1WXMA

Solution structure of the n-terminal ras-binding domain (rbd) in human a-raf kinase
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
86
structure length
86
Chain Sequence
GSSGSSGGTVKVYLPNKQRTVVTVRDGMSVYDSLDKALKVRGLNQDCCVVYRLIKGRKTVTAWDTAIAPLDGEELIVEVLSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution Structure of the N-terminal Ras-binding Domain (RBD) in Human a-Raf Kinase
rcsb
molecule keywords A-Raf proto-oncogene serine/threonine-protein kinase
molecule tags Transferase
source organism Homo sapiens
total genus 7
structure length 86
sequence length 86
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2005-01-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02196 RBD Raf-like Ras-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 1wxmA01
3I3TB 1EUVB 3H1UA 3UIPB 3PLUA 4TQ1A 3W1YA 4MEMA 2MP2B 1J0GA 4NNJB 4I6LB 3V6CB 5J18A 4M0WB 3A1QB 1WGDA 2KFJA 2XEWA 3PPAA 3WA0A 3VUXA 3KW5B 3JSVB 4HJKA 1WGHA 2REXA 2KVRA 2NBVB 4E74A 2DZIA 4ZRKA 1CMXB 3H9DA 3DVGY 2KX0A 1GJZA 4ANXA 4ANUA 4FBJB 2O6VB 3VTVA 3ZTDA 2IZVB 3UQAA 1GG3A 2JWZA 3R3MA 4G3XB 1WGGA 3VHTC 4B6WA 1J8CA 4F1SA 1YQBA 5IAAC 1WFYA 3DDCB 3PHWB 4DHJB 2KTFA 3N3KB 3W1SC 4AJYB 1V6EA 3DBLI 2D07B 4DWFA 3L54A 3VDZA 1GUAB 2YLMA 3T8MA 4ICUA 3A33B 4GU2A 3DPDA 4KDIC 3TMPB 3TL5A 2ZCBA 4CO7A 3IHPC 4ZDVA 2IYDB 3KH0A 1R4MI 3H6NA 3V62A 4EKUA 2WYQA 4FJVB 4LJOB 5LXIB 2ZNVC 1Q0WB 2IO3B 3ZVVA 1KLVA 2FCMA 2L8JA 2N7DA 2RPQA 2BYVE 2AL6A 2NR2A 1V80A 3ZNZB 4HVBA 2ZZPB 2BGFA 3LJ3A 5AZFA 3N30A 4KIKA 3VUYA 1TTNA 1WE6A 1WJ6A 4DDGD 3DBSA 2MA9B 4BKTA 5BO4B 4TQ0A 4FHKA 4FN2A 4IUMB 2K25A 4W9LA 3ZO5B 3TBLD 1H4RA 1E90A 2N9EB 3KUCB 1WJNA 2KHWB 4WWOA 1WE7A 3QA8A 5JH5C 1WGRA 1G6JA 3NS8A 4OVUA 3P2BA 3H7SA 1Q1OA 4RM8A 4A3OA 4HK2A 2FNJB 3APDA 4BKSA 5JHBA 4GSWA 1Q5WB 1KOTA 2JRIB 2EMTA 3AU5A 1ZW7A 3L0WB 3VTUA 2KO3A 3NHEB 3RULA 5D7GA 2NPTA 3PV1A 2Y5BB 3R66C 3IBEA 4IWOA 1P3QU 3HIZA 4MELA 1WY8A 4MH0E 4W9DA 4A3PA 3PVLA 1E8XA 1YJ1A 5E6OA 4TV3A 4KIKB 4BFRA 4DHZB 2KQSA 4KZ0A 4IWPA 4KVGB 2KFKA 3L08A 2C5LC 1WXMA 2VRRB 1E8WA 3QHTA 4GDLA 4W9IA 4EZJA 3SHQA 4FULA 3X23A 2DZMA 2N1WA 4LDTD 1TBEA 3WANA 2WX1A 2V1YA 4WJOA 2IY0B 2BYEA 3NY5A 3L17A 4I6NB 5DCNA 2XK5A 4FJZA 2ZJDA 4W9CA 3X0WA 3UF8A 2CU1A 2IBIB 2L0FA 2ZPYA 2CR5A 1ZKHA 2FIFA 2UWQA 1F9JA 1L7YA 1WXAA 1WF9A 2LI5A 3PS6A 5J2RA 2NPTB 1L2NA 2BPSA 3A4RA 3HM6X 3JSVA 4ANWA 4EZKA 1GC7A 2LZ6A 2KC2A 5D2MB 2CKHB 3WAMA 1E7UA 2KFKB 5E6PA 1WMHA 1V86A 3KYDD 4GDLB 1V9JA 4B9KA 1V81A 2L00B 4AP4C 4IM3A 3VFKA 2G4DB 2DZJA 2Z0EB 3DCGA 3DVGX 3O65B 2HJ8A 4GMVA 3VUWA 5KHQA 4W9JA 4XZ4A 4DXAB 1K8RB 2RSUA 4MSMB 1UZXB 2XK5B 3CMMB 3WAOA 2MW5A 4KV2A 2JZZA 3JYUA 2J0MA 3SD5A 1WM2A 2BKRB 2WWZA 3A4SC 4PYZA 3WAPA 1V49A 2GBKA 1WZ0A 3TJPA 1S1QB 1P1AA 4N9F4 2CHZA 2HTHA 3NOBA 3ZKJC 1WJ4A 4NJ7A 2JPHA 3ML9A 3IG3A 5C1ZA 4ZRJA 5J17A 3ZNID 1VD2A 1UBQA 3LDZE 3PLVA 4TKNA 1WRDB 2CS4A 4NAWA 2MWSB 2M0XA 1WMHB 3PSEB 4HPMB 3ZRFA 2LVQA 3PREA 1IYFA 1RRBA 3IFWB 2OJRA 1PQSA 1R4NI 2O2VA 4NJ6A 3CSFA 5JZEB 2B3AA 2HE7A 2BKFA 4E3CA 2N9PC 2KX3A 1SIFA 4IG7B 4K7WA 3KYCD 3M3JA 1EF1A 4GXBA 4JQWC 2KWCA 4WWNA 2ZEQA 3Q3JA 4RMAA 5IA7A 2DAFA 4BOSC 2KDFB 5DPSA 3RUIB 1LQBA 2ZCCA 2FCSA 2MBQA 3ZRCA 2J7QB 1QZEA 4URKA 2Z0DB 2D10A 3CSTA 3NZSA 1D3ZA 1WZ3A 1NI2A 2L7RA 3QK0A 2J0KA 2KK8A 4FLHA 4K1RB 4NAWB 2JF5A 3RT3B 4A20A 3UIOB 3V6EB 2KLGA 2DAJA 1WX7A 3UGBB 4CYEA 2LVPA 2MBHA 3VXWA 5GMVA 4KSLC 3RD2A 2O2VB 2AEHA 4J6IA 2WDTB 2GOWA 5EDSA 4BKGA 1M94A 2KNBA 4MJSA 1UGMA 1X1MA 2KDIA 4GB9A 4M8NA 3PRPB 1C1YB 5CX3A 3IVFA 2MCNB 2NCNA 1S3SG 2IO2B 4MGIE 3VH4B 4HXDA 1A5RA 2ZVOA 4MM3A 1KJTA 3A9KB 4DDID 4AUQC 2KD0A 2C7MB 2ZNVB 2M8SA 5TR5A 3MJWA 3AXCA 4TUUA 3PT2B 3EC8A 2LWPA 2KDEB 3DOWA 2KDBA 2OOBB 2G45B 1RFAA 2LGXA 3A9JA 3ALBA 2UYZB 1J19A 2C9WB 3K9PB 1UH6A 4JGHB 4GGQA 2MBBB 5D6JB 3VH3B 2ZVNA 5C23A 3C0RB 4IM0A 1Y8RC 2JXXA 4FADA 1V5OA 3HM3A 4K7UA 4WAAA 4MJSB 2DYMA 3JW0X 3OAWA 2LGYA 3VAWA 1EF5A 2AL3A 2DZKA 2A4ZA 2K8BA 4LJPB 5AZGA 5AZHA 3OJ3A 5G2NA 3B08A 3H7PA 4WJNA 1YX6B 4MSQB 1KM7A 4WJPA 4F7ZA 1P98A 4F8CB 3QX1A 3B1LX 2DYOA 2Z59B 5DPRA 4PYUA 2GBRA 1RLFA 3ZDTA 2JRHA 2FUHB 1I42A 1SE9A 2R2OA 3N32A 1RAXA 3A9JB 3RZFA 2L76A 3OLMD 3ZDMC 2GMIC 2KANA 1XQQA 2KTRA 4HLEA 2BYFA 3QQ8B 3HHMA 2LASA 3MTNB 3T9LA 2PE6B 1WX8A 1P0RA 4XC2A 4BOZB 3EHVA 3L16A 3ZIMA 2LD9A 2KJ6A 3NZUA 2K8HA 4HWIB 1OTRB 2DHZA 1YX5B 1Z2MA 4WQOB 3S2AA 2MBEA 1WH3A 4XX5A 3ML8A 3DQVA 2KKCA 3DVNU 5DPTA 2LRUA 3H7PB 2PJHA 4G50A 4LDTB 3L13A 1E8YA 5E6NA 4P7IA 4E71A 1GC6A 4GIVA 2GBNA 2MBOA 1OEYJ 3KUZA 2MSED 3ZNHB 3K9OB 1T0YA 1WYWB 2O6VD 4DK5A 3RCZA 2KTRB 4II2B 2K6QA 2MLBA 4MGKE 2KOXA 2I1JA 2C7HA 1OGWA 2L05A 1BT0A 2J0JA 3Q3FA 4AJWA 2LRWA 2RD0A 3ZW3A 5DPWA 1ISNA 4EZLA 4DHJD 2MRPA 2BF8B 1UBIA 4NY0A 4RM9A 2IO0B 2LXAA 2NBUA 2AYOB 3GOEA 2AWTA 2GBMA 4JL9A 3W1SA 4I6PA 1UD7A 2NVUI 3L10B 2DYBA 2FIDA 3JVZX 1WI0A 2LGDA 1WX9A 1OEYA 2K8CA 2LJ5A 3ZUNA 4W9HA 3D32A 3DBHI 4ANVA 2QHOA 1I35A 2RR9A 2MQJA 1WR6E 4HPLB 3ENEA 3QCAA 1LM8B 2M4NA 4K7SA 3SU8X 3A9KA 3QJZA 4DHZE 2FCNA 4FA6A 1H8CA 2M17A 2LUEA 1TGZB 1TZ1A 1OQYA 5G55A 2D2QA 4CHKA 2KLCA 1V5TA 3M62B 4G0NB 4FHJA 3VQIA 4PS8A 3V60A 3QIJA 3TIXA 2KMCA 3QC8B 4W9FA 2JZ3B 2LVOA 3ONSA 4IWQA 4X57B 4FJYA 4HCNB 3TCAA 1XD3B 1UELA 3OJ4B 1HE8A 2EMSA 3HK0A 2KJHB 2KJRA 1FXTB 4W9GA 2KQ7A 3ZTCA 2CHWA 1V2YA 2KWUB 3WIMA 1NDDA 4KZCA 2DX5B 1C3TA 4GDKA 3PRZA 4EEWA 3U7DA 2L3ZA 5JHAA 1WIAA 2N7EA 4B95A 2KN5A 1WM3A 3PRMB 2CHXA 1NBFC 3KVFB 3DVNV 2D3GA 4G11A 3QWZB 1XT9B 2I1KA 4GOCA 3VVWB 4W9KA 4JIOU 2PPHA 1VCBA 5KHOA 1SGHA 4KSKC 4M8MA 3SDLC 4W9EA 1WJUA 3RZWC 3UINB 1WGYA 5D94A 4BVUC 2LXCA 4PS7A 4NQLB 1WR1A 3KUDB 2D11A 2JT4B 3PTFC 5HKHA 1E7VA 2KZRA 2L0TA 4MGYE 4II3B 3R7QA 2A5UA 5CHVC 4YL8A 5L95C 5CTRC 4OVVA 1E5WA 3EECA 2R2QA 4GDKB 3ZLZA 4BBNC 4MGZE 2NBWB 5CHFA 5CHWA 4PS3A 1P9DU 2BWFA 2C7NB 3R7RA 4JLCA 2K39A 2IO1B 4BKSD 3UQBA 1MG8A 2FAZA 2KMAA 2IY1B 4NQKE 3APCA 1U4AA 4HDOA 2N4FA 2JUOA 1EO6A 2KC1A 2M1MA 4KDLB 4EUTA 3BINA 3BY4B 1YIWA 2N1VA 3M95A 3MHSD 3APFA 2JVCA 5LLIA 1Z5SB 3RYTA 2MX2A 2PEAA 4IW0A 1JRUA 3AULA 2G4SA 4ASWC 2KXJA 4IM2A 2YVCA 3ZNGC 3M63B 5FR6A 3U8ZA 4WJQA 3DBRI 3WALA 4ICVA 4NPNA 5AEKB 3U30A 2K1FA 1IPGA 4DBGA 2V3SA 3AI5A 3ECIA 4EOYA 2G3QB 1ZGUB 2ASQA 2KWVB 2XBBC 1LXDA 2V4LA 3GZNI 2MP2A 4K81A 4AWJA 3EFUA 5LXHA 4IC7B 3CF6E 3A1QA 1WXSA 3AU4A 1AARA 2NS5A 1GNUA 3PZDA 2W9NA 2PE9A 4WWPA 2JY6A 3V61A 2EKEC 2N9XA 2HD5B 3PGEA 1WXVA 2GBJA 2ZPNA 1E8ZA 4EFOA 2FCQA 5L83A 4HDQA 4LCDE 2RGFA 3B0AA 3VTWA 4HCPB 1LFDA 2C60A 4MDKE 4BBNF 4AOFA 3QARA 2BWES 4ZYNA 2O6VA 3PHXB 2K6DB 3QAQA 1IP9A 2DENB 4GN1A 2WX0A 4ZRIA 1YD8U
chains in the Genus database with same CATH superfamily
1EUVB 1XCQL 3H8HA 3ETRA 3V6CB 4M0WB 1WGDA 3AEDB 2L83A 5FR3A 3VUXA 3KW5B 3JSVB 4HJKA 2KVRA 2DZIA 2JU6X 2ZW0A 1XXGA 4FBJB 2O6VB 2IZVB 1WGGA 3VHTC 4B6WA 1VZ7A 1FCLA 1WFYA 3PHWB 2KTFA 3KWVA 4AS1A 3T3OA 4DWFA 3L54A 1E9MA 3VDZA 1GUAB 2KACA 4Q2JA 4GU2A 3NVWA 1SF0A 1P7EA 3IAS1 1T0SC 4AQ7A 1Y56A 3V62A 1J7CA 2WYQA 4FJVB 5LXIB 3ZVVA 2IO3B 5BMHA 2AL6A 4HROA 2BGFA 2WQYB 4JX1C 4NJCA 5AZFA 2KDMA 4KIKA 1MFWA 2MA9B 3AECB 4W9LA 1E90A 1WGKA 1K50A 1UGJA 1Q1OA 4BKSA 5JHBA 1Q5WB 2JRIB 1L0VB 3PV1A 1WY8A 2GRIA 3PVLA 1YJ1A 5E6OA 4KIKB 4BFRA 2KQSA 1KLUD 2VRRB 1I4GA 3SHQA 3B2GA 4MM3B 1TBEA 2J52A 4I6NB 2HJ1A 5IKCM 5C3JB 4W9CA 3UF8A 2CU1A 2FBWB 5EE3A 1E6EB 1L7YA 2LI5A 5J2RA 2BPSA 3HM6X 1F2RC 1GC7A 4DQOC 3AE7B 3WAMA 1E7UA 2N7JA 1V9JA 2BB6A 1V81A 2L00B 4AP4C 2G4DB 2DZJA 2PVOD 5IO9A 4XZ4A 4ZRQA 1K8RB 4MSMB 2LFIA 3AEEB 3W9CB 2MW5A 1BUIC 3GB1A 2HTME 4EE2A 1WM2A 2BKRB 3A4SC 2GBKA 4OVZA 5I4DA 2HTHA 4LK0M 2JPHA 3IG3A 3Q14C 4ZRJA 1UBQA 2M0XA 4YWGG 1RRBA 2OJRA 1PQSA 1R4NI 4WWMA 2B3AA 2BKFA 2KX3A 1NYQA 4IG7B 4LTUA 2HDEA 4RMAA 3Q8AA 2DAFA 2K9XA 2KDFB 5DPSA 3RUIB 4US8A 2MBQA 2KMMA 1F77A 4XYCA 1D3ZA 1WZ3A 2KK8A 2W3SA 4M00A 2JF5A 3EGRA 3UIOB 3V6EB 2KLGA 1WX7A 2D3BA 2MBHA 3RD2A 2AEHA 5EDSA 2KNBA 1UGMA 4GB9A 4M8NA 5CX3A 2WDVB 3VH4B 1HTQA 3U2SC 3A9KB 4AUQC 2RPVA 5TR5A 4TUUA 1B1ZA 3EC8A 2LWPA 2OOBB 3BVMA 5HG2A 1C78A 2BYTA 2UYZB 1J19A 4GGQA 3ZJUA 3VH3B 2WXQA 4P16A 5C23A 3C0RB 4XWTA 2TSSA 2JXXA 4FADA 3MP9A 1GAQB 4WAAA 1ZPSA 3OAWA 2WXJA 2K8BA 2A4ZA 4RNAA 5AZGA 3OJ3A 1YX6B 2AQ3B 4XGAB 4F8CB 4H2AA 3ZJTA 3ZXRA 5BYSA 2JRHA 1I42A 3N32A 1RAXA 1SJHD 4OZBA 1SJED 1XQQA 1PUTA 2LASA 3T9LA 2KT7A 4MT5A 1OTRB 3R8BA 1Z2MA 1QQRA 2MBEA 4YTPB 4YTNB 3ML8A 1RFKA 3DVNU 2LRUA 1GPXA 2PJHA 3L13A 2QC8A 1JWAD 2JX5A 3U52E 2J42A 2MBOA 1TKEA 3K9OB 4S17A 2LHDA 4RF0A 3Q6BA 2L05A 2X38A 1OGWA 2LRWA 3ZW3A 4C4VA 2WDQB 2BF8B 4NY0A 4RM9A 2NBUA 4JL9A 5H8YE 1J7BA 2NVUI 3L4PA 1EWCA 1STEA 3P63A 1L0YB 4W9HA 3D32A 3DBHI 2WU2B 4ANVA 3HRDD 1YN3A 2RR9A 2IDYA 2SEBD 2MJEA 3MJ5A 2M4NA 4RFBA 4CQNA 4DHZE 4FA6A 5G55A 2IGHA 3O13A 2KAJA 4C4VB 4W9FA 1SSNA 4A6QA 4FJYA 1FEHA 1UELA 2EMSA 2KJRA 3CIRB 2KQ7A 3I9V1 2CHWA 1V2YA 2KWUB 3SEBA 4KZCA 2DX5B 1C77A 2L3ZA 2N7EA 1UUPA 2KN5A 3RNFC 3KVFB 2W82A 1XT9B 3BYYB 4REZA 3KLSX 2K5PA 2W55A 2PPHA 3SDLC 1HTOA 1CJEA 4BVUC 2V3PA 3DBRB 1WR1A 3AV8A 3KUDB 2Y5PA 2JT4B 5HKHA 2L0TA 5BMIA 1L0XB 4YXDB 3NVZA 5LNK1 2WXLA 2BWFA 2K39A 2IO1B 3BK1A 3UQBA 5C2TB 4HDOA 2JUOA 2KC1A 2M1MA 3BINA 4BAXA 4XDCA 2N1VA 1TJEA 2V3NA 3APFA 1Z5SB 2MJ3A 2PEAA 4IW0A 2H88B 3AULA 2DWQA 1FD6A 2KXJA 3Q3NC 4IOIE 4WIPA 3VR8B 1DOYA 3AE8B 5AEKB 1GB1A 2K1FA 1IPGA 3AI5A 1AN8A 1ZGUB 1ET9A 2XBBC 2MP2A 4K81A 3Q2AC 5LXHA 1FNWA 2NS5A 1N6ZA 3OG5A 4WWPA 4A9AA 4C56C 1WXVA 4EFOA 3OWEB 2FCQA 4HDQA 4PT5A 3T3NA 2C60A 3QARA 4ZYNA 4ZHOA 2BVCA 2YEPB 2WXIA 5HFYA 1C9FA 1NYRA 1N61A 3PLUA 2MP2B 4NNJB 1KLGD 1T5XD 2QCZA 3DHIC 3PPAA 1YQ4B 1N62A 4YTMB 2ICIA 1AW7A 2FUG1 2VH2A 3DVGY 1GJZA 3VTVA 4UDUC 1GG3A 2JWZA 4G3XB 1L6VA 2VZKB 5IAAC 1C4PA 1JQ4A 3DBLI 2KYWA 4NAMA 4ICUA 3DWGC 3A33B 3NG0A 3DPDA 4KDIC 3TL5A 4CO7A 3MHZA 4ZDVA 4ITKA 1R4MI 3H6NA 1N63A 2ZNVC 2FCMA 1ZOYB 3IT6B 2N7DA 2BYVE 4RGMA 1V1PA 4M02A 3HVZA 1ZDVA 3N30A 1LO5D 3VUYA 1WE6A 3NZ3A 5FK9C 4TQ0A 3Q8CA 4FN2A 2JQRB 3N1XC 1WJNA 2JWUA 5JH5C 3NS8A 2FNJB 2QMTA 4GSWA 1FFVA 2D5GA 3RULA 1V1PB 1EU4A 3IBEA 3R66C 4B0EA 1HEZE 1JROA 2MH7A 4DHZB 4IWPA 2C5LC 4GDLA 3QHTA 4W9IA 5FKAC 2N1WA 3WANA 2V1YA 4WJOA 3TEWA 2BYEA 2DNFA 3L17A 3RNAC 1N5XA 2ZPYA 2CR5A 1YN5A 2UWQA 1WXAA 3JSVA 4XDDA 2NTSA 2LZ6A 1R4NB 2M56B 3N20C 1WMHA 4GDLB 1XLNA 3V3XA 3P4RB 3VUWA 3DCGA 1JWMD 2PVGC 1FCCC 4JWSC 2RSUA 2WXFA 1UZXB 4KV2A 3JYUA 3SD5A 3WAPA 1ROEA 1WZ0A 4LNIA 4LLGM 4N9F4 3NOBA 2VZKD 1WJ4A 4NJ7A 3ZNID 3LDZE 4TKNA 1WMHB 3PSEB 1NVID 4HPMB 3ZRFA 2LVQA 1IYFA 3IFWB 2O2VA 5T8IA 3CSFA 5JZEB 3WCQA 3GS2A 4K7WA 3KYCD 4P1BC 2PKOA 3TSSA 4BOSC 1LQBA 2ZCCA 2FCSA 3ZRCA 2J7QB 1PGAA 1IBXA 2G9HD 2Z0DB 4OW0A 3CSTA 4L1BA 1NI2A 2L7RA 1QOGA 2D3CA 4FLHA 2GI9A 3RT3B 2WGSA 3UGBB 4RH6A 5GMVA 2O2VB 4J6IA 2WDTB 4BKGA 1M94A 2KDIA 3IVFA 1YNTE 1S3SG 2IO2B 5GXGB 3LYYA 4MM3A 2ZNVB 2M8SA 1IBXB 3AXCA 4N59A 1YD8U 2WXNA 3A9JA 2WXMA 1UH6A 4JGHB 2MBBB 4K3CA 3W2DA 2WXGA 1FXIA 3SR6A 1V5OA 3RMKC 4K7UA 3NRZA 1T0RC 3JW0X 3RNCC 2KWDA 2AL3A 1WXQA 3H7PA 4MSQB 4F7ZA 1P98A 1TKYA 2GB1A 3E9SA 2DYOA 2SAKA 2GBRA 1RLFA 2FUHB 3EUB2 4ZRPA 2G1EA 3A9JB 3OLMD 2KTRA 3MC9A 2BYFA 3Q3OC 2N0SB 3IXSA 3MTNB 2PE6B 2L52A 4BOZB 2WLBA 1KRHA 2JYEA 2QEJC 3ZIMA 2BBCA 2CU3A 1TT5B 2DHZA 4YSXB 4WQOB 2DBYA 4XX5A 3TUOA 4C7ZA 2KKCA 4ZHPA 3H7PB 4LDTB 4JE3B 4P7IA 4GIVA 1MVKA 3BVGA 1FFUA 2ZW1A 1T0YA 2O6VD 2KTRB 3RNGC 2MLBA 4MGKE 4AJWA 5DPWA 2RD0A 3AE1B 1ISNA 4O1NA 5JXVA 2K22A 2IGDA 3W5VB 1VZ6A 2AYOB 3GOEA 3FAHA 2FIDA 1JCKB 2K8CA 1OEYA 1IGDA 1CK1A 2N9KA 2QHOA 2MQJA 4LNNA 1WR6E 4ZOHC 3ENEA 3ZJVA 4K7SA 1VRAB 3A9KA 3UI3A 2FCNA 2JSVX 2M17A 3EFCA 2LUEA 2KLCA 4G0NB 3VQIA 4P6VF 1HZ5A 1ZDXA 3TIXA 3QC8B 2LVOA 1DOXA 4KKJA 1I4XA 3N9YC 1XD3B 1NENB 4R3DA 1QKZA 1F1HA 5EE1A 1LGRA 3P1MA 3U7DA 4ARCA 4B95A 2KN4A 1NBFC 1B9RA 2RDHA 5IN7A 3VVWB 4W9KA 1VCBA 1SGHA 4KSKC 4W9EA 5BMGA 3UINB 5D94A 1TZOA 2LMCA 4JPSA 4ARIA 1VJKA 3PTFC 2QIEB 4II3B 2A5UA 5CHVC 5CTRC 1TYGB 2Y5CA 2R2QA 3EECA 3ZLZA 4BBNC 2H89B 4MGZE 2NBWB 2XNAC 4BZAA 2C7NB 1NEKB 3J9CA 4BKSD 1QOBA 1MG8A 4HJGE 4MH8A 4JWUC 2MEKA 3BY4B 4RGNA 2VH1A 4WQMA 4IM2A 2YVCA 3ZNGC 4WJQA 3WALA 1SEBD 2V3SA 2G3QB 1LXDA 2M19A 3BYTB 3GE3C 2DLBA 1GNUA 3BK2A 2PE9A 3RFZB 3C19A 2HD5B 2GBJA 2ZPNA 4LCDE 3B0AA 3VTWA 1LFDA 4BBNF 2BWES 3PHXB 2WXOA 3R2TA 1KF6B 3DBLB 1QLBB 1ZXIA 3H9DA 2B76B 4ZRIA 3BVZA 1K53A 4TQ1A 4WURA 3FKYA 1J0GA 2E3TA 2EELA 4I6LB 2XEWA 3RNEC 1R4MB 1UWXA 5HHDG 2WS3B 4HPPA 2NBVB 4E74A 3CWIA 1CMXB 1QT9A 1FXAA 1PDXA 4LNKA 3R3MA 3W5UB 2ACZB 2BS2B 3DDCB 3DHGC 4DHJB 1TS5A 3W1SC 4AJYB 1V6EA 2KVZA 2YLMA 3T8MA 1EM7A 4USAA 4C7YA 3TMPB 2ZCBA 2IGGA 2IYDB 4C00A 3Q8FA 2QSDA 4LJOB 1V97A 1V8CA 1QOFA 2L8JA 1JWUD 1C76A 1V80A 4HVBA 2ZZPB 3LJ3A 1FO4A 1WSPA 1TTNA 1WJ6A 4BKTA 2N9LA 2BB5A 2CJNA 4FHKA 3AM9A 3ZO5B 3TBLD 1H4RA 4D2KA 2N9EB 2KHWB 4WWOA 1WGRA 4LNFA 1G6JA 2W54A 4OVUA 3P2BA 4HK2A 3APDA 3ABVB 1XLOA 4GLSC 1KOTA 3AU5A 1ZW7A 3L0WB 3SFDB 1HA5A 2KO3A 3NHEB 1XCTL 4IWOA 3HIZA 4A3PA 4MH0E 4W9DA 1E8XA 3FC4A 4KVGB 3L08A 1ZE3D 2PMVA 1D5ZC 3MC0B 1L4DB 4FULA 1CQVA 2DZMA 3VRAB 2WU5B 2IY0B 3NY5A 4J3OD 1BMLC 2ZJDA 2IBIB 1GOZA 2L0FA 1ZKHA 2FIFA 1MI0A 3A4RA 4ANWA 2LEKA 2PLPA 3P4PB 4XE0A 5D2MB 5HI1A 3EA6A 3AEAB 3VFKA 1KLVA 3O65B 3DVGX 2HJ8A 5KHQA 4W9JA 3AEFB 4DXAB 2NTTA 1JRPA 1T0QC 2R61A 3I57A 1EWYC 1FMAD 4PYZA 2V9HA 1BXTA 2MHJA 3TJPA 3HVDA 1SBBB 1S1QB 1P1AA 3ZKJC 5J17A 1VD2A 3PLVA 1WRDB 2CS4A 1GB4A 3URYA 2FE8A 3PREA 1SIJA 4E3CA 2N9PC 2INPE 3VR9B 1SIFA 1JWSD 3ZXVA 1EF1A 1YOVB 4GXBA 4JQWC 1XO3A 2KWCA 3Q3JA 4URKA 2D10A 1VDVA 3Q8BA 3QK0A 2IJ0A 3RNBC 4K1RB 4A20A 2DAJA 4CYEA 1DGJA 4KSLC 2OHFA 1DYQA 3U7ZA 1JALA 4MJSA 1X1MA 2Q5WD 1C1YB 1RWSA 2NCNA 5AUIA 4MGIE 1FRRA 1A5RA 2ZVOA 1KJTA 4DDID 2KD0A 2C7MB 1TS4A 3MJWA 1E0ZA 2CJOA 3PT2B 3DOWA 2G45B 1RFAA 2LGXA 4TMAB 5G5HA 2C9WB 1ZUD2 2XN9C 2MJDA 5D6JB 3RI7C 1N5WA 2ZVNA 2BT6A 1VLBA 4IM0A 1Y8RC 5D3DA 1L5PA 4MJSB 2LGYA 1E7PB 2DZKA 4LJPB 4A55A 1PGBA 5BYQA 5AZHA 1FPYA 1KTKA 3B08A 4WJNA 4WJPA 1XLPA 3B1LX 1JWBD 3ZDTA 2L76A 2GMIC 2KANA 2Z8LA 1FM0D 1P0RA 4XC2A 1ZP0B 1HXYD 3L16A 2LD9A 2KJ6A 1SE4A 1QF6A 2K8HA 4HWIB 1YX5B 1WH3A 3DQVA 4G50A 3RPFC 4A8XC 5E6NA 1AYFA 4E71A 2GBNA 1OEYJ 3KUZA 1XF5L 2MSED 3ZNHB 3RCZA 3NVYA 4II2B 4FXCA 2K6QA 2KOXA 2I1JA 5EE9A 4RF1A 1BT0A 2J0JA 2MRPA 4RCOA 3AH7A 2QDFA 2BS3B 4IDIA 4RGOS 2K0PA 4K3BA 3PZ8A 4L2YA 2AWTA 2GBMA 2M0AA 4I6PA 1UD7A 1TS3A 3JVZX 3ZUNA 1SXTA 3AEGB 3AMZA 5IOIA 1D4BA 4HPLB 1LM8B 2LUMA 3BZDB 1TZ1A 1OQYA 4CHKA 2D2QA 5BYRA 4FHJA 3QIJA 4IWQA 2BTEA 4HCNB 4KGTA 2WP9B 4M01A 3WIMA 1D6EC 2WXHA 1C3TA 4GDKA 3PRZA 1EU3A 5JHAA 1WIAA 2IPKD 3DVNV 4G11A 4JIOU 4M8MA 1WJUA 1MHHE 2LXCA 3Q8EA 4PS7A 1MPEA 2WXRA 4NQLB 1PGXA 1JW9D 2KZRA 2LGIA 3R7QA 4GDKB 2I38A 5CHFA 4HKQA 4OZAA 2KMAA 4OHJA 3APCA 1MHXA 2N4FA 2X8XX 1EO6A 4EUTA 4KDLB 1IGCA 3U4EG 3M95A 3MHSD 2JVCA 4L23A 3RYTA 3B2FA 1JRUA 2G4SA 3NS1A 5FR6A 4ICVA 2WHIA 3U30A 3ECIA 2ASQA 2KWVB 3DBHB 2BW2A 2V4LA 2LGSA 3GZNI 4AWJA 2WXKA 4IC7B 3A1QA 1WXSA 3AU4A 3PZDA 1TIFA 2W9NA 2JY6A 1I4HA 2N9XA 2J4XA 3PGEA 2RDBC 5L83A 5EE0A 3MFGA 4HCPB 4MDKE 4AOFA 3HUIA 2K6DB 5G5GA 1IP9A 4US9A 2WX0A 2INDC 3LXFA 3I3TB 3H1UA 3UIPB 3W1YA 4MEMA 5J18A 3A1QB 2RDGA 2KFJA 3WA0A 4B0MA 4KGRA 1VZ8A 1WGHA 2REXA 2QJLA 2ONQA 4ZRKA 1MJDA 2KX0A 1WWTA 4ANXA 3PO0A 4ANUA 3LB8C 3UQAA 3ZTDA 2J53A 1J8CA 4F1SA 1YQBA 1SE2A 2PTLA 3P42A 3N3KB 3TEXA 2JYTA 2D07B 3RN9C 1T3QA 1L6UA 3VRBB 4DXGA 3IHPC 3KH0A 4EKUA 3MC8A 1Q0WB 2Y3AA 2OJWA 1I4QA 2RPQA 1VR9A 2KQ4X 2NR2A 4YSZB 5AUKA 3ZNZB 3N1YC 1HZ6A 1A70A 4DDGD 3DBSA 5BO4B 1N60A 4IUMB 3V05A 2K25A 1RYJA 3N1ZC 3DHHC 3KUCB 1WE7A 3QA8A 1F0ZA 1WRIA 3AE4B 3H7SA 4RM8A 4DXFA 4A3OA 2EMTA 3VTUA 2JZPA 5D7GA 1CZPA 2NPTA 2Y5BB 1P3QU 4MELA 1PFDA 1I4PA 2UU7A 3NJTA 4TV3A 2WNMA 4KZ0A 2KFKA 1WXMA 2V0GA 1E8WA 3AN1A 4EZJA 3GP7A 3X23A 4LDTD 1UWMA 5DCNA 2BQQA 2XK5A 4FJZA 3X0WA 4MACA 1QILA 1F9JA 1WF9A 3PS6A 2ON8A 2NPTB 1T6BX 1L2NA 4A90A 1YMHE 3B9JA 4EZKA 2KC2A 4N6EB 3AE2B 2CKHB 2WXPA 1XLQA 5E6JA 2KFKB 4XWWA 5E6PA 3KYDD 1V86A 4B9KA 1XEEA 4IM3A 1L4ZB 2Z0EB 3FILA 4GMVA 1DOIA 1K52A 2EKIA 3AB5A 1SB3C 2XK5B 3CMMB 3WAOA 2JZZA 2J0MA 2WWZA 1V49A 3KQ4A 4NZLB 2CHZA 3Q3MC 3ML9A 5C1ZA 4NAWA 2MWSB 1V1OA 3FILB 4NJ6A 2HE7A 5TSSA 1ZXHA 3M3JA 4WWNA 2ZEQA 5IA7A 1ET6A 3NVVA 1KFYB 1QZEA 3NZSA 1FNVA 2YEPF 2J0KA 3NUHB 1NI3A 2BS4B 3IT4B 4NAWB 3TEYA 2LHEA 2LVPA 3VXWA 1AWDA 2GOWA 1TY0A 2MCNB 3PRPB 1YN4A 1FIQA 1I4RA 4HXDA 3AE5B 2LJIA 2QILA 4N58A 2KDEB 2KDBA 2L1AA 1MG4A 3ALBA 3AE9B 3K9PB 1TY2A 3HM3A 2DYMA 5H92C 3VAWA 1EF5A 4KGSA 1D5XC 1OQQA 4LNOA 5G2NA 1KM7A 3QX1A 1UNSA 2Z59B 5DPRA 1TS2A 1SE9A 2R2OA 3RZFA 3ZDMC 1OFFA 1C4AA 4HLEA 1OQRA 3QQ8B 3HHMA 1HQRD 1WX8A 4RGTA 3EHVA 1YQ3B 2V4IB 3Q69A 1PYWD 3NZUA 2E6XA 1FNUA 3S2AA 2INNE 5DPTA 3BWUD 4HRSA 1E8YA 1J7AA 3ZYYX 1GC6A 3BIID 1ESFA 2K3UA 3I63C 3GE8C 1WYWB 4DK5A 3SFEB 2OEDA 4PYUA 2L32A 2C7HA 3Q3FA 2JXTA 4EZLA 4DHJD 1UBIA 1YJIA 2IO0B 2LXAA 3W1SA 1RM6C 2D3AA 1FRDA 1JMLA 3L10B 2DYBA 1WI0A 2LGDA 3R2IA 1WX9A 2LJ5A 4TSSA 1C79A 1I35A 4WAFA 4YT0B 1I7HA 3QCAA 3SU8X 3QJZA 2PW9A 2RMMA 5D3IB 1H8CA 1K51A 1IUEA 1TGZB 4WH4A 1F2RI 1UF0A 1V5TA 3M62B 4PS8A 3V60A 4HKZE 2KMCA 2JZ3B 3ONSA 4S0RA 4X57B 3KWLA 3TCAA 3OJ4B 1HE8A 2W3RA 3HK0A 2KJHB 4W9GA 1FXTB 1TKGA 3ZTCA 1NDDA 3I5JC 4EEWA 1M4VA 2NMQA 1WM3A 2I2YA 3PRMB 2CHXA 1ACCA 2D3GA 3QWZB 4HEA1 3AE6B 2I1KA 3IAM1 4GOCA 5KHOA 2WDRB 3RZWC 1WGYA 4ZYSA 1E10A 2GLSA 2D11A 1Q10A 1E7VA 4P1CC 4MGYE 4YL8A 5L95C 4PK1A 3GZNB 4OVVA 1E5WA 4QAYA 4ACFA 5CHWA 4PS3A 1P9DU 3R7RA 4JLCA 4OZCA 3E56A 3P4SB 1SE3A 2FAZA 2IY1B 4NQKE 1U4AA 4KX6B 1YIWA 3AE3B 5LLIA 3TEZA 2MX2A 3C8YA 2PIAA 4C80A 4ASWC 2AX5A 2AQ2B 3M63B 3AEBB 3U8ZA 1C4CA 3P4QB 1ENFA 3DBRI 4NPNA 4DBGA 3ZQ4A 4EOYA 5IP4D 3EFUA 5MPOA 3CF6E 4M0WA 1QOAA 1AARA 2AQ1B 1P7FA 3V61A 1WYGA 2EKEC 1F52A 1R7SA 1E8ZA 2INCC 4KKIA 1YJJA 4YSYB 2RGFA 3DWMA 3ZGZA 2O6VA 1KH0A 1D5MC 3QAQA 2DENB 4IKGA 4GN1A 3PZ7A 2WX1A
chains in the Genus database with same CATH topology
3I3TB 1EUVB 3H1UA 3UIPB 3PLUA 4TQ1A 3W1YA 4MEMA 2MP2B 1J0GA 4NNJB 4I6LB 3V6CB 5J18A 4M0WB 3A1QB 1WGDA 2KFJA 2XEWA 3PPAA 3WA0A 3VUXA 3KW5B 3JSVB 4HJKA 1WGHA 2REXA 2KVRA 2NBVB 4E74A 2DZIA 4ZRKA 1CMXB 3H9DA 3DVGY 2KX0A 1GJZA 4ANXA 4ANUA 4FBJB 2O6VB 3VTVA 3ZTDA 2IZVB 3UQAA 1GG3A 2JWZA 3R3MA 4G3XB 1WGGA 3VHTC 4B6WA 1J8CA 4F1SA 1YQBA 5IAAC 1WFYA 3DDCB 3PHWB 4DHJB 2KTFA 3N3KB 3W1SC 4AJYB 1V6EA 3DBLI 2D07B 4DWFA 3L54A 3VDZA 1GUAB 2YLMA 3T8MA 4ICUA 3A33B 4GU2A 3DPDA 4KDIC 3TMPB 3TL5A 2ZCBA 4CO7A 3IHPC 4ZDVA 2IYDB 3KH0A 1R4MI 3H6NA 3V62A 4EKUA 2WYQA 4FJVB 4LJOB 5LXIB 2ZNVC 1Q0WB 2IO3B 3ZVVA 1KLVA 2FCMA 2L8JA 2N7DA 2RPQA 2BYVE 2AL6A 2NR2A 1V80A 3ZNZB 4HVBA 2ZZPB 2BGFA 3LJ3A 5AZFA 3N30A 4KIKA 3VUYA 1TTNA 1WE6A 1WJ6A 4DDGD 3DBSA 2MA9B 4BKTA 5BO4B 4TQ0A 4FHKA 4FN2A 4IUMB 2K25A 4W9LA 3ZO5B 3TBLD 1H4RA 1E90A 2N9EB 3KUCB 1WJNA 2KHWB 4WWOA 1WE7A 3QA8A 5JH5C 1WGRA 1G6JA 3NS8A 4OVUA 3P2BA 3H7SA 1Q1OA 4RM8A 4A3OA 4HK2A 2FNJB 3APDA 4BKSA 5JHBA 4GSWA 1Q5WB 1KOTA 2JRIB 2EMTA 3AU5A 1ZW7A 3L0WB 3VTUA 2KO3A 3NHEB 3RULA 5D7GA 2NPTA 3PV1A 2Y5BB 3R66C 3IBEA 4IWOA 1P3QU 3HIZA 4MELA 1WY8A 4MH0E 4W9DA 4A3PA 3PVLA 1E8XA 1YJ1A 5E6OA 4TV3A 4KIKB 4BFRA 4DHZB 2KQSA 4KZ0A 4IWPA 4KVGB 2KFKA 3L08A 2C5LC 1WXMA 2VRRB 1E8WA 3QHTA 4GDLA 4W9IA 4EZJA 3SHQA 4FULA 3X23A 2DZMA 2N1WA 4LDTD 1TBEA 3WANA 2WX1A 2V1YA 4WJOA 2IY0B 2BYEA 3NY5A 3L17A 4I6NB 5DCNA 2XK5A 4FJZA 2ZJDA 4W9CA 3X0WA 3UF8A 2CU1A 2IBIB 2L0FA 2ZPYA 2CR5A 1ZKHA 2FIFA 2UWQA 1F9JA 1L7YA 1WXAA 1WF9A 2LI5A 3PS6A 5J2RA 2NPTB 1L2NA 2BPSA 3A4RA 3HM6X 3JSVA 4ANWA 4EZKA 1GC7A 2LZ6A 2KC2A 5D2MB 2CKHB 3WAMA 1E7UA 2KFKB 5E6PA 1WMHA 1V86A 3KYDD 4GDLB 1V9JA 4B9KA 1V81A 2L00B 4AP4C 4IM3A 3VFKA 2G4DB 2DZJA 2Z0EB 3DCGA 3DVGX 3O65B 2HJ8A 4GMVA 3VUWA 5KHQA 4W9JA 4XZ4A 4DXAB 1K8RB 2RSUA 4MSMB 1UZXB 2XK5B 3CMMB 3WAOA 2MW5A 4KV2A 2JZZA 3JYUA 2J0MA 3SD5A 1WM2A 2BKRB 2WWZA 3A4SC 4PYZA 3WAPA 1V49A 2GBKA 1WZ0A 3TJPA 1S1QB 1P1AA 4N9F4 2CHZA 2HTHA 3NOBA 3ZKJC 1WJ4A 4NJ7A 2JPHA 3ML9A 3IG3A 5C1ZA 4ZRJA 5J17A 3ZNID 1VD2A 1UBQA 3LDZE 3PLVA 4TKNA 1WRDB 2CS4A 4NAWA 2MWSB 2M0XA 1WMHB 3PSEB 4HPMB 3ZRFA 2LVQA 3PREA 1IYFA 1RRBA 3IFWB 2OJRA 1PQSA 1R4NI 2O2VA 4NJ6A 3CSFA 5JZEB 2B3AA 2HE7A 2BKFA 4E3CA 2N9PC 2KX3A 1SIFA 4IG7B 4K7WA 3KYCD 3M3JA 1EF1A 4GXBA 4JQWC 2KWCA 4WWNA 2ZEQA 3Q3JA 4RMAA 5IA7A 2DAFA 4BOSC 2KDFB 5DPSA 3RUIB 1LQBA 2ZCCA 2FCSA 2MBQA 3ZRCA 2J7QB 1QZEA 4URKA 2Z0DB 2D10A 3CSTA 3NZSA 1D3ZA 1WZ3A 1NI2A 2L7RA 3QK0A 2J0KA 2KK8A 4FLHA 4K1RB 4NAWB 2JF5A 3RT3B 4A20A 3UIOB 3V6EB 2KLGA 2DAJA 1WX7A 3UGBB 4CYEA 2LVPA 2MBHA 3VXWA 5GMVA 4KSLC 3RD2A 2O2VB 2AEHA 4J6IA 2WDTB 2GOWA 5EDSA 4BKGA 1M94A 2KNBA 4MJSA 1UGMA 1X1MA 2KDIA 4GB9A 4M8NA 3PRPB 1C1YB 5CX3A 3IVFA 2MCNB 2NCNA 1S3SG 2IO2B 4MGIE 3VH4B 4HXDA 1A5RA 2ZVOA 4MM3A 1KJTA 3A9KB 4DDID 4AUQC 2KD0A 2C7MB 2ZNVB 2M8SA 5TR5A 3MJWA 3AXCA 4TUUA 3PT2B 3EC8A 2LWPA 2KDEB 3DOWA 2KDBA 2OOBB 2G45B 1RFAA 2LGXA 3A9JA 3ALBA 2UYZB 1J19A 2C9WB 3K9PB 1UH6A 4JGHB 4GGQA 2MBBB 5D6JB 3VH3B 2ZVNA 5C23A 3C0RB 4IM0A 1Y8RC 2JXXA 4FADA 1V5OA 3HM3A 4K7UA 4WAAA 4MJSB 2DYMA 3JW0X 3OAWA 2LGYA 3VAWA 1EF5A 2AL3A 2DZKA 2A4ZA 2K8BA 4LJPB 5AZGA 5AZHA 3OJ3A 5G2NA 3B08A 3H7PA 4WJNA 1YX6B 4MSQB 1KM7A 4WJPA 4F7ZA 1P98A 4F8CB 3QX1A 3B1LX 2DYOA 2Z59B 5DPRA 4PYUA 2GBRA 1RLFA 3ZDTA 2JRHA 2FUHB 1I42A 1SE9A 2R2OA 3N32A 1RAXA 3A9JB 3RZFA 2L76A 3OLMD 3ZDMC 2GMIC 2KANA 1XQQA 2KTRA 4HLEA 2BYFA 3QQ8B 3HHMA 2LASA 3MTNB 3T9LA 2PE6B 1WX8A 1P0RA 4XC2A 4BOZB 3EHVA 3L16A 3ZIMA 2LD9A 2KJ6A 3NZUA 2K8HA 4HWIB 1OTRB 2DHZA 1YX5B 1Z2MA 4WQOB 3S2AA 2MBEA 1WH3A 4XX5A 3ML8A 3DQVA 2KKCA 3DVNU 5DPTA 2LRUA 3H7PB 2PJHA 4G50A 4LDTB 3L13A 1E8YA 5E6NA 4P7IA 4E71A 1GC6A 4GIVA 2GBNA 2MBOA 1OEYJ 3KUZA 2MSED 3ZNHB 3K9OB 1T0YA 1WYWB 2O6VD 4DK5A 3RCZA 2KTRB 4II2B 2K6QA 2MLBA 4MGKE 2KOXA 2I1JA 2C7HA 1OGWA 2L05A 1BT0A 2J0JA 3Q3FA 4AJWA 2LRWA 2RD0A 3ZW3A 5DPWA 1ISNA 4EZLA 4DHJD 2MRPA 2BF8B 1UBIA 4NY0A 4RM9A 2IO0B 2LXAA 2NBUA 2AYOB 3GOEA 2AWTA 2GBMA 4JL9A 3W1SA 4I6PA 1UD7A 2NVUI 3L10B 2DYBA 2FIDA 3JVZX 1WI0A 2LGDA 1WX9A 1OEYA 2K8CA 2LJ5A 3ZUNA 4W9HA 3D32A 3DBHI 4ANVA 2QHOA 1I35A 2RR9A 2MQJA 1WR6E 4HPLB 3ENEA 3QCAA 1LM8B 2M4NA 4K7SA 3SU8X 3A9KA 3QJZA 4DHZE 2FCNA 4FA6A 1H8CA 2M17A 2LUEA 1TGZB 1TZ1A 1OQYA 5G55A 2D2QA 4CHKA 2KLCA 1V5TA 3M62B 4G0NB 4FHJA 3VQIA 4PS8A 3V60A 3QIJA 3TIXA 2KMCA 3QC8B 4W9FA 2JZ3B 2LVOA 3ONSA 4IWQA 4X57B 4FJYA 4HCNB 3TCAA 1XD3B 1UELA 3OJ4B 1HE8A 2EMSA 3HK0A 2KJHB 2KJRA 1FXTB 4W9GA 2KQ7A 3ZTCA 2CHWA 1V2YA 2KWUB 3WIMA 1NDDA 4KZCA 2DX5B 1C3TA 4GDKA 3PRZA 4EEWA 3U7DA 2L3ZA 5JHAA 1WIAA 2N7EA 4B95A 2KN5A 1WM3A 3PRMB 2CHXA 1NBFC 3KVFB 3DVNV 2D3GA 4G11A 3QWZB 1XT9B 2I1KA 4GOCA 3VVWB 4W9KA 4JIOU 2PPHA 1VCBA 5KHOA 1SGHA 4KSKC 4M8MA 3SDLC 4W9EA 1WJUA 3RZWC 3UINB 1WGYA 5D94A 4BVUC 2LXCA 4PS7A 4NQLB 1WR1A 3KUDB 2D11A 2JT4B 3PTFC 5HKHA 1E7VA 2KZRA 2L0TA 4MGYE 4II3B 3R7QA 2A5UA 5CHVC 4YL8A 5L95C 5CTRC 4OVVA 1E5WA 3EECA 2R2QA 4GDKB 3ZLZA 4BBNC 4MGZE 2NBWB 5CHFA 5CHWA 4PS3A 1P9DU 2BWFA 2C7NB 3R7RA 4JLCA 2K39A 2IO1B 4BKSD 3UQBA 1MG8A 2FAZA 2KMAA 2IY1B 4NQKE 3APCA 1U4AA 4HDOA 2N4FA 2JUOA 1EO6A 2KC1A 2M1MA 4KDLB 4EUTA 3BINA 3BY4B 1YIWA 2N1VA 3M95A 3MHSD 3APFA 2JVCA 5LLIA 1Z5SB 3RYTA 2MX2A 2PEAA 4IW0A 1JRUA 3AULA 2G4SA 4ASWC 2KXJA 4IM2A 2YVCA 3ZNGC 3M63B 5FR6A 3U8ZA 4WJQA 3DBRI 3WALA 4ICVA 4NPNA 5AEKB 3U30A 2K1FA 1IPGA 4DBGA 2V3SA 3AI5A 3ECIA 4EOYA 2G3QB 1ZGUB 2ASQA 2KWVB 2XBBC 1LXDA 2V4LA 3GZNI 2MP2A 4K81A 4AWJA 3EFUA 5LXHA 4IC7B 3CF6E 3A1QA 1WXSA 3AU4A 1AARA 2NS5A 1GNUA 3PZDA 2W9NA 2PE9A 4WWPA 2JY6A 3V61A 2EKEC 2N9XA 2HD5B 3PGEA 1WXVA 2GBJA 2ZPNA 1E8ZA 4EFOA 2FCQA 5L83A 4HDQA 4LCDE 2RGFA 3B0AA 3VTWA 4HCPB 1LFDA 2C60A 4MDKE 4BBNF 4AOFA 3QARA 2BWES 4ZYNA 2O6VA 3PHXB 2K6DB 3QAQA 1IP9A 2DENB 4GN1A 2WX0A 4ZRIA 1YD8U
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3I3T B;  1EUV B;  3H1U A;  3UIP B;  3PLU A;  4TQ1 A;  3W1Y A;  4MEM A;  2MP2 B;  1J0G A;  4NNJ B;  4I6L B;  3V6C B;  5J18 A;  4M0W B;  3A1Q B;  1WGD A;  2KFJ A;  2XEW A;  3PPA A;  3WA0 A;  3VUX A;  3KW5 B;  3JSV B;  4HJK A;  1WGH A;  2REX A;  2KVR A;  2NBV B;  4E74 A;  2DZI A;  4ZRK A;  1CMX B;  3H9D A;  3DVG Y;  2KX0 A;  1GJZ A;  4ANX A;  4ANU A;  4FBJ B;  2O6V B;  3VTV A;  3ZTD A;  2IZV B;  3UQA A;  1GG3 A;  2JWZ A;  3R3M A;  4G3X B;  1WGG A;  3VHT C;  4B6W A;  1J8C A;  4F1S A;  1YQB A;  5IAA C;  1WFY A;  3DDC B;  3PHW B;  4DHJ B;  2KTF A;  3N3K B;  3W1S C;  4AJY B;  1V6E A;  3DBL I;  2D07 B;  4DWF A;  3L54 A;  3VDZ A;  1GUA B;  2YLM A;  3T8M A;  4ICU A;  3A33 B;  4GU2 A;  3DPD A;  4KDI C;  3TMP B;  3TL5 A;  2ZCB A;  4CO7 A;  3IHP C;  4ZDV A;  2IYD B;  3KH0 A;  1R4M I;  3H6N A;  3V62 A;  4EKU A;  2WYQ A;  4FJV B;  4LJO B;  5LXI B;  2ZNV C;  1Q0W B;  2IO3 B;  3ZVV A;  1KLV A;  2FCM A;  2L8J A;  2N7D A;  2RPQ A;  2BYV E;  2AL6 A;  2NR2 A;  1V80 A;  3ZNZ B;  4HVB A;  2ZZP B;  2BGF A;  3LJ3 A;  5AZF A;  3N30 A;  4KIK A;  3VUY A;  1TTN A;  1WE6 A;  1WJ6 A;  4DDG D;  3DBS A;  2MA9 B;  4BKT A;  5BO4 B;  4TQ0 A;  4FHK A;  4FN2 A;  4IUM B;  2K25 A;  4W9L A;  3ZO5 B;  3TBL D;  1H4R A;  1E90 A;  2N9E B;  3KUC B;  1WJN A;  2KHW B;  4WWO A;  1WE7 A;  3QA8 A;  5JH5 C;  1WGR A;  1G6J A;  3NS8 A;  4OVU A;  3P2B A;  3H7S A;  1Q1O A;  4RM8 A;  4A3O A;  4HK2 A;  2FNJ B;  3APD A;  4BKS A;  5JHB A;  4GSW A;  1Q5W B;  1KOT A;  2JRI B;  2EMT A;  3AU5 A;  1ZW7 A;  3L0W B;  3VTU A;  2KO3 A;  3NHE B;  3RUL A;  5D7G A;  2NPT A;  3PV1 A;  2Y5B B;  3R66 C;  3IBE A;  4IWO A;  1P3Q U;  3HIZ A;  4MEL A;  1WY8 A;  4MH0 E;  4W9D A;  4A3P A;  3PVL A;  1E8X A;  1YJ1 A;  5E6O A;  4TV3 A;  4KIK B;  4BFR A;  4DHZ B;  2KQS A;  4KZ0 A;  4IWP A;  4KVG B;  2KFK A;  3L08 A;  2C5L C;  1WXM A;  2VRR B;  1E8W A;  3QHT A;  4GDL A;  4W9I A;  4EZJ A;  3SHQ A;  4FUL A;  3X23 A;  2DZM A;  2N1W A;  4LDT D;  1TBE A;  3WAN A;  2WX1 A;  2V1Y A;  4WJO A;  2IY0 B;  2BYE A;  3NY5 A;  3L17 A;  4I6N B;  5DCN A;  2XK5 A;  4FJZ A;  2ZJD A;  4W9C A;  3X0W A;  3UF8 A;  2CU1 A;  2IBI B;  2L0F A;  2ZPY A;  2CR5 A;  1ZKH A;  2FIF A;  2UWQ A;  1F9J A;  1L7Y A;  1WXA A;  1WF9 A;  2LI5 A;  3PS6 A;  5J2R A;  2NPT B;  1L2N A;  2BPS A;  3A4R A;  3HM6 X;  3JSV A;  4ANW A;  4EZK A;  1GC7 A;  2LZ6 A;  2KC2 A;  5D2M B;  2CKH B;  3WAM A;  1E7U A;  2KFK B;  5E6P A;  1WMH A;  1V86 A;  3KYD D;  4GDL B;  1V9J A;  4B9K A;  1V81 A;  2L00 B;  4AP4 C;  4IM3 A;  3VFK A;  2G4D B;  2DZJ A;  2Z0E B;  3DCG A;  3DVG X;  3O65 B;  2HJ8 A;  4GMV A;  3VUW A;  5KHQ A;  4W9J A;  4XZ4 A;  4DXA B;  1K8R B;  2RSU A;  4MSM B;  1UZX B;  2XK5 B;  3CMM B;  3WAO A;  2MW5 A;  4KV2 A;  2JZZ A;  3JYU A;  2J0M A;  3SD5 A;  1WM2 A;  2BKR B;  2WWZ A;  3A4S C;  4PYZ A;  3WAP A;  1V49 A;  2GBK A;  1WZ0 A;  3TJP A;  1S1Q B;  1P1A A;  4N9F 4;  2CHZ A;  2HTH A;  3NOB A;  3ZKJ C;  1WJ4 A;  4NJ7 A;  2JPH A;  3ML9 A;  3IG3 A;  5C1Z A;  4ZRJ A;  5J17 A;  3ZNI D;  1VD2 A;  1UBQ A;  3LDZ E;  3PLV A;  4TKN A;  1WRD B;  2CS4 A;  4NAW A;  2MWS B;  2M0X A;  1WMH B;  3PSE B;  4HPM B;  3ZRF A;  2LVQ A;  3PRE A;  1IYF A;  1RRB A;  3IFW B;  2OJR A;  1PQS A;  1R4N I;  2O2V A;  4NJ6 A;  3CSF A;  5JZE B;  2B3A A;  2HE7 A;  2BKF A;  4E3C A;  2N9P C;  2KX3 A;  1SIF A;  4IG7 B;  4K7W A;  3KYC D;  3M3J A;  1EF1 A;  4GXB A;  4JQW C;  2KWC A;  4WWN A;  2ZEQ A;  3Q3J A;  4RMA A;  5IA7 A;  2DAF A;  4BOS C;  2KDF B;  5DPS A;  3RUI B;  1LQB A;  2ZCC A;  2FCS A;  2MBQ A;  3ZRC A;  2J7Q B;  1QZE A;  4URK A;  2Z0D B;  2D10 A;  3CST A;  3NZS A;  1D3Z A;  1WZ3 A;  1NI2 A;  2L7R A;  3QK0 A;  2J0K A;  2KK8 A;  4FLH A;  4K1R B;  4NAW B;  2JF5 A;  3RT3 B;  4A20 A;  3UIO B;  3V6E B;  2KLG A;  2DAJ A;  1WX7 A;  3UGB B;  4CYE A;  2LVP A;  2MBH A;  3VXW A;  5GMV A;  4KSL C;  3RD2 A;  2O2V B;  2AEH A;  4J6I A;  2WDT B;  2GOW A;  5EDS A;  4BKG A;  1M94 A;  2KNB A;  4MJS A;  1UGM A;  1X1M A;  2KDI A;  4GB9 A;  4M8N A;  3PRP B;  1C1Y B;  5CX3 A;  3IVF A;  2MCN B;  2NCN A;  1S3S G;  2IO2 B;  4MGI E;  3VH4 B;  4HXD A;  1A5R A;  2ZVO A;  4MM3 A;  1KJT A;  3A9K B;  4DDI D;  4AUQ C;  2KD0 A;  2C7M B;  2ZNV B;  2M8S A;  5TR5 A;  3MJW A;  3AXC A;  4TUU A;  3PT2 B;  3EC8 A;  2LWP A;  2KDE B;  3DOW A;  2KDB A;  2OOB B;  2G45 B;  1RFA A;  2LGX A;  3A9J A;  3ALB A;  2UYZ B;  1J19 A;  2C9W B;  3K9P B;  1UH6 A;  4JGH B;  4GGQ A;  2MBB B;  5D6J B;  3VH3 B;  2ZVN A;  5C23 A;  3C0R B;  4IM0 A;  1Y8R C;  2JXX A;  4FAD A;  1V5O A;  3HM3 A;  4K7U A;  4WAA A;  4MJS B;  2DYM A;  3JW0 X;  3OAW A;  2LGY A;  3VAW A;  1EF5 A;  2AL3 A;  2DZK A;  2A4Z A;  2K8B A;  4LJP B;  5AZG A;  5AZH A;  3OJ3 A;  5G2N A;  3B08 A;  3H7P A;  4WJN A;  1YX6 B;  4MSQ B;  1KM7 A;  4WJP A;  4F7Z A;  1P98 A;  4F8C B;  3QX1 A;  3B1L X;  2DYO A;  2Z59 B;  5DPR A;  4PYU A;  2GBR A;  1RLF A;  3ZDT A;  2JRH A;  2FUH B;  1I42 A;  1SE9 A;  2R2O A;  3N32 A;  1RAX A;  3A9J B;  3RZF A;  2L76 A;  3OLM D;  3ZDM C;  2GMI C;  2KAN A;  1XQQ A;  2KTR A;  4HLE A;  2BYF A;  3QQ8 B;  3HHM A;  2LAS A;  3MTN B;  3T9L A;  2PE6 B;  1WX8 A;  1P0R A;  4XC2 A;  4BOZ B;  3EHV A;  3L16 A;  3ZIM A;  2LD9 A;  2KJ6 A;  3NZU A;  2K8H A;  4HWI B;  1OTR B;  2DHZ A;  1YX5 B;  1Z2M A;  4WQO B;  3S2A A;  2MBE A;  1WH3 A;  4XX5 A;  3ML8 A;  3DQV A;  2KKC A;  3DVN U;  5DPT A;  2LRU A;  3H7P B;  2PJH A;  4G50 A;  4LDT B;  3L13 A;  1E8Y A;  5E6N A;  4P7I A;  4E71 A;  1GC6 A;  4GIV A;  2GBN A;  2MBO A;  1OEY J;  3KUZ A;  2MSE D;  3ZNH B;  3K9O B;  1T0Y A;  1WYW B;  2O6V D;  4DK5 A;  3RCZ A;  2KTR B;  4II2 B;  2K6Q A;  2MLB A;  4MGK E;  2KOX A;  2I1J A;  2C7H A;  1OGW A;  2L05 A;  1BT0 A;  2J0J A;  3Q3F A;  4AJW A;  2LRW A;  2RD0 A;  3ZW3 A;  5DPW A;  1ISN A;  4EZL A;  4DHJ D;  2MRP A;  2BF8 B;  1UBI A;  4NY0 A;  4RM9 A;  2IO0 B;  2LXA A;  2NBU A;  2AYO B;  3GOE A;  2AWT A;  2GBM A;  4JL9 A;  3W1S A;  4I6P A;  1UD7 A;  2NVU I;  3L10 B;  2DYB A;  2FID A;  3JVZ X;  1WI0 A;  2LGD A;  1WX9 A;  1OEY A;  2K8C A;  2LJ5 A;  3ZUN A;  4W9H A;  3D32 A;  3DBH I;  4ANV A;  2QHO A;  1I35 A;  2RR9 A;  2MQJ A;  1WR6 E;  4HPL B;  3ENE A;  3QCA A;  1LM8 B;  2M4N A;  4K7S A;  3SU8 X;  3A9K A;  3QJZ A;  4DHZ E;  2FCN A;  4FA6 A;  1H8C A;  2M17 A;  2LUE A;  1TGZ B;  1TZ1 A;  1OQY A;  5G55 A;  2D2Q A;  4CHK A;  2KLC A;  1V5T A;  3M62 B;  4G0N B;  4FHJ A;  3VQI A;  4PS8 A;  3V60 A;  3QIJ A;  3TIX A;  2KMC A;  3QC8 B;  4W9F A;  2JZ3 B;  2LVO A;  3ONS A;  4IWQ A;  4X57 B;  4FJY A;  4HCN B;  3TCA A;  1XD3 B;  1UEL A;  3OJ4 B;  1HE8 A;  2EMS A;  3HK0 A;  2KJH B;  2KJR A;  1FXT B;  4W9G A;  2KQ7 A;  3ZTC A;  2CHW A;  1V2Y A;  2KWU B;  3WIM A;  1NDD A;  4KZC A;  2DX5 B;  1C3T A;  4GDK A;  3PRZ A;  4EEW A;  3U7D A;  2L3Z A;  5JHA A;  1WIA A;  2N7E A;  4B95 A;  2KN5 A;  1WM3 A;  3PRM B;  2CHX A;  1NBF C;  3KVF B;  3DVN V;  2D3G A;  4G11 A;  3QWZ B;  1XT9 B;  2I1K A;  4GOC A;  3VVW B;  4W9K A;  4JIO U;  2PPH A;  1VCB A;  5KHO A;  1SGH A;  4KSK C;  4M8M A;  3SDL C;  4W9E A;  1WJU A;  3RZW C;  3UIN B;  1WGY A;  5D94 A;  4BVU C;  2LXC A;  4PS7 A;  4NQL B;  1WR1 A;  3KUD B;  2D11 A;  2JT4 B;  3PTF C;  5HKH A;  1E7V A;  2KZR A;  2L0T A;  4MGY E;  4II3 B;  3R7Q A;  2A5U A;  5CHV C;  4YL8 A;  5L95 C;  5CTR C;  4OVV A;  1E5W A;  3EEC A;  2R2Q A;  4GDK B;  3ZLZ A;  4BBN C;  4MGZ E;  2NBW B;  5CHF A;  5CHW A;  4PS3 A;  1P9D U;  2BWF A;  2C7N B;  3R7R A;  4JLC A;  2K39 A;  2IO1 B;  4BKS D;  3UQB A;  1MG8 A;  2FAZ A;  2KMA A;  2IY1 B;  4NQK E;  3APC A;  1U4A A;  4HDO A;  2N4F A;  2JUO A;  1EO6 A;  2KC1 A;  2M1M A;  4KDL B;  4EUT A;  3BIN A;  3BY4 B;  1YIW A;  2N1V A;  3M95 A;  3MHS D;  3APF A;  2JVC A;  5LLI A;  1Z5S B;  3RYT A;  2MX2 A;  2PEA A;  4IW0 A;  1JRU A;  3AUL A;  2G4S A;  4ASW C;  2KXJ A;  4IM2 A;  2YVC A;  3ZNG C;  3M63 B;  5FR6 A;  3U8Z A;  4WJQ A;  3DBR I;  3WAL A;  4ICV A;  4NPN A;  5AEK B;  3U30 A;  2K1F A;  1IPG A;  4DBG A;  2V3S A;  3AI5 A;  3ECI A;  4EOY A;  2G3Q B;  1ZGU B;  2ASQ A;  2KWV B;  2XBB C;  1LXD A;  2V4L A;  3GZN I;  2MP2 A;  4K81 A;  4AWJ A;  3EFU A;  5LXH A;  4IC7 B;  3CF6 E;  3A1Q A;  1WXS A;  3AU4 A;  1AAR A;  2NS5 A;  1GNU A;  3PZD A;  2W9N A;  2PE9 A;  4WWP A;  2JY6 A;  3V61 A;  2EKE C;  2N9X A;  2HD5 B;  3PGE A;  1WXV A;  2GBJ A;  2ZPN A;  1E8Z A;  4EFO A;  2FCQ A;  5L83 A;  4HDQ A;  4LCD E;  2RGF A;  3B0A A;  3VTW A;  4HCP B;  1LFD A;  2C60 A;  4MDK E;  4BBN F;  4AOF A;  3QAR A;  2BWE S;  4ZYN A;  2O6V A;  3PHX B;  2K6D B;  3QAQ A;  1IP9 A;  2DEN B;  4GN1 A;  2WX0 A;  4ZRI A;  1YD8 U; 
#chains in the Genus database with same CATH topology
 1EUV B;  1XCQ L;  3H8H A;  3ETR A;  3V6C B;  4M0W B;  1WGD A;  3AED B;  2L83 A;  5FR3 A;  3VUX A;  3KW5 B;  3JSV B;  4HJK A;  2KVR A;  2DZI A;  2JU6 X;  2ZW0 A;  1XXG A;  4FBJ B;  2O6V B;  2IZV B;  1WGG A;  3VHT C;  4B6W A;  1VZ7 A;  1FCL A;  1WFY A;  3PHW B;  2KTF A;  3KWV A;  4AS1 A;  3T3O A;  4DWF A;  3L54 A;  1E9M A;  3VDZ A;  1GUA B;  2KAC A;  4Q2J A;  4GU2 A;  3NVW A;  1SF0 A;  1P7E A;  3IAS 1;  1T0S C;  4AQ7 A;  1Y56 A;  3V62 A;  1J7C A;  2WYQ A;  4FJV B;  5LXI B;  3ZVV A;  2IO3 B;  5BMH A;  2AL6 A;  4HRO A;  2BGF A;  2WQY B;  4JX1 C;  4NJC A;  5AZF A;  2KDM A;  4KIK A;  1MFW A;  2MA9 B;  3AEC B;  4W9L A;  1E90 A;  1WGK A;  1K50 A;  1UGJ A;  1Q1O A;  4BKS A;  5JHB A;  1Q5W B;  2JRI B;  1L0V B;  3PV1 A;  1WY8 A;  2GRI A;  3PVL A;  1YJ1 A;  5E6O A;  4KIK B;  4BFR A;  2KQS A;  1KLU D;  2VRR B;  1I4G A;  3SHQ A;  3B2G A;  4MM3 B;  1TBE A;  2J52 A;  4I6N B;  2HJ1 A;  5IKC M;  5C3J B;  4W9C A;  3UF8 A;  2CU1 A;  2FBW B;  5EE3 A;  1E6E B;  1L7Y A;  2LI5 A;  5J2R A;  2BPS A;  3HM6 X;  1F2R C;  1GC7 A;  4DQO C;  3AE7 B;  3WAM A;  1E7U A;  2N7J A;  1V9J A;  2BB6 A;  1V81 A;  2L00 B;  4AP4 C;  2G4D B;  2DZJ A;  2PVO D;  5IO9 A;  4XZ4 A;  4ZRQ A;  1K8R B;  4MSM B;  2LFI A;  3AEE B;  3W9C B;  2MW5 A;  1BUI C;  3GB1 A;  2HTM E;  4EE2 A;  1WM2 A;  2BKR B;  3A4S C;  2GBK A;  4OVZ A;  5I4D A;  2HTH A;  4LK0 M;  2JPH A;  3IG3 A;  3Q14 C;  4ZRJ A;  1UBQ A;  2M0X A;  4YWG G;  1RRB A;  2OJR A;  1PQS A;  1R4N I;  4WWM A;  2B3A A;  2BKF A;  2KX3 A;  1NYQ A;  4IG7 B;  4LTU A;  2HDE A;  4RMA A;  3Q8A A;  2DAF A;  2K9X A;  2KDF B;  5DPS A;  3RUI B;  4US8 A;  2MBQ A;  2KMM A;  1F77 A;  4XYC A;  1D3Z A;  1WZ3 A;  2KK8 A;  2W3S A;  4M00 A;  2JF5 A;  3EGR A;  3UIO B;  3V6E B;  2KLG A;  1WX7 A;  2D3B A;  2MBH A;  3RD2 A;  2AEH A;  5EDS A;  2KNB A;  1UGM A;  4GB9 A;  4M8N A;  5CX3 A;  2WDV B;  3VH4 B;  1HTQ A;  3U2S C;  3A9K B;  4AUQ C;  2RPV A;  5TR5 A;  4TUU A;  1B1Z A;  3EC8 A;  2LWP A;  2OOB B;  3BVM A;  5HG2 A;  1C78 A;  2BYT A;  2UYZ B;  1J19 A;  4GGQ A;  3ZJU A;  3VH3 B;  2WXQ A;  4P16 A;  5C23 A;  3C0R B;  4XWT A;  2TSS A;  2JXX A;  4FAD A;  3MP9 A;  1GAQ B;  4WAA A;  1ZPS A;  3OAW A;  2WXJ A;  2K8B A;  2A4Z A;  4RNA A;  5AZG A;  3OJ3 A;  1YX6 B;  2AQ3 B;  4XGA B;  4F8C B;  4H2A A;  3ZJT A;  3ZXR A;  5BYS A;  2JRH A;  1I42 A;  3N32 A;  1RAX A;  1SJH D;  4OZB A;  1SJE D;  1XQQ A;  1PUT A;  2LAS A;  3T9L A;  2KT7 A;  4MT5 A;  1OTR B;  3R8B A;  1Z2M A;  1QQR A;  2MBE A;  4YTP B;  4YTN B;  3ML8 A;  1RFK A;  3DVN U;  2LRU A;  1GPX A;  2PJH A;  3L13 A;  2QC8 A;  1JWA D;  2JX5 A;  3U52 E;  2J42 A;  2MBO A;  1TKE A;  3K9O B;  4S17 A;  2LHD A;  4RF0 A;  3Q6B A;  2L05 A;  2X38 A;  1OGW A;  2LRW A;  3ZW3 A;  4C4V A;  2WDQ B;  2BF8 B;  4NY0 A;  4RM9 A;  2NBU A;  4JL9 A;  5H8Y E;  1J7B A;  2NVU I;  3L4P A;  1EWC A;  1STE A;  3P63 A;  1L0Y B;  4W9H A;  3D32 A;  3DBH I;  2WU2 B;  4ANV A;  3HRD D;  1YN3 A;  2RR9 A;  2IDY A;  2SEB D;  2MJE A;  3MJ5 A;  2M4N A;  4RFB A;  4CQN A;  4DHZ E;  4FA6 A;  5G55 A;  2IGH A;  3O13 A;  2KAJ A;  4C4V B;  4W9F A;  1SSN A;  4A6Q A;  4FJY A;  1FEH A;  1UEL A;  2EMS A;  2KJR A;  3CIR B;  2KQ7 A;  3I9V 1;  2CHW A;  1V2Y A;  2KWU B;  3SEB A;  4KZC A;  2DX5 B;  1C77 A;  2L3Z A;  2N7E A;  1UUP A;  2KN5 A;  3RNF C;  3KVF B;  2W82 A;  1XT9 B;  3BYY B;  4REZ A;  3KLS X;  2K5P A;  2W55 A;  2PPH A;  3SDL C;  1HTO A;  1CJE A;  4BVU C;  2V3P A;  3DBR B;  1WR1 A;  3AV8 A;  3KUD B;  2Y5P A;  2JT4 B;  5HKH A;  2L0T A;  5BMI A;  1L0X B;  4YXD B;  3NVZ A;  5LNK 1;  2WXL A;  2BWF A;  2K39 A;  2IO1 B;  3BK1 A;  3UQB A;  5C2T B;  4HDO A;  2JUO A;  2KC1 A;  2M1M A;  3BIN A;  4BAX A;  4XDC A;  2N1V A;  1TJE A;  2V3N A;  3APF A;  1Z5S B;  2MJ3 A;  2PEA A;  4IW0 A;  2H88 B;  3AUL A;  2DWQ A;  1FD6 A;  2KXJ A;  3Q3N C;  4IOI E;  4WIP A;  3VR8 B;  1DOY A;  3AE8 B;  5AEK B;  1GB1 A;  2K1F A;  1IPG A;  3AI5 A;  1AN8 A;  1ZGU B;  1ET9 A;  2XBB C;  2MP2 A;  4K81 A;  3Q2A C;  5LXH A;  1FNW A;  2NS5 A;  1N6Z A;  3OG5 A;  4WWP A;  4A9A A;  4C56 C;  1WXV A;  4EFO A;  3OWE B;  2FCQ A;  4HDQ A;  4PT5 A;  3T3N A;  2C60 A;  3QAR A;  4ZYN A;  4ZHO A;  2BVC A;  2YEP B;  2WXI A;  5HFY A;  1C9F A;  1NYR A;  1N61 A;  3PLU A;  2MP2 B;  4NNJ B;  1KLG D;  1T5X D;  2QCZ A;  3DHI C;  3PPA A;  1YQ4 B;  1N62 A;  4YTM B;  2ICI A;  1AW7 A;  2FUG 1;  2VH2 A;  3DVG Y;  1GJZ A;  3VTV A;  4UDU C;  1GG3 A;  2JWZ A;  4G3X B;  1L6V A;  2VZK B;  5IAA C;  1C4P A;  1JQ4 A;  3DBL I;  2KYW A;  4NAM A;  4ICU A;  3DWG C;  3A33 B;  3NG0 A;  3DPD A;  4KDI C;  3TL5 A;  4CO7 A;  3MHZ A;  4ZDV A;  4ITK A;  1R4M I;  3H6N A;  1N63 A;  2ZNV C;  2FCM A;  1ZOY B;  3IT6 B;  2N7D A;  2BYV E;  4RGM A;  1V1P A;  4M02 A;  3HVZ A;  1ZDV A;  3N30 A;  1LO5 D;  3VUY A;  1WE6 A;  3NZ3 A;  5FK9 C;  4TQ0 A;  3Q8C A;  4FN2 A;  2JQR B;  3N1X C;  1WJN A;  2JWU A;  5JH5 C;  3NS8 A;  2FNJ B;  2QMT A;  4GSW A;  1FFV A;  2D5G A;  3RUL A;  1V1P B;  1EU4 A;  3IBE A;  3R66 C;  4B0E A;  1HEZ E;  1JRO A;  2MH7 A;  4DHZ B;  4IWP A;  2C5L C;  4GDL A;  3QHT A;  4W9I A;  5FKA C;  2N1W A;  3WAN A;  2V1Y A;  4WJO A;  3TEW A;  2BYE A;  2DNF A;  3L17 A;  3RNA C;  1N5X A;  2ZPY A;  2CR5 A;  1YN5 A;  2UWQ A;  1WXA A;  3JSV A;  4XDD A;  2NTS A;  2LZ6 A;  1R4N B;  2M56 B;  3N20 C;  1WMH A;  4GDL B;  1XLN A;  3V3X A;  3P4R B;  3VUW A;  3DCG A;  1JWM D;  2PVG C;  1FCC C;  4JWS C;  2RSU A;  2WXF A;  1UZX B;  4KV2 A;  3JYU A;  3SD5 A;  3WAP A;  1ROE A;  1WZ0 A;  4LNI A;  4LLG M;  4N9F 4;  3NOB A;  2VZK D;  1WJ4 A;  4NJ7 A;  3ZNI D;  3LDZ E;  4TKN A;  1WMH B;  3PSE B;  1NVI D;  4HPM B;  3ZRF A;  2LVQ A;  1IYF A;  3IFW B;  2O2V A;  5T8I A;  3CSF A;  5JZE B;  3WCQ A;  3GS2 A;  4K7W A;  3KYC D;  4P1B C;  2PKO A;  3TSS A;  4BOS C;  1LQB A;  2ZCC A;  2FCS A;  3ZRC A;  2J7Q B;  1PGA A;  1IBX A;  2G9H D;  2Z0D B;  4OW0 A;  3CST A;  4L1B A;  1NI2 A;  2L7R A;  1QOG A;  2D3C A;  4FLH A;  2GI9 A;  3RT3 B;  2WGS A;  3UGB B;  4RH6 A;  5GMV A;  2O2V B;  4J6I A;  2WDT B;  4BKG A;  1M94 A;  2KDI A;  3IVF A;  1YNT E;  1S3S G;  2IO2 B;  5GXG B;  3LYY A;  4MM3 A;  2ZNV B;  2M8S A;  1IBX B;  3AXC A;  4N59 A;  1YD8 U;  2WXN A;  3A9J A;  2WXM A;  1UH6 A;  4JGH B;  2MBB B;  4K3C A;  3W2D A;  2WXG A;  1FXI A;  3SR6 A;  1V5O A;  3RMK C;  4K7U A;  3NRZ A;  1T0R C;  3JW0 X;  3RNC C;  2KWD A;  2AL3 A;  1WXQ A;  3H7P A;  4MSQ B;  4F7Z A;  1P98 A;  1TKY A;  2GB1 A;  3E9S A;  2DYO A;  2SAK A;  2GBR A;  1RLF A;  2FUH B;  3EUB 2;  4ZRP A;  2G1E A;  3A9J B;  3OLM D;  2KTR A;  3MC9 A;  2BYF A;  3Q3O C;  2N0S B;  3IXS A;  3MTN B;  2PE6 B;  2L52 A;  4BOZ B;  2WLB A;  1KRH A;  2JYE A;  2QEJ C;  3ZIM A;  2BBC A;  2CU3 A;  1TT5 B;  2DHZ A;  4YSX B;  4WQO B;  2DBY A;  4XX5 A;  3TUO A;  4C7Z A;  2KKC A;  4ZHP A;  3H7P B;  4LDT B;  4JE3 B;  4P7I A;  4GIV A;  1MVK A;  3BVG A;  1FFU A;  2ZW1 A;  1T0Y A;  2O6V D;  2KTR B;  3RNG C;  2MLB A;  4MGK E;  4AJW A;  5DPW A;  2RD0 A;  3AE1 B;  1ISN A;  4O1N A;  5JXV A;  2K22 A;  2IGD A;  3W5V B;  1VZ6 A;  2AYO B;  3GOE A;  3FAH A;  2FID A;  1JCK B;  2K8C A;  1OEY A;  1IGD A;  1CK1 A;  2N9K A;  2QHO A;  2MQJ A;  4LNN A;  1WR6 E;  4ZOH C;  3ENE A;  3ZJV A;  4K7S A;  1VRA B;  3A9K A;  3UI3 A;  2FCN A;  2JSV X;  2M17 A;  3EFC A;  2LUE A;  2KLC A;  4G0N B;  3VQI A;  4P6V F;  1HZ5 A;  1ZDX A;  3TIX A;  3QC8 B;  2LVO A;  1DOX A;  4KKJ A;  1I4X A;  3N9Y C;  1XD3 B;  1NEN B;  4R3D A;  1QKZ A;  1F1H A;  5EE1 A;  1LGR A;  3P1M A;  3U7D A;  4ARC A;  4B95 A;  2KN4 A;  1NBF C;  1B9R A;  2RDH A;  5IN7 A;  3VVW B;  4W9K A;  1VCB A;  1SGH A;  4KSK C;  4W9E A;  5BMG A;  3UIN B;  5D94 A;  1TZO A;  2LMC A;  4JPS A;  4ARI A;  1VJK A;  3PTF C;  2QIE B;  4II3 B;  2A5U A;  5CHV C;  5CTR C;  1TYG B;  2Y5C A;  2R2Q A;  3EEC A;  3ZLZ A;  4BBN C;  2H89 B;  4MGZ E;  2NBW B;  2XNA C;  4BZA A;  2C7N B;  1NEK B;  3J9C A;  4BKS D;  1QOB A;  1MG8 A;  4HJG E;  4MH8 A;  4JWU C;  2MEK A;  3BY4 B;  4RGN A;  2VH1 A;  4WQM A;  4IM2 A;  2YVC A;  3ZNG C;  4WJQ A;  3WAL A;  1SEB D;  2V3S A;  2G3Q B;  1LXD A;  2M19 A;  3BYT B;  3GE3 C;  2DLB A;  1GNU A;  3BK2 A;  2PE9 A;  3RFZ B;  3C19 A;  2HD5 B;  2GBJ A;  2ZPN A;  4LCD E;  3B0A A;  3VTW A;  1LFD A;  4BBN F;  2BWE S;  3PHX B;  2WXO A;  3R2T A;  1KF6 B;  3DBL B;  1QLB B;  1ZXI A;  3H9D A;  2B76 B;  4ZRI A;  3BVZ A;  1K53 A;  4TQ1 A;  4WUR A;  3FKY A;  1J0G A;  2E3T A;  2EEL A;  4I6L B;  2XEW A;  3RNE C;  1R4M B;  1UWX A;  5HHD G;  2WS3 B;  4HPP A;  2NBV B;  4E74 A;  3CWI A;  1CMX B;  1QT9 A;  1FXA A;  1PDX A;  4LNK A;  3R3M A;  3W5U B;  2ACZ B;  2BS2 B;  3DDC B;  3DHG C;  4DHJ B;  1TS5 A;  3W1S C;  4AJY B;  1V6E A;  2KVZ A;  2YLM A;  3T8M A;  1EM7 A;  4USA A;  4C7Y A;  3TMP B;  2ZCB A;  2IGG A;  2IYD B;  4C00 A;  3Q8F A;  2QSD A;  4LJO B;  1V97 A;  1V8C A;  1QOF A;  2L8J A;  1JWU D;  1C76 A;  1V80 A;  4HVB A;  2ZZP B;  3LJ3 A;  1FO4 A;  1WSP A;  1TTN A;  1WJ6 A;  4BKT A;  2N9L A;  2BB5 A;  2CJN A;  4FHK A;  3AM9 A;  3ZO5 B;  3TBL D;  1H4R A;  4D2K A;  2N9E B;  2KHW B;  4WWO A;  1WGR A;  4LNF A;  1G6J A;  2W54 A;  4OVU A;  3P2B A;  4HK2 A;  3APD A;  3ABV B;  1XLO A;  4GLS C;  1KOT A;  3AU5 A;  1ZW7 A;  3L0W B;  3SFD B;  1HA5 A;  2KO3 A;  3NHE B;  1XCT L;  4IWO A;  3HIZ A;  4A3P A;  4MH0 E;  4W9D A;  1E8X A;  3FC4 A;  4KVG B;  3L08 A;  1ZE3 D;  2PMV A;  1D5Z C;  3MC0 B;  1L4D B;  4FUL A;  1CQV A;  2DZM A;  3VRA B;  2WU5 B;  2IY0 B;  3NY5 A;  4J3O D;  1BML C;  2ZJD A;  2IBI B;  1GOZ A;  2L0F A;  1ZKH A;  2FIF A;  1MI0 A;  3A4R A;  4ANW A;  2LEK A;  2PLP A;  3P4P B;  4XE0 A;  5D2M B;  5HI1 A;  3EA6 A;  3AEA B;  3VFK A;  1KLV A;  3O65 B;  3DVG X;  2HJ8 A;  5KHQ A;  4W9J A;  3AEF B;  4DXA B;  2NTT A;  1JRP A;  1T0Q C;  2R61 A;  3I57 A;  1EWY C;  1FMA D;  4PYZ A;  2V9H A;  1BXT A;  2MHJ A;  3TJP A;  3HVD A;  1SBB B;  1S1Q B;  1P1A A;  3ZKJ C;  5J17 A;  1VD2 A;  3PLV A;  1WRD B;  2CS4 A;  1GB4 A;  3URY A;  2FE8 A;  3PRE A;  1SIJ A;  4E3C A;  2N9P C;  2INP E;  3VR9 B;  1SIF A;  1JWS D;  3ZXV A;  1EF1 A;  1YOV B;  4GXB A;  4JQW C;  1XO3 A;  2KWC A;  3Q3J A;  4URK A;  2D10 A;  1VDV A;  3Q8B A;  3QK0 A;  2IJ0 A;  3RNB C;  4K1R B;  4A20 A;  2DAJ A;  4CYE A;  1DGJ A;  4KSL C;  2OHF A;  1DYQ A;  3U7Z A;  1JAL A;  4MJS A;  1X1M A;  2Q5W D;  1C1Y B;  1RWS A;  2NCN A;  5AUI A;  4MGI E;  1FRR A;  1A5R A;  2ZVO A;  1KJT A;  4DDI D;  2KD0 A;  2C7M B;  1TS4 A;  3MJW A;  1E0Z A;  2CJO A;  3PT2 B;  3DOW A;  2G45 B;  1RFA A;  2LGX A;  4TMA B;  5G5H A;  2C9W B;  1ZUD 2;  2XN9 C;  2MJD A;  5D6J B;  3RI7 C;  1N5W A;  2ZVN A;  2BT6 A;  1VLB A;  4IM0 A;  1Y8R C;  5D3D A;  1L5P A;  4MJS B;  2LGY A;  1E7P B;  2DZK A;  4LJP B;  4A55 A;  1PGB A;  5BYQ A;  5AZH A;  1FPY A;  1KTK A;  3B08 A;  4WJN A;  4WJP A;  1XLP A;  3B1L X;  1JWB D;  3ZDT A;  2L76 A;  2GMI C;  2KAN A;  2Z8L A;  1FM0 D;  1P0R A;  4XC2 A;  1ZP0 B;  1HXY D;  3L16 A;  2LD9 A;  2KJ6 A;  1SE4 A;  1QF6 A;  2K8H A;  4HWI B;  1YX5 B;  1WH3 A;  3DQV A;  4G50 A;  3RPF C;  4A8X C;  5E6N A;  1AYF A;  4E71 A;  2GBN A;  1OEY J;  3KUZ A;  1XF5 L;  2MSE D;  3ZNH B;  3RCZ A;  3NVY A;  4II2 B;  4FXC A;  2K6Q A;  2KOX A;  2I1J A;  5EE9 A;  4RF1 A;  1BT0 A;  2J0J A;  2MRP A;  4RCO A;  3AH7 A;  2QDF A;  2BS3 B;  4IDI A;  4RGO S;  2K0P A;  4K3B A;  3PZ8 A;  4L2Y A;  2AWT A;  2GBM A;  2M0A A;  4I6P A;  1UD7 A;  1TS3 A;  3JVZ X;  3ZUN A;  1SXT A;  3AEG B;  3AMZ A;  5IOI A;  1D4B A;  4HPL B;  1LM8 B;  2LUM A;  3BZD B;  1TZ1 A;  1OQY A;  4CHK A;  2D2Q A;  5BYR A;  4FHJ A;  3QIJ A;  4IWQ A;  2BTE A;  4HCN B;  4KGT A;  2WP9 B;  4M01 A;  3WIM A;  1D6E C;  2WXH A;  1C3T A;  4GDK A;  3PRZ A;  1EU3 A;  5JHA A;  1WIA A;  2IPK D;  3DVN V;  4G11 A;  4JIO U;  4M8M A;  1WJU A;  1MHH E;  2LXC A;  3Q8E A;  4PS7 A;  1MPE A;  2WXR A;  4NQL B;  1PGX A;  1JW9 D;  2KZR A;  2LGI A;  3R7Q A;  4GDK B;  2I38 A;  5CHF A;  4HKQ A;  4OZA A;  2KMA A;  4OHJ A;  3APC A;  1MHX A;  2N4F A;  2X8X X;  1EO6 A;  4EUT A;  4KDL B;  1IGC A;  3U4E G;  3M95 A;  3MHS D;  2JVC A;  4L23 A;  3RYT A;  3B2F A;  1JRU A;  2G4S A;  3NS1 A;  5FR6 A;  4ICV A;  2WHI A;  3U30 A;  3ECI A;  2ASQ A;  2KWV B;  3DBH B;  2BW2 A;  2V4L A;  2LGS A;  3GZN I;  4AWJ A;  2WXK A;  4IC7 B;  3A1Q A;  1WXS A;  3AU4 A;  3PZD A;  1TIF A;  2W9N A;  2JY6 A;  1I4H A;  2N9X A;  2J4X A;  3PGE A;  2RDB C;  5L83 A;  5EE0 A;  3MFG A;  4HCP B;  4MDK E;  4AOF A;  3HUI A;  2K6D B;  5G5G A;  1IP9 A;  4US9 A;  2WX0 A;  2IND C;  3LXF A;  3I3T B;  3H1U A;  3UIP B;  3W1Y A;  4MEM A;  5J18 A;  3A1Q B;  2RDG A;  2KFJ A;  3WA0 A;  4B0M A;  4KGR A;  1VZ8 A;  1WGH A;  2REX A;  2QJL A;  2ONQ A;  4ZRK A;  1MJD A;  2KX0 A;  1WWT A;  4ANX A;  3PO0 A;  4ANU A;  3LB8 C;  3UQA A;  3ZTD A;  2J53 A;  1J8C A;  4F1S A;  1YQB A;  1SE2 A;  2PTL A;  3P42 A;  3N3K B;  3TEX A;  2JYT A;  2D07 B;  3RN9 C;  1T3Q A;  1L6U A;  3VRB B;  4DXG A;  3IHP C;  3KH0 A;  4EKU A;  3MC8 A;  1Q0W B;  2Y3A A;  2OJW A;  1I4Q A;  2RPQ A;  1VR9 A;  2KQ4 X;  2NR2 A;  4YSZ B;  5AUK A;  3ZNZ B;  3N1Y C;  1HZ6 A;  1A70 A;  4DDG D;  3DBS A;  5BO4 B;  1N60 A;  4IUM B;  3V05 A;  2K25 A;  1RYJ A;  3N1Z C;  3DHH C;  3KUC B;  1WE7 A;  3QA8 A;  1F0Z A;  1WRI A;  3AE4 B;  3H7S A;  4RM8 A;  4DXF A;  4A3O A;  2EMT A;  3VTU A;  2JZP A;  5D7G A;  1CZP A;  2NPT A;  2Y5B B;  1P3Q U;  4MEL A;  1PFD A;  1I4P A;  2UU7 A;  3NJT A;  4TV3 A;  2WNM A;  4KZ0 A;  2KFK A;  1WXM A;  2V0G A;  1E8W A;  3AN1 A;  4EZJ A;  3GP7 A;  3X23 A;  4LDT D;  1UWM A;  5DCN A;  2BQQ A;  2XK5 A;  4FJZ A;  3X0W A;  4MAC A;  1QIL A;  1F9J A;  1WF9 A;  3PS6 A;  2ON8 A;  2NPT B;  1T6B X;  1L2N A;  4A90 A;  1YMH E;  3B9J A;  4EZK A;  2KC2 A;  4N6E B;  3AE2 B;  2CKH B;  2WXP A;  1XLQ A;  5E6J A;  2KFK B;  4XWW A;  5E6P A;  3KYD D;  1V86 A;  4B9K A;  1XEE A;  4IM3 A;  1L4Z B;  2Z0E B;  3FIL A;  4GMV A;  1DOI A;  1K52 A;  2EKI A;  3AB5 A;  1SB3 C;  2XK5 B;  3CMM B;  3WAO A;  2JZZ A;  2J0M A;  2WWZ A;  1V49 A;  3KQ4 A;  4NZL B;  2CHZ A;  3Q3M C;  3ML9 A;  5C1Z A;  4NAW A;  2MWS B;  1V1O A;  3FIL B;  4NJ6 A;  2HE7 A;  5TSS A;  1ZXH A;  3M3J A;  4WWN A;  2ZEQ A;  5IA7 A;  1ET6 A;  3NVV A;  1KFY B;  1QZE A;  3NZS A;  1FNV A;  2YEP F;  2J0K A;  3NUH B;  1NI3 A;  2BS4 B;  3IT4 B;  4NAW B;  3TEY A;  2LHE A;  2LVP A;  3VXW A;  1AWD A;  2GOW A;  1TY0 A;  2MCN B;  3PRP B;  1YN4 A;  1FIQ A;  1I4R A;  4HXD A;  3AE5 B;  2LJI A;  2QIL A;  4N58 A;  2KDE B;  2KDB A;  2L1A A;  1MG4 A;  3ALB A;  3AE9 B;  3K9P B;  1TY2 A;  3HM3 A;  2DYM A;  5H92 C;  3VAW A;  1EF5 A;  4KGS A;  1D5X C;  1OQQ A;  4LNO A;  5G2N A;  1KM7 A;  3QX1 A;  1UNS A;  2Z59 B;  5DPR A;  1TS2 A;  1SE9 A;  2R2O A;  3RZF A;  3ZDM C;  1OFF A;  1C4A A;  4HLE A;  1OQR A;  3QQ8 B;  3HHM A;  1HQR D;  1WX8 A;  4RGT A;  3EHV A;  1YQ3 B;  2V4I B;  3Q69 A;  1PYW D;  3NZU A;  2E6X A;  1FNU A;  3S2A A;  2INN E;  5DPT A;  3BWU D;  4HRS A;  1E8Y A;  1J7A A;  3ZYY X;  1GC6 A;  3BII D;  1ESF A;  2K3U A;  3I63 C;  3GE8 C;  1WYW B;  4DK5 A;  3SFE B;  2OED A;  4PYU A;  2L32 A;  2C7H A;  3Q3F A;  2JXT A;  4EZL A;  4DHJ D;  1UBI A;  1YJI A;  2IO0 B;  2LXA A;  3W1S A;  1RM6 C;  2D3A A;  1FRD A;  1JML A;  3L10 B;  2DYB A;  1WI0 A;  2LGD A;  3R2I A;  1WX9 A;  2LJ5 A;  4TSS A;  1C79 A;  1I35 A;  4WAF A;  4YT0 B;  1I7H A;  3QCA A;  3SU8 X;  3QJZ A;  2PW9 A;  2RMM A;  5D3I B;  1H8C A;  1K51 A;  1IUE A;  1TGZ B;  4WH4 A;  1F2R I;  1UF0 A;  1V5T A;  3M62 B;  4PS8 A;  3V60 A;  4HKZ E;  2KMC A;  2JZ3 B;  3ONS A;  4S0R A;  4X57 B;  3KWL A;  3TCA A;  3OJ4 B;  1HE8 A;  2W3R A;  3HK0 A;  2KJH B;  4W9G A;  1FXT B;  1TKG A;  3ZTC A;  1NDD A;  3I5J C;  4EEW A;  1M4V A;  2NMQ A;  1WM3 A;  2I2Y A;  3PRM B;  2CHX A;  1ACC A;  2D3G A;  3QWZ B;  4HEA 1;  3AE6 B;  2I1K A;  3IAM 1;  4GOC A;  5KHO A;  2WDR B;  3RZW C;  1WGY A;  4ZYS A;  1E10 A;  2GLS A;  2D11 A;  1Q10 A;  1E7V A;  4P1C C;  4MGY E;  4YL8 A;  5L95 C;  4PK1 A;  3GZN B;  4OVV A;  1E5W A;  4QAY A;  4ACF A;  5CHW A;  4PS3 A;  1P9D U;  3R7R A;  4JLC A;  4OZC A;  3E56 A;  3P4S B;  1SE3 A;  2FAZ A;  2IY1 B;  4NQK E;  1U4A A;  4KX6 B;  1YIW A;  3AE3 B;  5LLI A;  3TEZ A;  2MX2 A;  3C8Y A;  2PIA A;  4C80 A;  4ASW C;  2AX5 A;  2AQ2 B;  3M63 B;  3AEB B;  3U8Z A;  1C4C A;  3P4Q B;  1ENF A;  3DBR I;  4NPN A;  4DBG A;  3ZQ4 A;  4EOY A;  5IP4 D;  3EFU A;  5MPO A;  3CF6 E;  4M0W A;  1QOA A;  1AAR A;  2AQ1 B;  1P7F A;  3V61 A;  1WYG A;  2EKE C;  1F52 A;  1R7S A;  1E8Z A;  2INC C;  4KKI A;  1YJJ A;  4YSY B;  2RGF A;  3DWM A;  3ZGZ A;  2O6V A;  1KH0 A;  1D5M C;  3QAQ A;  2DEN B;  4IKG A;  4GN1 A;  3PZ7 A;  2WX1 A; 
#chains in the Genus database with same CATH homology
 3I3T B;  1EUV B;  3H1U A;  3UIP B;  3PLU A;  4TQ1 A;  3W1Y A;  4MEM A;  2MP2 B;  1J0G A;  4NNJ B;  4I6L B;  3V6C B;  5J18 A;  4M0W B;  3A1Q B;  1WGD A;  2KFJ A;  2XEW A;  3PPA A;  3WA0 A;  3VUX A;  3KW5 B;  3JSV B;  4HJK A;  1WGH A;  2REX A;  2KVR A;  2NBV B;  4E74 A;  2DZI A;  4ZRK A;  1CMX B;  3H9D A;  3DVG Y;  2KX0 A;  1GJZ A;  4ANX A;  4ANU A;  4FBJ B;  2O6V B;  3VTV A;  3ZTD A;  2IZV B;  3UQA A;  1GG3 A;  2JWZ A;  3R3M A;  4G3X B;  1WGG A;  3VHT C;  4B6W A;  1J8C A;  4F1S A;  1YQB A;  5IAA C;  1WFY A;  3DDC B;  3PHW B;  4DHJ B;  2KTF A;  3N3K B;  3W1S C;  4AJY B;  1V6E A;  3DBL I;  2D07 B;  4DWF A;  3L54 A;  3VDZ A;  1GUA B;  2YLM A;  3T8M A;  4ICU A;  3A33 B;  4GU2 A;  3DPD A;  4KDI C;  3TMP B;  3TL5 A;  2ZCB A;  4CO7 A;  3IHP C;  4ZDV A;  2IYD B;  3KH0 A;  1R4M I;  3H6N A;  3V62 A;  4EKU A;  2WYQ A;  4FJV B;  4LJO B;  5LXI B;  2ZNV C;  1Q0W B;  2IO3 B;  3ZVV A;  1KLV A;  2FCM A;  2L8J A;  2N7D A;  2RPQ A;  2BYV E;  2AL6 A;  2NR2 A;  1V80 A;  3ZNZ B;  4HVB A;  2ZZP B;  2BGF A;  3LJ3 A;  5AZF A;  3N30 A;  4KIK A;  3VUY A;  1TTN A;  1WE6 A;  1WJ6 A;  4DDG D;  3DBS A;  2MA9 B;  4BKT A;  5BO4 B;  4TQ0 A;  4FHK A;  4FN2 A;  4IUM B;  2K25 A;  4W9L A;  3ZO5 B;  3TBL D;  1H4R A;  1E90 A;  2N9E B;  3KUC B;  1WJN A;  2KHW B;  4WWO A;  1WE7 A;  3QA8 A;  5JH5 C;  1WGR A;  1G6J A;  3NS8 A;  4OVU A;  3P2B A;  3H7S A;  1Q1O A;  4RM8 A;  4A3O A;  4HK2 A;  2FNJ B;  3APD A;  4BKS A;  5JHB A;  4GSW A;  1Q5W B;  1KOT A;  2JRI B;  2EMT A;  3AU5 A;  1ZW7 A;  3L0W B;  3VTU A;  2KO3 A;  3NHE B;  3RUL A;  5D7G A;  2NPT A;  3PV1 A;  2Y5B B;  3R66 C;  3IBE A;  4IWO A;  1P3Q U;  3HIZ A;  4MEL A;  1WY8 A;  4MH0 E;  4W9D A;  4A3P A;  3PVL A;  1E8X A;  1YJ1 A;  5E6O A;  4TV3 A;  4KIK B;  4BFR A;  4DHZ B;  2KQS A;  4KZ0 A;  4IWP A;  4KVG B;  2KFK A;  3L08 A;  2C5L C;  1WXM A;  2VRR B;  1E8W A;  3QHT A;  4GDL A;  4W9I A;  4EZJ A;  3SHQ A;  4FUL A;  3X23 A;  2DZM A;  2N1W A;  4LDT D;  1TBE A;  3WAN A;  2WX1 A;  2V1Y A;  4WJO A;  2IY0 B;  2BYE A;  3NY5 A;  3L17 A;  4I6N B;  5DCN A;  2XK5 A;  4FJZ A;  2ZJD A;  4W9C A;  3X0W A;  3UF8 A;  2CU1 A;  2IBI B;  2L0F A;  2ZPY A;  2CR5 A;  1ZKH A;  2FIF A;  2UWQ A;  1F9J A;  1L7Y A;  1WXA A;  1WF9 A;  2LI5 A;  3PS6 A;  5J2R A;  2NPT B;  1L2N A;  2BPS A;  3A4R A;  3HM6 X;  3JSV A;  4ANW A;  4EZK A;  1GC7 A;  2LZ6 A;  2KC2 A;  5D2M B;  2CKH B;  3WAM A;  1E7U A;  2KFK B;  5E6P A;  1WMH A;  1V86 A;  3KYD D;  4GDL B;  1V9J A;  4B9K A;  1V81 A;  2L00 B;  4AP4 C;  4IM3 A;  3VFK A;  2G4D B;  2DZJ A;  2Z0E B;  3DCG A;  3DVG X;  3O65 B;  2HJ8 A;  4GMV A;  3VUW A;  5KHQ A;  4W9J A;  4XZ4 A;  4DXA B;  1K8R B;  2RSU A;  4MSM B;  1UZX B;  2XK5 B;  3CMM B;  3WAO A;  2MW5 A;  4KV2 A;  2JZZ A;  3JYU A;  2J0M A;  3SD5 A;  1WM2 A;  2BKR B;  2WWZ A;  3A4S C;  4PYZ A;  3WAP A;  1V49 A;  2GBK A;  1WZ0 A;  3TJP A;  1S1Q B;  1P1A A;  4N9F 4;  2CHZ A;  2HTH A;  3NOB A;  3ZKJ C;  1WJ4 A;  4NJ7 A;  2JPH A;  3ML9 A;  3IG3 A;  5C1Z A;  4ZRJ A;  5J17 A;  3ZNI D;  1VD2 A;  1UBQ A;  3LDZ E;  3PLV A;  4TKN A;  1WRD B;  2CS4 A;  4NAW A;  2MWS B;  2M0X A;  1WMH B;  3PSE B;  4HPM B;  3ZRF A;  2LVQ A;  3PRE A;  1IYF A;  1RRB A;  3IFW B;  2OJR A;  1PQS A;  1R4N I;  2O2V A;  4NJ6 A;  3CSF A;  5JZE B;  2B3A A;  2HE7 A;  2BKF A;  4E3C A;  2N9P C;  2KX3 A;  1SIF A;  4IG7 B;  4K7W A;  3KYC D;  3M3J A;  1EF1 A;  4GXB A;  4JQW C;  2KWC A;  4WWN A;  2ZEQ A;  3Q3J A;  4RMA A;  5IA7 A;  2DAF A;  4BOS C;  2KDF B;  5DPS A;  3RUI B;  1LQB A;  2ZCC A;  2FCS A;  2MBQ A;  3ZRC A;  2J7Q B;  1QZE A;  4URK A;  2Z0D B;  2D10 A;  3CST A;  3NZS A;  1D3Z A;  1WZ3 A;  1NI2 A;  2L7R A;  3QK0 A;  2J0K A;  2KK8 A;  4FLH A;  4K1R B;  4NAW B;  2JF5 A;  3RT3 B;  4A20 A;  3UIO B;  3V6E B;  2KLG A;  2DAJ A;  1WX7 A;  3UGB B;  4CYE A;  2LVP A;  2MBH A;  3VXW A;  5GMV A;  4KSL C;  3RD2 A;  2O2V B;  2AEH A;  4J6I A;  2WDT B;  2GOW A;  5EDS A;  4BKG A;  1M94 A;  2KNB A;  4MJS A;  1UGM A;  1X1M A;  2KDI A;  4GB9 A;  4M8N A;  3PRP B;  1C1Y B;  5CX3 A;  3IVF A;  2MCN B;  2NCN A;  1S3S G;  2IO2 B;  4MGI E;  3VH4 B;  4HXD A;  1A5R A;  2ZVO A;  4MM3 A;  1KJT A;  3A9K B;  4DDI D;  4AUQ C;  2KD0 A;  2C7M B;  2ZNV B;  2M8S A;  5TR5 A;  3MJW A;  3AXC A;  4TUU A;  3PT2 B;  3EC8 A;  2LWP A;  2KDE B;  3DOW A;  2KDB A;  2OOB B;  2G45 B;  1RFA A;  2LGX A;  3A9J A;  3ALB A;  2UYZ B;  1J19 A;  2C9W B;  3K9P B;  1UH6 A;  4JGH B;  4GGQ A;  2MBB B;  5D6J B;  3VH3 B;  2ZVN A;  5C23 A;  3C0R B;  4IM0 A;  1Y8R C;  2JXX A;  4FAD A;  1V5O A;  3HM3 A;  4K7U A;  4WAA A;  4MJS B;  2DYM A;  3JW0 X;  3OAW A;  2LGY A;  3VAW A;  1EF5 A;  2AL3 A;  2DZK A;  2A4Z A;  2K8B A;  4LJP B;  5AZG A;  5AZH A;  3OJ3 A;  5G2N A;  3B08 A;  3H7P A;  4WJN A;  1YX6 B;  4MSQ B;  1KM7 A;  4WJP A;  4F7Z A;  1P98 A;  4F8C B;  3QX1 A;  3B1L X;  2DYO A;  2Z59 B;  5DPR A;  4PYU A;  2GBR A;  1RLF A;  3ZDT A;  2JRH A;  2FUH B;  1I42 A;  1SE9 A;  2R2O A;  3N32 A;  1RAX A;  3A9J B;  3RZF A;  2L76 A;  3OLM D;  3ZDM C;  2GMI C;  2KAN A;  1XQQ A;  2KTR A;  4HLE A;  2BYF A;  3QQ8 B;  3HHM A;  2LAS A;  3MTN B;  3T9L A;  2PE6 B;  1WX8 A;  1P0R A;  4XC2 A;  4BOZ B;  3EHV A;  3L16 A;  3ZIM A;  2LD9 A;  2KJ6 A;  3NZU A;  2K8H A;  4HWI B;  1OTR B;  2DHZ A;  1YX5 B;  1Z2M A;  4WQO B;  3S2A A;  2MBE A;  1WH3 A;  4XX5 A;  3ML8 A;  3DQV A;  2KKC A;  3DVN U;  5DPT A;  2LRU A;  3H7P B;  2PJH A;  4G50 A;  4LDT B;  3L13 A;  1E8Y A;  5E6N A;  4P7I A;  4E71 A;  1GC6 A;  4GIV A;  2GBN A;  2MBO A;  1OEY J;  3KUZ A;  2MSE D;  3ZNH B;  3K9O B;  1T0Y A;  1WYW B;  2O6V D;  4DK5 A;  3RCZ A;  2KTR B;  4II2 B;  2K6Q A;  2MLB A;  4MGK E;  2KOX A;  2I1J A;  2C7H A;  1OGW A;  2L05 A;  1BT0 A;  2J0J A;  3Q3F A;  4AJW A;  2LRW A;  2RD0 A;  3ZW3 A;  5DPW A;  1ISN A;  4EZL A;  4DHJ D;  2MRP A;  2BF8 B;  1UBI A;  4NY0 A;  4RM9 A;  2IO0 B;  2LXA A;  2NBU A;  2AYO B;  3GOE A;  2AWT A;  2GBM A;  4JL9 A;  3W1S A;  4I6P A;  1UD7 A;  2NVU I;  3L10 B;  2DYB A;  2FID A;  3JVZ X;  1WI0 A;  2LGD A;  1WX9 A;  1OEY A;  2K8C A;  2LJ5 A;  3ZUN A;  4W9H A;  3D32 A;  3DBH I;  4ANV A;  2QHO A;  1I35 A;  2RR9 A;  2MQJ A;  1WR6 E;  4HPL B;  3ENE A;  3QCA A;  1LM8 B;  2M4N A;  4K7S A;  3SU8 X;  3A9K A;  3QJZ A;  4DHZ E;  2FCN A;  4FA6 A;  1H8C A;  2M17 A;  2LUE A;  1TGZ B;  1TZ1 A;  1OQY A;  5G55 A;  2D2Q A;  4CHK A;  2KLC A;  1V5T A;  3M62 B;  4G0N B;  4FHJ A;  3VQI A;  4PS8 A;  3V60 A;  3QIJ A;  3TIX A;  2KMC A;  3QC8 B;  4W9F A;  2JZ3 B;  2LVO A;  3ONS A;  4IWQ A;  4X57 B;  4FJY A;  4HCN B;  3TCA A;  1XD3 B;  1UEL A;  3OJ4 B;  1HE8 A;  2EMS A;  3HK0 A;  2KJH B;  2KJR A;  1FXT B;  4W9G A;  2KQ7 A;  3ZTC A;  2CHW A;  1V2Y A;  2KWU B;  3WIM A;  1NDD A;  4KZC A;  2DX5 B;  1C3T A;  4GDK A;  3PRZ A;  4EEW A;  3U7D A;  2L3Z A;  5JHA A;  1WIA A;  2N7E A;  4B95 A;  2KN5 A;  1WM3 A;  3PRM B;  2CHX A;  1NBF C;  3KVF B;  3DVN V;  2D3G A;  4G11 A;  3QWZ B;  1XT9 B;  2I1K A;  4GOC A;  3VVW B;  4W9K A;  4JIO U;  2PPH A;  1VCB A;  5KHO A;  1SGH A;  4KSK C;  4M8M A;  3SDL C;  4W9E A;  1WJU A;  3RZW C;  3UIN B;  1WGY A;  5D94 A;  4BVU C;  2LXC A;  4PS7 A;  4NQL B;  1WR1 A;  3KUD B;  2D11 A;  2JT4 B;  3PTF C;  5HKH A;  1E7V A;  2KZR A;  2L0T A;  4MGY E;  4II3 B;  3R7Q A;  2A5U A;  5CHV C;  4YL8 A;  5L95 C;  5CTR C;  4OVV A;  1E5W A;  3EEC A;  2R2Q A;  4GDK B;  3ZLZ A;  4BBN C;  4MGZ E;  2NBW B;  5CHF A;  5CHW A;  4PS3 A;  1P9D U;  2BWF A;  2C7N B;  3R7R A;  4JLC A;  2K39 A;  2IO1 B;  4BKS D;  3UQB A;  1MG8 A;  2FAZ A;  2KMA A;  2IY1 B;  4NQK E;  3APC A;  1U4A A;  4HDO A;  2N4F A;  2JUO A;  1EO6 A;  2KC1 A;  2M1M A;  4KDL B;  4EUT A;  3BIN A;  3BY4 B;  1YIW A;  2N1V A;  3M95 A;  3MHS D;  3APF A;  2JVC A;  5LLI A;  1Z5S B;  3RYT A;  2MX2 A;  2PEA A;  4IW0 A;  1JRU A;  3AUL A;  2G4S A;  4ASW C;  2KXJ A;  4IM2 A;  2YVC A;  3ZNG C;  3M63 B;  5FR6 A;  3U8Z A;  4WJQ A;  3DBR I;  3WAL A;  4ICV A;  4NPN A;  5AEK B;  3U30 A;  2K1F A;  1IPG A;  4DBG A;  2V3S A;  3AI5 A;  3ECI A;  4EOY A;  2G3Q B;  1ZGU B;  2ASQ A;  2KWV B;  2XBB C;  1LXD A;  2V4L A;  3GZN I;  2MP2 A;  4K81 A;  4AWJ A;  3EFU A;  5LXH A;  4IC7 B;  3CF6 E;  3A1Q A;  1WXS A;  3AU4 A;  1AAR A;  2NS5 A;  1GNU A;  3PZD A;  2W9N A;  2PE9 A;  4WWP A;  2JY6 A;  3V61 A;  2EKE C;  2N9X A;  2HD5 B;  3PGE A;  1WXV A;  2GBJ A;  2ZPN A;  1E8Z A;  4EFO A;  2FCQ A;  5L83 A;  4HDQ A;  4LCD E;  2RGF A;  3B0A A;  3VTW A;  4HCP B;  1LFD A;  2C60 A;  4MDK E;  4BBN F;  4AOF A;  3QAR A;  2BWE S;  4ZYN A;  2O6V A;  3PHX B;  2K6D B;  3QAQ A;  1IP9 A;  2DEN B;  4GN1 A;  2WX0 A;  4ZRI A;  1YD8 U; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...