1WXMA

Solution structure of the n-terminal ras-binding domain (rbd) in human a-raf kinase
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
86
structure length
86
Chain Sequence
GSSGSSGGTVKVYLPNKQRTVVTVRDGMSVYDSLDKALKVRGLNQDCCVVYRLIKGRKTVTAWDTAIAPLDGEELIVEVLSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution Structure of the N-terminal Ras-binding Domain (RBD) in Human a-Raf Kinase
rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords A-Raf proto-oncogene serine/threonine-protein kinase
total genus 7
structure length 86
sequence length 86
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2005-01-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02196 RBD Raf-like Ras-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 1wxmA01
3H7SA 1UD7A 1J0GA 2ZPYA 3PZDA 4W9IA 3CSTA 3QC8B 4EFOA 2KFKB 1UZXB 3TIXA 2N7EA 1UBQA 3ZNZB 4G50A 3A1QB 4FADA 3HM6X 4DHZE 3WAOA 4MJSA 3ZKJC 4EZLA 2BGFA 4ZRJA 2KN5A 2KXJA 2ZCCA 3A1QA 1OQYA 1EF5A 2KMCA 1QZEA 3RZWC 2FIDA 5CHVC 5CX3A 2FIFA 4DXAB 2IO3B 4DHJD 2KLGA 5D7GA 2AWTA 3N30A 5TR5A 3W1SA 2L7RA 1Z5SB 3QCAA 3B08A 2VRRB 3KW5B 4NNJB 4ANXA 2XK5A 2RD0A 1OEYA 2ASQA 2LVQA 4NQKE 3ZIMA 3PLVA 5LLIA 2MRPA 3PHXB 4KDLB 4G11A 1LM8B 4CO7A 2MP2A 2CR5A 1AARA 2ZJDA 2FNJB 4MSQB 3IG3A 3U8ZA 2LI5A 4WWPA 3KUZA 5CHFA 2AL6A 3ZTCA 2NS5A 1WI0A 1KOTA 4DWFA 2GOWA 3VUYA 3MJWA 5AZFA 4DHJB 2MA9B 4GB9A 3OJ3A 2KFJA 4JLCA 2A5UA 5E6OA 4MGYE 4NPNA 3DVGY 4W9DA 3H7PA 1WZ3A 2KTRB 4I6NB 1XT9B 5AEKB 2L00B 1BT0A 2CHWA 5FR6A 2L0TA 3B1LX 3VVWB 3QWZB 5BO4B 3UGBB 4HDQA 2JVCA 3DVNU 4XZ4A 5E6PA 2O2VA 1EO6A 1P0RA 3VUXA 5IA7A 2GBKA 1WXSA 1PQSA 2DAFA 1P3QU 3L13A 3PT2B 5LXIB 5HKHA 4FHJA 4BBNC 1WR6E 4NJ6A 4TV3A 3PSEB 3PS6A 4MM3A 2IO1B 4JQWC 3IFWB 3DBHI 3UF8A 2YLMA 3UQAA 4GDLA 2ZZPB 2RGFA 1NDDA 4KSLC 2KDIA 4P7IA 2JY6A 1RAXA 4FHKA 4YL8A 3GOEA 1F9JA 1LFDA 3VTWA 4B6WA 2R2QA 4CYEA 2BKRB 2LVPA 1UH6A 2JPHA 5DPRA 2LWPA 1ZW7A 2KDBA 2JXXA 2ZCBA 2EKEC 3NS8A 2N9EB 1GG3A 3W1YA 3OJ4B 4NY0A 3UQBA 1YQBA 3APDA 3D32A 3PRZA 1WJUA 2C5LC 3VTVA 1WF9A 2KVRA 5JHAA 3WANA 1WFYA 1YX5B 2LRWA 2K39A 2L76A 4TKNA 2DX5B 3UIOB 4X57B 4A3OA 3A9KA 4HJKA 2K8BA 4RM8A 1E7UA 3K9OB 1UGMA 3C0RB 3X0WA 3DBSA 2DZMA 2KQSA 3JVZX 3M95A 3NZUA 3A9JB 2LZ6A 1WJ6A 2LGDA 2M0XA 1C1YB 1D3ZA 2G3QB 1S3SG 2N7DA 3PV1A 4WWNA 3WAPA 1KJTA 3Q3FA 1R4MI 1TBEA 2BYFA 2JZ3B 4ZRKA 3SHQA 2D3GA 4BKSA 2N4FA 4IG7B 1V6EA 2KO3A 1WM3A 3DPDA 4HXDA 3KUDB 3ALBA 5AZGA 4JIOU 1WGDA 1GC7A 4GIVA 3ZRCA 1X1MA 3V62A 2AYOB 1V80A 3ZDTA 2KWUB 2KC1A 3B0AA 1RFAA 4W9JA 1L2NA 4ICVA 1WE6A 3QARA 4HWIB 2HJ8A 3VHTC 3K9PB 2NBVB 5AZHA 1V2YA 1Z2MA 1E5WA 4J6IA 1WMHA 1UBIA 2KWCA 1E8XA 1I35A 4W9LA 3Q3JA 2GBJA 1WGGA 2W9NA 1E8ZA 2DYBA 4RMAA 3JSVB 1WGYA 3M63B 4GMVA 3ZDMC 3HK0A 4CHKA 3EFUA 1WRDB 3AU5A 2MSED 4FBJB 4ANUA 3N32A 3CMMB 3PRPB 3DQVA 3VAWA 5L95C 1NBFC 5J18A 4IW0A 3SU8X 2WX1A 4MSMB 5D6JB 2L05A 3HHMA 1HE8A 1LQBA 1FXTB 2FCSA 2PE6B 3ZNGC 3M3JA 2JWZA 2KTFA 3KYDD 1V86A 2XEWA 3A4RA 2ZPNA 3APCA 4II3B 3RULA 2JT4B 2M17A 2MW5A 2DENB 1XQQA 3QQ8B 3AULA 2BKFA 4WJNA 1TTNA 3CF6E 2WWZA 2LUEA 4II2B 3PREA 3L10B 5DPSA 1T0YA 4HLEA 1GC6A 2KLCA 4HPLB 1WXVA 4MJSB 2D11A 2AEHA 3V61A 4K1RB 2Z0EB 4AP4C 2LGXA 2KX3A 2MQJA 2UYZB 3RT3B 2PPHA 2B3AA 4PS7A 4RM9A 2DAJA 5G2NA 5JZEB 4GSWA 2RPQA 4IUMB 2IO2B 5LXHA 4TUUA 3NZSA 1YX6B 3EC8A 4IWQA 4W9CA 3DOWA 2DYMA 2CHZA 2LXAA 2A4ZA 5G55A 3IVFA 2Y5BB 4WQOB 5CTRC 4K7UA 2KX0A 2NVUI 2O2VB 4WJQA 5C23A 2GBMA 3JW0X 2MWSB 3ENEA 3H1UA 4GXBA 3TBLD 4NAWB 2EMTA 2N1VA 3V60A 2MX2A 3EECA 2J0KA 4LCDE 1IP9A 2KTRA 4IM3A 3VH4B 1GJZA 2HD5B 2KD0A 4W9GA 1ISNA 2HTHA 1OGWA 4MH0E 3VDZA 2KK8A 2ZEQA 1VD2A 3APFA 2N1WA 1IPGA 4MGZE 2D2QA 2L3ZA 2IYDB 3PLUA 2UWQA 3WAMA 1WX8A 1WR1A 2BF8B 2D07B 2HE7A 2KZRA 2KQ7A 2EMSA 2M8SA 2BYEA 1S1QB 2ZNVC 3ZW3A 4HDOA 4MGKE 3TL5A 1KM7A 3ECIA 4JGHB 4XX5A 4M8NA 4K7WA 1SE9A 2KJ6A 3I3TB 2RR9A 1WJ4A 2O6VD 4ASWC 3KUCB 2KNBA 3IBEA 2DZJA 4W9FA 1GUAB 4E74A 4BKTA 1YD8U 5J17A 3NHEB 3ML8A 2WDTB 2CKHB 1Q5WB 4K81A 1J8CA 4FJZA 2FCMA 4BOSC 4PS3A 3BY4B 4KDIC 2KMAA 2ZNVB 3ZNHB 3PHWB 3U7DA 1WYWB 2BPSA 4LJOB 2LVOA 2K6QA 2V3SA 1WY8A 1WE7A 3AU4A 3QA8A 4LJPB 2MBOA 3MHSD 4E3CA 2KJHB 5D2MB 5D94A 3HIZA 4I6LB 4BKSD 4ANVA 4W9EA 3DCGA 3RCZA 1L7YA 3VH3B 1V5TA 2N9PC 2OOBB 2MBHA 2C7HA 1WZ0A 3T9LA 2KDFB 4LDTD 4ZYNA 2LJ5A 3DBRI 2MCNB 4BFRA 2LD9A 1C3TA 3RUIB 2KJRA 1WGRA 3UIPB 4W9HA 1IYFA 1OTRB 4F8CB 4WJOA 2I1JA 1I42A 3A9KB 1E8WA 2C60A 4IWOA 3VQIA 2LRUA 2K25A 3ZLZA 2IY1B 3P2BA 2MP2B 2BYVE 4FJVB 2N9XA 3L17A 2I1KA 1WJNA 2J0JA 1V81A 2ZVNA 2BWFA 4GDLB 5KHQA 2C7NB 2K8CA 5C1ZA 1GNUA 4IWPA 3TJPA 2J7QB 2MBQA 4PS8A 4PYUA 2GBNA 2XK5B 1VCBA 3ZRFA 3BINA 2NCNA 2RSUA 1WGHA 3JSVA 4KSKC 5JHBA 1SIFA 1NI2A 1ZKHA 3ZO5B 3R66C 4G3XB 1Y8RC 4I6PA 1EF1A 1J19A 2KKCA 4ANWA 1E7VA 1WXMA 4GN1A 4JL9A 1YIWA 2BWES 2ZVOA 3LDZE 5DPTA 3TMPB 3T8MA 2KWVB 4AJYB 2K6DB 2KFKA 3VUWA 2XBBC 3H7PB 3PRMB 2LASA 2MBBB 2PJHA 3KH0A 4BVUC 3TCAA 2FCQA 2WYQA 4EUTA 2AL3A 1V49A 4WAAA 4KZ0A 4XC2A 1WIAA 3AXCA 4KIKB 4DDID 4DHZB 2JZZA 1WX9A 1E90A 2GBRA 4OVVA 3QJZA 3A33B 2KOXA 1KLVA 1TZ1A 2NBUA 5DCNA 3SD5A 4W9KA 4DDGD 3PVLA 2C9WB 2DZIA 1EUVB 1M94A 1TGZB 2NPTB 2LXCA 4EEWA 2G45B 1Q1OA 5EDSA 1RRBA 3PPAA 3O65B 2KHWB 1ZGUB 4EZKA 5L83A 3OAWA 5CHWA 2Z59B 4FA6A 3ZTDA 2YVCA 2D10A 2KC2A 1YJ1A 4IM0A 2OJRA 4KV2A 3QX1A 3R7QA 4HCNB 2CU1A 4GU2A 3IHPC 4F7ZA 3DDCB 4FJYA 5JH5C 3OLMD 1WMHB 2MBEA 3QAQA 1MG8A 2K8HA 2FUHB 4ICUA 4NAWA 2JF5A 4AUQC 2CS4A 1V9JA 3QIJA 1Q0WB 4HK2A 4MELA 2NPTA 2JUOA 3GZNI 3VTUA 2KDEB 2J0MA 4MGIE 4F1SA 4MEMA 4B95A 1JRUA 1P1AA 5J2RA 3DBLI 3DVNV 3A4SC 4MDKE 4BOZB 1K8RB 2LGYA 3ZUNA 4BKGA 2JRIB 3NY5A 1RLFA 2L0FA 2KANA 1WH3A 4KIKA 4EZJA 1U4AA 4WWOA 4EOYA 3DVGX 2QHOA 2JRHA 2DZKA 3L08A 4KZCA 1A5RA 3L16A 3RD2A 3U30A 3VFKA 4DBGA 5DPWA 3H9DA 3M62B 3QK0A 4HVBA 2REXA 3LJ3A 2V4LA 4GDKB 1UELA 4GDKA 2O6VB 4NQLB 2C7MB 4BBNF 2IO0B 3R7RA 3EHVA 4FN2A 1SGHA 4DK5A 5E6NA 3A9JA 3V6EB 2G4SA 4FLHA 3R3MA 3CSFA 2FCNA 1P9DU 3JYUA 2PEAA 3NOBA 3N3KB 1H8CA 4HCPB 3ZVVA 2PE9A 3MTNB 2Z0DB 3QHTA 4IM2A 1XD3B 2IZVB 2V1YA 2FAZA 3HM3A 4IC7B 3RYTA 1WM2A 3PGEA 5IAAC 3KYCD 4G0NB 2NR2A 2K1FA 1WXAA 3X23A 4KVGB 4EKUA 1LXDA 4HPMB 2WX0A 1CMXB 4AJWA 1H4RA 4GOCA 2G4DB 2DHZA 4TQ0A 3KVFB 4LDTB 3W1SC 4ZDVA 4M0WB 2DYOA 4PYZA 2IBIB 4K7SA 3V6CB 3WA0A 5GMVA 1G6JA 2R2OA 4GGQA 4M8MA 3UINB 3PTFC 3ZNID 4B9KA 4A3PA 2CHXA 3L54A 4AWJA 2IY0B 3ONSA 5KHOA 3ML9A 1E8YA 3SDLC 2O6VA 2MLBA 4A20A 3L0WB 3VXWA 2NBWB 4TQ1A 4FULA 4NJ7A 4WJPA 1P98A 3WIMA 1OEYJ 3S2AA 2L8JA 2GMIC 3AI5A 4ZRIA 1WX7A 4OVUA 4AOFA 4URKA 1V5OA 4E71A 2M4NA 2M1MA 3WALA 3H6NA 4N9F4 1R4NI 3RZFA
chains in the Genus database with same CATH superfamily
1UD7A 4W9IA 2GRIA 3TIXA 3A1QB 4FADA 2IPKD 3WAOA 4EZLA 4D2KA 1OQYA 3EGRA 4OVZA 2FIDA 5BMHA 5CX3A 1MHHE 2BB6A 2IO3B 2AWTA 3Q2AC 2WXJA 5FKAC 5HI1A 1WXQA 1ET9A 1T3QA 4ANXA 2XK5A 4C7ZA 2WDRB 1MPEA 2MRPA 3PHXB 3HRDD 2V3PA 4G11A 1LM8B 1AARA 1T5XD 1FFVA 2KDMA 1SSNA 3KUZA 5CHFA 2QILA 3NZ3A 3ZTCA 4RGOS 2NS5A 2WHIA 4DWFA 4DHJB 1RFKA 4GB9A 4JLCA 2EKIA 4NPNA 1V1OA 2RMMA 3Q8EA 2KTRB 1XT9B 5AEKB 2CHWA 3QWZB 1L4DB 3UGBB 1R7SA 2X8XX 4C00A 1YQ4B 2RDGA 3TSSA 1WXSA 1ZP0B 1D5MC 2QSDA 1FCLA 4FHJA 1WR6E 3PS6A 4JQWC 1J7AA 4GDLA 2RGFA 1NDDA 2KDIA 2JY6A 2PKOA 4YL8A 3BZDB 1F9JA 1LFDA 3VTWA 4B6WA 2R61A 2JPHA 1ZW7A 1GG3A 1DOIA 1TKGA 1VRAB 3GS2A 2DX5B 3NS1A 3A9KA 3BVZA 1QOBA 4RM8A 2Y5PA 1FRDA 2SAKA 3M95A 2G3QB 2NMQA 3WAPA 3Q3FA 3SHQA 2N4FA 2JSVX 4IG7B 2KO3A 3DPDA 2XN9C 3ALBA 3GE3C 5AZGA 5C2TB 1WGDA 1GC7A 2MJ3A 1QF6A 3PZ7A 2KWUB 1F77A 1L2NA 5AUIA 1TS4A 3PO0A 1VLBA 2BYTA 3BIID 2NBVB 1V2YA 1E5WA 1N5XA 1WMHA 1UBIA 3DHIC 4BZAA 1IUEA 1WRIA 4LLGM 1L5PA 1YNTE 3JSVB 4GMVA 1V1PA 5IKCM 1QILA 4KKJA 1C78A 3VAWA 4ARIA 1NBFC 1TKEA 3SU8X 2WX1A 2V3NA 2PE6B 5C3JB 3RULA 1XQQA 3ABVB 2LUEA 4II2B 3PREA 4N59A 3BVMA 5DPSA 1T0YA 1K51A 1WXVA 2Z0EB 2K22A 2PPHA 3P63A 4PS7A 4RM9A 4WIPA 5JZEB 3NG0A 2E6XA 3NZSA 4IWQA 4W9CA 5TSSA 2CHZA 2LXAA 4C80A 3MP9A 2Y5BB 4WQOB 4K7UA 2KX0A 2NVUI 2WP9B 1D5ZC 4WJQA 5C23A 4GXBA 3ZJVA 2EMTA 2ICIA 2N1VA 2MX2A 1IGCA 4LCDE 2L83A 2KTRA 3VDZA 2ZEQA 3APFA 1WX8A 2HE7A 4HWIB 2KQ7A 2DNFA 1SEBD 4M8NA 1JWSD 1SE9A 4KGSA 2RR9A 1SBBB 3B9JA 3R8BA 1FNVA 3DBRB 4BKTA 5J17A 1B9RA 2WDTB 1Q5WB 1J8CA 2FCMA 4BOSC 4YXDB 2JQRB 4KDIC 3ZNHB 1DOXA 3U7DA 2BPSA 3IAS1 1JQ4A 4R3DA 2V3SA 1WE7A 4LJPB 3OWEB 2KJHB 2WGSA 5D94A 4ZRPA 5H92C 4W9EA 3DCGA 4AS1A 1L7YA 4HKQA 1QOFA 2N9PC 3ZXRA 2C7HA 2FUG1 1WSPA 4K3BA 3BWUD 2KDFB 3TEZA 1WGRA 3UIPB 4DXFA 4IWOA 4QAYA 3NVVA 1WJNA 4LNKA 3P42A 1QLBB 4PYUA 2JZPA 1EU4A 4RNAA 1VCBA 2NCNA 1WGHA 3VRAB 1FXAA 3OG5A 1VZ6A 3Q3OC 1PGBA 4I6PA 1J19A 3FKYA 3PRMB 2MBBB 2VZKD 4XC2A 1WIAA 1CK1A 1WX9A 3UI3A 4PT5A 3SD5A 1N60A 2DZIA 1M94A 2LXCA 4Q2JA 3T3OA 1RRBA 3PPAA 2KHWB 4B0MA 2WNMA 2ZW1A 3AEEB 3QX1A 5G5GA 2Y5CA 5JH5C 1OQRA 3IXSA 1V9JA 1Q0WB 2QJLA 4HK2A 3NRZA 3TEYA 1P1AA 3N1ZC 1CQVA 4KGRA 3NY5A 1RLFA 5IN7A 2D5GA 4ZOHC 4WWOA 4A55A 4EOYA 2RPVA 3DVGX 3L08A 1RM6C 3L16A 3RD2A 3VFKA 5DPWA 3H9DA 1DGJA 2O6VB 2YEPB 5E6NA 2QEJC 3SR6A 4FLHA 3R3MA 2PTLA 2Z0DB 3HM3A 3PGEA 1WXAA 1LXDA 4HPMB 4AJWA 1FNWA 1KTKA 2MJEA 4C4VA 2DHZA 1UUPA 3KVFB 4XWTA 4PYZA 3U2SC 5GMVA 4M8MA 1HZ6A 2CHXA 1YN3A 3L54A 3SFDB 3ONSA 4JPSA 5KHOA 1GAQB 2WS3B 2MLBA 4FULA 4NJ7A 1P98A 3WIMA 3ZJTA 3AI5A 4A8XC 3RNCC 2BB5A 4S17A 2JYTA 1NYQA 4DQOC 3H7SA 4NAMA 4EFOA 2KFKB 3W5VB 4WAFA 2N7EA 2DBYA 4DHZE 2BGFA 2KN5A 2KXJA 2PVOD 3IAM1 2GLSA 2H88B 3PZ8A 3W2DA 4XYCA 3RZWC 1C77A 3J9CA 4RFBA 2KLGA 2KWDA 3AECB 4L2YA 3VR9B 1N62A 4NNJB 2RD0A 1PGXA 5D3IB 3IT4B 1ZPSA 2INDC 2LI5A 4WWPA 4GLSC 1KOTA 2M0AA 2QMTA 5IO9A 1L0VB 2MA9B 5E6OA 3DVGY 2LMCA 4YTMB 2WLBA 1XCTL 4I6NB 1L0YB 4HKZE 3GB1A 2L0TA 2VH1A 1OQQA 3DVNU 4XZ4A 5E6PA 5IOIA 1FXIA 1EO6A 1P0RA 3VUXA 1AYFA 2GBKA 1P3QU 3L13A 5HFYA 4NJ6A 3N20C 3PSEB 4ARCA 1MG4A 1P7EA 3IFWB 4KSLC 3V05A 1STEA 3GOEA 2J53A 2R2QA 4CYEA 2BKRB 2LWPA 2EKEC 4ZRQA 2MEKA 3NJTA 1ZUD2 2LUMA 3IT6B 3OJ4B 4NY0A 1YQBA 3APDA 3D32A 4C4VB 1WJUA 2XNAC 2FBWB 1KH0A 5JHAA 4WH4A 1EM7A 1YX5B 2LRWA 2D3CA 2K39A 3AE5B 4X57B 1FPYA 3X0WA 1J7BA 3C0RB 2DWQA 1TIFA 3NZUA 2LZ6A 2LGIA 2M0XA 1DYQA 1RWSA 2QC8A 2N7DA 3PV1A 1KJTA 1KLUD 1TBEA 2JZ3B 4ZRKA 5LNK1 1R4MB 3KUDB 4GIVA 1X1MA 1XF5L 2HTME 3B0AA 5HG2A 1RFAA 3RMKC 4P16A 2W55A 2HJ8A 2PW9A 4J6IA 3MFGA 2KWCA 1FMAD 2GBJA 2W9NA 2DYBA 4RMAA 3ZRCA 3M63B 3ZDMC 3EFUA 2MSED 1ZXIA 4FBJB 3AMZA 3CMMB 4ZHPA 1WYGA 4M00A 3HHMA 3GZNB 1LQBA 2FCSA 2KTFA 2QDFA 2ZPNA 1ACCA 3APCA 1I4PA 2BKFA 1TTNA 2WWZA 1PYWD 4HLEA 1GC6A 2AEHA 4K1RB 2B76B 2KX3A 2UYZB 3LYYA 2B3AA 5LXHA 4TUUA 3EC8A 3DOWA 2DYMA 5G55A 2WXLA 3BYTB 5EE1A 3EA6A 3IVFA 2O2VB 2MWSB 1VJKA 2K9XA 3MC8A 4USAA 1IP9A 1GJZA 2HD5B 2IDYA 1C9FA 3R2TA 2L3ZA 1WR1A 2D07B 2KZRA 2EMSA 4ACFA 1S1QB 3N9YC 4NZLB 4JGHB 4XX5A 1AW7A 3I3TB 1OFFA 1SE4A 1GUAB 2WU2B 3NHEB 3KLSX 1L6VA 2BS4B 5HHDG 2WXPA 1SIJA 3AU4A 2MBOA 4E3CA 3ZJUA 1NEKB 1GB1A 2INCC 4I6LB 1TJEA 4XGAB 2QCZA 3DWGC 5T8IA 1YMHE 4LDTD 3DBRI 2LD9A 3EFCA 3RUIB 5EE0A 1I7HA 1OTRB 4F8CB 1I42A 1E8WA 2C60A 2LRUA 1HZ5A 1AN8A 1ZXHA 1E6EB 2J7QB 1QQRA 2XK5B 2OHFA 2RSUA 4KSKC 4RGTA 1SIFA 4MH8A 3DBHB 1M4VA 1Y56A 3W5UB 3ZO5B 2ZW0A 4G3XB 1WGKA 1Y8RC 4ANWA 1E7VA 4WWMA 4JL9A 1YIWA 2ZVOA 2PIAA 3Q3MC 3T8MA 4AJYB 2N9LA 3VUWA 2XBBC 3H7PB 4BVUC 2WYQA 2AL3A 4WAAA 4KZ0A 2RDHA 4KIKB 2GB1A 1PDXA 4DHZB 1E90A 2WXMA 1KLVA 2NBUA 3U52E 2C9WB 3AM9A 4EEWA 3BK1A 1Q1OA 1JWMD 3O65B 1ZGUB 5L83A 5CHWA 4FA6A 3ZTDA 2KC2A 1YJ1A 1MVKA 2OJRA 4MACA 4JWUC 4HCNB 3IHPC 1FRRA 3DDCB 1TT5B 4FJYA 1F1HA 1I4XA 1WMHB 2MBEA 3QAQA 5FR3A 2LJIA 2J4XA 3HUIA 2FUHB 4NAWA 2JF5A 4AUQC 2N9KA 3QIJA 2NPTA 3GZNI 3VTUA 3N1YC 3DVNV 1J7CA 1K8RB 2AX5A 2JRIB 3DBLB 4KIKA 1NYRA 1U4AA 3RNEC 2JRHA 2J52A 1E7PB 2WDVB 5EE3A 1UELA 4GDKA 4WURA 2C7MB 2IO0B 2INPE 3R7RA 3EHVA 1FFUA 4LNIA 3V6EB 1BXTA 3CSFA 2Y3AA 3N3KB 3WCQA 3ZVVA 2PE9A 3QHTA 3AE2B 2V1YA 2FAZA 5IAAC 3KYCD 1R4NB 2K1FA 4KVGB 1EU3A 1H4RA 4GOCA 1MJDA 2G4DB 2L1AA 1TS3A 4TQ0A 3TEWA 4LDTB 4M0WB 3WA0A 4PK1A 3KWLA 1CZPA 4TMAB 1HA5A 4GGQA 4LNFA 4B9KA 4YSYB 4A3PA 1A70A 3ML9A 3L0WB 4TQ1A 2L8JA 5BYRA 3LB8C 4AOFA 4URKA 4E71A 2M4NA 2M1MA 3WALA 3H6NA 4N9F4 1J0GA 3PZDA 1FO4A 3QC8B 3CIRB 2PMVA 3KWVA 3TEXA 3HM6X 3ZKJC 1IBXB 1N6ZA 2KMCA 1QZEA 2V9HA 3TUOA 4JX1C 2FIFA 3CWIA 4DXAB 5D7GA 4NJCA 3N30A 5TR5A 1Z5SB 3QCAA 1BMLC 3I9V1 1MHXA 3KQ4A 2LVQA 3AN1A 3ZIMA 3PLVA 3AV8A 1TZOA 4KDLB 4CO7A 2MP2A 2CR5A 2ZJDA 4MSQB 3IG3A 2V0GA 2W3SA 1SE2A 2AL6A 4YSXB 2CU3A 1WI0A 4LK0M 3VR8B 3O13A 2GOWA 1ET6A 1PUTA 2KFJA 4MGYE 4W9DA 2J42A 3H7PA 3AEAB 2L00B 1NVID 1KLGD 3MC9A 2BQQA 5FR6A 4P6VF 3VVWB 5JXVA 5BO4B 3B2GA 1FCCC 5IA7A 3B2FA 1XO3A 1HEZE 1T0RC 5LXIB 5HKHA 4MM3A 1C4CA 3DBHI 3UF8A 3P4QB 4P7IA 3Q8FA 4BAXA 2BVCA 1UH6A 2JXXA 2ZCBA 2SEBD 1DOYA 3Q8AA 3Q69A 4US9A 2E3TA 4XE0A 4YTNB 4MT5A 3PRZA 2C5LC 3AE8B 1WF9A 3ZYYX 3HVDA 2HJ1A 2L76A 1SXTA 3UIOB 4HJKA 2K8BA 3P1MA 1E7UA 2HDEA 3K9OB 3HVZA 3DBSA 2DZMA 2KQSA 4M0WA 1WJ6A 1C1YB 4A9AA 1D3ZA 2PLPA 4WWNA 2MHJA 2D3GA 4BKSA 1I4HA 2MJDA 4HXDA 2W82A 4YWGG 1UGJA 3V62A 1V80A 3ZDTA 1ESFA 2KC1A 4W9JA 1WE6A 2CJNA 1SF0A 1VZ7A 1IBXA 5G5HA 5BYQA 5AZHA 1BUIC 1HTQA 4US8A 4OZCA 4OZAA 1I35A 4HJGE 3Q3JA 3RPFC 1WGGA 1JW9D 1E8ZA 3I57A 1WGYA 3BYYB 1EWCA 3DQVA 3ZGZA 3AEBB 3RFZB 5L95C 5J18A 3NVZA 4YSZB 1P7FA 4MSMB 1I4GA 1L4ZB 1HE8A 3N1XC 1JCKB 3ZNGC 2JWZA 3KYDD 3A4RA 4II3B 2MW5A 2DENB 2IGDA 3AULA 3FAHA 3QQ8B 3L10B 1HXYD 3BVGA 4HPLB 1UNSA 3AH7A 3V61A 2MQJA 2DAJA 4GSWA 4IUMB 2IO2B 4HEA1 3RNFC 3P4SB 3DWMA 2L52A 1N5WA 5CTRC 3SFEB 1YJJA 2GBMA 3ENEA 4A6QA 3H1UA 2D3BA 3EECA 2J0KA 4IM3A 3VH4B 2KD0A 3NVYA 1ISNA 3AE9B 2HTHA 2KK8A 2N1WA 1IPGA 3PLUA 1GOZA 1C79A 1Q10A 3ZW3A 2M8SA 2ZNVC 2BYEA 4MGKE 1D6EC 3ECIA 2X38A 4ASWC 1L6UA 2KNBA 2CJOA 2DZJA 4E74A 3Q8BA 1HQRD 5H8YE 1YD8U 1AWDA 3ML8A 1F2RI 4K81A 1YN5A 3Q8CA 4FJZA 4PS3A 3BY4B 2KMAA 2ZNVB 1JWBD 3PHWB 1E10A 4LJOB 3L4PA 2TSSA 2LVOA 2K6QA 4OW0A 1WY8A 3QA8A 5BMGA 1SB3C 3MHSD 3U4EG 5D2MB 3HIZA 1XLOA 1JWAD 3ZQ4A 3AEFB 2ACZB 2OJWA 4WQMA 1T0SC 2OOBB 1LGRA 2MBHA 1WZ0A 3RNBC 1UF0A 2LJ5A 4BFRA 4W9HA 4WJOA 3A9KB 3VQIA 1E9MA 4YTPB 2K25A 3ZLZA 3P2BA 2MP2B 2BYVE 3L17A 2I1KA 1ENFA 1V81A 5KHQA 2INNE 1GPXA 4KGTA 2M56B 3AE1B 2K8CA 1GNUA 4IWPA 4RGMA 2H89B 4M01A 2NTSA 2VZKB 2GBNA 3ZRFA 2BW2A 3JSVA 1F2RC 1XEEA 3MJ5A 1NI2A 3AE6B 1XLPA 3R66C 4FXCA 3Q14C 4N58A 2KKCA 1WXMA 4GN1A 2Z8LA 3LDZE 5DPTA 3I63C 2I2YA 2LASA 2PJHA 4AQ7A 1D5XC 2FCQA 3NVWA 2MH7A 4DDID 2JZZA 4OVVA 3QJZA 3A33B 2KOXA 5DCNA 1YOVB 1EUVB 4OZBA 2NPTB 4LNOA 2G45B 4ITKA 4HPPA 4EZKA 3OAWA 1ROEA 2D10A 3V3XA 4KV2A 3R7QA 1D4BA 2CU1A 4GU2A 5MPOA 4IOIE 1PGAA 1MG8A 2K8HA 5E6JA 4ICUA 2CS4A 2JUOA 2KDEB 3P4PB 2J0MA 4MGIE 4B95A 2WXQA 1FIQA 3A4SC 4MDKE 4BOZB 3ZUNA 2LGYA 2RDBC 2KANA 1WH3A 4EZJA 3ZXVA 4KZCA 1A5RA 3U30A 4DBGA 2LEKA 2WXRA 2WU5B 1YJIA 1N63A 4HVBA 3LJ3A 2V4LA 4BBNF 4J3OD 4FN2A 1SGHA 3A9JA 1L0XB 2WQYB 1H8CA 4HCPB 3MTNB 2IZVB 4IC7B 1WM2A 3VRBB 2NR2A 2EELA 2G1EA 2AQ1B 4CQNA 2BS2B 1CMXB 1GB4A 3V6CB 2KQ4X 3UINB 1TS2A 4M02A 3PTFC 3FILB 1C4PA 2IY0B 1E8YA 2O6VA 3AEDB 4A20A 3VXWA 4C56C 4WJPA 1OEYJ 2KACA 3S2AA 2GMIC 4ZRIA 1WX7A 1V5OA 1XXGA 2BTEA 1R4NI 1XCQL 2ZPYA 3CSTA 2D3AA 1UZXB 1UBQA 3ZNZB 4G50A 3T3NA 4S0RA 4MJSA 4KX6B 4ZRJA 2ZCCA 3A1QA 3FC4A 3AB5A 2QIEB 1EF5A 2Q5WD 5CHVC 3R2IA 4DHJD 3U7ZA 3MC0B 3RN9C 2WXGA 3W1SA 1JMLA 2L7RA 4UDUC 1JWUD 3B08A 2VRRB 3KW5B 1YQ3B 1OEYA 2ASQA 4NQKE 5LLIA 3E9SA 4N6EB 2FNJB 1QOAA 3U8ZA 1YN4A 4K3CA 4ZHOA 3VUYA 2KMMA 3MJWA 5AZFA 3OJ3A 2A5UA 2BT6A 3AE4B 1WZ3A 4C7YA 5EE9A 2BS3B 1BT0A 2K5PA 3B1LX 2KVZA 4HDQA 2GI9A 2JVCA 5AUKA 2O2VA 4IKGA 1PQSA 2DAFA 1NENB 3PT2B 1CJEA 4B0EA 1XLNA 4TV3A 4BBNC 1SJED 2IO1B 2WXNA 4HRSA 2YLMA 3UQAA 2ZZPB 3C8YA 1RAXA 4FHKA 3GP7A 1ZOYB 1V8CA 4LTUA 2LVPA 2KYWA 5DPRA 2KDBA 3NS8A 2N9EB 2IJ0A 3W1YA 3UQBA 1V97A 1F0ZA 3VTVA 2KVRA 2KAJA 3Q3NC 1I4QA 3WANA 1WFYA 1UWMA 4TKNA 4XDDA 1V1PB 4ZYSA 4A3OA 1UGMA 3SEBA 3JVZX 3A9JB 2LGDA 5GXGB 2V4IB 1S3SG 2N7JA 1K52A 1R4MI 2BYFA 1V6EA 1FD6A 1WM3A 4JIOU 4H2AA 1NI3A 2AYOB 2DLBA 4L23A 1TY2A 4ICVA 2JWUA 3RI7C 4XDCA 3QARA 3VHTC 3K9PB 1HTOA 1Z2MA 4MM3B 1E8XA 4W9LA 2W54A 4P1CC 4CHKA 3HK0A 4JE3B 1WRDB 3AU5A 4IDIA 1T6BX 4ANUA 3N32A 3PRPB 4IW0A 2ONQA 1JROA 5D6JB 2L05A 4RF1A 2JYEA 1FXTB 3M3JA 1V86A 2XEWA 2JT4B 1QT9A 2M17A 4WJNA 4XWWA 3CF6E 3RNGC 1K53A 2KLCA 4MJSB 2D11A 1JALA 4AP4C 2LGXA 3RT3B 5G2NA 2WXHA 2RPQA 1YX6B 2LHDA 1C76A 3AE3B 2A4ZA 1XLQA 4OHJA 3ETRA 5FK9C 3NUHB 2WDQB 3JW0X 3TBLD 4NAWB 1LO5D 1RYJA 3V60A 3W9CB 1I4RA 4W9GA 1OGWA 4MH0E 4REZA 1JRPA 1VD2A 4MGZE 2D2QA 2IYDB 2UWQA 3WAMA 2BF8B 4A90A 3I5JC 4P1BC 4HDOA 3TL5A 1KM7A 4TSSA 4K7WA 1MFWA 2KJ6A 2LFIA 2L32A 1ZE3D 1WJ4A 2O6VD 3KUCB 2M19A 3IBEA 4W9FA 2CKHB 2PVGC 2WXIA 2JX5A 3URYA 1WYWB 3H8HA 2W3RA 2OEDA 4L1BA 2IGHA 4RF0A 2N0SB 3AEGB 2G9HD 4BKSD 4ANVA 1C4AA 3RCZA 3VH3B 1V5TA 1TY0A 1T0QC 1QKZA 3RNAC 1PFDA 4RCOA 2FE8A 3T9LA 1ZDXA 4ZYNA 2MCNB 1C3TA 2KJRA 1SE3A 2ON8A 1IYFA 2AQ2B 3MHZA 2I1JA 1ZDVA 2IY1B 1E0ZA 5D3DA 2I38A 1FNUA 2N9XA 4FJVB 2ZVNA 4GDLB 2J0JA 2BWFA 2UU7A 1F52A 2C7NB 4HROA 5C1ZA 1FM0D 3TJPA 2MBQA 3AE7B 4PS8A 4O1NA 3BINA 5JHBA 1ZKHA 1K50A 1TYGB 2JU6X 4EE2A 2KN4A 1EF1A 5BMIA 1SJHD 2BWES 3TMPB 2KWVB 2K6DB 2KFKA 1VZ8A 3KH0A 2LGSA 3TCAA 4EUTA 1V49A 3AXCA 1IGDA 2GBRA 1TZ1A 4W9KA 4DDGD 3PVLA 3P4RB 2IGGA 1UWXA 1TGZB 2LHEA 3LXFA 5EDSA 1EWYC 2Z59B 2YVCA 1FEHA 3DHGC 4IM0A 2K0PA 1N61A 3E56A 4F7ZA 1TKYA 1WWTA 1TS5A 3OLMD 4YT0B 4MELA 1KRHA 4RGNA 4F1SA 4MEMA 2K3UA 1JRUA 5J2RA 3DBLI 4BKGA 3Q6BA 2L0FA 3DHHC 2KT7A 2QHOA 2DZKA 2YEPF 3M62B 3QK0A 2REXA 4GDKB 4NQLB 1KF6B 5BYSA 4DXGA 3GE8C 2WXKA 4DK5A 3FILA 2G4SA 1VR9A 2FCNA 1P9DU 3JYUA 2PEAA 3NOBA 4JWSC 2WXOA 4LNNA 4KKIA 4IM2A 1MI0A 1QOGA 1XD3B 3RYTA 4G0NB 3X23A 4EKUA 1VDVA 2WX0A 2WXFA 3W1SC 4ZDVA 2DYOA 2IBIB 4K7SA 1B1ZA 2AQ3B 2VH2A 2R2OA 1G6JA 3ZNID 5IP4D 4AWJA 4RH6A 3SDLC 3EUB2 2JXTA 2NBWB 2BBCA 3BK2A 5I4DA 4OVUA 3C19A 1KFYB 2NTTA 3RZFA
chains in the Genus database with same CATH topology
3H7SA 1UD7A 1J0GA 2ZPYA 3PZDA 4W9IA 3CSTA 3QC8B 4EFOA 2KFKB 1UZXB 3TIXA 2N7EA 1UBQA 3ZNZB 4G50A 3A1QB 4FADA 3HM6X 4DHZE 3WAOA 4MJSA 3ZKJC 4EZLA 2BGFA 4ZRJA 2KN5A 2KXJA 2ZCCA 3A1QA 1OQYA 1EF5A 2KMCA 1QZEA 3RZWC 2FIDA 5CHVC 5CX3A 2FIFA 4DXAB 2IO3B 4DHJD 2KLGA 5D7GA 2AWTA 3N30A 5TR5A 3W1SA 2L7RA 1Z5SB 3QCAA 3B08A 2VRRB 3KW5B 4NNJB 4ANXA 2XK5A 2RD0A 1OEYA 2ASQA 2LVQA 4NQKE 3ZIMA 3PLVA 5LLIA 2MRPA 3PHXB 4KDLB 4G11A 1LM8B 4CO7A 2MP2A 2CR5A 1AARA 2ZJDA 2FNJB 4MSQB 3IG3A 3U8ZA 2LI5A 4WWPA 3KUZA 5CHFA 2AL6A 3ZTCA 2NS5A 1WI0A 1KOTA 4DWFA 2GOWA 3VUYA 3MJWA 5AZFA 4DHJB 2MA9B 4GB9A 3OJ3A 2KFJA 4JLCA 2A5UA 5E6OA 4MGYE 4NPNA 3DVGY 4W9DA 3H7PA 1WZ3A 2KTRB 4I6NB 1XT9B 5AEKB 2L00B 1BT0A 2CHWA 5FR6A 2L0TA 3B1LX 3VVWB 3QWZB 5BO4B 3UGBB 4HDQA 2JVCA 3DVNU 4XZ4A 5E6PA 2O2VA 1EO6A 1P0RA 3VUXA 5IA7A 2GBKA 1WXSA 1PQSA 2DAFA 1P3QU 3L13A 3PT2B 5LXIB 5HKHA 4FHJA 4BBNC 1WR6E 4NJ6A 4TV3A 3PSEB 3PS6A 4MM3A 2IO1B 4JQWC 3IFWB 3DBHI 3UF8A 2YLMA 3UQAA 4GDLA 2ZZPB 2RGFA 1NDDA 4KSLC 2KDIA 4P7IA 2JY6A 1RAXA 4FHKA 4YL8A 3GOEA 1F9JA 1LFDA 3VTWA 4B6WA 2R2QA 4CYEA 2BKRB 2LVPA 1UH6A 2JPHA 5DPRA 2LWPA 1ZW7A 2KDBA 2JXXA 2ZCBA 2EKEC 3NS8A 2N9EB 1GG3A 3W1YA 3OJ4B 4NY0A 3UQBA 1YQBA 3APDA 3D32A 3PRZA 1WJUA 2C5LC 3VTVA 1WF9A 2KVRA 5JHAA 3WANA 1WFYA 1YX5B 2LRWA 2K39A 2L76A 4TKNA 2DX5B 3UIOB 4X57B 4A3OA 3A9KA 4HJKA 2K8BA 4RM8A 1E7UA 3K9OB 1UGMA 3C0RB 3X0WA 3DBSA 2DZMA 2KQSA 3JVZX 3M95A 3NZUA 3A9JB 2LZ6A 1WJ6A 2LGDA 2M0XA 1C1YB 1D3ZA 2G3QB 1S3SG 2N7DA 3PV1A 4WWNA 3WAPA 1KJTA 3Q3FA 1R4MI 1TBEA 2BYFA 2JZ3B 4ZRKA 3SHQA 2D3GA 4BKSA 2N4FA 4IG7B 1V6EA 2KO3A 1WM3A 3DPDA 4HXDA 3KUDB 3ALBA 5AZGA 4JIOU 1WGDA 1GC7A 4GIVA 3ZRCA 1X1MA 3V62A 2AYOB 1V80A 3ZDTA 2KWUB 2KC1A 3B0AA 1RFAA 4W9JA 1L2NA 4ICVA 1WE6A 3QARA 4HWIB 2HJ8A 3VHTC 3K9PB 2NBVB 5AZHA 1V2YA 1Z2MA 1E5WA 4J6IA 1WMHA 1UBIA 2KWCA 1E8XA 1I35A 4W9LA 3Q3JA 2GBJA 1WGGA 2W9NA 1E8ZA 2DYBA 4RMAA 3JSVB 1WGYA 3M63B 4GMVA 3ZDMC 3HK0A 4CHKA 3EFUA 1WRDB 3AU5A 2MSED 4FBJB 4ANUA 3N32A 3CMMB 3PRPB 3DQVA 3VAWA 5L95C 1NBFC 5J18A 4IW0A 3SU8X 2WX1A 4MSMB 5D6JB 2L05A 3HHMA 1HE8A 1LQBA 1FXTB 2FCSA 2PE6B 3ZNGC 3M3JA 2JWZA 2KTFA 3KYDD 1V86A 2XEWA 3A4RA 2ZPNA 3APCA 4II3B 3RULA 2JT4B 2M17A 2MW5A 2DENB 1XQQA 3QQ8B 3AULA 2BKFA 4WJNA 1TTNA 3CF6E 2WWZA 2LUEA 4II2B 3PREA 3L10B 5DPSA 1T0YA 4HLEA 1GC6A 2KLCA 4HPLB 1WXVA 4MJSB 2D11A 2AEHA 3V61A 4K1RB 2Z0EB 4AP4C 2LGXA 2KX3A 2MQJA 2UYZB 3RT3B 2PPHA 2B3AA 4PS7A 4RM9A 2DAJA 5G2NA 5JZEB 4GSWA 2RPQA 4IUMB 2IO2B 5LXHA 4TUUA 3NZSA 1YX6B 3EC8A 4IWQA 4W9CA 3DOWA 2DYMA 2CHZA 2LXAA 2A4ZA 5G55A 3IVFA 2Y5BB 4WQOB 5CTRC 4K7UA 2KX0A 2NVUI 2O2VB 4WJQA 5C23A 2GBMA 3JW0X 2MWSB 3ENEA 3H1UA 4GXBA 3TBLD 4NAWB 2EMTA 2N1VA 3V60A 2MX2A 3EECA 2J0KA 4LCDE 1IP9A 2KTRA 4IM3A 3VH4B 1GJZA 2HD5B 2KD0A 4W9GA 1ISNA 2HTHA 1OGWA 4MH0E 3VDZA 2KK8A 2ZEQA 1VD2A 3APFA 2N1WA 1IPGA 4MGZE 2D2QA 2L3ZA 2IYDB 3PLUA 2UWQA 3WAMA 1WX8A 1WR1A 2BF8B 2D07B 2HE7A 2KZRA 2KQ7A 2EMSA 2M8SA 2BYEA 1S1QB 2ZNVC 3ZW3A 4HDOA 4MGKE 3TL5A 1KM7A 3ECIA 4JGHB 4XX5A 4M8NA 4K7WA 1SE9A 2KJ6A 3I3TB 2RR9A 1WJ4A 2O6VD 4ASWC 3KUCB 2KNBA 3IBEA 2DZJA 4W9FA 1GUAB 4E74A 4BKTA 1YD8U 5J17A 3NHEB 3ML8A 2WDTB 2CKHB 1Q5WB 4K81A 1J8CA 4FJZA 2FCMA 4BOSC 4PS3A 3BY4B 4KDIC 2KMAA 2ZNVB 3ZNHB 3PHWB 3U7DA 1WYWB 2BPSA 4LJOB 2LVOA 2K6QA 2V3SA 1WY8A 1WE7A 3AU4A 3QA8A 4LJPB 2MBOA 3MHSD 4E3CA 2KJHB 5D2MB 5D94A 3HIZA 4I6LB 4BKSD 4ANVA 4W9EA 3DCGA 3RCZA 1L7YA 3VH3B 1V5TA 2N9PC 2OOBB 2MBHA 2C7HA 1WZ0A 3T9LA 2KDFB 4LDTD 4ZYNA 2LJ5A 3DBRI 2MCNB 4BFRA 2LD9A 1C3TA 3RUIB 2KJRA 1WGRA 3UIPB 4W9HA 1IYFA 1OTRB 4F8CB 4WJOA 2I1JA 1I42A 3A9KB 1E8WA 2C60A 4IWOA 3VQIA 2LRUA 2K25A 3ZLZA 2IY1B 3P2BA 2MP2B 2BYVE 4FJVB 2N9XA 3L17A 2I1KA 1WJNA 2J0JA 1V81A 2ZVNA 2BWFA 4GDLB 5KHQA 2C7NB 2K8CA 5C1ZA 1GNUA 4IWPA 3TJPA 2J7QB 2MBQA 4PS8A 4PYUA 2GBNA 2XK5B 1VCBA 3ZRFA 3BINA 2NCNA 2RSUA 1WGHA 3JSVA 4KSKC 5JHBA 1SIFA 1NI2A 1ZKHA 3ZO5B 3R66C 4G3XB 1Y8RC 4I6PA 1EF1A 1J19A 2KKCA 4ANWA 1E7VA 1WXMA 4GN1A 4JL9A 1YIWA 2BWES 2ZVOA 3LDZE 5DPTA 3TMPB 3T8MA 2KWVB 4AJYB 2K6DB 2KFKA 3VUWA 2XBBC 3H7PB 3PRMB 2LASA 2MBBB 2PJHA 3KH0A 4BVUC 3TCAA 2FCQA 2WYQA 4EUTA 2AL3A 1V49A 4WAAA 4KZ0A 4XC2A 1WIAA 3AXCA 4KIKB 4DDID 4DHZB 2JZZA 1WX9A 1E90A 2GBRA 4OVVA 3QJZA 3A33B 2KOXA 1KLVA 1TZ1A 2NBUA 5DCNA 3SD5A 4W9KA 4DDGD 3PVLA 2C9WB 2DZIA 1EUVB 1M94A 1TGZB 2NPTB 2LXCA 4EEWA 2G45B 1Q1OA 5EDSA 1RRBA 3PPAA 3O65B 2KHWB 1ZGUB 4EZKA 5L83A 3OAWA 5CHWA 2Z59B 4FA6A 3ZTDA 2YVCA 2D10A 2KC2A 1YJ1A 4IM0A 2OJRA 4KV2A 3QX1A 3R7QA 4HCNB 2CU1A 4GU2A 3IHPC 4F7ZA 3DDCB 4FJYA 5JH5C 3OLMD 1WMHB 2MBEA 3QAQA 1MG8A 2K8HA 2FUHB 4ICUA 4NAWA 2JF5A 4AUQC 2CS4A 1V9JA 3QIJA 1Q0WB 4HK2A 4MELA 2NPTA 2JUOA 3GZNI 3VTUA 2KDEB 2J0MA 4MGIE 4F1SA 4MEMA 4B95A 1JRUA 1P1AA 5J2RA 3DBLI 3DVNV 3A4SC 4MDKE 4BOZB 1K8RB 2LGYA 3ZUNA 4BKGA 2JRIB 3NY5A 1RLFA 2L0FA 2KANA 1WH3A 4KIKA 4EZJA 1U4AA 4WWOA 4EOYA 3DVGX 2QHOA 2JRHA 2DZKA 3L08A 4KZCA 1A5RA 3L16A 3RD2A 3U30A 3VFKA 4DBGA 5DPWA 3H9DA 3M62B 3QK0A 4HVBA 2REXA 3LJ3A 2V4LA 4GDKB 1UELA 4GDKA 2O6VB 4NQLB 2C7MB 4BBNF 2IO0B 3R7RA 3EHVA 4FN2A 1SGHA 4DK5A 5E6NA 3A9JA 3V6EB 2G4SA 4FLHA 3R3MA 3CSFA 2FCNA 1P9DU 3JYUA 2PEAA 3NOBA 3N3KB 1H8CA 4HCPB 3ZVVA 2PE9A 3MTNB 2Z0DB 3QHTA 4IM2A 1XD3B 2IZVB 2V1YA 2FAZA 3HM3A 4IC7B 3RYTA 1WM2A 3PGEA 5IAAC 3KYCD 4G0NB 2NR2A 2K1FA 1WXAA 3X23A 4KVGB 4EKUA 1LXDA 4HPMB 2WX0A 1CMXB 4AJWA 1H4RA 4GOCA 2G4DB 2DHZA 4TQ0A 3KVFB 4LDTB 3W1SC 4ZDVA 4M0WB 2DYOA 4PYZA 2IBIB 4K7SA 3V6CB 3WA0A 5GMVA 1G6JA 2R2OA 4GGQA 4M8MA 3UINB 3PTFC 3ZNID 4B9KA 4A3PA 2CHXA 3L54A 4AWJA 2IY0B 3ONSA 5KHOA 3ML9A 1E8YA 3SDLC 2O6VA 2MLBA 4A20A 3L0WB 3VXWA 2NBWB 4TQ1A 4FULA 4NJ7A 4WJPA 1P98A 3WIMA 1OEYJ 3S2AA 2L8JA 2GMIC 3AI5A 4ZRIA 1WX7A 4OVUA 4AOFA 4URKA 1V5OA 4E71A 2M4NA 2M1MA 3WALA 3H6NA 4N9F4 1R4NI 3RZFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3H7S A;  1UD7 A;  1J0G A;  2ZPY A;  3PZD A;  4W9I A;  3CST A;  3QC8 B;  4EFO A;  2KFK B;  1UZX B;  3TIX A;  2N7E A;  1UBQ A;  3ZNZ B;  4G50 A;  3A1Q B;  4FAD A;  3HM6 X;  4DHZ E;  3WAO A;  4MJS A;  3ZKJ C;  4EZL A;  2BGF A;  4ZRJ A;  2KN5 A;  2KXJ A;  2ZCC A;  3A1Q A;  1OQY A;  1EF5 A;  2KMC A;  1QZE A;  3RZW C;  2FID A;  5CHV C;  5CX3 A;  2FIF A;  4DXA B;  2IO3 B;  4DHJ D;  2KLG A;  5D7G A;  2AWT A;  3N30 A;  5TR5 A;  3W1S A;  2L7R A;  1Z5S B;  3QCA A;  3B08 A;  2VRR B;  3KW5 B;  4NNJ B;  4ANX A;  2XK5 A;  2RD0 A;  1OEY A;  2ASQ A;  2LVQ A;  4NQK E;  3ZIM A;  3PLV A;  5LLI A;  2MRP A;  3PHX B;  4KDL B;  4G11 A;  1LM8 B;  4CO7 A;  2MP2 A;  2CR5 A;  1AAR A;  2ZJD A;  2FNJ B;  4MSQ B;  3IG3 A;  3U8Z A;  2LI5 A;  4WWP A;  3KUZ A;  5CHF A;  2AL6 A;  3ZTC A;  2NS5 A;  1WI0 A;  1KOT A;  4DWF A;  2GOW A;  3VUY A;  3MJW A;  5AZF A;  4DHJ B;  2MA9 B;  4GB9 A;  3OJ3 A;  2KFJ A;  4JLC A;  2A5U A;  5E6O A;  4MGY E;  4NPN A;  3DVG Y;  4W9D A;  3H7P A;  1WZ3 A;  2KTR B;  4I6N B;  1XT9 B;  5AEK B;  2L00 B;  1BT0 A;  2CHW A;  5FR6 A;  2L0T A;  3B1L X;  3VVW B;  3QWZ B;  5BO4 B;  3UGB B;  4HDQ A;  2JVC A;  3DVN U;  4XZ4 A;  5E6P A;  2O2V A;  1EO6 A;  1P0R A;  3VUX A;  5IA7 A;  2GBK A;  1WXS A;  1PQS A;  2DAF A;  1P3Q U;  3L13 A;  3PT2 B;  5LXI B;  5HKH A;  4FHJ A;  4BBN C;  1WR6 E;  4NJ6 A;  4TV3 A;  3PSE B;  3PS6 A;  4MM3 A;  2IO1 B;  4JQW C;  3IFW B;  3DBH I;  3UF8 A;  2YLM A;  3UQA A;  4GDL A;  2ZZP B;  2RGF A;  1NDD A;  4KSL C;  2KDI A;  4P7I A;  2JY6 A;  1RAX A;  4FHK A;  4YL8 A;  3GOE A;  1F9J A;  1LFD A;  3VTW A;  4B6W A;  2R2Q A;  4CYE A;  2BKR B;  2LVP A;  1UH6 A;  2JPH A;  5DPR A;  2LWP A;  1ZW7 A;  2KDB A;  2JXX A;  2ZCB A;  2EKE C;  3NS8 A;  2N9E B;  1GG3 A;  3W1Y A;  3OJ4 B;  4NY0 A;  3UQB A;  1YQB A;  3APD A;  3D32 A;  3PRZ A;  1WJU A;  2C5L C;  3VTV A;  1WF9 A;  2KVR A;  5JHA A;  3WAN A;  1WFY A;  1YX5 B;  2LRW A;  2K39 A;  2L76 A;  4TKN A;  2DX5 B;  3UIO B;  4X57 B;  4A3O A;  3A9K A;  4HJK A;  2K8B A;  4RM8 A;  1E7U A;  3K9O B;  1UGM A;  3C0R B;  3X0W A;  3DBS A;  2DZM A;  2KQS A;  3JVZ X;  3M95 A;  3NZU A;  3A9J B;  2LZ6 A;  1WJ6 A;  2LGD A;  2M0X A;  1C1Y B;  1D3Z A;  2G3Q B;  1S3S G;  2N7D A;  3PV1 A;  4WWN A;  3WAP A;  1KJT A;  3Q3F A;  1R4M I;  1TBE A;  2BYF A;  2JZ3 B;  4ZRK A;  3SHQ A;  2D3G A;  4BKS A;  2N4F A;  4IG7 B;  1V6E A;  2KO3 A;  1WM3 A;  3DPD A;  4HXD A;  3KUD B;  3ALB A;  5AZG A;  4JIO U;  1WGD A;  1GC7 A;  4GIV A;  3ZRC A;  1X1M A;  3V62 A;  2AYO B;  1V80 A;  3ZDT A;  2KWU B;  2KC1 A;  3B0A A;  1RFA A;  4W9J A;  1L2N A;  4ICV A;  1WE6 A;  3QAR A;  4HWI B;  2HJ8 A;  3VHT C;  3K9P B;  2NBV B;  5AZH A;  1V2Y A;  1Z2M A;  1E5W A;  4J6I A;  1WMH A;  1UBI A;  2KWC A;  1E8X A;  1I35 A;  4W9L A;  3Q3J A;  2GBJ A;  1WGG A;  2W9N A;  1E8Z A;  2DYB A;  4RMA A;  3JSV B;  1WGY A;  3M63 B;  4GMV A;  3ZDM C;  3HK0 A;  4CHK A;  3EFU A;  1WRD B;  3AU5 A;  2MSE D;  4FBJ B;  4ANU A;  3N32 A;  3CMM B;  3PRP B;  3DQV A;  3VAW A;  5L95 C;  1NBF C;  5J18 A;  4IW0 A;  3SU8 X;  2WX1 A;  4MSM B;  5D6J B;  2L05 A;  3HHM A;  1HE8 A;  1LQB A;  1FXT B;  2FCS A;  2PE6 B;  3ZNG C;  3M3J A;  2JWZ A;  2KTF A;  3KYD D;  1V86 A;  2XEW A;  3A4R A;  2ZPN A;  3APC A;  4II3 B;  3RUL A;  2JT4 B;  2M17 A;  2MW5 A;  2DEN B;  1XQQ A;  3QQ8 B;  3AUL A;  2BKF A;  4WJN A;  1TTN A;  3CF6 E;  2WWZ A;  2LUE A;  4II2 B;  3PRE A;  3L10 B;  5DPS A;  1T0Y A;  4HLE A;  1GC6 A;  2KLC A;  4HPL B;  1WXV A;  4MJS B;  2D11 A;  2AEH A;  3V61 A;  4K1R B;  2Z0E B;  4AP4 C;  2LGX A;  2KX3 A;  2MQJ A;  2UYZ B;  3RT3 B;  2PPH A;  2B3A A;  4PS7 A;  4RM9 A;  2DAJ A;  5G2N A;  5JZE B;  4GSW A;  2RPQ A;  4IUM B;  2IO2 B;  5LXH A;  4TUU A;  3NZS A;  1YX6 B;  3EC8 A;  4IWQ A;  4W9C A;  3DOW A;  2DYM A;  2CHZ A;  2LXA A;  2A4Z A;  5G55 A;  3IVF A;  2Y5B B;  4WQO B;  5CTR C;  4K7U A;  2KX0 A;  2NVU I;  2O2V B;  4WJQ A;  5C23 A;  2GBM A;  3JW0 X;  2MWS B;  3ENE A;  3H1U A;  4GXB A;  3TBL D;  4NAW B;  2EMT A;  2N1V A;  3V60 A;  2MX2 A;  3EEC A;  2J0K A;  4LCD E;  1IP9 A;  2KTR A;  4IM3 A;  3VH4 B;  1GJZ A;  2HD5 B;  2KD0 A;  4W9G A;  1ISN A;  2HTH A;  1OGW A;  4MH0 E;  3VDZ A;  2KK8 A;  2ZEQ A;  1VD2 A;  3APF A;  2N1W A;  1IPG A;  4MGZ E;  2D2Q A;  2L3Z A;  2IYD B;  3PLU A;  2UWQ A;  3WAM A;  1WX8 A;  1WR1 A;  2BF8 B;  2D07 B;  2HE7 A;  2KZR A;  2KQ7 A;  2EMS A;  2M8S A;  2BYE A;  1S1Q B;  2ZNV C;  3ZW3 A;  4HDO A;  4MGK E;  3TL5 A;  1KM7 A;  3ECI A;  4JGH B;  4XX5 A;  4M8N A;  4K7W A;  1SE9 A;  2KJ6 A;  3I3T B;  2RR9 A;  1WJ4 A;  2O6V D;  4ASW C;  3KUC B;  2KNB A;  3IBE A;  2DZJ A;  4W9F A;  1GUA B;  4E74 A;  4BKT A;  1YD8 U;  5J17 A;  3NHE B;  3ML8 A;  2WDT B;  2CKH B;  1Q5W B;  4K81 A;  1J8C A;  4FJZ A;  2FCM A;  4BOS C;  4PS3 A;  3BY4 B;  4KDI C;  2KMA A;  2ZNV B;  3ZNH B;  3PHW B;  3U7D A;  1WYW B;  2BPS A;  4LJO B;  2LVO A;  2K6Q A;  2V3S A;  1WY8 A;  1WE7 A;  3AU4 A;  3QA8 A;  4LJP B;  2MBO A;  3MHS D;  4E3C A;  2KJH B;  5D2M B;  5D94 A;  3HIZ A;  4I6L B;  4BKS D;  4ANV A;  4W9E A;  3DCG A;  3RCZ A;  1L7Y A;  3VH3 B;  1V5T A;  2N9P C;  2OOB B;  2MBH A;  2C7H A;  1WZ0 A;  3T9L A;  2KDF B;  4LDT D;  4ZYN A;  2LJ5 A;  3DBR I;  2MCN B;  4BFR A;  2LD9 A;  1C3T A;  3RUI B;  2KJR A;  1WGR A;  3UIP B;  4W9H A;  1IYF A;  1OTR B;  4F8C B;  4WJO A;  2I1J A;  1I42 A;  3A9K B;  1E8W A;  2C60 A;  4IWO A;  3VQI A;  2LRU A;  2K25 A;  3ZLZ A;  2IY1 B;  3P2B A;  2MP2 B;  2BYV E;  4FJV B;  2N9X A;  3L17 A;  2I1K A;  1WJN A;  2J0J A;  1V81 A;  2ZVN A;  2BWF A;  4GDL B;  5KHQ A;  2C7N B;  2K8C A;  5C1Z A;  1GNU A;  4IWP A;  3TJP A;  2J7Q B;  2MBQ A;  4PS8 A;  4PYU A;  2GBN A;  2XK5 B;  1VCB A;  3ZRF A;  3BIN A;  2NCN A;  2RSU A;  1WGH A;  3JSV A;  4KSK C;  5JHB A;  1SIF A;  1NI2 A;  1ZKH A;  3ZO5 B;  3R66 C;  4G3X B;  1Y8R C;  4I6P A;  1EF1 A;  1J19 A;  2KKC A;  4ANW A;  1E7V A;  1WXM A;  4GN1 A;  4JL9 A;  1YIW A;  2BWE S;  2ZVO A;  3LDZ E;  5DPT A;  3TMP B;  3T8M A;  2KWV B;  4AJY B;  2K6D B;  2KFK A;  3VUW A;  2XBB C;  3H7P B;  3PRM B;  2LAS A;  2MBB B;  2PJH A;  3KH0 A;  4BVU C;  3TCA A;  2FCQ A;  2WYQ A;  4EUT A;  2AL3 A;  1V49 A;  4WAA A;  4KZ0 A;  4XC2 A;  1WIA A;  3AXC A;  4KIK B;  4DDI D;  4DHZ B;  2JZZ A;  1WX9 A;  1E90 A;  2GBR A;  4OVV A;  3QJZ A;  3A33 B;  2KOX A;  1KLV A;  1TZ1 A;  2NBU A;  5DCN A;  3SD5 A;  4W9K A;  4DDG D;  3PVL A;  2C9W B;  2DZI A;  1EUV B;  1M94 A;  1TGZ B;  2NPT B;  2LXC A;  4EEW A;  2G45 B;  1Q1O A;  5EDS A;  1RRB A;  3PPA A;  3O65 B;  2KHW B;  1ZGU B;  4EZK A;  5L83 A;  3OAW A;  5CHW A;  2Z59 B;  4FA6 A;  3ZTD A;  2YVC A;  2D10 A;  2KC2 A;  1YJ1 A;  4IM0 A;  2OJR A;  4KV2 A;  3QX1 A;  3R7Q A;  4HCN B;  2CU1 A;  4GU2 A;  3IHP C;  4F7Z A;  3DDC B;  4FJY A;  5JH5 C;  3OLM D;  1WMH B;  2MBE A;  3QAQ A;  1MG8 A;  2K8H A;  2FUH B;  4ICU A;  4NAW A;  2JF5 A;  4AUQ C;  2CS4 A;  1V9J A;  3QIJ A;  1Q0W B;  4HK2 A;  4MEL A;  2NPT A;  2JUO A;  3GZN I;  3VTU A;  2KDE B;  2J0M A;  4MGI E;  4F1S A;  4MEM A;  4B95 A;  1JRU A;  1P1A A;  5J2R A;  3DBL I;  3DVN V;  3A4S C;  4MDK E;  4BOZ B;  1K8R B;  2LGY A;  3ZUN A;  4BKG A;  2JRI B;  3NY5 A;  1RLF A;  2L0F A;  2KAN A;  1WH3 A;  4KIK A;  4EZJ A;  1U4A A;  4WWO A;  4EOY A;  3DVG X;  2QHO A;  2JRH A;  2DZK A;  3L08 A;  4KZC A;  1A5R A;  3L16 A;  3RD2 A;  3U30 A;  3VFK A;  4DBG A;  5DPW A;  3H9D A;  3M62 B;  3QK0 A;  4HVB A;  2REX A;  3LJ3 A;  2V4L A;  4GDK B;  1UEL A;  4GDK A;  2O6V B;  4NQL B;  2C7M B;  4BBN F;  2IO0 B;  3R7R A;  3EHV A;  4FN2 A;  1SGH A;  4DK5 A;  5E6N A;  3A9J A;  3V6E B;  2G4S A;  4FLH A;  3R3M A;  3CSF A;  2FCN A;  1P9D U;  3JYU A;  2PEA A;  3NOB A;  3N3K B;  1H8C A;  4HCP B;  3ZVV A;  2PE9 A;  3MTN B;  2Z0D B;  3QHT A;  4IM2 A;  1XD3 B;  2IZV B;  2V1Y A;  2FAZ A;  3HM3 A;  4IC7 B;  3RYT A;  1WM2 A;  3PGE A;  5IAA C;  3KYC D;  4G0N B;  2NR2 A;  2K1F A;  1WXA A;  3X23 A;  4KVG B;  4EKU A;  1LXD A;  4HPM B;  2WX0 A;  1CMX B;  4AJW A;  1H4R A;  4GOC A;  2G4D B;  2DHZ A;  4TQ0 A;  3KVF B;  4LDT B;  3W1S C;  4ZDV A;  4M0W B;  2DYO A;  4PYZ A;  2IBI B;  4K7S A;  3V6C B;  3WA0 A;  5GMV A;  1G6J A;  2R2O A;  4GGQ A;  4M8M A;  3UIN B;  3PTF C;  3ZNI D;  4B9K A;  4A3P A;  2CHX A;  3L54 A;  4AWJ A;  2IY0 B;  3ONS A;  5KHO A;  3ML9 A;  1E8Y A;  3SDL C;  2O6V A;  2MLB A;  4A20 A;  3L0W B;  3VXW A;  2NBW B;  4TQ1 A;  4FUL A;  4NJ7 A;  4WJP A;  1P98 A;  3WIM A;  1OEY J;  3S2A A;  2L8J A;  2GMI C;  3AI5 A;  4ZRI A;  1WX7 A;  4OVU A;  4AOF A;  4URK A;  1V5O A;  4E71 A;  2M4N A;  2M1M A;  3WAL A;  3H6N A;  4N9F 4;  1R4N I;  3RZF A; 
#chains in the Genus database with same CATH topology
 1UD7 A;  4W9I A;  2GRI A;  3TIX A;  3A1Q B;  4FAD A;  2IPK D;  3WAO A;  4EZL A;  4D2K A;  1OQY A;  3EGR A;  4OVZ A;  2FID A;  5BMH A;  5CX3 A;  1MHH E;  2BB6 A;  2IO3 B;  2AWT A;  3Q2A C;  2WXJ A;  5FKA C;  5HI1 A;  1WXQ A;  1ET9 A;  1T3Q A;  4ANX A;  2XK5 A;  4C7Z A;  2WDR B;  1MPE A;  2MRP A;  3PHX B;  3HRD D;  2V3P A;  4G11 A;  1LM8 B;  1AAR A;  1T5X D;  1FFV A;  2KDM A;  1SSN A;  3KUZ A;  5CHF A;  2QIL A;  3NZ3 A;  3ZTC A;  4RGO S;  2NS5 A;  2WHI A;  4DWF A;  4DHJ B;  1RFK A;  4GB9 A;  4JLC A;  2EKI A;  4NPN A;  1V1O A;  2RMM A;  3Q8E A;  2KTR B;  1XT9 B;  5AEK B;  2CHW A;  3QWZ B;  1L4D B;  3UGB B;  1R7S A;  2X8X X;  4C00 A;  1YQ4 B;  2RDG A;  3TSS A;  1WXS A;  1ZP0 B;  1D5M C;  2QSD A;  1FCL A;  4FHJ A;  1WR6 E;  3PS6 A;  4JQW C;  1J7A A;  4GDL A;  2RGF A;  1NDD A;  2KDI A;  2JY6 A;  2PKO A;  4YL8 A;  3BZD B;  1F9J A;  1LFD A;  3VTW A;  4B6W A;  2R61 A;  2JPH A;  1ZW7 A;  1GG3 A;  1DOI A;  1TKG A;  1VRA B;  3GS2 A;  2DX5 B;  3NS1 A;  3A9K A;  3BVZ A;  1QOB A;  4RM8 A;  2Y5P A;  1FRD A;  2SAK A;  3M95 A;  2G3Q B;  2NMQ A;  3WAP A;  3Q3F A;  3SHQ A;  2N4F A;  2JSV X;  4IG7 B;  2KO3 A;  3DPD A;  2XN9 C;  3ALB A;  3GE3 C;  5AZG A;  5C2T B;  1WGD A;  1GC7 A;  2MJ3 A;  1QF6 A;  3PZ7 A;  2KWU B;  1F77 A;  1L2N A;  5AUI A;  1TS4 A;  3PO0 A;  1VLB A;  2BYT A;  3BII D;  2NBV B;  1V2Y A;  1E5W A;  1N5X A;  1WMH A;  1UBI A;  3DHI C;  4BZA A;  1IUE A;  1WRI A;  4LLG M;  1L5P A;  1YNT E;  3JSV B;  4GMV A;  1V1P A;  5IKC M;  1QIL A;  4KKJ A;  1C78 A;  3VAW A;  4ARI A;  1NBF C;  1TKE A;  3SU8 X;  2WX1 A;  2V3N A;  2PE6 B;  5C3J B;  3RUL A;  1XQQ A;  3ABV B;  2LUE A;  4II2 B;  3PRE A;  4N59 A;  3BVM A;  5DPS A;  1T0Y A;  1K51 A;  1WXV A;  2Z0E B;  2K22 A;  2PPH A;  3P63 A;  4PS7 A;  4RM9 A;  4WIP A;  5JZE B;  3NG0 A;  2E6X A;  3NZS A;  4IWQ A;  4W9C A;  5TSS A;  2CHZ A;  2LXA A;  4C80 A;  3MP9 A;  2Y5B B;  4WQO B;  4K7U A;  2KX0 A;  2NVU I;  2WP9 B;  1D5Z C;  4WJQ A;  5C23 A;  4GXB A;  3ZJV A;  2EMT A;  2ICI A;  2N1V A;  2MX2 A;  1IGC A;  4LCD E;  2L83 A;  2KTR A;  3VDZ A;  2ZEQ A;  3APF A;  1WX8 A;  2HE7 A;  4HWI B;  2KQ7 A;  2DNF A;  1SEB D;  4M8N A;  1JWS D;  1SE9 A;  4KGS A;  2RR9 A;  1SBB B;  3B9J A;  3R8B A;  1FNV A;  3DBR B;  4BKT A;  5J17 A;  1B9R A;  2WDT B;  1Q5W B;  1J8C A;  2FCM A;  4BOS C;  4YXD B;  2JQR B;  4KDI C;  3ZNH B;  1DOX A;  3U7D A;  2BPS A;  3IAS 1;  1JQ4 A;  4R3D A;  2V3S A;  1WE7 A;  4LJP B;  3OWE B;  2KJH B;  2WGS A;  5D94 A;  4ZRP A;  5H92 C;  4W9E A;  3DCG A;  4AS1 A;  1L7Y A;  4HKQ A;  1QOF A;  2N9P C;  3ZXR A;  2C7H A;  2FUG 1;  1WSP A;  4K3B A;  3BWU D;  2KDF B;  3TEZ A;  1WGR A;  3UIP B;  4DXF A;  4IWO A;  4QAY A;  3NVV A;  1WJN A;  4LNK A;  3P42 A;  1QLB B;  4PYU A;  2JZP A;  1EU4 A;  4RNA A;  1VCB A;  2NCN A;  1WGH A;  3VRA B;  1FXA A;  3OG5 A;  1VZ6 A;  3Q3O C;  1PGB A;  4I6P A;  1J19 A;  3FKY A;  3PRM B;  2MBB B;  2VZK D;  4XC2 A;  1WIA A;  1CK1 A;  1WX9 A;  3UI3 A;  4PT5 A;  3SD5 A;  1N60 A;  2DZI A;  1M94 A;  2LXC A;  4Q2J A;  3T3O A;  1RRB A;  3PPA A;  2KHW B;  4B0M A;  2WNM A;  2ZW1 A;  3AEE B;  3QX1 A;  5G5G A;  2Y5C A;  5JH5 C;  1OQR A;  3IXS A;  1V9J A;  1Q0W B;  2QJL A;  4HK2 A;  3NRZ A;  3TEY A;  1P1A A;  3N1Z C;  1CQV A;  4KGR A;  3NY5 A;  1RLF A;  5IN7 A;  2D5G A;  4ZOH C;  4WWO A;  4A55 A;  4EOY A;  2RPV A;  3DVG X;  3L08 A;  1RM6 C;  3L16 A;  3RD2 A;  3VFK A;  5DPW A;  3H9D A;  1DGJ A;  2O6V B;  2YEP B;  5E6N A;  2QEJ C;  3SR6 A;  4FLH A;  3R3M A;  2PTL A;  2Z0D B;  3HM3 A;  3PGE A;  1WXA A;  1LXD A;  4HPM B;  4AJW A;  1FNW A;  1KTK A;  2MJE A;  4C4V A;  2DHZ A;  1UUP A;  3KVF B;  4XWT A;  4PYZ A;  3U2S C;  5GMV A;  4M8M A;  1HZ6 A;  2CHX A;  1YN3 A;  3L54 A;  3SFD B;  3ONS A;  4JPS A;  5KHO A;  1GAQ B;  2WS3 B;  2MLB A;  4FUL A;  4NJ7 A;  1P98 A;  3WIM A;  3ZJT A;  3AI5 A;  4A8X C;  3RNC C;  2BB5 A;  4S17 A;  2JYT A;  1NYQ A;  4DQO C;  3H7S A;  4NAM A;  4EFO A;  2KFK B;  3W5V B;  4WAF A;  2N7E A;  2DBY A;  4DHZ E;  2BGF A;  2KN5 A;  2KXJ A;  2PVO D;  3IAM 1;  2GLS A;  2H88 B;  3PZ8 A;  3W2D A;  4XYC A;  3RZW C;  1C77 A;  3J9C A;  4RFB A;  2KLG A;  2KWD A;  3AEC B;  4L2Y A;  3VR9 B;  1N62 A;  4NNJ B;  2RD0 A;  1PGX A;  5D3I B;  3IT4 B;  1ZPS A;  2IND C;  2LI5 A;  4WWP A;  4GLS C;  1KOT A;  2M0A A;  2QMT A;  5IO9 A;  1L0V B;  2MA9 B;  5E6O A;  3DVG Y;  2LMC A;  4YTM B;  2WLB A;  1XCT L;  4I6N B;  1L0Y B;  4HKZ E;  3GB1 A;  2L0T A;  2VH1 A;  1OQQ A;  3DVN U;  4XZ4 A;  5E6P A;  5IOI A;  1FXI A;  1EO6 A;  1P0R A;  3VUX A;  1AYF A;  2GBK A;  1P3Q U;  3L13 A;  5HFY A;  4NJ6 A;  3N20 C;  3PSE B;  4ARC A;  1MG4 A;  1P7E A;  3IFW B;  4KSL C;  3V05 A;  1STE A;  3GOE A;  2J53 A;  2R2Q A;  4CYE A;  2BKR B;  2LWP A;  2EKE C;  4ZRQ A;  2MEK A;  3NJT A;  1ZUD 2;  2LUM A;  3IT6 B;  3OJ4 B;  4NY0 A;  1YQB A;  3APD A;  3D32 A;  4C4V B;  1WJU A;  2XNA C;  2FBW B;  1KH0 A;  5JHA A;  4WH4 A;  1EM7 A;  1YX5 B;  2LRW A;  2D3C A;  2K39 A;  3AE5 B;  4X57 B;  1FPY A;  3X0W A;  1J7B A;  3C0R B;  2DWQ A;  1TIF A;  3NZU A;  2LZ6 A;  2LGI A;  2M0X A;  1DYQ A;  1RWS A;  2QC8 A;  2N7D A;  3PV1 A;  1KJT A;  1KLU D;  1TBE A;  2JZ3 B;  4ZRK A;  5LNK 1;  1R4M B;  3KUD B;  4GIV A;  1X1M A;  1XF5 L;  2HTM E;  3B0A A;  5HG2 A;  1RFA A;  3RMK C;  4P16 A;  2W55 A;  2HJ8 A;  2PW9 A;  4J6I A;  3MFG A;  2KWC A;  1FMA D;  2GBJ A;  2W9N A;  2DYB A;  4RMA A;  3ZRC A;  3M63 B;  3ZDM C;  3EFU A;  2MSE D;  1ZXI A;  4FBJ B;  3AMZ A;  3CMM B;  4ZHP A;  1WYG A;  4M00 A;  3HHM A;  3GZN B;  1LQB A;  2FCS A;  2KTF A;  2QDF A;  2ZPN A;  1ACC A;  3APC A;  1I4P A;  2BKF A;  1TTN A;  2WWZ A;  1PYW D;  4HLE A;  1GC6 A;  2AEH A;  4K1R B;  2B76 B;  2KX3 A;  2UYZ B;  3LYY A;  2B3A A;  5LXH A;  4TUU A;  3EC8 A;  3DOW A;  2DYM A;  5G55 A;  2WXL A;  3BYT B;  5EE1 A;  3EA6 A;  3IVF A;  2O2V B;  2MWS B;  1VJK A;  2K9X A;  3MC8 A;  4USA A;  1IP9 A;  1GJZ A;  2HD5 B;  2IDY A;  1C9F A;  3R2T A;  2L3Z A;  1WR1 A;  2D07 B;  2KZR A;  2EMS A;  4ACF A;  1S1Q B;  3N9Y C;  4NZL B;  4JGH B;  4XX5 A;  1AW7 A;  3I3T B;  1OFF A;  1SE4 A;  1GUA B;  2WU2 B;  3NHE B;  3KLS X;  1L6V A;  2BS4 B;  5HHD G;  2WXP A;  1SIJ A;  3AU4 A;  2MBO A;  4E3C A;  3ZJU A;  1NEK B;  1GB1 A;  2INC C;  4I6L B;  1TJE A;  4XGA B;  2QCZ A;  3DWG C;  5T8I A;  1YMH E;  4LDT D;  3DBR I;  2LD9 A;  3EFC A;  3RUI B;  5EE0 A;  1I7H A;  1OTR B;  4F8C B;  1I42 A;  1E8W A;  2C60 A;  2LRU A;  1HZ5 A;  1AN8 A;  1ZXH A;  1E6E B;  2J7Q B;  1QQR A;  2XK5 B;  2OHF A;  2RSU A;  4KSK C;  4RGT A;  1SIF A;  4MH8 A;  3DBH B;  1M4V A;  1Y56 A;  3W5U B;  3ZO5 B;  2ZW0 A;  4G3X B;  1WGK A;  1Y8R C;  4ANW A;  1E7V A;  4WWM A;  4JL9 A;  1YIW A;  2ZVO A;  2PIA A;  3Q3M C;  3T8M A;  4AJY B;  2N9L A;  3VUW A;  2XBB C;  3H7P B;  4BVU C;  2WYQ A;  2AL3 A;  4WAA A;  4KZ0 A;  2RDH A;  4KIK B;  2GB1 A;  1PDX A;  4DHZ B;  1E90 A;  2WXM A;  1KLV A;  2NBU A;  3U52 E;  2C9W B;  3AM9 A;  4EEW A;  3BK1 A;  1Q1O A;  1JWM D;  3O65 B;  1ZGU B;  5L83 A;  5CHW A;  4FA6 A;  3ZTD A;  2KC2 A;  1YJ1 A;  1MVK A;  2OJR A;  4MAC A;  4JWU C;  4HCN B;  3IHP C;  1FRR A;  3DDC B;  1TT5 B;  4FJY A;  1F1H A;  1I4X A;  1WMH B;  2MBE A;  3QAQ A;  5FR3 A;  2LJI A;  2J4X A;  3HUI A;  2FUH B;  4NAW A;  2JF5 A;  4AUQ C;  2N9K A;  3QIJ A;  2NPT A;  3GZN I;  3VTU A;  3N1Y C;  3DVN V;  1J7C A;  1K8R B;  2AX5 A;  2JRI B;  3DBL B;  4KIK A;  1NYR A;  1U4A A;  3RNE C;  2JRH A;  2J52 A;  1E7P B;  2WDV B;  5EE3 A;  1UEL A;  4GDK A;  4WUR A;  2C7M B;  2IO0 B;  2INP E;  3R7R A;  3EHV A;  1FFU A;  4LNI A;  3V6E B;  1BXT A;  3CSF A;  2Y3A A;  3N3K B;  3WCQ A;  3ZVV A;  2PE9 A;  3QHT A;  3AE2 B;  2V1Y A;  2FAZ A;  5IAA C;  3KYC D;  1R4N B;  2K1F A;  4KVG B;  1EU3 A;  1H4R A;  4GOC A;  1MJD A;  2G4D B;  2L1A A;  1TS3 A;  4TQ0 A;  3TEW A;  4LDT B;  4M0W B;  3WA0 A;  4PK1 A;  3KWL A;  1CZP A;  4TMA B;  1HA5 A;  4GGQ A;  4LNF A;  4B9K A;  4YSY B;  4A3P A;  1A70 A;  3ML9 A;  3L0W B;  4TQ1 A;  2L8J A;  5BYR A;  3LB8 C;  4AOF A;  4URK A;  4E71 A;  2M4N A;  2M1M A;  3WAL A;  3H6N A;  4N9F 4;  1J0G A;  3PZD A;  1FO4 A;  3QC8 B;  3CIR B;  2PMV A;  3KWV A;  3TEX A;  3HM6 X;  3ZKJ C;  1IBX B;  1N6Z A;  2KMC A;  1QZE A;  2V9H A;  3TUO A;  4JX1 C;  2FIF A;  3CWI A;  4DXA B;  5D7G A;  4NJC A;  3N30 A;  5TR5 A;  1Z5S B;  3QCA A;  1BML C;  3I9V 1;  1MHX A;  3KQ4 A;  2LVQ A;  3AN1 A;  3ZIM A;  3PLV A;  3AV8 A;  1TZO A;  4KDL B;  4CO7 A;  2MP2 A;  2CR5 A;  2ZJD A;  4MSQ B;  3IG3 A;  2V0G A;  2W3S A;  1SE2 A;  2AL6 A;  4YSX B;  2CU3 A;  1WI0 A;  4LK0 M;  3VR8 B;  3O13 A;  2GOW A;  1ET6 A;  1PUT A;  2KFJ A;  4MGY E;  4W9D A;  2J42 A;  3H7P A;  3AEA B;  2L00 B;  1NVI D;  1KLG D;  3MC9 A;  2BQQ A;  5FR6 A;  4P6V F;  3VVW B;  5JXV A;  5BO4 B;  3B2G A;  1FCC C;  5IA7 A;  3B2F A;  1XO3 A;  1HEZ E;  1T0R C;  5LXI B;  5HKH A;  4MM3 A;  1C4C A;  3DBH I;  3UF8 A;  3P4Q B;  4P7I A;  3Q8F A;  4BAX A;  2BVC A;  1UH6 A;  2JXX A;  2ZCB A;  2SEB D;  1DOY A;  3Q8A A;  3Q69 A;  4US9 A;  2E3T A;  4XE0 A;  4YTN B;  4MT5 A;  3PRZ A;  2C5L C;  3AE8 B;  1WF9 A;  3ZYY X;  3HVD A;  2HJ1 A;  2L76 A;  1SXT A;  3UIO B;  4HJK A;  2K8B A;  3P1M A;  1E7U A;  2HDE A;  3K9O B;  3HVZ A;  3DBS A;  2DZM A;  2KQS A;  4M0W A;  1WJ6 A;  1C1Y B;  4A9A A;  1D3Z A;  2PLP A;  4WWN A;  2MHJ A;  2D3G A;  4BKS A;  1I4H A;  2MJD A;  4HXD A;  2W82 A;  4YWG G;  1UGJ A;  3V62 A;  1V80 A;  3ZDT A;  1ESF A;  2KC1 A;  4W9J A;  1WE6 A;  2CJN A;  1SF0 A;  1VZ7 A;  1IBX A;  5G5H A;  5BYQ A;  5AZH A;  1BUI C;  1HTQ A;  4US8 A;  4OZC A;  4OZA A;  1I35 A;  4HJG E;  3Q3J A;  3RPF C;  1WGG A;  1JW9 D;  1E8Z A;  3I57 A;  1WGY A;  3BYY B;  1EWC A;  3DQV A;  3ZGZ A;  3AEB B;  3RFZ B;  5L95 C;  5J18 A;  3NVZ A;  4YSZ B;  1P7F A;  4MSM B;  1I4G A;  1L4Z B;  1HE8 A;  3N1X C;  1JCK B;  3ZNG C;  2JWZ A;  3KYD D;  3A4R A;  4II3 B;  2MW5 A;  2DEN B;  2IGD A;  3AUL A;  3FAH A;  3QQ8 B;  3L10 B;  1HXY D;  3BVG A;  4HPL B;  1UNS A;  3AH7 A;  3V61 A;  2MQJ A;  2DAJ A;  4GSW A;  4IUM B;  2IO2 B;  4HEA 1;  3RNF C;  3P4S B;  3DWM A;  2L52 A;  1N5W A;  5CTR C;  3SFE B;  1YJJ A;  2GBM A;  3ENE A;  4A6Q A;  3H1U A;  2D3B A;  3EEC A;  2J0K A;  4IM3 A;  3VH4 B;  2KD0 A;  3NVY A;  1ISN A;  3AE9 B;  2HTH A;  2KK8 A;  2N1W A;  1IPG A;  3PLU A;  1GOZ A;  1C79 A;  1Q10 A;  3ZW3 A;  2M8S A;  2ZNV C;  2BYE A;  4MGK E;  1D6E C;  3ECI A;  2X38 A;  4ASW C;  1L6U A;  2KNB A;  2CJO A;  2DZJ A;  4E74 A;  3Q8B A;  1HQR D;  5H8Y E;  1YD8 U;  1AWD A;  3ML8 A;  1F2R I;  4K81 A;  1YN5 A;  3Q8C A;  4FJZ A;  4PS3 A;  3BY4 B;  2KMA A;  2ZNV B;  1JWB D;  3PHW B;  1E10 A;  4LJO B;  3L4P A;  2TSS A;  2LVO A;  2K6Q A;  4OW0 A;  1WY8 A;  3QA8 A;  5BMG A;  1SB3 C;  3MHS D;  3U4E G;  5D2M B;  3HIZ A;  1XLO A;  1JWA D;  3ZQ4 A;  3AEF B;  2ACZ B;  2OJW A;  4WQM A;  1T0S C;  2OOB B;  1LGR A;  2MBH A;  1WZ0 A;  3RNB C;  1UF0 A;  2LJ5 A;  4BFR A;  4W9H A;  4WJO A;  3A9K B;  3VQI A;  1E9M A;  4YTP B;  2K25 A;  3ZLZ A;  3P2B A;  2MP2 B;  2BYV E;  3L17 A;  2I1K A;  1ENF A;  1V81 A;  5KHQ A;  2INN E;  1GPX A;  4KGT A;  2M56 B;  3AE1 B;  2K8C A;  1GNU A;  4IWP A;  4RGM A;  2H89 B;  4M01 A;  2NTS A;  2VZK B;  2GBN A;  3ZRF A;  2BW2 A;  3JSV A;  1F2R C;  1XEE A;  3MJ5 A;  1NI2 A;  3AE6 B;  1XLP A;  3R66 C;  4FXC A;  3Q14 C;  4N58 A;  2KKC A;  1WXM A;  4GN1 A;  2Z8L A;  3LDZ E;  5DPT A;  3I63 C;  2I2Y A;  2LAS A;  2PJH A;  4AQ7 A;  1D5X C;  2FCQ A;  3NVW A;  2MH7 A;  4DDI D;  2JZZ A;  4OVV A;  3QJZ A;  3A33 B;  2KOX A;  5DCN A;  1YOV B;  1EUV B;  4OZB A;  2NPT B;  4LNO A;  2G45 B;  4ITK A;  4HPP A;  4EZK A;  3OAW A;  1ROE A;  2D10 A;  3V3X A;  4KV2 A;  3R7Q A;  1D4B A;  2CU1 A;  4GU2 A;  5MPO A;  4IOI E;  1PGA A;  1MG8 A;  2K8H A;  5E6J A;  4ICU A;  2CS4 A;  2JUO A;  2KDE B;  3P4P B;  2J0M A;  4MGI E;  4B95 A;  2WXQ A;  1FIQ A;  3A4S C;  4MDK E;  4BOZ B;  3ZUN A;  2LGY A;  2RDB C;  2KAN A;  1WH3 A;  4EZJ A;  3ZXV A;  4KZC A;  1A5R A;  3U30 A;  4DBG A;  2LEK A;  2WXR A;  2WU5 B;  1YJI A;  1N63 A;  4HVB A;  3LJ3 A;  2V4L A;  4BBN F;  4J3O D;  4FN2 A;  1SGH A;  3A9J A;  1L0X B;  2WQY B;  1H8C A;  4HCP B;  3MTN B;  2IZV B;  4IC7 B;  1WM2 A;  3VRB B;  2NR2 A;  2EEL A;  2G1E A;  2AQ1 B;  4CQN A;  2BS2 B;  1CMX B;  1GB4 A;  3V6C B;  2KQ4 X;  3UIN B;  1TS2 A;  4M02 A;  3PTF C;  3FIL B;  1C4P A;  2IY0 B;  1E8Y A;  2O6V A;  3AED B;  4A20 A;  3VXW A;  4C56 C;  4WJP A;  1OEY J;  2KAC A;  3S2A A;  2GMI C;  4ZRI A;  1WX7 A;  1V5O A;  1XXG A;  2BTE A;  1R4N I;  1XCQ L;  2ZPY A;  3CST A;  2D3A A;  1UZX B;  1UBQ A;  3ZNZ B;  4G50 A;  3T3N A;  4S0R A;  4MJS A;  4KX6 B;  4ZRJ A;  2ZCC A;  3A1Q A;  3FC4 A;  3AB5 A;  2QIE B;  1EF5 A;  2Q5W D;  5CHV C;  3R2I A;  4DHJ D;  3U7Z A;  3MC0 B;  3RN9 C;  2WXG A;  3W1S A;  1JML A;  2L7R A;  4UDU C;  1JWU D;  3B08 A;  2VRR B;  3KW5 B;  1YQ3 B;  1OEY A;  2ASQ A;  4NQK E;  5LLI A;  3E9S A;  4N6E B;  2FNJ B;  1QOA A;  3U8Z A;  1YN4 A;  4K3C A;  4ZHO A;  3VUY A;  2KMM A;  3MJW A;  5AZF A;  3OJ3 A;  2A5U A;  2BT6 A;  3AE4 B;  1WZ3 A;  4C7Y A;  5EE9 A;  2BS3 B;  1BT0 A;  2K5P A;  3B1L X;  2KVZ A;  4HDQ A;  2GI9 A;  2JVC A;  5AUK A;  2O2V A;  4IKG A;  1PQS A;  2DAF A;  1NEN B;  3PT2 B;  1CJE A;  4B0E A;  1XLN A;  4TV3 A;  4BBN C;  1SJE D;  2IO1 B;  2WXN A;  4HRS A;  2YLM A;  3UQA A;  2ZZP B;  3C8Y A;  1RAX A;  4FHK A;  3GP7 A;  1ZOY B;  1V8C A;  4LTU A;  2LVP A;  2KYW A;  5DPR A;  2KDB A;  3NS8 A;  2N9E B;  2IJ0 A;  3W1Y A;  3UQB A;  1V97 A;  1F0Z A;  3VTV A;  2KVR A;  2KAJ A;  3Q3N C;  1I4Q A;  3WAN A;  1WFY A;  1UWM A;  4TKN A;  4XDD A;  1V1P B;  4ZYS A;  4A3O A;  1UGM A;  3SEB A;  3JVZ X;  3A9J B;  2LGD A;  5GXG B;  2V4I B;  1S3S G;  2N7J A;  1K52 A;  1R4M I;  2BYF A;  1V6E A;  1FD6 A;  1WM3 A;  4JIO U;  4H2A A;  1NI3 A;  2AYO B;  2DLB A;  4L23 A;  1TY2 A;  4ICV A;  2JWU A;  3RI7 C;  4XDC A;  3QAR A;  3VHT C;  3K9P B;  1HTO A;  1Z2M A;  4MM3 B;  1E8X A;  4W9L A;  2W54 A;  4P1C C;  4CHK A;  3HK0 A;  4JE3 B;  1WRD B;  3AU5 A;  4IDI A;  1T6B X;  4ANU A;  3N32 A;  3PRP B;  4IW0 A;  2ONQ A;  1JRO A;  5D6J B;  2L05 A;  4RF1 A;  2JYE A;  1FXT B;  3M3J A;  1V86 A;  2XEW A;  2JT4 B;  1QT9 A;  2M17 A;  4WJN A;  4XWW A;  3CF6 E;  3RNG C;  1K53 A;  2KLC A;  4MJS B;  2D11 A;  1JAL A;  4AP4 C;  2LGX A;  3RT3 B;  5G2N A;  2WXH A;  2RPQ A;  1YX6 B;  2LHD A;  1C76 A;  3AE3 B;  2A4Z A;  1XLQ A;  4OHJ A;  3ETR A;  5FK9 C;  3NUH B;  2WDQ B;  3JW0 X;  3TBL D;  4NAW B;  1LO5 D;  1RYJ A;  3V60 A;  3W9C B;  1I4R A;  4W9G A;  1OGW A;  4MH0 E;  4REZ A;  1JRP A;  1VD2 A;  4MGZ E;  2D2Q A;  2IYD B;  2UWQ A;  3WAM A;  2BF8 B;  4A90 A;  3I5J C;  4P1B C;  4HDO A;  3TL5 A;  1KM7 A;  4TSS A;  4K7W A;  1MFW A;  2KJ6 A;  2LFI A;  2L32 A;  1ZE3 D;  1WJ4 A;  2O6V D;  3KUC B;  2M19 A;  3IBE A;  4W9F A;  2CKH B;  2PVG C;  2WXI A;  2JX5 A;  3URY A;  1WYW B;  3H8H A;  2W3R A;  2OED A;  4L1B A;  2IGH A;  4RF0 A;  2N0S B;  3AEG B;  2G9H D;  4BKS D;  4ANV A;  1C4A A;  3RCZ A;  3VH3 B;  1V5T A;  1TY0 A;  1T0Q C;  1QKZ A;  3RNA C;  1PFD A;  4RCO A;  2FE8 A;  3T9L A;  1ZDX A;  4ZYN A;  2MCN B;  1C3T A;  2KJR A;  1SE3 A;  2ON8 A;  1IYF A;  2AQ2 B;  3MHZ A;  2I1J A;  1ZDV A;  2IY1 B;  1E0Z A;  5D3D A;  2I38 A;  1FNU A;  2N9X A;  4FJV B;  2ZVN A;  4GDL B;  2J0J A;  2BWF A;  2UU7 A;  1F52 A;  2C7N B;  4HRO A;  5C1Z A;  1FM0 D;  3TJP A;  2MBQ A;  3AE7 B;  4PS8 A;  4O1N A;  3BIN A;  5JHB A;  1ZKH A;  1K50 A;  1TYG B;  2JU6 X;  4EE2 A;  2KN4 A;  1EF1 A;  5BMI A;  1SJH D;  2BWE S;  3TMP B;  2KWV B;  2K6D B;  2KFK A;  1VZ8 A;  3KH0 A;  2LGS A;  3TCA A;  4EUT A;  1V49 A;  3AXC A;  1IGD A;  2GBR A;  1TZ1 A;  4W9K A;  4DDG D;  3PVL A;  3P4R B;  2IGG A;  1UWX A;  1TGZ B;  2LHE A;  3LXF A;  5EDS A;  1EWY C;  2Z59 B;  2YVC A;  1FEH A;  3DHG C;  4IM0 A;  2K0P A;  1N61 A;  3E56 A;  4F7Z A;  1TKY A;  1WWT A;  1TS5 A;  3OLM D;  4YT0 B;  4MEL A;  1KRH A;  4RGN A;  4F1S A;  4MEM A;  2K3U A;  1JRU A;  5J2R A;  3DBL I;  4BKG A;  3Q6B A;  2L0F A;  3DHH C;  2KT7 A;  2QHO A;  2DZK A;  2YEP F;  3M62 B;  3QK0 A;  2REX A;  4GDK B;  4NQL B;  1KF6 B;  5BYS A;  4DXG A;  3GE8 C;  2WXK A;  4DK5 A;  3FIL A;  2G4S A;  1VR9 A;  2FCN A;  1P9D U;  3JYU A;  2PEA A;  3NOB A;  4JWS C;  2WXO A;  4LNN A;  4KKI A;  4IM2 A;  1MI0 A;  1QOG A;  1XD3 B;  3RYT A;  4G0N B;  3X23 A;  4EKU A;  1VDV A;  2WX0 A;  2WXF A;  3W1S C;  4ZDV A;  2DYO A;  2IBI B;  4K7S A;  1B1Z A;  2AQ3 B;  2VH2 A;  2R2O A;  1G6J A;  3ZNI D;  5IP4 D;  4AWJ A;  4RH6 A;  3SDL C;  3EUB 2;  2JXT A;  2NBW B;  2BBC A;  3BK2 A;  5I4D A;  4OVU A;  3C19 A;  1KFY B;  2NTT A;  3RZF A; 
#chains in the Genus database with same CATH homology
 3H7S A;  1UD7 A;  1J0G A;  2ZPY A;  3PZD A;  4W9I A;  3CST A;  3QC8 B;  4EFO A;  2KFK B;  1UZX B;  3TIX A;  2N7E A;  1UBQ A;  3ZNZ B;  4G50 A;  3A1Q B;  4FAD A;  3HM6 X;  4DHZ E;  3WAO A;  4MJS A;  3ZKJ C;  4EZL A;  2BGF A;  4ZRJ A;  2KN5 A;  2KXJ A;  2ZCC A;  3A1Q A;  1OQY A;  1EF5 A;  2KMC A;  1QZE A;  3RZW C;  2FID A;  5CHV C;  5CX3 A;  2FIF A;  4DXA B;  2IO3 B;  4DHJ D;  2KLG A;  5D7G A;  2AWT A;  3N30 A;  5TR5 A;  3W1S A;  2L7R A;  1Z5S B;  3QCA A;  3B08 A;  2VRR B;  3KW5 B;  4NNJ B;  4ANX A;  2XK5 A;  2RD0 A;  1OEY A;  2ASQ A;  2LVQ A;  4NQK E;  3ZIM A;  3PLV A;  5LLI A;  2MRP A;  3PHX B;  4KDL B;  4G11 A;  1LM8 B;  4CO7 A;  2MP2 A;  2CR5 A;  1AAR A;  2ZJD A;  2FNJ B;  4MSQ B;  3IG3 A;  3U8Z A;  2LI5 A;  4WWP A;  3KUZ A;  5CHF A;  2AL6 A;  3ZTC A;  2NS5 A;  1WI0 A;  1KOT A;  4DWF A;  2GOW A;  3VUY A;  3MJW A;  5AZF A;  4DHJ B;  2MA9 B;  4GB9 A;  3OJ3 A;  2KFJ A;  4JLC A;  2A5U A;  5E6O A;  4MGY E;  4NPN A;  3DVG Y;  4W9D A;  3H7P A;  1WZ3 A;  2KTR B;  4I6N B;  1XT9 B;  5AEK B;  2L00 B;  1BT0 A;  2CHW A;  5FR6 A;  2L0T A;  3B1L X;  3VVW B;  3QWZ B;  5BO4 B;  3UGB B;  4HDQ A;  2JVC A;  3DVN U;  4XZ4 A;  5E6P A;  2O2V A;  1EO6 A;  1P0R A;  3VUX A;  5IA7 A;  2GBK A;  1WXS A;  1PQS A;  2DAF A;  1P3Q U;  3L13 A;  3PT2 B;  5LXI B;  5HKH A;  4FHJ A;  4BBN C;  1WR6 E;  4NJ6 A;  4TV3 A;  3PSE B;  3PS6 A;  4MM3 A;  2IO1 B;  4JQW C;  3IFW B;  3DBH I;  3UF8 A;  2YLM A;  3UQA A;  4GDL A;  2ZZP B;  2RGF A;  1NDD A;  4KSL C;  2KDI A;  4P7I A;  2JY6 A;  1RAX A;  4FHK A;  4YL8 A;  3GOE A;  1F9J A;  1LFD A;  3VTW A;  4B6W A;  2R2Q A;  4CYE A;  2BKR B;  2LVP A;  1UH6 A;  2JPH A;  5DPR A;  2LWP A;  1ZW7 A;  2KDB A;  2JXX A;  2ZCB A;  2EKE C;  3NS8 A;  2N9E B;  1GG3 A;  3W1Y A;  3OJ4 B;  4NY0 A;  3UQB A;  1YQB A;  3APD A;  3D32 A;  3PRZ A;  1WJU A;  2C5L C;  3VTV A;  1WF9 A;  2KVR A;  5JHA A;  3WAN A;  1WFY A;  1YX5 B;  2LRW A;  2K39 A;  2L76 A;  4TKN A;  2DX5 B;  3UIO B;  4X57 B;  4A3O A;  3A9K A;  4HJK A;  2K8B A;  4RM8 A;  1E7U A;  3K9O B;  1UGM A;  3C0R B;  3X0W A;  3DBS A;  2DZM A;  2KQS A;  3JVZ X;  3M95 A;  3NZU A;  3A9J B;  2LZ6 A;  1WJ6 A;  2LGD A;  2M0X A;  1C1Y B;  1D3Z A;  2G3Q B;  1S3S G;  2N7D A;  3PV1 A;  4WWN A;  3WAP A;  1KJT A;  3Q3F A;  1R4M I;  1TBE A;  2BYF A;  2JZ3 B;  4ZRK A;  3SHQ A;  2D3G A;  4BKS A;  2N4F A;  4IG7 B;  1V6E A;  2KO3 A;  1WM3 A;  3DPD A;  4HXD A;  3KUD B;  3ALB A;  5AZG A;  4JIO U;  1WGD A;  1GC7 A;  4GIV A;  3ZRC A;  1X1M A;  3V62 A;  2AYO B;  1V80 A;  3ZDT A;  2KWU B;  2KC1 A;  3B0A A;  1RFA A;  4W9J A;  1L2N A;  4ICV A;  1WE6 A;  3QAR A;  4HWI B;  2HJ8 A;  3VHT C;  3K9P B;  2NBV B;  5AZH A;  1V2Y A;  1Z2M A;  1E5W A;  4J6I A;  1WMH A;  1UBI A;  2KWC A;  1E8X A;  1I35 A;  4W9L A;  3Q3J A;  2GBJ A;  1WGG A;  2W9N A;  1E8Z A;  2DYB A;  4RMA A;  3JSV B;  1WGY A;  3M63 B;  4GMV A;  3ZDM C;  3HK0 A;  4CHK A;  3EFU A;  1WRD B;  3AU5 A;  2MSE D;  4FBJ B;  4ANU A;  3N32 A;  3CMM B;  3PRP B;  3DQV A;  3VAW A;  5L95 C;  1NBF C;  5J18 A;  4IW0 A;  3SU8 X;  2WX1 A;  4MSM B;  5D6J B;  2L05 A;  3HHM A;  1HE8 A;  1LQB A;  1FXT B;  2FCS A;  2PE6 B;  3ZNG C;  3M3J A;  2JWZ A;  2KTF A;  3KYD D;  1V86 A;  2XEW A;  3A4R A;  2ZPN A;  3APC A;  4II3 B;  3RUL A;  2JT4 B;  2M17 A;  2MW5 A;  2DEN B;  1XQQ A;  3QQ8 B;  3AUL A;  2BKF A;  4WJN A;  1TTN A;  3CF6 E;  2WWZ A;  2LUE A;  4II2 B;  3PRE A;  3L10 B;  5DPS A;  1T0Y A;  4HLE A;  1GC6 A;  2KLC A;  4HPL B;  1WXV A;  4MJS B;  2D11 A;  2AEH A;  3V61 A;  4K1R B;  2Z0E B;  4AP4 C;  2LGX A;  2KX3 A;  2MQJ A;  2UYZ B;  3RT3 B;  2PPH A;  2B3A A;  4PS7 A;  4RM9 A;  2DAJ A;  5G2N A;  5JZE B;  4GSW A;  2RPQ A;  4IUM B;  2IO2 B;  5LXH A;  4TUU A;  3NZS A;  1YX6 B;  3EC8 A;  4IWQ A;  4W9C A;  3DOW A;  2DYM A;  2CHZ A;  2LXA A;  2A4Z A;  5G55 A;  3IVF A;  2Y5B B;  4WQO B;  5CTR C;  4K7U A;  2KX0 A;  2NVU I;  2O2V B;  4WJQ A;  5C23 A;  2GBM A;  3JW0 X;  2MWS B;  3ENE A;  3H1U A;  4GXB A;  3TBL D;  4NAW B;  2EMT A;  2N1V A;  3V60 A;  2MX2 A;  3EEC A;  2J0K A;  4LCD E;  1IP9 A;  2KTR A;  4IM3 A;  3VH4 B;  1GJZ A;  2HD5 B;  2KD0 A;  4W9G A;  1ISN A;  2HTH A;  1OGW A;  4MH0 E;  3VDZ A;  2KK8 A;  2ZEQ A;  1VD2 A;  3APF A;  2N1W A;  1IPG A;  4MGZ E;  2D2Q A;  2L3Z A;  2IYD B;  3PLU A;  2UWQ A;  3WAM A;  1WX8 A;  1WR1 A;  2BF8 B;  2D07 B;  2HE7 A;  2KZR A;  2KQ7 A;  2EMS A;  2M8S A;  2BYE A;  1S1Q B;  2ZNV C;  3ZW3 A;  4HDO A;  4MGK E;  3TL5 A;  1KM7 A;  3ECI A;  4JGH B;  4XX5 A;  4M8N A;  4K7W A;  1SE9 A;  2KJ6 A;  3I3T B;  2RR9 A;  1WJ4 A;  2O6V D;  4ASW C;  3KUC B;  2KNB A;  3IBE A;  2DZJ A;  4W9F A;  1GUA B;  4E74 A;  4BKT A;  1YD8 U;  5J17 A;  3NHE B;  3ML8 A;  2WDT B;  2CKH B;  1Q5W B;  4K81 A;  1J8C A;  4FJZ A;  2FCM A;  4BOS C;  4PS3 A;  3BY4 B;  4KDI C;  2KMA A;  2ZNV B;  3ZNH B;  3PHW B;  3U7D A;  1WYW B;  2BPS A;  4LJO B;  2LVO A;  2K6Q A;  2V3S A;  1WY8 A;  1WE7 A;  3AU4 A;  3QA8 A;  4LJP B;  2MBO A;  3MHS D;  4E3C A;  2KJH B;  5D2M B;  5D94 A;  3HIZ A;  4I6L B;  4BKS D;  4ANV A;  4W9E A;  3DCG A;  3RCZ A;  1L7Y A;  3VH3 B;  1V5T A;  2N9P C;  2OOB B;  2MBH A;  2C7H A;  1WZ0 A;  3T9L A;  2KDF B;  4LDT D;  4ZYN A;  2LJ5 A;  3DBR I;  2MCN B;  4BFR A;  2LD9 A;  1C3T A;  3RUI B;  2KJR A;  1WGR A;  3UIP B;  4W9H A;  1IYF A;  1OTR B;  4F8C B;  4WJO A;  2I1J A;  1I42 A;  3A9K B;  1E8W A;  2C60 A;  4IWO A;  3VQI A;  2LRU A;  2K25 A;  3ZLZ A;  2IY1 B;  3P2B A;  2MP2 B;  2BYV E;  4FJV B;  2N9X A;  3L17 A;  2I1K A;  1WJN A;  2J0J A;  1V81 A;  2ZVN A;  2BWF A;  4GDL B;  5KHQ A;  2C7N B;  2K8C A;  5C1Z A;  1GNU A;  4IWP A;  3TJP A;  2J7Q B;  2MBQ A;  4PS8 A;  4PYU A;  2GBN A;  2XK5 B;  1VCB A;  3ZRF A;  3BIN A;  2NCN A;  2RSU A;  1WGH A;  3JSV A;  4KSK C;  5JHB A;  1SIF A;  1NI2 A;  1ZKH A;  3ZO5 B;  3R66 C;  4G3X B;  1Y8R C;  4I6P A;  1EF1 A;  1J19 A;  2KKC A;  4ANW A;  1E7V A;  1WXM A;  4GN1 A;  4JL9 A;  1YIW A;  2BWE S;  2ZVO A;  3LDZ E;  5DPT A;  3TMP B;  3T8M A;  2KWV B;  4AJY B;  2K6D B;  2KFK A;  3VUW A;  2XBB C;  3H7P B;  3PRM B;  2LAS A;  2MBB B;  2PJH A;  3KH0 A;  4BVU C;  3TCA A;  2FCQ A;  2WYQ A;  4EUT A;  2AL3 A;  1V49 A;  4WAA A;  4KZ0 A;  4XC2 A;  1WIA A;  3AXC A;  4KIK B;  4DDI D;  4DHZ B;  2JZZ A;  1WX9 A;  1E90 A;  2GBR A;  4OVV A;  3QJZ A;  3A33 B;  2KOX A;  1KLV A;  1TZ1 A;  2NBU A;  5DCN A;  3SD5 A;  4W9K A;  4DDG D;  3PVL A;  2C9W B;  2DZI A;  1EUV B;  1M94 A;  1TGZ B;  2NPT B;  2LXC A;  4EEW A;  2G45 B;  1Q1O A;  5EDS A;  1RRB A;  3PPA A;  3O65 B;  2KHW B;  1ZGU B;  4EZK A;  5L83 A;  3OAW A;  5CHW A;  2Z59 B;  4FA6 A;  3ZTD A;  2YVC A;  2D10 A;  2KC2 A;  1YJ1 A;  4IM0 A;  2OJR A;  4KV2 A;  3QX1 A;  3R7Q A;  4HCN B;  2CU1 A;  4GU2 A;  3IHP C;  4F7Z A;  3DDC B;  4FJY A;  5JH5 C;  3OLM D;  1WMH B;  2MBE A;  3QAQ A;  1MG8 A;  2K8H A;  2FUH B;  4ICU A;  4NAW A;  2JF5 A;  4AUQ C;  2CS4 A;  1V9J A;  3QIJ A;  1Q0W B;  4HK2 A;  4MEL A;  2NPT A;  2JUO A;  3GZN I;  3VTU A;  2KDE B;  2J0M A;  4MGI E;  4F1S A;  4MEM A;  4B95 A;  1JRU A;  1P1A A;  5J2R A;  3DBL I;  3DVN V;  3A4S C;  4MDK E;  4BOZ B;  1K8R B;  2LGY A;  3ZUN A;  4BKG A;  2JRI B;  3NY5 A;  1RLF A;  2L0F A;  2KAN A;  1WH3 A;  4KIK A;  4EZJ A;  1U4A A;  4WWO A;  4EOY A;  3DVG X;  2QHO A;  2JRH A;  2DZK A;  3L08 A;  4KZC A;  1A5R A;  3L16 A;  3RD2 A;  3U30 A;  3VFK A;  4DBG A;  5DPW A;  3H9D A;  3M62 B;  3QK0 A;  4HVB A;  2REX A;  3LJ3 A;  2V4L A;  4GDK B;  1UEL A;  4GDK A;  2O6V B;  4NQL B;  2C7M B;  4BBN F;  2IO0 B;  3R7R A;  3EHV A;  4FN2 A;  1SGH A;  4DK5 A;  5E6N A;  3A9J A;  3V6E B;  2G4S A;  4FLH A;  3R3M A;  3CSF A;  2FCN A;  1P9D U;  3JYU A;  2PEA A;  3NOB A;  3N3K B;  1H8C A;  4HCP B;  3ZVV A;  2PE9 A;  3MTN B;  2Z0D B;  3QHT A;  4IM2 A;  1XD3 B;  2IZV B;  2V1Y A;  2FAZ A;  3HM3 A;  4IC7 B;  3RYT A;  1WM2 A;  3PGE A;  5IAA C;  3KYC D;  4G0N B;  2NR2 A;  2K1F A;  1WXA A;  3X23 A;  4KVG B;  4EKU A;  1LXD A;  4HPM B;  2WX0 A;  1CMX B;  4AJW A;  1H4R A;  4GOC A;  2G4D B;  2DHZ A;  4TQ0 A;  3KVF B;  4LDT B;  3W1S C;  4ZDV A;  4M0W B;  2DYO A;  4PYZ A;  2IBI B;  4K7S A;  3V6C B;  3WA0 A;  5GMV A;  1G6J A;  2R2O A;  4GGQ A;  4M8M A;  3UIN B;  3PTF C;  3ZNI D;  4B9K A;  4A3P A;  2CHX A;  3L54 A;  4AWJ A;  2IY0 B;  3ONS A;  5KHO A;  3ML9 A;  1E8Y A;  3SDL C;  2O6V A;  2MLB A;  4A20 A;  3L0W B;  3VXW A;  2NBW B;  4TQ1 A;  4FUL A;  4NJ7 A;  4WJP A;  1P98 A;  3WIM A;  1OEY J;  3S2A A;  2L8J A;  2GMI C;  3AI5 A;  4ZRI A;  1WX7 A;  4OVU A;  4AOF A;  4URK A;  1V5O A;  4E71 A;  2M4N A;  2M1M A;  3WAL A;  3H6N A;  4N9F 4;  1R4N I;  3RZF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...