1WXMA

Solution structure of the n-terminal ras-binding domain (rbd) in human a-raf kinase
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
86
structure length
86
Chain Sequence
GSSGSSGGTVKVYLPNKQRTVVTVRDGMSVYDSLDKALKVRGLNQDCCVVYRLIKGRKTVTAWDTAIAPLDGEELIVEVLSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution Structure of the N-terminal Ras-binding Domain (RBD) in Human a-Raf Kinase
rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords A-Raf proto-oncogene serine/threonine-protein kinase
total genus 7
structure length 86
sequence length 86
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2005-01-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02196 RBD Raf-like Ras-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 1wxmA01
2DAFA 2BF8B 4EOYA 5J18A 5D2MB 2NCNA 3EHVA 4EZLA 4I6NB 2PPHA 4JLCA 5E6PA 1D3ZA 4MH0E 4AJWA 4FHJA 3ENEA 2K8HA 1LXDA 1V5TA 3H7SA 5D7GA 3KUCB 2W9NA 4W9CA 4HLEA 2Z59B 2LWPA 2RSUA 3KH0A 3B0AA 4HCPB 4MJSB 3L17A 3VUXA 1P0RA 1Z2MA 4BBNF 1BT0A 4FN2A 3W1SC 3ZTCA 2O6VD 1R4MI 4MM3A 3U7DA 3A9KA 2MBEA 3UF8A 1YQBA 3PS6A 2LJ5A 3O65B 3ZIMA 3AU5A 2FCSA 2GMIC 1XT9B 1EO6A 3BINA 3N32A 1ZW7A 4FHKA 3LJ3A 3V6EB 3JVZX 2LASA 1WY8A 4URKA 4GXBA 3ZRFA 1E90A 3R3MA 4ZYNA 4G11A 1V80A 4W9FA 4ZDVA 2M17A 4K1RB 1L7YA 3R7QA 4IUMB 4XX5A 2DYMA 4TKNA 4ASWC 4II2B 1T0YA 4J6IA 4DDGD 5D94A 3EFUA 4W9KA 1VD2A 4MDKE 1WXSA 4NQLB 2IO1B 3LDZE 4RM9A 3TIXA 2D2QA 2PJHA 3OJ4B 3OJ3A 1WI0A 4WQOB 4LCDE 3VHTC 2KZRA 1E8WA 3IHPC 3VVWB 3WIMA 3I3TB 2K8CA 1WE7A 1OEYA 1WIAA 1K8RB 2K6DB 3PV1A 1V81A 3AXCA 5DCNA 3IBEA 1WJ4A 1F9JA 3U8ZA 2JF5A 3R66C 2O6VB 4HCNB 4E71A 3ZDMC 1AARA 2WX1A 3APCA 3A1QA 2N1WA 2NS5A 3ZVVA 1Z5SB 4A3PA 3UQBA 1GC7A 1WX8A 2NVUI 1RLFA 2N7EA 1UBQA 2CHWA 2L7RA 1WRDB 1NDDA 2KQSA 1KLVA 1ZGUB 3QHTA 3VFKA 2KFJA 1WZ3A 1WMHA 2NPTA 1U4AA 3WALA 5C23A 5JH5C 3H1UA 4K81A 5IAAC 5J17A 1WMHB 3KW5B 1TGZB 1WGHA 4HVBA 3HIZA 2KLGA 3PRMB 3NZUA 2DZMA 2J0KA 4ANUA 2JZ3B 3GOEA 5HKHA 2O6VA 5GMVA 2WYQA 4IM2A 4W9DA 1KJTA 2O2VB 3OAWA 3H7PB 2LZ6A 5CHWA 4AP4C 2JPHA 4AOFA 1X1MA 2ZNVC 2C7MB 2WDTB 5KHQA 4TUUA 2A4ZA 1SGHA 2JWZA 2OOBB 3JSVB 3PHWB 1WH3A 1TBEA 1WGYA 2EMSA 2KO3A 1IPGA 2ZEQA 2KTFA 2JXXA 3ZUNA 2M8SA 2PE6B 3PLUA 3ONSA 4KSKC 1V5OA 5AZHA 1EF1A 3QA8A 2XBBC 2G45B 3VH4B 4F1SA 1TZ1A 2FCQA 3WAOA 2DZJA 1Q0WB 4HPMB 2KKCA 2MWSB 2LD9A 2WWZA 3VQIA 4LDTD 4HWIB 2DZKA 3TMPB 1H4RA 3PRPB 3X23A 5DPWA 3R7RA 3JSVA 2MBBB 4NJ7A 4OVVA 1ISNA 2LXCA 3K9PB 3DQVA 1IP9A 2MLBA 2KDFB 3PZDA 4KDLB 3PREA 4IM3A 3DBRI 3H7PA 2EKEC 5E6NA 3A9KB 5LXIB 1WXVA 1YJ1A 2ZNVB 1TTNA 5E6OA 3C0RB 3X0WA 3PVLA 4WJNA 2MP2A 1ZKHA 2UYZB 3DPDA 4GIVA 4TV3A 2HTHA 1WFYA 4NAWA 2G3QB 2KNBA 3A4SC 2IZVB 4P7IA 2KDIA 3A33B 2Z0EB 3DVNV 5BO4B 2C7NB 3PPAA 4DWFA 4BOSC 2ZJDA 2PE9A 1P9DU 3L10B 3DVNU 4BFRA 2CS4A 1S1QB 4TQ1A 2Y5BB 4BKSA 3QK0A 3PTFC 5G55A 1WX9A 5FR6A 4ZRIA 5C1ZA 2FCNA 2RR9A 4HK2A 1PQSA 2L3ZA 4JQWC 1WXAA 1IYFA 2HD5B 4TQ0A 4WJPA 2M4NA 1WXMA 2AWTA 4MGIE 3VUYA 2KC1A 1GC6A 1E5WA 3HM3A 4M8NA 2MW5A 3SU8X 2QHOA 4BKGA 2LGYA 2K6QA 2KDBA 2V3SA 3UGBB 4IW0A 2C9WB 2DYBA 1VCBA 2MA9B 1P1AA 2EMTA 4G3XB 4WAAA 2KOXA 3CMMB 4K7SA 4I6LB 5AZFA 2L00B 4MELA 2GBKA 4PS7A 2LGDA 4KDIC 4ZRKA 2KXJA 3ZRCA 2FNJB 4GOCA 4BOZB 2LRUA 1G6JA 1S3SG 2I1JA 1SE9A 3DBSA 2JT4B 3IVFA 2BKRB 4RM8A 4W9LA 1V9JA 4ICVA 2MCNB 2REXA 1WJ6A 1P3QU 3NHEB 4GDLB 5JHAA 2K8BA 2L76A 2KTRA 2CR5A 3EECA 3PLVA 1I42A 2PEAA 1V86A 4W9GA 3Q3FA 4MEMA 4HDOA 1RAXA 2KVRA 2NBVB 4E3CA 1WJNA 4CO7A 3BY4B 3UIPB 2V4LA 2DHZA 3APFA 2R2QA 3DVGX 3ZO5B 4F8CB 1V6EA 1WGGA 2KJHB 4WWNA 2HJ8A 2Z0DB 4FULA 4CHKA 4EZKA 4KIKA 1XQQA 4X57B 2KFKA 3PSEB 3V6CB 4KIKB 3JYUA 1M94A 2IY1B 3D32A 5CTRC 4IWQA 4MGYE 2LGXA 2JRIB 3V61A 4HPLB 2KJ6A 3Q3JA 2MSED 2NPTB 2KQ7A 3N3KB 3VTVA 2KX0A 3M95A 2LUEA 3VAWA 4IC7B 2BYFA 4NAWB 4IWPA 3RZWC 1WR1A 4EFOA 4PYUA 2MP2B 3IFWB 3KUZA 1LFDA 2D11A 3SDLC 4BKSD 3K9OB 1NI2A 4NQKE 1WM2A 2HE7A 1E8ZA 2IO3B 1EUVB 1V49A 3PHXB 3KUDB 4MSMB 2GBNA 3VXWA 3ZTDA 3P2BA 5J2RA 1E7UA 1E8YA 4E74A 1Y8RC 4GN1A 4PYZA 4W9HA 1KOTA 3A9JB 5D6JB 4B6WA 5L83A 1YX6B 3ZNID 4DDID 1MG8A 3ML8A 2KK8A 5CX3A 2A5UA 4WJQA 2CU1A 2JUOA 2LXAA 4ZRJA 3RULA 1UD7A 3IG3A 1FXTB 2OJRA 2NBUA 3PT2B 4LJPB 5L95C 4A3OA 4PS8A 4B95A 2BKFA 4EEWA 4NPNA 5AZGA 2GBMA 2KMAA 3RZFA 3AU4A 2MQJA 2ZPYA 5DPRA 4GDKA 3W1YA 2UWQA 1E7VA 4WWOA 1UBIA 4GU2A 2G4SA 5DPTA 4ANVA 2XEWA 4RMAA 2MBQA 1OTRB 3VUWA 3A4RA 2BPSA 2L0TA 2ZPNA 2CHZA 3UIOB 3CF6E 1WGRA 2R2OA 2FAZA 3ML9A 4PS3A 4BKTA 2KANA 2AL3A 1YX5B 2O2VA 3L16A 3ZNGC 2BYEA 1NBFC 2J0MA 4FJYA 3N30A 3T9LA 2I1KA 4KZ0A 3HM6X 4DHZB 1HE8A 1UH6A 2C7HA 2FIFA 4EZJA 2KD0A 3M62B 5TR5A 3ZNZB 2LRWA 4HJKA 1J8CA 3HHMA 2KX3A 2N7DA 3APDA 3QARA 4YL8A 3U30A 4DBGA 5IA7A 3UINB 3VTWA 3L08A 1OQYA 1WF9A 2BWES 1RFAA 2KDEB 2L8JA 4GSWA 2ZVOA 3OLMD 1EF5A 1UELA 2N4FA 3DVGY 3RT3B 4EKUA 4XC2A 3QCAA 4JL9A 3A1QB 4KZCA 1OEYJ 3MHSD 1KM7A 1QZEA 4GDLA 4DHJB 3AULA 4W9IA 4B9KA 4W9EA 4DK5A 2GBJA 1UZXB 3L54A 4M8MA 1GNUA 3DCGA 3KYDD 2DZIA 2JVCA 2ZCCA 3ZNHB 4GB9A 4BVUC 4NY0A 5G2NA 2J0JA 3EC8A 4MGZE 3ZKJC 3QX1A 1A5RA 2ASQA 2MX2A 2K39A 3B08A 4AJYB 3JW0X 4WJOA 4II3B 2XK5A 3MTNB 2IY0B 2KTRB 4GMVA 1J0GA 1LQBA 3DOWA 2J7QB 1WGDA 3T8MA 2K1FA 3ALBA 5EDSA 1P98A 3PRZA 2D10A 4LDTB 2CKHB 2KHWB 5LLIA 4GGQA 4K7UA 4ANXA 1Q1OA 2ZCBA 2XK5B 3V60A 2KWVB 4FADA 2AL6A 4EUTA 3B1LX 2KN5A 3DBLI 4FA6A 1WX7A 2IBIB 2VRRB 3RCZA 4AUQC 2LVOA 4ICUA 2DAJA 2YVCA 2KJRA 3MJWA 4OVUA 4IG7B 2JY6A 2C60A 1UGMA 2JRHA 4BBNC 3VTUA 1XD3B 2BYVE 4FJZA 1GG3A 2KWCA 2MBHA 4AWJA 3L0WB 5KHOA 3WAMA 4DHJD 2GOWA 4WWPA 3NS8A 2M0XA 2RGFA 3VH3B 1GJZA 1GUAB 4LJOB 4MJSA 2JZZA 4JIOU 4JGHB 4KSLC 2FIDA 2DYOA 2ZZPB 3VDZA 2IYDB 3WAPA 3M63B 4HDQA 3RYTA 3SHQA 2WX0A 3TBLD 1WJUA 1J19A 2FCMA 4FJVB 2IO2B 2BWFA 4FLHA 5AEKB 2L05A 3PGEA 3NY5A 3QJZA 3UQAA 1WE6A 5CHFA 2YLMA 3ECIA 2KMCA 4KVGB 4M0WB 3TCAA 3M3JA 3CSFA 1C1YB 5CHVC 4A20A 4ANWA 2RD0A 4NNJB 4HXDA 2G4DB 2IO0B 3H9DA 3TL5A 4XZ4A 2C5LC 3H6NA 5LXHA 1OGWA 1Q5WB 2B3AA 5DPSA 1H8CA 4GDKB 3CSTA 3WANA 4G0NB 4K7WA 1L2NA 3L13A 2M1MA 2N1VA 3V62A 1WZ0A 4IWOA 2LI5A 1I35A 4G50A 3RD2A 1YD8U 1C3TA 1V2YA 3DDCB 5JZEB 3NOBA 4N9F4 2GBRA 4W9JA 1LM8B 2N9XA 3QAQA 4FBJB 3ZW3A 1E8XA 2N9EB 2K25A 3A9JA 4F7ZA 2AYOB 5JHBA 2N9PC 1YIWA 3TJPA 3QIJA 2L0FA 4DXAB 2BGFA 2LVQA 3GZNI 2ZVNA 1RRBA 3HK0A 2NBWB 3KYCD 2KWUB 3NZSA 3RUIB 4CYEA 3QC8B 2V1YA 2FUHB 3QQ8B 2D3GA 1WYWB 3WA0A 3W1SA 2LVPA 2RPQA 2MBOA 4NJ6A 4DHZE 2D07B 3KVFB 4MSQB 2AEHA 4KV2A 1SIFA 2CHXA 1WR6E 1WM3A 3QWZB 1CMXB 3S2AA 2NR2A 3ZDTA 2KLCA 4IM0A 3ZLZA 2DX5B 2DENB 4MGKE 4I6PA 2KC2A 3SD5A 1R4NI 3AI5A 1JRUA 3DBHI 2MRPA 2KFKB
chains in the Genus database with same CATH superfamily
1PDXA 2KN4A 3EHVA 2BS4B 2WXRA 2BVCA 4MH0E 3BK2A 3AE7B 5D7GA 3KH0A 2V3NA 3B0AA 4HCPB 2M19A 1Z2MA 1FEHA 1K52A 4FN2A 3TUOA 3ZTCA 2O6VD 4J3OD 2PIAA 1UNSA 3UF8A 4HKZE 2LJ5A 3AU5A 1WGKA 1IGDA 1FNUA 3AEDB 1ZOYB 2GMIC 1NEKB 3N32A 1ZW7A 3V6EB 3UI3A 1WY8A 3IAM1 3PZ8A 2PLPA 4ZYNA 4W9FA 5BMIA 4NZLB 4XX5A 4ASWC 1T0YA 5EE1A 4B0EA 2X8XX 2LJIA 1PYWD 1WXSA 1IBXA 3LDZE 1TYGB 3TIXA 2MJEA 2D2QA 1L6VA 1E8WA 1FXIA 3EFCA 3SEBA 1V81A 3ZJVA 4RNAA 4E71A 3ZDMC 1JCKB 2WX1A 3UQBA 1QOBA 1Z5SB 4N6EB 1GC7A 2CU3A 4RF0A 1RLFA 2N7EA 1UBQA 1WRDB 1WMHA 1U4AA 3WALA 3H1UA 4K81A 3KW5B 3VRBB 3HIZA 4A6QA 3N20C 3AEEB 2XNAC 4IKGA 4YSZB 1JWUD 4W9DA 1I4RA 2N0SB 2MEKA 3J9CA 2LZ6A 4AP4C 2JPHA 4AOFA 1X1MA 3B2FA 2ZNVC 4HEA1 4TUUA 2A4ZA 2BB6A 3JSVB 1WGYA 1IPGA 2ZEQA 2KTFA 2JXXA 2JXTA 4F1SA 3SFDB 1QQRA 1KTKA 1YOVB 3TEZA 1FNVA 3TMPB 2DZKA 5DPWA 5G5HA 4OVVA 3DBHB 1GPXA 1GB1A 3PREA 1V8CA 3H7PA 5E6NA 1K51A 1WXVA 2ZW1A 3X0WA 1K50A 3DPDA 1WFYA 4NAWA 3A4SC 3DVNV 2C7NB 1SSNA 3O13A 1GOZA 4BOSC 2PE9A 4M0WA 3P1MA 3WCQA 4HK2A 1WXMA 3HM3A 4C4VA 2MW5A 2KDBA 2V3SA 4JPSA 2C9WB 2BYTA 3RNEC 2MA9B 2EMTA 4G3XB 3CMMB 4I6LB 3AEAB 2LUMA 1SXTA 4KDIC 4ZRKA 2KXJA 2V0GA 2LRUA 4ZRQA 2WLBA 1QOFA 4RM8A 1YN3A 1WJ6A 2PVOD 3PLVA 3Q3FA 1E10A 4HDOA 4R3DA 1WSPA 3GS2A 3GZNB 3BWUD 2V4LA 4RGNA 3APFA 3DVGX 3ZO5B 4F8CB 1V6EA 3NVVA 4CHKA 4X57B 1XCTL 4KIKB 3JYUA 3D32A 5CTRC 1JW9D 4IWQA 2WXHA 1CZPA 2WHIA 4HPLB 2MSED 2NPTB 2KQ7A 3IT6B 3N3KB 4XWWA 2LUEA 3VAWA 2E3TA 4IC7B 2BYFA 4EFOA 4PT5A 3KUZA 4C80A 1NI2A 1XF5L 2JSVX 3AE5B 1E8ZA 2IO3B 1V49A 3PHXB 2KWDA 1E7UA 1P7EA 2NTSA 4GN1A 4PYZA 4W9HA 2A5UA 3EUB2 3IG3A 1GB4A 1C4PA 1N61A 5AZGA 2ACZB 2MQJA 1E7VA 4WWOA 2G4SA 2QEJC 4OW0A 3DHHC 4RMAA 2MBQA 1OTRB 4A90A 1TKEA 4US8A 2ZPNA 3CF6E 1KRHA 2KANA 1T3QA 1YX5B 3ZNGC 2BYEA 1NBFC 2VZKD 4WQMA 1EWYC 1UWMA 4KZ0A 4DHZB 1HE8A 2C7HA 5TR5A 4HJKA 1J8CA 5HFYA 2KX3A 3VTWA 5BYSA 1EF5A 2N4FA 3DVGY 1JROA 1J7CA 2ICIA 2B76B 1KM7A 1QZEA 4GDLA 4B9KA 1GNUA 1OQQA 1F77A 2DZIA 5G2NA 3MC9A 4KKJA 1HA5A 2WDVB 2QMTA 3GB1A 4XYCA 2K39A 3FKYA 3B08A 1NENB 5C2TB 4JX1C 1J0GA 2J7QB 2K1FA 3HRDD 1E0ZA 3AEBB 2AQ2B 1DOIA 3RI7C 1E7PB 5BMHA 3Q69A 4EUTA 1WX7A 3DHGC 2W3SA 2YVCA 1QLBB 4OVUA 2C60A 3FILA 4XE0A 2RDBC 1AW7A 2KWCA 2WXFA 4MM3B 4MJSA 1QOAA 1CJEA 2ZZPB 3VDZA 3RYTA 2QC8A 1J19A 3H8HA 4OZAA 4FJVB 2IO2B 1VJKA 2WU5B 5AEKB 4REZA 4P6VF 3QJZA 3R8BA 3RNAC 4M0WB 1MFWA 3RN9C 1SIJA 2JYEA 2I38A 3AE4B 3Q8CA 2IO0B 3H9DA 3H6NA 2B3AA 1EU3A 4K7WA 1L2NA 3DWMA 3L13A 2W3RA 4IWOA 4G50A 1YD8U 1V2YA 2J53A 2JQRB 4N9F4 2GBRA 4LK0M 1UGJA 5JXVA 5HI1A 4ARIA 3A9JA 2AYOB 1HXYD 3B2GA 2L52A 1YIWA 1KLUD 2WDRB 2LHDA 2BGFA 2LVQA 4FXCA 2QJLA 2HDEA 3NVZA 2KWUB 4CYEA 2XN9C 3GE3C 2D3GA 1FCCC 4DHZE 2FBWB 4A8XC 1VZ7A 3QWZB 3S2AA 2J4XA 2RDHA 2DX5B 4I6PA 2KC2A 3SD5A 3LYYA 3AI5A 2MRPA 1RFKA 4I6NB 2PPHA 4FHJA 3ENEA 3RNFC 1FFUA 1LXDA 4D2KA 4ZRPA 1SJED 2Z59B 2RSUA 3AV8A 1GAQB 4RFBA 4CQNA 4IOIE 1R4MI 1DGJA 3RMKC 3A9KA 3RFZB 5AUIA 1YQBA 2VZKB 4ZHOA 3BINA 2WGSA 3LJ3A 3VR8B 4URKA 4GXBA 3R3MA 1NI3A 1OFFA 4G11A 1V80A 4TSSA 2WXOA 1FRDA 3R7QA 3PO0A 4TKNA 4DDGD 3Q3NC 1VD2A 4MDKE 2DBYA 4NQLB 5EE9A 5FR3A 1NYRA 1WI0A 4WQOB 2H89B 4S0RA 3IHPC 1WE7A 1K8RB 1WJ4A 2O6VB 4HCNB 1PGAA 1FM0D 2NS5A 4B0MA 4A3PA 2GLSA 1NDDA 2PKOA 5J17A 4K3CA 1WGHA 3AEGB 3PRMB 2LGSA 1T6BX 2JZ3B 4IM2A 3BVMA 3H7PB 2HJ1A 5CHWA 2C7MB 1C4AA 4MH8A 1F1HA 2JWZA 3PHWB 4MACA 2M8SA 2YEPF 1JWBD 1T0RC 4HJGE 1TZ1A 1MJDA 2FCQA 4ZOHC 4HPMB 2SAKA 2MWSB 1C76A 1D5ZC 3X23A 3PRPB 3JSVA 3U7ZA 2MBBB 4NJ7A 1R4NB 2LXCA 3K9PB 1I4GA 1IP9A 2MLBA 3PZDA 1B1ZA 4IM3A 3DBRI 3ETRA 2EKEC 3A9KB 2ZNVB 5E6OA 1FRRA 4GIVA 2HTHA 4YWGG 2IZVB 2KDIA 1T0QC 2Z0EB 1Q10A 2ZJDA 2H88B 4LNOA 3DVNU 4BFRA 4ITKA 4TQ1A 3URYA 4LNFA 2Y5BB 1EU4A 2INPE 5FR6A 4ZRIA 2FCNA 4JQWC 5C3JB 1WXAA 2JZPA 2L83A 4WJPA 2M4NA 4MGIE 4OHJA 1KFYB 3SU8X 3AH7A 4IW0A 4UDUC 4M01A 3KLSX 4K7SA 2L00B 4MELA 2WXQA 4PS7A 2LGDA 4BOZB 4GOCA 1G6JA 4YTPB 1SE9A 1RYJA 2BKRB 1V9JA 2MCNB 3N1ZC 1P3QU 5JHAA 5FK9C 2L76A 2CR5A 1I42A 2PEAA 1V86A 4W9GA 3MJ5A 4KGTA 5HG2A 3KWVA 1WXQA 2OEDA 3ZQ4A 2DHZA 3Q8EA 2E6XA 2Y3AA 1AYFA 2HJ8A 4FULA 3NUHB 4EZKA 2JYTA 3V6CB 1F52A 2IJ0A 1R4MB 2AX5A 1TT5B 4NAWB 4P1CC 1WR1A 1XLPA 2MP2B 3IFWB 2INDC 1HEZE 2WXIA 4BKSD 5BMGA 1YJIA 1F2RC 3ZXRA 1WM2A 1ZXIA 2HE7A 4LTUA 3FILB 3KUDB 3P4QB 4MSMB 3ZTDA 2VH1A 3P2BA 2WXJA 1Y8RC 1KOTA 5L83A 1MHHE 5CX3A 2X38A 4AQ7A 2JUOA 2LXAA 4ZRJA 1QT9A 2OJRA 2NBUA 3PT2B 5L95C 4EEWA 3Q14C 4GDKA 2UWQA 2V4IB 4GU2A 3NJTA 5DPTA 1CQVA 3RNGC 2CHZA 2R2OA 2J0MA 2I1KA 5IN7A 3I5JC 2ONQA 1OQRA 1UH6A 2FIFA 4EZJA 2KD0A 2LRWA 1SE3A 2NMQA 3U30A 3UINB 1ESFA 1MHXA 1OQYA 3MC8A 2KDEB 2VH2A 4HRSA 1V1OA 4XDDA 3RT3B 2WXGA 1XO3A 3A1QB 1OEYJ 4W9EA 1SF0A 1JALA 2PMVA 4M8MA 3DCGA 2ZCCA 4BVUC 3MFGA 2K22A 1I4XA 4AJYB 4WJOA 4RGMA 2LGIA 3AE8B 2INNE 3DOWA 1C79A 5EE0A 4L2YA 1EWCA 3ALBA 1P98A 3PRZA 4A9AA 1NYQA 2CKHB 2KHWB 3DBRB 4GGQA 4ANXA 1Q1OA 2XK5B 3V60A 4C56C 3HVDA 1L0VB 2LVOA 2DAJA 3V3XA 1RWSA 3RNCC 1HZ6A 4YXDB 2JRHA 1XD3B 4HROA 2MBHA 1TY0A 3WAMA 4WWPA 1LO5D 3NS8A 2M0XA 2RGFA 2WNMA 1QF6A 2N9KA 2JZZA 4JIOU 2FIDA 2IYDB 3M63B 3SHQA 3GE8C 1WYGA 1ZXHA 2KMCA 4KVGB 3AEFB 4NNJB 4OVZA 3T3OA 3IAS1 5LXHA 2JWUA 1OGWA 2QDFA 4PK1A 1FMAD 4G0NB 2N1VA 1L5PA 2OJWA 1M4VA 2LI5A 1C3TA 1RM6C 3DDCB 2BQQA 3NOBA 1L0XB 3ZW3A 1E8XA 2N9EB 2K25A 2N9PC 2L0FA 4EE2A 3KYCD 3NZSA 3RUIB 3NRZA 3QQ8B 1WYWB 3WA0A 2LVPA 2RPQA 1MI0A 3SR6A 2D07B 2FUG1 4RGOS 1WM3A 3ZDTA 2I2YA 2DENB 4MGKE 1TS2A 2QCZA 1CK1A 1EM7A 2DAFA 5J18A 2WS3B 5D2MB 2NCNA 3RPFC 4JLCA 1Y56A 2K0PA 2K8HA 1V5TA 3H7SA 3KUCB 2W9NA 1AWDA 3L17A 2V9HA 1JWSD 4BBNF 1BT0A 4YSXB 3U7DA 3DBLB 3O65B 4ZYSA 3ZIMA 1FXAA 2FCSA 3ZGZA 1XT9B 4OZCA 2FE8A 3JVZX 2N9LA 2LEKA 3ZRFA 1E90A 1FO4A 1QOGA 4ZDVA 2M0AA 2DYMA 2PW9A 4J6IA 1ZE3D 5BYQA 3RNBC 3OJ3A 1BUIC 3VHTC 4WWMA 3WIMA 2K8CA 1WIAA 1OEYA 1XLQA 1T0SC 2K6DB 2KVZA 3PV1A 5DCNA 3IBEA 1F9JA 2IGGA 3U8ZA 2N7JA 1AARA 3APCA 3A1QA 2N1WA 1SB3C 1WX8A 4KKIA 1YQ4B 1D5MC 2NVUI 2QSDA 2CHWA 3TEXA 3N1XC 3QHTA 2KFJA 1WZ3A 2NPTA 4DXFA 5JH5C 1WMHB 1C4CA 3Q8FA 3P4PB 4HVBA 3NZUA 1F2RI 2DZMA 2WQYB 3GOEA 3LXFA 5GMVA 1KJTA 2O2VB 2INCC 2KYWA 1FCLA 2EMSA 2KO3A 3PLUA 3ONSA 1UWXA 5G5GA 5LNK1 2R61A 2XBBC 3AM9A 1MG4A 1IGCA 2DZJA 1Q0WB 3AE9B 2KKCA 2LD9A 1L4ZB 4TMAB 2WWZA 3VQIA 1H4RA 1SJHD 3R7RA 4YTNB 1TIFA 3Q6BA 2WXMA 5HHDG 2KDFB 4KDLB 3CWIA 1FNWA 5LXIB 3W9CB 1TTNA 3PVLA 2MP2A 1ZKHA 1IUEA 2UYZB 1TJEA 1WWTA 4TV3A 3ZXVA 2G3QB 2KNBA 3R2TA 4P7IA 3A33B 5BO4B 3MP9A 5T8IA 2CS4A 1S1QB 5D3IB 3QK0A 2BS3B 5C1ZA 2IDYA 1D5XC 1PQSA 1IYFA 1YMHE 2HD5B 3VUYA 1GC6A 3W2DA 1XCQL 1XEEA 2QHOA 2LGYA 4BKGA 2K6QA 2DYBA 1I4PA 1P1AA 4WAAA 2WU2B 2KOXA 4L1BA 2GBKA 3N9YC 3N1YC 2KAJA 1KLGD 2W54A 3DBSA 2JT4B 3IVFA 4W9LA 3ABVB 3NHEB 2K8BA 3EECA 4DQOC 4KGRA 1YNTE 4MEMA 1RAXA 3IXSA 2KVRA 2NBVB 4E3CA 3UIPB 1TKYA 3I63C 1WGGA 2KJHB 2HTME 4KIKA 1XQQA 2KFKA 2KDMA 5I4DA 3ZJTA 2LGXA 2JRIB 3V61A 1VDVA 3Q3JA 2KX0A 3M95A 3RZWC 5D3DA 4RGTA 1LFDA 3SDLC 2RPVA 2WDQB 1BXTA 3K9OB 1N60A 2IGHA 3VXWA 2BB5A 1ROEA 5J2RA 1E8YA 4LNNA 4E74A 4S17A 2JU6X 3A9JB 4B6WA 4RH6A 4DDID 1MG8A 2KK8A 4WJQA 2CU1A 3RULA 1UD7A 1STEA 4WAFA 4LJPB 4A3OA 3BYTB 4PS8A 4B95A 2BKFA 4NPNA 4QAYA 1R7SA 2GBMA 2KMAA 2Y5CA 2ZPYA 5DPRA 1TKGA 1L6UA 1VZ8A 4ANVA 2XEWA 3VUWA 2NTTA 2EELA 2BPSA 2Q5WD 4BKTA 2AL3A 3NG0A 3L16A 4FJYA 3N30A 2V3PA 4AS1A 3HM6X 4JE3B 2WXKA 3M62B 2OHFA 3ZNZB 2N7DA 3APDA 4YL8A 4DBGA 2WXLA 2K3UA 5IA7A 5GXGB 2LMCA 5AUKA 1WF9A 2BWES 1RFAA 2L8JA 1QKZA 4GSWA 3OLMD 3C19A 3QCAA 2JX5A 1PGXA 4DHJB 3AULA 4RF1A 4DK5A 1UZXB 3L54A 2JVCA 3ZNHB 4GB9A 3EC8A 3QX1A 1A5RA 2MX2A 1N5XA 3MTNB 2IY0B 4NAMA 1J7AA 1L0YB 2W55A 1HZ5A 4M00A 5IP4D 1WGDA 4RCOA 3KWLA 2D10A 5EE3A 2ZCBA 3Q8BA 2KWVB 4FADA 2AL6A 3B1LX 4H2AA 2VRRB 2IBIB 3TEWA 3C8YA 2K9XA 2JY6A 3VTUA 1XLNA 2BYVE 1GG3A 1ET9A 3L0WB 4BZAA 2GOWA 1FD6A 3Q2AC 1GJZA 3FC4A 2AQ3B 4KSLC 2DYOA 3TBLD 2L32A 4C7ZA 1KF6B 3TSSA 1LGRA 5H8YE 2BW2A 4IDIA 3U52E 4FLHA 1HTQA 2L05A 3NY5A 3R2IA 1WE6A 5CHFA 3V05A 2YLMA 3TCAA 5CHVC 1V1PA 4ANWA 2RD0A 2LFIA 2KMMA 4DXGA 4ACFA 1ZPSA 4C00A 4XZ4A 1Q5WB 5DPSA 3BVGA 3CSTA 2Y5PA 1QILA 2KQ4X 1IBXB 2M1MA 1WZ0A 1I35A 1T5XD 3TEYA 3NZ3A 2J52A 4FBJB 4F7ZA 5JHBA 1ZUD2 4LNIA 3BK1A 3GZNI 3HK0A 2NBWB 3QC8B 2FUHB 4WH4A 1F0ZA 2IPKD 1FFVA 1SE4A 2MBOA 4MSQB 2AEHA 2RDGA 1SIFA 3I57A 1VRAB 1CMXB 2KLCA 2D5GA 2WXPA 5BYRA 1JWMD 3ZLZA 1V1PB 2MHJA 3MHZA 1R4NI 2CJOA 2L1AA 2KFKB 1VR9A 2BF8B 4EOYA 5TSSA 1JMLA 4EZLA 2D3AA 1SE2A 3T3NA 5E6PA 1D3ZA 4AJWA 3Q8AA 1E9MA 4HLEA 4W9CA 1I7HA 2LWPA 3ZJUA 4MJSB 3VUXA 1P0RA 1TS3A 3W1SC 2QILA 4MM3A 1DOYA 3P4SB 2MBEA 3PS6A 1PGBA 3B9JA 4KGSA 1P7FA 2YEPB 4HPPA 1EO6A 4FHKA 5H92C 1UF0A 2LASA 3KQ4A 1WRIA 1I4HA 2CJNA 4P1BC 2M17A 4K1RB 1L7YA 4IUMB 4II2B 5D94A 3EFUA 4XDCA 4W9KA 3W5VB 2IO1B 2PVGC 3OG5A 4RM9A 3E9SA 2PJHA 1YJJA 3OJ4B 4LCDE 3EA6A 2KZRA 4KX6B 3VVWB 2WP9B 3I3TB 2KT7A 2SEBD 1ENFA 3AXCA 2MJ3A 4YSYB 2JF5A 3R66C 3ZVVA 3BIID 1VZ6A 4XGAB 3PZ7A 2L7RA 1KLVA 2KQSA 1ZGUB 3VFKA 5C23A 5IAAC 1TGZB 2LHEA 2BS2B 1UUPA 2D3BA 2KLGA 2J0KA 4ANUA 2AQ1B 3GP7A 3AECB 5HKHA 2O6VA 4N58A 2WYQA 3OAWA 3W5UB 1E6EB 2WDTB 5KHQA 1SGHA 2OOBB 2W82A 1WH3A 1TBEA 3P4RB 3ZUNA 1XXGA 2PE6B 2Z8LA 4KSKC 1V5OA 5AZHA 1EF1A 3QA8A 1D4BA 2G45B 3VH4B 3WAOA 3P42A 4JWSC 1B9RA 4LDTD 4HWIB 4LLGM 1ISNA 3DQVA 1FPYA 4Q2JA 1C9FA 1YJ1A 3DWGC 3C0RB 4WJNA 3BVZA 2IGDA 2RMMA 1TS5A 3PPAA 4DWFA 2QIEB 3NS1A 1P9DU 3L10B 5E6JA 5IO9A 4BKSA 3VRAB 3PTFC 5G55A 1WX9A 1PUTA 2RR9A 2L3ZA 2KACA 4TQ0A 3AMZA 2AWTA 3IT4B 2KC1A 1E5WA 4M8NA 2GB1A 4JWUC 3UGBB 1VCBA 3NVYA 5AZFA 4US9A 3AB5A 1JWAD 3ZRCA 2FNJB 4GLSC 4USAA 1S3SG 2I1JA 2G1EA 3P63A 1V97A 4ICVA 1ET6A 2REXA 1DYQA 3E56A 1AN8A 4GDLB 2KTRA 1KH0A 1DOXA 4C4VB 3AE3B 2MH7A 1WJNA 3AE1B 3BY4B 4CO7A 4LNKA 2R2QA 4WWNA 2Z0DB 1I4QA 3PSEB 1L4DB 4M02A 1ACCA 1M94A 2IY1B 4MGYE 3VR9B 4HKQA 2KJ6A 1C77A 3VTVA 2EKIA 4IWPA 4ZHPA 4PYUA 1TY2A 1A70A 1FIQA 2D11A 1BMLC 4NQKE 1EUVB 1ZDVA 2GBNA 2MJDA 4L23A 5D6JB 4WURA 1YX6B 3ZYYX 3ZNID 3ML8A 4OZBA 1YQ3B 1HTOA 1FXTB 4WIPA 4A55A 1N62A 4MT5A 5IKCM 2GRIA 3OWEB 1YN5A 3RZFA 3AE2B 1ZDXA 3AU4A 3BYYB 3W1YA 4BAXA 1UBIA 3A4RA 2L0TA 4YTMB 3UIOB 3AE6B 5IOIA 1WGRA 4PS3A 2FAZA 3ML9A 1C78A 2O2VA 1YN4A 3MC0B 3T9LA 4XWTA 1MVKA 4NJCA 3HHMA 3QARA 3BZDB 4N59A 3L08A 2ZW0A 3HUIA 1MPEA 2ZVOA 3AN1A 1UELA 4EKUA 4XC2A 4JL9A 4KZCA 3MHSD 4W9IA 2GBJA 3KYDD 2D3CA 3Q3OC 3CIRB 4NY0A 2J0JA 4MGZE 3ZKJC 1J7BA 2ASQA 3JW0X 4II3B 2XK5A 2DWQA 2KTRB 3HVZA 3U4EG 2ON8A 4K3BA 4GMVA 1LQBA 3DHIC 2DNFA 2WXNA 3NVWA 3EGRA 3T8MA 1JRPA 5EDSA 4LDTB 4YT0B 5LLIA 4C7YA 2BTEA 4K7UA 2BT6A 2KN5A 3DBLI 4FA6A 3RCZA 4AUQC 4ICUA 2KJRA 3MJWA 4IG7B 1UGMA 4BBNC 2UU7A 4P16A 4FJZA 4AWJA 5KHOA 4DHJD 1N63A 3U2SC 3VH3B 4ARCA 2PTLA 1GUAB 4LJOB 1D6EC 4JGHB 3I9V1 3WAPA 1VLBA 4HDQA 2WX0A 1N5WA 1WJUA 2G9HD 2FCMA 2BWFA 3PGEA 3UQAA 2J42A 3ECIA 3M3JA 3SFEB 3CSFA 1C1YB 3L4PA 4A20A 4HXDA 5FKAC 1SEBD 2G4DB 1HQRD 3TL5A 2GI9A 2C5LC 1H8CA 4GDKB 1NVID 3WANA 3V62A 2M56B 2BBCA 3RD2A 5MPOA 5JZEB 1TS4A 4W9JA 1LM8B 2N9XA 3QAQA 1TZOA 3TJPA 3QIJA 4DXAB 1ZP0B 2ZVNA 1RRBA 3LB8C 2K5PA 1K53A 1SBBB 2V1YA 1JQ4A 3W1SA 4NJ6A 1XLOA 3KVFB 4KV2A 3FAHA 2DLBA 2CHXA 1WR6E 3Q3MC 2NR2A 4IM0A 1PFDA 4O1NA 1JRUA 3DBHI 1N6ZA 2TSSA
chains in the Genus database with same CATH topology
2DAFA 2BF8B 4EOYA 5J18A 5D2MB 2NCNA 3EHVA 4EZLA 4I6NB 2PPHA 4JLCA 5E6PA 1D3ZA 4MH0E 4AJWA 4FHJA 3ENEA 2K8HA 1LXDA 1V5TA 3H7SA 5D7GA 3KUCB 2W9NA 4W9CA 4HLEA 2Z59B 2LWPA 2RSUA 3KH0A 3B0AA 4HCPB 4MJSB 3L17A 3VUXA 1P0RA 1Z2MA 4BBNF 1BT0A 4FN2A 3W1SC 3ZTCA 2O6VD 1R4MI 4MM3A 3U7DA 3A9KA 2MBEA 3UF8A 1YQBA 3PS6A 2LJ5A 3O65B 3ZIMA 3AU5A 2FCSA 2GMIC 1XT9B 1EO6A 3BINA 3N32A 1ZW7A 4FHKA 3LJ3A 3V6EB 3JVZX 2LASA 1WY8A 4URKA 4GXBA 3ZRFA 1E90A 3R3MA 4ZYNA 4G11A 1V80A 4W9FA 4ZDVA 2M17A 4K1RB 1L7YA 3R7QA 4IUMB 4XX5A 2DYMA 4TKNA 4ASWC 4II2B 1T0YA 4J6IA 4DDGD 5D94A 3EFUA 4W9KA 1VD2A 4MDKE 1WXSA 4NQLB 2IO1B 3LDZE 4RM9A 3TIXA 2D2QA 2PJHA 3OJ4B 3OJ3A 1WI0A 4WQOB 4LCDE 3VHTC 2KZRA 1E8WA 3IHPC 3VVWB 3WIMA 3I3TB 2K8CA 1WE7A 1OEYA 1WIAA 1K8RB 2K6DB 3PV1A 1V81A 3AXCA 5DCNA 3IBEA 1WJ4A 1F9JA 3U8ZA 2JF5A 3R66C 2O6VB 4HCNB 4E71A 3ZDMC 1AARA 2WX1A 3APCA 3A1QA 2N1WA 2NS5A 3ZVVA 1Z5SB 4A3PA 3UQBA 1GC7A 1WX8A 2NVUI 1RLFA 2N7EA 1UBQA 2CHWA 2L7RA 1WRDB 1NDDA 2KQSA 1KLVA 1ZGUB 3QHTA 3VFKA 2KFJA 1WZ3A 1WMHA 2NPTA 1U4AA 3WALA 5C23A 5JH5C 3H1UA 4K81A 5IAAC 5J17A 1WMHB 3KW5B 1TGZB 1WGHA 4HVBA 3HIZA 2KLGA 3PRMB 3NZUA 2DZMA 2J0KA 4ANUA 2JZ3B 3GOEA 5HKHA 2O6VA 5GMVA 2WYQA 4IM2A 4W9DA 1KJTA 2O2VB 3OAWA 3H7PB 2LZ6A 5CHWA 4AP4C 2JPHA 4AOFA 1X1MA 2ZNVC 2C7MB 2WDTB 5KHQA 4TUUA 2A4ZA 1SGHA 2JWZA 2OOBB 3JSVB 3PHWB 1WH3A 1TBEA 1WGYA 2EMSA 2KO3A 1IPGA 2ZEQA 2KTFA 2JXXA 3ZUNA 2M8SA 2PE6B 3PLUA 3ONSA 4KSKC 1V5OA 5AZHA 1EF1A 3QA8A 2XBBC 2G45B 3VH4B 4F1SA 1TZ1A 2FCQA 3WAOA 2DZJA 1Q0WB 4HPMB 2KKCA 2MWSB 2LD9A 2WWZA 3VQIA 4LDTD 4HWIB 2DZKA 3TMPB 1H4RA 3PRPB 3X23A 5DPWA 3R7RA 3JSVA 2MBBB 4NJ7A 4OVVA 1ISNA 2LXCA 3K9PB 3DQVA 1IP9A 2MLBA 2KDFB 3PZDA 4KDLB 3PREA 4IM3A 3DBRI 3H7PA 2EKEC 5E6NA 3A9KB 5LXIB 1WXVA 1YJ1A 2ZNVB 1TTNA 5E6OA 3C0RB 3X0WA 3PVLA 4WJNA 2MP2A 1ZKHA 2UYZB 3DPDA 4GIVA 4TV3A 2HTHA 1WFYA 4NAWA 2G3QB 2KNBA 3A4SC 2IZVB 4P7IA 2KDIA 3A33B 2Z0EB 3DVNV 5BO4B 2C7NB 3PPAA 4DWFA 4BOSC 2ZJDA 2PE9A 1P9DU 3L10B 3DVNU 4BFRA 2CS4A 1S1QB 4TQ1A 2Y5BB 4BKSA 3QK0A 3PTFC 5G55A 1WX9A 5FR6A 4ZRIA 5C1ZA 2FCNA 2RR9A 4HK2A 1PQSA 2L3ZA 4JQWC 1WXAA 1IYFA 2HD5B 4TQ0A 4WJPA 2M4NA 1WXMA 2AWTA 4MGIE 3VUYA 2KC1A 1GC6A 1E5WA 3HM3A 4M8NA 2MW5A 3SU8X 2QHOA 4BKGA 2LGYA 2K6QA 2KDBA 2V3SA 3UGBB 4IW0A 2C9WB 2DYBA 1VCBA 2MA9B 1P1AA 2EMTA 4G3XB 4WAAA 2KOXA 3CMMB 4K7SA 4I6LB 5AZFA 2L00B 4MELA 2GBKA 4PS7A 2LGDA 4KDIC 4ZRKA 2KXJA 3ZRCA 2FNJB 4GOCA 4BOZB 2LRUA 1G6JA 1S3SG 2I1JA 1SE9A 3DBSA 2JT4B 3IVFA 2BKRB 4RM8A 4W9LA 1V9JA 4ICVA 2MCNB 2REXA 1WJ6A 1P3QU 3NHEB 4GDLB 5JHAA 2K8BA 2L76A 2KTRA 2CR5A 3EECA 3PLVA 1I42A 2PEAA 1V86A 4W9GA 3Q3FA 4MEMA 4HDOA 1RAXA 2KVRA 2NBVB 4E3CA 1WJNA 4CO7A 3BY4B 3UIPB 2V4LA 2DHZA 3APFA 2R2QA 3DVGX 3ZO5B 4F8CB 1V6EA 1WGGA 2KJHB 4WWNA 2HJ8A 2Z0DB 4FULA 4CHKA 4EZKA 4KIKA 1XQQA 4X57B 2KFKA 3PSEB 3V6CB 4KIKB 3JYUA 1M94A 2IY1B 3D32A 5CTRC 4IWQA 4MGYE 2LGXA 2JRIB 3V61A 4HPLB 2KJ6A 3Q3JA 2MSED 2NPTB 2KQ7A 3N3KB 3VTVA 2KX0A 3M95A 2LUEA 3VAWA 4IC7B 2BYFA 4NAWB 4IWPA 3RZWC 1WR1A 4EFOA 4PYUA 2MP2B 3IFWB 3KUZA 1LFDA 2D11A 3SDLC 4BKSD 3K9OB 1NI2A 4NQKE 1WM2A 2HE7A 1E8ZA 2IO3B 1EUVB 1V49A 3PHXB 3KUDB 4MSMB 2GBNA 3VXWA 3ZTDA 3P2BA 5J2RA 1E7UA 1E8YA 4E74A 1Y8RC 4GN1A 4PYZA 4W9HA 1KOTA 3A9JB 5D6JB 4B6WA 5L83A 1YX6B 3ZNID 4DDID 1MG8A 3ML8A 2KK8A 5CX3A 2A5UA 4WJQA 2CU1A 2JUOA 2LXAA 4ZRJA 3RULA 1UD7A 3IG3A 1FXTB 2OJRA 2NBUA 3PT2B 4LJPB 5L95C 4A3OA 4PS8A 4B95A 2BKFA 4EEWA 4NPNA 5AZGA 2GBMA 2KMAA 3RZFA 3AU4A 2MQJA 2ZPYA 5DPRA 4GDKA 3W1YA 2UWQA 1E7VA 4WWOA 1UBIA 4GU2A 2G4SA 5DPTA 4ANVA 2XEWA 4RMAA 2MBQA 1OTRB 3VUWA 3A4RA 2BPSA 2L0TA 2ZPNA 2CHZA 3UIOB 3CF6E 1WGRA 2R2OA 2FAZA 3ML9A 4PS3A 4BKTA 2KANA 2AL3A 1YX5B 2O2VA 3L16A 3ZNGC 2BYEA 1NBFC 2J0MA 4FJYA 3N30A 3T9LA 2I1KA 4KZ0A 3HM6X 4DHZB 1HE8A 1UH6A 2C7HA 2FIFA 4EZJA 2KD0A 3M62B 5TR5A 3ZNZB 2LRWA 4HJKA 1J8CA 3HHMA 2KX3A 2N7DA 3APDA 3QARA 4YL8A 3U30A 4DBGA 5IA7A 3UINB 3VTWA 3L08A 1OQYA 1WF9A 2BWES 1RFAA 2KDEB 2L8JA 4GSWA 2ZVOA 3OLMD 1EF5A 1UELA 2N4FA 3DVGY 3RT3B 4EKUA 4XC2A 3QCAA 4JL9A 3A1QB 4KZCA 1OEYJ 3MHSD 1KM7A 1QZEA 4GDLA 4DHJB 3AULA 4W9IA 4B9KA 4W9EA 4DK5A 2GBJA 1UZXB 3L54A 4M8MA 1GNUA 3DCGA 3KYDD 2DZIA 2JVCA 2ZCCA 3ZNHB 4GB9A 4BVUC 4NY0A 5G2NA 2J0JA 3EC8A 4MGZE 3ZKJC 3QX1A 1A5RA 2ASQA 2MX2A 2K39A 3B08A 4AJYB 3JW0X 4WJOA 4II3B 2XK5A 3MTNB 2IY0B 2KTRB 4GMVA 1J0GA 1LQBA 3DOWA 2J7QB 1WGDA 3T8MA 2K1FA 3ALBA 5EDSA 1P98A 3PRZA 2D10A 4LDTB 2CKHB 2KHWB 5LLIA 4GGQA 4K7UA 4ANXA 1Q1OA 2ZCBA 2XK5B 3V60A 2KWVB 4FADA 2AL6A 4EUTA 3B1LX 2KN5A 3DBLI 4FA6A 1WX7A 2IBIB 2VRRB 3RCZA 4AUQC 2LVOA 4ICUA 2DAJA 2YVCA 2KJRA 3MJWA 4OVUA 4IG7B 2JY6A 2C60A 1UGMA 2JRHA 4BBNC 3VTUA 1XD3B 2BYVE 4FJZA 1GG3A 2KWCA 2MBHA 4AWJA 3L0WB 5KHOA 3WAMA 4DHJD 2GOWA 4WWPA 3NS8A 2M0XA 2RGFA 3VH3B 1GJZA 1GUAB 4LJOB 4MJSA 2JZZA 4JIOU 4JGHB 4KSLC 2FIDA 2DYOA 2ZZPB 3VDZA 2IYDB 3WAPA 3M63B 4HDQA 3RYTA 3SHQA 2WX0A 3TBLD 1WJUA 1J19A 2FCMA 4FJVB 2IO2B 2BWFA 4FLHA 5AEKB 2L05A 3PGEA 3NY5A 3QJZA 3UQAA 1WE6A 5CHFA 2YLMA 3ECIA 2KMCA 4KVGB 4M0WB 3TCAA 3M3JA 3CSFA 1C1YB 5CHVC 4A20A 4ANWA 2RD0A 4NNJB 4HXDA 2G4DB 2IO0B 3H9DA 3TL5A 4XZ4A 2C5LC 3H6NA 5LXHA 1OGWA 1Q5WB 2B3AA 5DPSA 1H8CA 4GDKB 3CSTA 3WANA 4G0NB 4K7WA 1L2NA 3L13A 2M1MA 2N1VA 3V62A 1WZ0A 4IWOA 2LI5A 1I35A 4G50A 3RD2A 1YD8U 1C3TA 1V2YA 3DDCB 5JZEB 3NOBA 4N9F4 2GBRA 4W9JA 1LM8B 2N9XA 3QAQA 4FBJB 3ZW3A 1E8XA 2N9EB 2K25A 3A9JA 4F7ZA 2AYOB 5JHBA 2N9PC 1YIWA 3TJPA 3QIJA 2L0FA 4DXAB 2BGFA 2LVQA 3GZNI 2ZVNA 1RRBA 3HK0A 2NBWB 3KYCD 2KWUB 3NZSA 3RUIB 4CYEA 3QC8B 2V1YA 2FUHB 3QQ8B 2D3GA 1WYWB 3WA0A 3W1SA 2LVPA 2RPQA 2MBOA 4NJ6A 4DHZE 2D07B 3KVFB 4MSQB 2AEHA 4KV2A 1SIFA 2CHXA 1WR6E 1WM3A 3QWZB 1CMXB 3S2AA 2NR2A 3ZDTA 2KLCA 4IM0A 3ZLZA 2DX5B 2DENB 4MGKE 4I6PA 2KC2A 3SD5A 1R4NI 3AI5A 1JRUA 3DBHI 2MRPA 2KFKB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DAF A;  2BF8 B;  4EOY A;  5J18 A;  5D2M B;  2NCN A;  3EHV A;  4EZL A;  4I6N B;  2PPH A;  4JLC A;  5E6P A;  1D3Z A;  4MH0 E;  4AJW A;  4FHJ A;  3ENE A;  2K8H A;  1LXD A;  1V5T A;  3H7S A;  5D7G A;  3KUC B;  2W9N A;  4W9C A;  4HLE A;  2Z59 B;  2LWP A;  2RSU A;  3KH0 A;  3B0A A;  4HCP B;  4MJS B;  3L17 A;  3VUX A;  1P0R A;  1Z2M A;  4BBN F;  1BT0 A;  4FN2 A;  3W1S C;  3ZTC A;  2O6V D;  1R4M I;  4MM3 A;  3U7D A;  3A9K A;  2MBE A;  3UF8 A;  1YQB A;  3PS6 A;  2LJ5 A;  3O65 B;  3ZIM A;  3AU5 A;  2FCS A;  2GMI C;  1XT9 B;  1EO6 A;  3BIN A;  3N32 A;  1ZW7 A;  4FHK A;  3LJ3 A;  3V6E B;  3JVZ X;  2LAS A;  1WY8 A;  4URK A;  4GXB A;  3ZRF A;  1E90 A;  3R3M A;  4ZYN A;  4G11 A;  1V80 A;  4W9F A;  4ZDV A;  2M17 A;  4K1R B;  1L7Y A;  3R7Q A;  4IUM B;  4XX5 A;  2DYM A;  4TKN A;  4ASW C;  4II2 B;  1T0Y A;  4J6I A;  4DDG D;  5D94 A;  3EFU A;  4W9K A;  1VD2 A;  4MDK E;  1WXS A;  4NQL B;  2IO1 B;  3LDZ E;  4RM9 A;  3TIX A;  2D2Q A;  2PJH A;  3OJ4 B;  3OJ3 A;  1WI0 A;  4WQO B;  4LCD E;  3VHT C;  2KZR A;  1E8W A;  3IHP C;  3VVW B;  3WIM A;  3I3T B;  2K8C A;  1WE7 A;  1OEY A;  1WIA A;  1K8R B;  2K6D B;  3PV1 A;  1V81 A;  3AXC A;  5DCN A;  3IBE A;  1WJ4 A;  1F9J A;  3U8Z A;  2JF5 A;  3R66 C;  2O6V B;  4HCN B;  4E71 A;  3ZDM C;  1AAR A;  2WX1 A;  3APC A;  3A1Q A;  2N1W A;  2NS5 A;  3ZVV A;  1Z5S B;  4A3P A;  3UQB A;  1GC7 A;  1WX8 A;  2NVU I;  1RLF A;  2N7E A;  1UBQ A;  2CHW A;  2L7R A;  1WRD B;  1NDD A;  2KQS A;  1KLV A;  1ZGU B;  3QHT A;  3VFK A;  2KFJ A;  1WZ3 A;  1WMH A;  2NPT A;  1U4A A;  3WAL A;  5C23 A;  5JH5 C;  3H1U A;  4K81 A;  5IAA C;  5J17 A;  1WMH B;  3KW5 B;  1TGZ B;  1WGH A;  4HVB A;  3HIZ A;  2KLG A;  3PRM B;  3NZU A;  2DZM A;  2J0K A;  4ANU A;  2JZ3 B;  3GOE A;  5HKH A;  2O6V A;  5GMV A;  2WYQ A;  4IM2 A;  4W9D A;  1KJT A;  2O2V B;  3OAW A;  3H7P B;  2LZ6 A;  5CHW A;  4AP4 C;  2JPH A;  4AOF A;  1X1M A;  2ZNV C;  2C7M B;  2WDT B;  5KHQ A;  4TUU A;  2A4Z A;  1SGH A;  2JWZ A;  2OOB B;  3JSV B;  3PHW B;  1WH3 A;  1TBE A;  1WGY A;  2EMS A;  2KO3 A;  1IPG A;  2ZEQ A;  2KTF A;  2JXX A;  3ZUN A;  2M8S A;  2PE6 B;  3PLU A;  3ONS A;  4KSK C;  1V5O A;  5AZH A;  1EF1 A;  3QA8 A;  2XBB C;  2G45 B;  3VH4 B;  4F1S A;  1TZ1 A;  2FCQ A;  3WAO A;  2DZJ A;  1Q0W B;  4HPM B;  2KKC A;  2MWS B;  2LD9 A;  2WWZ A;  3VQI A;  4LDT D;  4HWI B;  2DZK A;  3TMP B;  1H4R A;  3PRP B;  3X23 A;  5DPW A;  3R7R A;  3JSV A;  2MBB B;  4NJ7 A;  4OVV A;  1ISN A;  2LXC A;  3K9P B;  3DQV A;  1IP9 A;  2MLB A;  2KDF B;  3PZD A;  4KDL B;  3PRE A;  4IM3 A;  3DBR I;  3H7P A;  2EKE C;  5E6N A;  3A9K B;  5LXI B;  1WXV A;  1YJ1 A;  2ZNV B;  1TTN A;  5E6O A;  3C0R B;  3X0W A;  3PVL A;  4WJN A;  2MP2 A;  1ZKH A;  2UYZ B;  3DPD A;  4GIV A;  4TV3 A;  2HTH A;  1WFY A;  4NAW A;  2G3Q B;  2KNB A;  3A4S C;  2IZV B;  4P7I A;  2KDI A;  3A33 B;  2Z0E B;  3DVN V;  5BO4 B;  2C7N B;  3PPA A;  4DWF A;  4BOS C;  2ZJD A;  2PE9 A;  1P9D U;  3L10 B;  3DVN U;  4BFR A;  2CS4 A;  1S1Q B;  4TQ1 A;  2Y5B B;  4BKS A;  3QK0 A;  3PTF C;  5G55 A;  1WX9 A;  5FR6 A;  4ZRI A;  5C1Z A;  2FCN A;  2RR9 A;  4HK2 A;  1PQS A;  2L3Z A;  4JQW C;  1WXA A;  1IYF A;  2HD5 B;  4TQ0 A;  4WJP A;  2M4N A;  1WXM A;  2AWT A;  4MGI E;  3VUY A;  2KC1 A;  1GC6 A;  1E5W A;  3HM3 A;  4M8N A;  2MW5 A;  3SU8 X;  2QHO A;  4BKG A;  2LGY A;  2K6Q A;  2KDB A;  2V3S A;  3UGB B;  4IW0 A;  2C9W B;  2DYB A;  1VCB A;  2MA9 B;  1P1A A;  2EMT A;  4G3X B;  4WAA A;  2KOX A;  3CMM B;  4K7S A;  4I6L B;  5AZF A;  2L00 B;  4MEL A;  2GBK A;  4PS7 A;  2LGD A;  4KDI C;  4ZRK A;  2KXJ A;  3ZRC A;  2FNJ B;  4GOC A;  4BOZ B;  2LRU A;  1G6J A;  1S3S G;  2I1J A;  1SE9 A;  3DBS A;  2JT4 B;  3IVF A;  2BKR B;  4RM8 A;  4W9L A;  1V9J A;  4ICV A;  2MCN B;  2REX A;  1WJ6 A;  1P3Q U;  3NHE B;  4GDL B;  5JHA A;  2K8B A;  2L76 A;  2KTR A;  2CR5 A;  3EEC A;  3PLV A;  1I42 A;  2PEA A;  1V86 A;  4W9G A;  3Q3F A;  4MEM A;  4HDO A;  1RAX A;  2KVR A;  2NBV B;  4E3C A;  1WJN A;  4CO7 A;  3BY4 B;  3UIP B;  2V4L A;  2DHZ A;  3APF A;  2R2Q A;  3DVG X;  3ZO5 B;  4F8C B;  1V6E A;  1WGG A;  2KJH B;  4WWN A;  2HJ8 A;  2Z0D B;  4FUL A;  4CHK A;  4EZK A;  4KIK A;  1XQQ A;  4X57 B;  2KFK A;  3PSE B;  3V6C B;  4KIK B;  3JYU A;  1M94 A;  2IY1 B;  3D32 A;  5CTR C;  4IWQ A;  4MGY E;  2LGX A;  2JRI B;  3V61 A;  4HPL B;  2KJ6 A;  3Q3J A;  2MSE D;  2NPT B;  2KQ7 A;  3N3K B;  3VTV A;  2KX0 A;  3M95 A;  2LUE A;  3VAW A;  4IC7 B;  2BYF A;  4NAW B;  4IWP A;  3RZW C;  1WR1 A;  4EFO A;  4PYU A;  2MP2 B;  3IFW B;  3KUZ A;  1LFD A;  2D11 A;  3SDL C;  4BKS D;  3K9O B;  1NI2 A;  4NQK E;  1WM2 A;  2HE7 A;  1E8Z A;  2IO3 B;  1EUV B;  1V49 A;  3PHX B;  3KUD B;  4MSM B;  2GBN A;  3VXW A;  3ZTD A;  3P2B A;  5J2R A;  1E7U A;  1E8Y A;  4E74 A;  1Y8R C;  4GN1 A;  4PYZ A;  4W9H A;  1KOT A;  3A9J B;  5D6J B;  4B6W A;  5L83 A;  1YX6 B;  3ZNI D;  4DDI D;  1MG8 A;  3ML8 A;  2KK8 A;  5CX3 A;  2A5U A;  4WJQ A;  2CU1 A;  2JUO A;  2LXA A;  4ZRJ A;  3RUL A;  1UD7 A;  3IG3 A;  1FXT B;  2OJR A;  2NBU A;  3PT2 B;  4LJP B;  5L95 C;  4A3O A;  4PS8 A;  4B95 A;  2BKF A;  4EEW A;  4NPN A;  5AZG A;  2GBM A;  2KMA A;  3RZF A;  3AU4 A;  2MQJ A;  2ZPY A;  5DPR A;  4GDK A;  3W1Y A;  2UWQ A;  1E7V A;  4WWO A;  1UBI A;  4GU2 A;  2G4S A;  5DPT A;  4ANV A;  2XEW A;  4RMA A;  2MBQ A;  1OTR B;  3VUW A;  3A4R A;  2BPS A;  2L0T A;  2ZPN A;  2CHZ A;  3UIO B;  3CF6 E;  1WGR A;  2R2O A;  2FAZ A;  3ML9 A;  4PS3 A;  4BKT A;  2KAN A;  2AL3 A;  1YX5 B;  2O2V A;  3L16 A;  3ZNG C;  2BYE A;  1NBF C;  2J0M A;  4FJY A;  3N30 A;  3T9L A;  2I1K A;  4KZ0 A;  3HM6 X;  4DHZ B;  1HE8 A;  1UH6 A;  2C7H A;  2FIF A;  4EZJ A;  2KD0 A;  3M62 B;  5TR5 A;  3ZNZ B;  2LRW A;  4HJK A;  1J8C A;  3HHM A;  2KX3 A;  2N7D A;  3APD A;  3QAR A;  4YL8 A;  3U30 A;  4DBG A;  5IA7 A;  3UIN B;  3VTW A;  3L08 A;  1OQY A;  1WF9 A;  2BWE S;  1RFA A;  2KDE B;  2L8J A;  4GSW A;  2ZVO A;  3OLM D;  1EF5 A;  1UEL A;  2N4F A;  3DVG Y;  3RT3 B;  4EKU A;  4XC2 A;  3QCA A;  4JL9 A;  3A1Q B;  4KZC A;  1OEY J;  3MHS D;  1KM7 A;  1QZE A;  4GDL A;  4DHJ B;  3AUL A;  4W9I A;  4B9K A;  4W9E A;  4DK5 A;  2GBJ A;  1UZX B;  3L54 A;  4M8M A;  1GNU A;  3DCG A;  3KYD D;  2DZI A;  2JVC A;  2ZCC A;  3ZNH B;  4GB9 A;  4BVU C;  4NY0 A;  5G2N A;  2J0J A;  3EC8 A;  4MGZ E;  3ZKJ C;  3QX1 A;  1A5R A;  2ASQ A;  2MX2 A;  2K39 A;  3B08 A;  4AJY B;  3JW0 X;  4WJO A;  4II3 B;  2XK5 A;  3MTN B;  2IY0 B;  2KTR B;  4GMV A;  1J0G A;  1LQB A;  3DOW A;  2J7Q B;  1WGD A;  3T8M A;  2K1F A;  3ALB A;  5EDS A;  1P98 A;  3PRZ A;  2D10 A;  4LDT B;  2CKH B;  2KHW B;  5LLI A;  4GGQ A;  4K7U A;  4ANX A;  1Q1O A;  2ZCB A;  2XK5 B;  3V60 A;  2KWV B;  4FAD A;  2AL6 A;  4EUT A;  3B1L X;  2KN5 A;  3DBL I;  4FA6 A;  1WX7 A;  2IBI B;  2VRR B;  3RCZ A;  4AUQ C;  2LVO A;  4ICU A;  2DAJ A;  2YVC A;  2KJR A;  3MJW A;  4OVU A;  4IG7 B;  2JY6 A;  2C60 A;  1UGM A;  2JRH A;  4BBN C;  3VTU A;  1XD3 B;  2BYV E;  4FJZ A;  1GG3 A;  2KWC A;  2MBH A;  4AWJ A;  3L0W B;  5KHO A;  3WAM A;  4DHJ D;  2GOW A;  4WWP A;  3NS8 A;  2M0X A;  2RGF A;  3VH3 B;  1GJZ A;  1GUA B;  4LJO B;  4MJS A;  2JZZ A;  4JIO U;  4JGH B;  4KSL C;  2FID A;  2DYO A;  2ZZP B;  3VDZ A;  2IYD B;  3WAP A;  3M63 B;  4HDQ A;  3RYT A;  3SHQ A;  2WX0 A;  3TBL D;  1WJU A;  1J19 A;  2FCM A;  4FJV B;  2IO2 B;  2BWF A;  4FLH A;  5AEK B;  2L05 A;  3PGE A;  3NY5 A;  3QJZ A;  3UQA A;  1WE6 A;  5CHF A;  2YLM A;  3ECI A;  2KMC A;  4KVG B;  4M0W B;  3TCA A;  3M3J A;  3CSF A;  1C1Y B;  5CHV C;  4A20 A;  4ANW A;  2RD0 A;  4NNJ B;  4HXD A;  2G4D B;  2IO0 B;  3H9D A;  3TL5 A;  4XZ4 A;  2C5L C;  3H6N A;  5LXH A;  1OGW A;  1Q5W B;  2B3A A;  5DPS A;  1H8C A;  4GDK B;  3CST A;  3WAN A;  4G0N B;  4K7W A;  1L2N A;  3L13 A;  2M1M A;  2N1V A;  3V62 A;  1WZ0 A;  4IWO A;  2LI5 A;  1I35 A;  4G50 A;  3RD2 A;  1YD8 U;  1C3T A;  1V2Y A;  3DDC B;  5JZE B;  3NOB A;  4N9F 4;  2GBR A;  4W9J A;  1LM8 B;  2N9X A;  3QAQ A;  4FBJ B;  3ZW3 A;  1E8X A;  2N9E B;  2K25 A;  3A9J A;  4F7Z A;  2AYO B;  5JHB A;  2N9P C;  1YIW A;  3TJP A;  3QIJ A;  2L0F A;  4DXA B;  2BGF A;  2LVQ A;  3GZN I;  2ZVN A;  1RRB A;  3HK0 A;  2NBW B;  3KYC D;  2KWU B;  3NZS A;  3RUI B;  4CYE A;  3QC8 B;  2V1Y A;  2FUH B;  3QQ8 B;  2D3G A;  1WYW B;  3WA0 A;  3W1S A;  2LVP A;  2RPQ A;  2MBO A;  4NJ6 A;  4DHZ E;  2D07 B;  3KVF B;  4MSQ B;  2AEH A;  4KV2 A;  1SIF A;  2CHX A;  1WR6 E;  1WM3 A;  3QWZ B;  1CMX B;  3S2A A;  2NR2 A;  3ZDT A;  2KLC A;  4IM0 A;  3ZLZ A;  2DX5 B;  2DEN B;  4MGK E;  4I6P A;  2KC2 A;  3SD5 A;  1R4N I;  3AI5 A;  1JRU A;  3DBH I;  2MRP A;  2KFK B; 
#chains in the Genus database with same CATH topology
 1PDX A;  2KN4 A;  3EHV A;  2BS4 B;  2WXR A;  2BVC A;  4MH0 E;  3BK2 A;  3AE7 B;  5D7G A;  3KH0 A;  2V3N A;  3B0A A;  4HCP B;  2M19 A;  1Z2M A;  1FEH A;  1K52 A;  4FN2 A;  3TUO A;  3ZTC A;  2O6V D;  4J3O D;  2PIA A;  1UNS A;  3UF8 A;  4HKZ E;  2LJ5 A;  3AU5 A;  1WGK A;  1IGD A;  1FNU A;  3AED B;  1ZOY B;  2GMI C;  1NEK B;  3N32 A;  1ZW7 A;  3V6E B;  3UI3 A;  1WY8 A;  3IAM 1;  3PZ8 A;  2PLP A;  4ZYN A;  4W9F A;  5BMI A;  4NZL B;  4XX5 A;  4ASW C;  1T0Y A;  5EE1 A;  4B0E A;  2X8X X;  2LJI A;  1PYW D;  1WXS A;  1IBX A;  3LDZ E;  1TYG B;  3TIX A;  2MJE A;  2D2Q A;  1L6V A;  1E8W A;  1FXI A;  3EFC A;  3SEB A;  1V81 A;  3ZJV A;  4RNA A;  4E71 A;  3ZDM C;  1JCK B;  2WX1 A;  3UQB A;  1QOB A;  1Z5S B;  4N6E B;  1GC7 A;  2CU3 A;  4RF0 A;  1RLF A;  2N7E A;  1UBQ A;  1WRD B;  1WMH A;  1U4A A;  3WAL A;  3H1U A;  4K81 A;  3KW5 B;  3VRB B;  3HIZ A;  4A6Q A;  3N20 C;  3AEE B;  2XNA C;  4IKG A;  4YSZ B;  1JWU D;  4W9D A;  1I4R A;  2N0S B;  2MEK A;  3J9C A;  2LZ6 A;  4AP4 C;  2JPH A;  4AOF A;  1X1M A;  3B2F A;  2ZNV C;  4HEA 1;  4TUU A;  2A4Z A;  2BB6 A;  3JSV B;  1WGY A;  1IPG A;  2ZEQ A;  2KTF A;  2JXX A;  2JXT A;  4F1S A;  3SFD B;  1QQR A;  1KTK A;  1YOV B;  3TEZ A;  1FNV A;  3TMP B;  2DZK A;  5DPW A;  5G5H A;  4OVV A;  3DBH B;  1GPX A;  1GB1 A;  3PRE A;  1V8C A;  3H7P A;  5E6N A;  1K51 A;  1WXV A;  2ZW1 A;  3X0W A;  1K50 A;  3DPD A;  1WFY A;  4NAW A;  3A4S C;  3DVN V;  2C7N B;  1SSN A;  3O13 A;  1GOZ A;  4BOS C;  2PE9 A;  4M0W A;  3P1M A;  3WCQ A;  4HK2 A;  1WXM A;  3HM3 A;  4C4V A;  2MW5 A;  2KDB A;  2V3S A;  4JPS A;  2C9W B;  2BYT A;  3RNE C;  2MA9 B;  2EMT A;  4G3X B;  3CMM B;  4I6L B;  3AEA B;  2LUM A;  1SXT A;  4KDI C;  4ZRK A;  2KXJ A;  2V0G A;  2LRU A;  4ZRQ A;  2WLB A;  1QOF A;  4RM8 A;  1YN3 A;  1WJ6 A;  2PVO D;  3PLV A;  3Q3F A;  1E10 A;  4HDO A;  4R3D A;  1WSP A;  3GS2 A;  3GZN B;  3BWU D;  2V4L A;  4RGN A;  3APF A;  3DVG X;  3ZO5 B;  4F8C B;  1V6E A;  3NVV A;  4CHK A;  4X57 B;  1XCT L;  4KIK B;  3JYU A;  3D32 A;  5CTR C;  1JW9 D;  4IWQ A;  2WXH A;  1CZP A;  2WHI A;  4HPL B;  2MSE D;  2NPT B;  2KQ7 A;  3IT6 B;  3N3K B;  4XWW A;  2LUE A;  3VAW A;  2E3T A;  4IC7 B;  2BYF A;  4EFO A;  4PT5 A;  3KUZ A;  4C80 A;  1NI2 A;  1XF5 L;  2JSV X;  3AE5 B;  1E8Z A;  2IO3 B;  1V49 A;  3PHX B;  2KWD A;  1E7U A;  1P7E A;  2NTS A;  4GN1 A;  4PYZ A;  4W9H A;  2A5U A;  3EUB 2;  3IG3 A;  1GB4 A;  1C4P A;  1N61 A;  5AZG A;  2ACZ B;  2MQJ A;  1E7V A;  4WWO A;  2G4S A;  2QEJ C;  4OW0 A;  3DHH C;  4RMA A;  2MBQ A;  1OTR B;  4A90 A;  1TKE A;  4US8 A;  2ZPN A;  3CF6 E;  1KRH A;  2KAN A;  1T3Q A;  1YX5 B;  3ZNG C;  2BYE A;  1NBF C;  2VZK D;  4WQM A;  1EWY C;  1UWM A;  4KZ0 A;  4DHZ B;  1HE8 A;  2C7H A;  5TR5 A;  4HJK A;  1J8C A;  5HFY A;  2KX3 A;  3VTW A;  5BYS A;  1EF5 A;  2N4F A;  3DVG Y;  1JRO A;  1J7C A;  2ICI A;  2B76 B;  1KM7 A;  1QZE A;  4GDL A;  4B9K A;  1GNU A;  1OQQ A;  1F77 A;  2DZI A;  5G2N A;  3MC9 A;  4KKJ A;  1HA5 A;  2WDV B;  2QMT A;  3GB1 A;  4XYC A;  2K39 A;  3FKY A;  3B08 A;  1NEN B;  5C2T B;  4JX1 C;  1J0G A;  2J7Q B;  2K1F A;  3HRD D;  1E0Z A;  3AEB B;  2AQ2 B;  1DOI A;  3RI7 C;  1E7P B;  5BMH A;  3Q69 A;  4EUT A;  1WX7 A;  3DHG C;  2W3S A;  2YVC A;  1QLB B;  4OVU A;  2C60 A;  3FIL A;  4XE0 A;  2RDB C;  1AW7 A;  2KWC A;  2WXF A;  4MM3 B;  4MJS A;  1QOA A;  1CJE A;  2ZZP B;  3VDZ A;  3RYT A;  2QC8 A;  1J19 A;  3H8H A;  4OZA A;  4FJV B;  2IO2 B;  1VJK A;  2WU5 B;  5AEK B;  4REZ A;  4P6V F;  3QJZ A;  3R8B A;  3RNA C;  4M0W B;  1MFW A;  3RN9 C;  1SIJ A;  2JYE A;  2I38 A;  3AE4 B;  3Q8C A;  2IO0 B;  3H9D A;  3H6N A;  2B3A A;  1EU3 A;  4K7W A;  1L2N A;  3DWM A;  3L13 A;  2W3R A;  4IWO A;  4G50 A;  1YD8 U;  1V2Y A;  2J53 A;  2JQR B;  4N9F 4;  2GBR A;  4LK0 M;  1UGJ A;  5JXV A;  5HI1 A;  4ARI A;  3A9J A;  2AYO B;  1HXY D;  3B2G A;  2L52 A;  1YIW A;  1KLU D;  2WDR B;  2LHD A;  2BGF A;  2LVQ A;  4FXC A;  2QJL A;  2HDE A;  3NVZ A;  2KWU B;  4CYE A;  2XN9 C;  3GE3 C;  2D3G A;  1FCC C;  4DHZ E;  2FBW B;  4A8X C;  1VZ7 A;  3QWZ B;  3S2A A;  2J4X A;  2RDH A;  2DX5 B;  4I6P A;  2KC2 A;  3SD5 A;  3LYY A;  3AI5 A;  2MRP A;  1RFK A;  4I6N B;  2PPH A;  4FHJ A;  3ENE A;  3RNF C;  1FFU A;  1LXD A;  4D2K A;  4ZRP A;  1SJE D;  2Z59 B;  2RSU A;  3AV8 A;  1GAQ B;  4RFB A;  4CQN A;  4IOI E;  1R4M I;  1DGJ A;  3RMK C;  3A9K A;  3RFZ B;  5AUI A;  1YQB A;  2VZK B;  4ZHO A;  3BIN A;  2WGS A;  3LJ3 A;  3VR8 B;  4URK A;  4GXB A;  3R3M A;  1NI3 A;  1OFF A;  4G11 A;  1V80 A;  4TSS A;  2WXO A;  1FRD A;  3R7Q A;  3PO0 A;  4TKN A;  4DDG D;  3Q3N C;  1VD2 A;  4MDK E;  2DBY A;  4NQL B;  5EE9 A;  5FR3 A;  1NYR A;  1WI0 A;  4WQO B;  2H89 B;  4S0R A;  3IHP C;  1WE7 A;  1K8R B;  1WJ4 A;  2O6V B;  4HCN B;  1PGA A;  1FM0 D;  2NS5 A;  4B0M A;  4A3P A;  2GLS A;  1NDD A;  2PKO A;  5J17 A;  4K3C A;  1WGH A;  3AEG B;  3PRM B;  2LGS A;  1T6B X;  2JZ3 B;  4IM2 A;  3BVM A;  3H7P B;  2HJ1 A;  5CHW A;  2C7M B;  1C4A A;  4MH8 A;  1F1H A;  2JWZ A;  3PHW B;  4MAC A;  2M8S A;  2YEP F;  1JWB D;  1T0R C;  4HJG E;  1TZ1 A;  1MJD A;  2FCQ A;  4ZOH C;  4HPM B;  2SAK A;  2MWS B;  1C76 A;  1D5Z C;  3X23 A;  3PRP B;  3JSV A;  3U7Z A;  2MBB B;  4NJ7 A;  1R4N B;  2LXC A;  3K9P B;  1I4G A;  1IP9 A;  2MLB A;  3PZD A;  1B1Z A;  4IM3 A;  3DBR I;  3ETR A;  2EKE C;  3A9K B;  2ZNV B;  5E6O A;  1FRR A;  4GIV A;  2HTH A;  4YWG G;  2IZV B;  2KDI A;  1T0Q C;  2Z0E B;  1Q10 A;  2ZJD A;  2H88 B;  4LNO A;  3DVN U;  4BFR A;  4ITK A;  4TQ1 A;  3URY A;  4LNF A;  2Y5B B;  1EU4 A;  2INP E;  5FR6 A;  4ZRI A;  2FCN A;  4JQW C;  5C3J B;  1WXA A;  2JZP A;  2L83 A;  4WJP A;  2M4N A;  4MGI E;  4OHJ A;  1KFY B;  3SU8 X;  3AH7 A;  4IW0 A;  4UDU C;  4M01 A;  3KLS X;  4K7S A;  2L00 B;  4MEL A;  2WXQ A;  4PS7 A;  2LGD A;  4BOZ B;  4GOC A;  1G6J A;  4YTP B;  1SE9 A;  1RYJ A;  2BKR B;  1V9J A;  2MCN B;  3N1Z C;  1P3Q U;  5JHA A;  5FK9 C;  2L76 A;  2CR5 A;  1I42 A;  2PEA A;  1V86 A;  4W9G A;  3MJ5 A;  4KGT A;  5HG2 A;  3KWV A;  1WXQ A;  2OED A;  3ZQ4 A;  2DHZ A;  3Q8E A;  2E6X A;  2Y3A A;  1AYF A;  2HJ8 A;  4FUL A;  3NUH B;  4EZK A;  2JYT A;  3V6C B;  1F52 A;  2IJ0 A;  1R4M B;  2AX5 A;  1TT5 B;  4NAW B;  4P1C C;  1WR1 A;  1XLP A;  2MP2 B;  3IFW B;  2IND C;  1HEZ E;  2WXI A;  4BKS D;  5BMG A;  1YJI A;  1F2R C;  3ZXR A;  1WM2 A;  1ZXI A;  2HE7 A;  4LTU A;  3FIL B;  3KUD B;  3P4Q B;  4MSM B;  3ZTD A;  2VH1 A;  3P2B A;  2WXJ A;  1Y8R C;  1KOT A;  5L83 A;  1MHH E;  5CX3 A;  2X38 A;  4AQ7 A;  2JUO A;  2LXA A;  4ZRJ A;  1QT9 A;  2OJR A;  2NBU A;  3PT2 B;  5L95 C;  4EEW A;  3Q14 C;  4GDK A;  2UWQ A;  2V4I B;  4GU2 A;  3NJT A;  5DPT A;  1CQV A;  3RNG C;  2CHZ A;  2R2O A;  2J0M A;  2I1K A;  5IN7 A;  3I5J C;  2ONQ A;  1OQR A;  1UH6 A;  2FIF A;  4EZJ A;  2KD0 A;  2LRW A;  1SE3 A;  2NMQ A;  3U30 A;  3UIN B;  1ESF A;  1MHX A;  1OQY A;  3MC8 A;  2KDE B;  2VH2 A;  4HRS A;  1V1O A;  4XDD A;  3RT3 B;  2WXG A;  1XO3 A;  3A1Q B;  1OEY J;  4W9E A;  1SF0 A;  1JAL A;  2PMV A;  4M8M A;  3DCG A;  2ZCC A;  4BVU C;  3MFG A;  2K22 A;  1I4X A;  4AJY B;  4WJO A;  4RGM A;  2LGI A;  3AE8 B;  2INN E;  3DOW A;  1C79 A;  5EE0 A;  4L2Y A;  1EWC A;  3ALB A;  1P98 A;  3PRZ A;  4A9A A;  1NYQ A;  2CKH B;  2KHW B;  3DBR B;  4GGQ A;  4ANX A;  1Q1O A;  2XK5 B;  3V60 A;  4C56 C;  3HVD A;  1L0V B;  2LVO A;  2DAJ A;  3V3X A;  1RWS A;  3RNC C;  1HZ6 A;  4YXD B;  2JRH A;  1XD3 B;  4HRO A;  2MBH A;  1TY0 A;  3WAM A;  4WWP A;  1LO5 D;  3NS8 A;  2M0X A;  2RGF A;  2WNM A;  1QF6 A;  2N9K A;  2JZZ A;  4JIO U;  2FID A;  2IYD B;  3M63 B;  3SHQ A;  3GE8 C;  1WYG A;  1ZXH A;  2KMC A;  4KVG B;  3AEF B;  4NNJ B;  4OVZ A;  3T3O A;  3IAS 1;  5LXH A;  2JWU A;  1OGW A;  2QDF A;  4PK1 A;  1FMA D;  4G0N B;  2N1V A;  1L5P A;  2OJW A;  1M4V A;  2LI5 A;  1C3T A;  1RM6 C;  3DDC B;  2BQQ A;  3NOB A;  1L0X B;  3ZW3 A;  1E8X A;  2N9E B;  2K25 A;  2N9P C;  2L0F A;  4EE2 A;  3KYC D;  3NZS A;  3RUI B;  3NRZ A;  3QQ8 B;  1WYW B;  3WA0 A;  2LVP A;  2RPQ A;  1MI0 A;  3SR6 A;  2D07 B;  2FUG 1;  4RGO S;  1WM3 A;  3ZDT A;  2I2Y A;  2DEN B;  4MGK E;  1TS2 A;  2QCZ A;  1CK1 A;  1EM7 A;  2DAF A;  5J18 A;  2WS3 B;  5D2M B;  2NCN A;  3RPF C;  4JLC A;  1Y56 A;  2K0P A;  2K8H A;  1V5T A;  3H7S A;  3KUC B;  2W9N A;  1AWD A;  3L17 A;  2V9H A;  1JWS D;  4BBN F;  1BT0 A;  4YSX B;  3U7D A;  3DBL B;  3O65 B;  4ZYS A;  3ZIM A;  1FXA A;  2FCS A;  3ZGZ A;  1XT9 B;  4OZC A;  2FE8 A;  3JVZ X;  2N9L A;  2LEK A;  3ZRF A;  1E90 A;  1FO4 A;  1QOG A;  4ZDV A;  2M0A A;  2DYM A;  2PW9 A;  4J6I A;  1ZE3 D;  5BYQ A;  3RNB C;  3OJ3 A;  1BUI C;  3VHT C;  4WWM A;  3WIM A;  2K8C A;  1WIA A;  1OEY A;  1XLQ A;  1T0S C;  2K6D B;  2KVZ A;  3PV1 A;  5DCN A;  3IBE A;  1F9J A;  2IGG A;  3U8Z A;  2N7J A;  1AAR A;  3APC A;  3A1Q A;  2N1W A;  1SB3 C;  1WX8 A;  4KKI A;  1YQ4 B;  1D5M C;  2NVU I;  2QSD A;  2CHW A;  3TEX A;  3N1X C;  3QHT A;  2KFJ A;  1WZ3 A;  2NPT A;  4DXF A;  5JH5 C;  1WMH B;  1C4C A;  3Q8F A;  3P4P B;  4HVB A;  3NZU A;  1F2R I;  2DZM A;  2WQY B;  3GOE A;  3LXF A;  5GMV A;  1KJT A;  2O2V B;  2INC C;  2KYW A;  1FCL A;  2EMS A;  2KO3 A;  3PLU A;  3ONS A;  1UWX A;  5G5G A;  5LNK 1;  2R61 A;  2XBB C;  3AM9 A;  1MG4 A;  1IGC A;  2DZJ A;  1Q0W B;  3AE9 B;  2KKC A;  2LD9 A;  1L4Z B;  4TMA B;  2WWZ A;  3VQI A;  1H4R A;  1SJH D;  3R7R A;  4YTN B;  1TIF A;  3Q6B A;  2WXM A;  5HHD G;  2KDF B;  4KDL B;  3CWI A;  1FNW A;  5LXI B;  3W9C B;  1TTN A;  3PVL A;  2MP2 A;  1ZKH A;  1IUE A;  2UYZ B;  1TJE A;  1WWT A;  4TV3 A;  3ZXV A;  2G3Q B;  2KNB A;  3R2T A;  4P7I A;  3A33 B;  5BO4 B;  3MP9 A;  5T8I A;  2CS4 A;  1S1Q B;  5D3I B;  3QK0 A;  2BS3 B;  5C1Z A;  2IDY A;  1D5X C;  1PQS A;  1IYF A;  1YMH E;  2HD5 B;  3VUY A;  1GC6 A;  3W2D A;  1XCQ L;  1XEE A;  2QHO A;  2LGY A;  4BKG A;  2K6Q A;  2DYB A;  1I4P A;  1P1A A;  4WAA A;  2WU2 B;  2KOX A;  4L1B A;  2GBK A;  3N9Y C;  3N1Y C;  2KAJ A;  1KLG D;  2W54 A;  3DBS A;  2JT4 B;  3IVF A;  4W9L A;  3ABV B;  3NHE B;  2K8B A;  3EEC A;  4DQO C;  4KGR A;  1YNT E;  4MEM A;  1RAX A;  3IXS A;  2KVR A;  2NBV B;  4E3C A;  3UIP B;  1TKY A;  3I63 C;  1WGG A;  2KJH B;  2HTM E;  4KIK A;  1XQQ A;  2KFK A;  2KDM A;  5I4D A;  3ZJT A;  2LGX A;  2JRI B;  3V61 A;  1VDV A;  3Q3J A;  2KX0 A;  3M95 A;  3RZW C;  5D3D A;  4RGT A;  1LFD A;  3SDL C;  2RPV A;  2WDQ B;  1BXT A;  3K9O B;  1N60 A;  2IGH A;  3VXW A;  2BB5 A;  1ROE A;  5J2R A;  1E8Y A;  4LNN A;  4E74 A;  4S17 A;  2JU6 X;  3A9J B;  4B6W A;  4RH6 A;  4DDI D;  1MG8 A;  2KK8 A;  4WJQ A;  2CU1 A;  3RUL A;  1UD7 A;  1STE A;  4WAF A;  4LJP B;  4A3O A;  3BYT B;  4PS8 A;  4B95 A;  2BKF A;  4NPN A;  4QAY A;  1R7S A;  2GBM A;  2KMA A;  2Y5C A;  2ZPY A;  5DPR A;  1TKG A;  1L6U A;  1VZ8 A;  4ANV A;  2XEW A;  3VUW A;  2NTT A;  2EEL A;  2BPS A;  2Q5W D;  4BKT A;  2AL3 A;  3NG0 A;  3L16 A;  4FJY A;  3N30 A;  2V3P A;  4AS1 A;  3HM6 X;  4JE3 B;  2WXK A;  3M62 B;  2OHF A;  3ZNZ B;  2N7D A;  3APD A;  4YL8 A;  4DBG A;  2WXL A;  2K3U A;  5IA7 A;  5GXG B;  2LMC A;  5AUK A;  1WF9 A;  2BWE S;  1RFA A;  2L8J A;  1QKZ A;  4GSW A;  3OLM D;  3C19 A;  3QCA A;  2JX5 A;  1PGX A;  4DHJ B;  3AUL A;  4RF1 A;  4DK5 A;  1UZX B;  3L54 A;  2JVC A;  3ZNH B;  4GB9 A;  3EC8 A;  3QX1 A;  1A5R A;  2MX2 A;  1N5X A;  3MTN B;  2IY0 B;  4NAM A;  1J7A A;  1L0Y B;  2W55 A;  1HZ5 A;  4M00 A;  5IP4 D;  1WGD A;  4RCO A;  3KWL A;  2D10 A;  5EE3 A;  2ZCB A;  3Q8B A;  2KWV B;  4FAD A;  2AL6 A;  3B1L X;  4H2A A;  2VRR B;  2IBI B;  3TEW A;  3C8Y A;  2K9X A;  2JY6 A;  3VTU A;  1XLN A;  2BYV E;  1GG3 A;  1ET9 A;  3L0W B;  4BZA A;  2GOW A;  1FD6 A;  3Q2A C;  1GJZ A;  3FC4 A;  2AQ3 B;  4KSL C;  2DYO A;  3TBL D;  2L32 A;  4C7Z A;  1KF6 B;  3TSS A;  1LGR A;  5H8Y E;  2BW2 A;  4IDI A;  3U52 E;  4FLH A;  1HTQ A;  2L05 A;  3NY5 A;  3R2I A;  1WE6 A;  5CHF A;  3V05 A;  2YLM A;  3TCA A;  5CHV C;  1V1P A;  4ANW A;  2RD0 A;  2LFI A;  2KMM A;  4DXG A;  4ACF A;  1ZPS A;  4C00 A;  4XZ4 A;  1Q5W B;  5DPS A;  3BVG A;  3CST A;  2Y5P A;  1QIL A;  2KQ4 X;  1IBX B;  2M1M A;  1WZ0 A;  1I35 A;  1T5X D;  3TEY A;  3NZ3 A;  2J52 A;  4FBJ B;  4F7Z A;  5JHB A;  1ZUD 2;  4LNI A;  3BK1 A;  3GZN I;  3HK0 A;  2NBW B;  3QC8 B;  2FUH B;  4WH4 A;  1F0Z A;  2IPK D;  1FFV A;  1SE4 A;  2MBO A;  4MSQ B;  2AEH A;  2RDG A;  1SIF A;  3I57 A;  1VRA B;  1CMX B;  2KLC A;  2D5G A;  2WXP A;  5BYR A;  1JWM D;  3ZLZ A;  1V1P B;  2MHJ A;  3MHZ A;  1R4N I;  2CJO A;  2L1A A;  2KFK B;  1VR9 A;  2BF8 B;  4EOY A;  5TSS A;  1JML A;  4EZL A;  2D3A A;  1SE2 A;  3T3N A;  5E6P A;  1D3Z A;  4AJW A;  3Q8A A;  1E9M A;  4HLE A;  4W9C A;  1I7H A;  2LWP A;  3ZJU A;  4MJS B;  3VUX A;  1P0R A;  1TS3 A;  3W1S C;  2QIL A;  4MM3 A;  1DOY A;  3P4S B;  2MBE A;  3PS6 A;  1PGB A;  3B9J A;  4KGS A;  1P7F A;  2YEP B;  4HPP A;  1EO6 A;  4FHK A;  5H92 C;  1UF0 A;  2LAS A;  3KQ4 A;  1WRI A;  1I4H A;  2CJN A;  4P1B C;  2M17 A;  4K1R B;  1L7Y A;  4IUM B;  4II2 B;  5D94 A;  3EFU A;  4XDC A;  4W9K A;  3W5V B;  2IO1 B;  2PVG C;  3OG5 A;  4RM9 A;  3E9S A;  2PJH A;  1YJJ A;  3OJ4 B;  4LCD E;  3EA6 A;  2KZR A;  4KX6 B;  3VVW B;  2WP9 B;  3I3T B;  2KT7 A;  2SEB D;  1ENF A;  3AXC A;  2MJ3 A;  4YSY B;  2JF5 A;  3R66 C;  3ZVV A;  3BII D;  1VZ6 A;  4XGA B;  3PZ7 A;  2L7R A;  1KLV A;  2KQS A;  1ZGU B;  3VFK A;  5C23 A;  5IAA C;  1TGZ B;  2LHE A;  2BS2 B;  1UUP A;  2D3B A;  2KLG A;  2J0K A;  4ANU A;  2AQ1 B;  3GP7 A;  3AEC B;  5HKH A;  2O6V A;  4N58 A;  2WYQ A;  3OAW A;  3W5U B;  1E6E B;  2WDT B;  5KHQ A;  1SGH A;  2OOB B;  2W82 A;  1WH3 A;  1TBE A;  3P4R B;  3ZUN A;  1XXG A;  2PE6 B;  2Z8L A;  4KSK C;  1V5O A;  5AZH A;  1EF1 A;  3QA8 A;  1D4B A;  2G45 B;  3VH4 B;  3WAO A;  3P42 A;  4JWS C;  1B9R A;  4LDT D;  4HWI B;  4LLG M;  1ISN A;  3DQV A;  1FPY A;  4Q2J A;  1C9F A;  1YJ1 A;  3DWG C;  3C0R B;  4WJN A;  3BVZ A;  2IGD A;  2RMM A;  1TS5 A;  3PPA A;  4DWF A;  2QIE B;  3NS1 A;  1P9D U;  3L10 B;  5E6J A;  5IO9 A;  4BKS A;  3VRA B;  3PTF C;  5G55 A;  1WX9 A;  1PUT A;  2RR9 A;  2L3Z A;  2KAC A;  4TQ0 A;  3AMZ A;  2AWT A;  3IT4 B;  2KC1 A;  1E5W A;  4M8N A;  2GB1 A;  4JWU C;  3UGB B;  1VCB A;  3NVY A;  5AZF A;  4US9 A;  3AB5 A;  1JWA D;  3ZRC A;  2FNJ B;  4GLS C;  4USA A;  1S3S G;  2I1J A;  2G1E A;  3P63 A;  1V97 A;  4ICV A;  1ET6 A;  2REX A;  1DYQ A;  3E56 A;  1AN8 A;  4GDL B;  2KTR A;  1KH0 A;  1DOX A;  4C4V B;  3AE3 B;  2MH7 A;  1WJN A;  3AE1 B;  3BY4 B;  4CO7 A;  4LNK A;  2R2Q A;  4WWN A;  2Z0D B;  1I4Q A;  3PSE B;  1L4D B;  4M02 A;  1ACC A;  1M94 A;  2IY1 B;  4MGY E;  3VR9 B;  4HKQ A;  2KJ6 A;  1C77 A;  3VTV A;  2EKI A;  4IWP A;  4ZHP A;  4PYU A;  1TY2 A;  1A70 A;  1FIQ A;  2D11 A;  1BML C;  4NQK E;  1EUV B;  1ZDV A;  2GBN A;  2MJD A;  4L23 A;  5D6J B;  4WUR A;  1YX6 B;  3ZYY X;  3ZNI D;  3ML8 A;  4OZB A;  1YQ3 B;  1HTO A;  1FXT B;  4WIP A;  4A55 A;  1N62 A;  4MT5 A;  5IKC M;  2GRI A;  3OWE B;  1YN5 A;  3RZF A;  3AE2 B;  1ZDX A;  3AU4 A;  3BYY B;  3W1Y A;  4BAX A;  1UBI A;  3A4R A;  2L0T A;  4YTM B;  3UIO B;  3AE6 B;  5IOI A;  1WGR A;  4PS3 A;  2FAZ A;  3ML9 A;  1C78 A;  2O2V A;  1YN4 A;  3MC0 B;  3T9L A;  4XWT A;  1MVK A;  4NJC A;  3HHM A;  3QAR A;  3BZD B;  4N59 A;  3L08 A;  2ZW0 A;  3HUI A;  1MPE A;  2ZVO A;  3AN1 A;  1UEL A;  4EKU A;  4XC2 A;  4JL9 A;  4KZC A;  3MHS D;  4W9I A;  2GBJ A;  3KYD D;  2D3C A;  3Q3O C;  3CIR B;  4NY0 A;  2J0J A;  4MGZ E;  3ZKJ C;  1J7B A;  2ASQ A;  3JW0 X;  4II3 B;  2XK5 A;  2DWQ A;  2KTR B;  3HVZ A;  3U4E G;  2ON8 A;  4K3B A;  4GMV A;  1LQB A;  3DHI C;  2DNF A;  2WXN A;  3NVW A;  3EGR A;  3T8M A;  1JRP A;  5EDS A;  4LDT B;  4YT0 B;  5LLI A;  4C7Y A;  2BTE A;  4K7U A;  2BT6 A;  2KN5 A;  3DBL I;  4FA6 A;  3RCZ A;  4AUQ C;  4ICU A;  2KJR A;  3MJW A;  4IG7 B;  1UGM A;  4BBN C;  2UU7 A;  4P16 A;  4FJZ A;  4AWJ A;  5KHO A;  4DHJ D;  1N63 A;  3U2S C;  3VH3 B;  4ARC A;  2PTL A;  1GUA B;  4LJO B;  1D6E C;  4JGH B;  3I9V 1;  3WAP A;  1VLB A;  4HDQ A;  2WX0 A;  1N5W A;  1WJU A;  2G9H D;  2FCM A;  2BWF A;  3PGE A;  3UQA A;  2J42 A;  3ECI A;  3M3J A;  3SFE B;  3CSF A;  1C1Y B;  3L4P A;  4A20 A;  4HXD A;  5FKA C;  1SEB D;  2G4D B;  1HQR D;  3TL5 A;  2GI9 A;  2C5L C;  1H8C A;  4GDK B;  1NVI D;  3WAN A;  3V62 A;  2M56 B;  2BBC A;  3RD2 A;  5MPO A;  5JZE B;  1TS4 A;  4W9J A;  1LM8 B;  2N9X A;  3QAQ A;  1TZO A;  3TJP A;  3QIJ A;  4DXA B;  1ZP0 B;  2ZVN A;  1RRB A;  3LB8 C;  2K5P A;  1K53 A;  1SBB B;  2V1Y A;  1JQ4 A;  3W1S A;  4NJ6 A;  1XLO A;  3KVF B;  4KV2 A;  3FAH A;  2DLB A;  2CHX A;  1WR6 E;  3Q3M C;  2NR2 A;  4IM0 A;  1PFD A;  4O1N A;  1JRU A;  3DBH I;  1N6Z A;  2TSS A; 
#chains in the Genus database with same CATH homology
 2DAF A;  2BF8 B;  4EOY A;  5J18 A;  5D2M B;  2NCN A;  3EHV A;  4EZL A;  4I6N B;  2PPH A;  4JLC A;  5E6P A;  1D3Z A;  4MH0 E;  4AJW A;  4FHJ A;  3ENE A;  2K8H A;  1LXD A;  1V5T A;  3H7S A;  5D7G A;  3KUC B;  2W9N A;  4W9C A;  4HLE A;  2Z59 B;  2LWP A;  2RSU A;  3KH0 A;  3B0A A;  4HCP B;  4MJS B;  3L17 A;  3VUX A;  1P0R A;  1Z2M A;  4BBN F;  1BT0 A;  4FN2 A;  3W1S C;  3ZTC A;  2O6V D;  1R4M I;  4MM3 A;  3U7D A;  3A9K A;  2MBE A;  3UF8 A;  1YQB A;  3PS6 A;  2LJ5 A;  3O65 B;  3ZIM A;  3AU5 A;  2FCS A;  2GMI C;  1XT9 B;  1EO6 A;  3BIN A;  3N32 A;  1ZW7 A;  4FHK A;  3LJ3 A;  3V6E B;  3JVZ X;  2LAS A;  1WY8 A;  4URK A;  4GXB A;  3ZRF A;  1E90 A;  3R3M A;  4ZYN A;  4G11 A;  1V80 A;  4W9F A;  4ZDV A;  2M17 A;  4K1R B;  1L7Y A;  3R7Q A;  4IUM B;  4XX5 A;  2DYM A;  4TKN A;  4ASW C;  4II2 B;  1T0Y A;  4J6I A;  4DDG D;  5D94 A;  3EFU A;  4W9K A;  1VD2 A;  4MDK E;  1WXS A;  4NQL B;  2IO1 B;  3LDZ E;  4RM9 A;  3TIX A;  2D2Q A;  2PJH A;  3OJ4 B;  3OJ3 A;  1WI0 A;  4WQO B;  4LCD E;  3VHT C;  2KZR A;  1E8W A;  3IHP C;  3VVW B;  3WIM A;  3I3T B;  2K8C A;  1WE7 A;  1OEY A;  1WIA A;  1K8R B;  2K6D B;  3PV1 A;  1V81 A;  3AXC A;  5DCN A;  3IBE A;  1WJ4 A;  1F9J A;  3U8Z A;  2JF5 A;  3R66 C;  2O6V B;  4HCN B;  4E71 A;  3ZDM C;  1AAR A;  2WX1 A;  3APC A;  3A1Q A;  2N1W A;  2NS5 A;  3ZVV A;  1Z5S B;  4A3P A;  3UQB A;  1GC7 A;  1WX8 A;  2NVU I;  1RLF A;  2N7E A;  1UBQ A;  2CHW A;  2L7R A;  1WRD B;  1NDD A;  2KQS A;  1KLV A;  1ZGU B;  3QHT A;  3VFK A;  2KFJ A;  1WZ3 A;  1WMH A;  2NPT A;  1U4A A;  3WAL A;  5C23 A;  5JH5 C;  3H1U A;  4K81 A;  5IAA C;  5J17 A;  1WMH B;  3KW5 B;  1TGZ B;  1WGH A;  4HVB A;  3HIZ A;  2KLG A;  3PRM B;  3NZU A;  2DZM A;  2J0K A;  4ANU A;  2JZ3 B;  3GOE A;  5HKH A;  2O6V A;  5GMV A;  2WYQ A;  4IM2 A;  4W9D A;  1KJT A;  2O2V B;  3OAW A;  3H7P B;  2LZ6 A;  5CHW A;  4AP4 C;  2JPH A;  4AOF A;  1X1M A;  2ZNV C;  2C7M B;  2WDT B;  5KHQ A;  4TUU A;  2A4Z A;  1SGH A;  2JWZ A;  2OOB B;  3JSV B;  3PHW B;  1WH3 A;  1TBE A;  1WGY A;  2EMS A;  2KO3 A;  1IPG A;  2ZEQ A;  2KTF A;  2JXX A;  3ZUN A;  2M8S A;  2PE6 B;  3PLU A;  3ONS A;  4KSK C;  1V5O A;  5AZH A;  1EF1 A;  3QA8 A;  2XBB C;  2G45 B;  3VH4 B;  4F1S A;  1TZ1 A;  2FCQ A;  3WAO A;  2DZJ A;  1Q0W B;  4HPM B;  2KKC A;  2MWS B;  2LD9 A;  2WWZ A;  3VQI A;  4LDT D;  4HWI B;  2DZK A;  3TMP B;  1H4R A;  3PRP B;  3X23 A;  5DPW A;  3R7R A;  3JSV A;  2MBB B;  4NJ7 A;  4OVV A;  1ISN A;  2LXC A;  3K9P B;  3DQV A;  1IP9 A;  2MLB A;  2KDF B;  3PZD A;  4KDL B;  3PRE A;  4IM3 A;  3DBR I;  3H7P A;  2EKE C;  5E6N A;  3A9K B;  5LXI B;  1WXV A;  1YJ1 A;  2ZNV B;  1TTN A;  5E6O A;  3C0R B;  3X0W A;  3PVL A;  4WJN A;  2MP2 A;  1ZKH A;  2UYZ B;  3DPD A;  4GIV A;  4TV3 A;  2HTH A;  1WFY A;  4NAW A;  2G3Q B;  2KNB A;  3A4S C;  2IZV B;  4P7I A;  2KDI A;  3A33 B;  2Z0E B;  3DVN V;  5BO4 B;  2C7N B;  3PPA A;  4DWF A;  4BOS C;  2ZJD A;  2PE9 A;  1P9D U;  3L10 B;  3DVN U;  4BFR A;  2CS4 A;  1S1Q B;  4TQ1 A;  2Y5B B;  4BKS A;  3QK0 A;  3PTF C;  5G55 A;  1WX9 A;  5FR6 A;  4ZRI A;  5C1Z A;  2FCN A;  2RR9 A;  4HK2 A;  1PQS A;  2L3Z A;  4JQW C;  1WXA A;  1IYF A;  2HD5 B;  4TQ0 A;  4WJP A;  2M4N A;  1WXM A;  2AWT A;  4MGI E;  3VUY A;  2KC1 A;  1GC6 A;  1E5W A;  3HM3 A;  4M8N A;  2MW5 A;  3SU8 X;  2QHO A;  4BKG A;  2LGY A;  2K6Q A;  2KDB A;  2V3S A;  3UGB B;  4IW0 A;  2C9W B;  2DYB A;  1VCB A;  2MA9 B;  1P1A A;  2EMT A;  4G3X B;  4WAA A;  2KOX A;  3CMM B;  4K7S A;  4I6L B;  5AZF A;  2L00 B;  4MEL A;  2GBK A;  4PS7 A;  2LGD A;  4KDI C;  4ZRK A;  2KXJ A;  3ZRC A;  2FNJ B;  4GOC A;  4BOZ B;  2LRU A;  1G6J A;  1S3S G;  2I1J A;  1SE9 A;  3DBS A;  2JT4 B;  3IVF A;  2BKR B;  4RM8 A;  4W9L A;  1V9J A;  4ICV A;  2MCN B;  2REX A;  1WJ6 A;  1P3Q U;  3NHE B;  4GDL B;  5JHA A;  2K8B A;  2L76 A;  2KTR A;  2CR5 A;  3EEC A;  3PLV A;  1I42 A;  2PEA A;  1V86 A;  4W9G A;  3Q3F A;  4MEM A;  4HDO A;  1RAX A;  2KVR A;  2NBV B;  4E3C A;  1WJN A;  4CO7 A;  3BY4 B;  3UIP B;  2V4L A;  2DHZ A;  3APF A;  2R2Q A;  3DVG X;  3ZO5 B;  4F8C B;  1V6E A;  1WGG A;  2KJH B;  4WWN A;  2HJ8 A;  2Z0D B;  4FUL A;  4CHK A;  4EZK A;  4KIK A;  1XQQ A;  4X57 B;  2KFK A;  3PSE B;  3V6C B;  4KIK B;  3JYU A;  1M94 A;  2IY1 B;  3D32 A;  5CTR C;  4IWQ A;  4MGY E;  2LGX A;  2JRI B;  3V61 A;  4HPL B;  2KJ6 A;  3Q3J A;  2MSE D;  2NPT B;  2KQ7 A;  3N3K B;  3VTV A;  2KX0 A;  3M95 A;  2LUE A;  3VAW A;  4IC7 B;  2BYF A;  4NAW B;  4IWP A;  3RZW C;  1WR1 A;  4EFO A;  4PYU A;  2MP2 B;  3IFW B;  3KUZ A;  1LFD A;  2D11 A;  3SDL C;  4BKS D;  3K9O B;  1NI2 A;  4NQK E;  1WM2 A;  2HE7 A;  1E8Z A;  2IO3 B;  1EUV B;  1V49 A;  3PHX B;  3KUD B;  4MSM B;  2GBN A;  3VXW A;  3ZTD A;  3P2B A;  5J2R A;  1E7U A;  1E8Y A;  4E74 A;  1Y8R C;  4GN1 A;  4PYZ A;  4W9H A;  1KOT A;  3A9J B;  5D6J B;  4B6W A;  5L83 A;  1YX6 B;  3ZNI D;  4DDI D;  1MG8 A;  3ML8 A;  2KK8 A;  5CX3 A;  2A5U A;  4WJQ A;  2CU1 A;  2JUO A;  2LXA A;  4ZRJ A;  3RUL A;  1UD7 A;  3IG3 A;  1FXT B;  2OJR A;  2NBU A;  3PT2 B;  4LJP B;  5L95 C;  4A3O A;  4PS8 A;  4B95 A;  2BKF A;  4EEW A;  4NPN A;  5AZG A;  2GBM A;  2KMA A;  3RZF A;  3AU4 A;  2MQJ A;  2ZPY A;  5DPR A;  4GDK A;  3W1Y A;  2UWQ A;  1E7V A;  4WWO A;  1UBI A;  4GU2 A;  2G4S A;  5DPT A;  4ANV A;  2XEW A;  4RMA A;  2MBQ A;  1OTR B;  3VUW A;  3A4R A;  2BPS A;  2L0T A;  2ZPN A;  2CHZ A;  3UIO B;  3CF6 E;  1WGR A;  2R2O A;  2FAZ A;  3ML9 A;  4PS3 A;  4BKT A;  2KAN A;  2AL3 A;  1YX5 B;  2O2V A;  3L16 A;  3ZNG C;  2BYE A;  1NBF C;  2J0M A;  4FJY A;  3N30 A;  3T9L A;  2I1K A;  4KZ0 A;  3HM6 X;  4DHZ B;  1HE8 A;  1UH6 A;  2C7H A;  2FIF A;  4EZJ A;  2KD0 A;  3M62 B;  5TR5 A;  3ZNZ B;  2LRW A;  4HJK A;  1J8C A;  3HHM A;  2KX3 A;  2N7D A;  3APD A;  3QAR A;  4YL8 A;  3U30 A;  4DBG A;  5IA7 A;  3UIN B;  3VTW A;  3L08 A;  1OQY A;  1WF9 A;  2BWE S;  1RFA A;  2KDE B;  2L8J A;  4GSW A;  2ZVO A;  3OLM D;  1EF5 A;  1UEL A;  2N4F A;  3DVG Y;  3RT3 B;  4EKU A;  4XC2 A;  3QCA A;  4JL9 A;  3A1Q B;  4KZC A;  1OEY J;  3MHS D;  1KM7 A;  1QZE A;  4GDL A;  4DHJ B;  3AUL A;  4W9I A;  4B9K A;  4W9E A;  4DK5 A;  2GBJ A;  1UZX B;  3L54 A;  4M8M A;  1GNU A;  3DCG A;  3KYD D;  2DZI A;  2JVC A;  2ZCC A;  3ZNH B;  4GB9 A;  4BVU C;  4NY0 A;  5G2N A;  2J0J A;  3EC8 A;  4MGZ E;  3ZKJ C;  3QX1 A;  1A5R A;  2ASQ A;  2MX2 A;  2K39 A;  3B08 A;  4AJY B;  3JW0 X;  4WJO A;  4II3 B;  2XK5 A;  3MTN B;  2IY0 B;  2KTR B;  4GMV A;  1J0G A;  1LQB A;  3DOW A;  2J7Q B;  1WGD A;  3T8M A;  2K1F A;  3ALB A;  5EDS A;  1P98 A;  3PRZ A;  2D10 A;  4LDT B;  2CKH B;  2KHW B;  5LLI A;  4GGQ A;  4K7U A;  4ANX A;  1Q1O A;  2ZCB A;  2XK5 B;  3V60 A;  2KWV B;  4FAD A;  2AL6 A;  4EUT A;  3B1L X;  2KN5 A;  3DBL I;  4FA6 A;  1WX7 A;  2IBI B;  2VRR B;  3RCZ A;  4AUQ C;  2LVO A;  4ICU A;  2DAJ A;  2YVC A;  2KJR A;  3MJW A;  4OVU A;  4IG7 B;  2JY6 A;  2C60 A;  1UGM A;  2JRH A;  4BBN C;  3VTU A;  1XD3 B;  2BYV E;  4FJZ A;  1GG3 A;  2KWC A;  2MBH A;  4AWJ A;  3L0W B;  5KHO A;  3WAM A;  4DHJ D;  2GOW A;  4WWP A;  3NS8 A;  2M0X A;  2RGF A;  3VH3 B;  1GJZ A;  1GUA B;  4LJO B;  4MJS A;  2JZZ A;  4JIO U;  4JGH B;  4KSL C;  2FID A;  2DYO A;  2ZZP B;  3VDZ A;  2IYD B;  3WAP A;  3M63 B;  4HDQ A;  3RYT A;  3SHQ A;  2WX0 A;  3TBL D;  1WJU A;  1J19 A;  2FCM A;  4FJV B;  2IO2 B;  2BWF A;  4FLH A;  5AEK B;  2L05 A;  3PGE A;  3NY5 A;  3QJZ A;  3UQA A;  1WE6 A;  5CHF A;  2YLM A;  3ECI A;  2KMC A;  4KVG B;  4M0W B;  3TCA A;  3M3J A;  3CSF A;  1C1Y B;  5CHV C;  4A20 A;  4ANW A;  2RD0 A;  4NNJ B;  4HXD A;  2G4D B;  2IO0 B;  3H9D A;  3TL5 A;  4XZ4 A;  2C5L C;  3H6N A;  5LXH A;  1OGW A;  1Q5W B;  2B3A A;  5DPS A;  1H8C A;  4GDK B;  3CST A;  3WAN A;  4G0N B;  4K7W A;  1L2N A;  3L13 A;  2M1M A;  2N1V A;  3V62 A;  1WZ0 A;  4IWO A;  2LI5 A;  1I35 A;  4G50 A;  3RD2 A;  1YD8 U;  1C3T A;  1V2Y A;  3DDC B;  5JZE B;  3NOB A;  4N9F 4;  2GBR A;  4W9J A;  1LM8 B;  2N9X A;  3QAQ A;  4FBJ B;  3ZW3 A;  1E8X A;  2N9E B;  2K25 A;  3A9J A;  4F7Z A;  2AYO B;  5JHB A;  2N9P C;  1YIW A;  3TJP A;  3QIJ A;  2L0F A;  4DXA B;  2BGF A;  2LVQ A;  3GZN I;  2ZVN A;  1RRB A;  3HK0 A;  2NBW B;  3KYC D;  2KWU B;  3NZS A;  3RUI B;  4CYE A;  3QC8 B;  2V1Y A;  2FUH B;  3QQ8 B;  2D3G A;  1WYW B;  3WA0 A;  3W1S A;  2LVP A;  2RPQ A;  2MBO A;  4NJ6 A;  4DHZ E;  2D07 B;  3KVF B;  4MSQ B;  2AEH A;  4KV2 A;  1SIF A;  2CHX A;  1WR6 E;  1WM3 A;  3QWZ B;  1CMX B;  3S2A A;  2NR2 A;  3ZDT A;  2KLC A;  4IM0 A;  3ZLZ A;  2DX5 B;  2DEN B;  4MGK E;  4I6P A;  2KC2 A;  3SD5 A;  1R4N I;  3AI5 A;  1JRU A;  3DBH I;  2MRP A;  2KFK B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...