP A;  3B0A A;  3TIX A;  1HE8 A;  3DDC B;  4W9F A;  2J0K A;  1WFY A;  3L0W B;  4I6N B;  1YJ1 A;  4J6I A;  1EF5 A;  2L3Z A;  1WJ6 A;  2LXC A;  2JRI B;  3MHS D;  3NS8 A;  2IY1 B;  2KHW B;  4TQ0 A;  3PV1 A;  3WAP A;  2DHZ A;  3X23 A;  3B1L X;  1WE6 A;  3PT2 B;  3A9J A;  1M94 A;  2MBE A;  4LJO B;  1E5W A;  3DVG Y;  4GDL A;  2RR9 A;  4HDQ A;  4W9G A;  2FCN A;  2K25 A;  2B3A A;  5AZG A;  1L7Y A;  3H9D A;  5D2M B;  2M1M A;  2BYE A;  2MQJ A;  4IM3 A;  4FA6 A;  3H7P A;  4E74 A;  4TKN A;  2LWP A;  3TCA A;  2ZZP B;  3O65 B;  4LDT B;  3PGE A;  3QK0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...