1WXMA

Solution structure of the n-terminal ras-binding domain (rbd) in human a-raf kinase
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
86
structure length
86
Chain Sequence
b'GSSGSSGGTVKVYLPNKQRTVVTVRDGMSVYDSLDKALKVRGLNQDCCVVYRLIKGRKTVTAWDTAIAPLDGEELIVEVLSGPSSG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords A-Raf proto-oncogene serine/threonine-protein kinase
publication title Solution Structure of the N-terminal Ras-binding Domain (RBD) in Human a-Raf Kinase
rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 7
structure length 86
sequence length 86
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2005-01-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02196 RBD Raf-like Ras-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 1wxmA01
1WR1A 2AEHA 4I6PA 4ANVA 3NY5A 1J19A 1OEYJ 1WJNA 2JZ3B 5JHAA 2KQ7A 4NAWB 3IG3A 4IC7B 1P9DU 3PRMB 3RYTA 1C3TA 2K39A 2K8HA 4MGKE 2MBHA 3PVLA 3SU8X 4AOFA 4JL9A 3L0WB 3PHXB 2KJ6A 3VUXA 3V6EB 4MEMA 2MLBA 2ZCBA 1YIWA 3PGEA 2KD0A 2LVOA 3L17A 2D3GA 2L05A 2IO1B 2O6VB 4GMVA 4GN1A 1QZEA 4GDKB 1JRUA 1WRDB 3AULA 2KWVB 4W9GA 2DZMA 4HDOA 2D11A 4IM3A 2O6VD 1WJ6A 3RCZA 2BKFA 2KC2A 4BKGA 2YLMA 3CSFA 3QA8A 2L3ZA 2MBBB 3U30A 2GBKA 4HXDA 2KFKA 1RRBA 2KFJA 4EOYA 3QWZB 2MW5A 4WJQA 2LXAA 1UGMA 2DAJA 4DDGD 2I1KA 1KOTA 4W9KA 3UIOB 2B3AA 1K8RB 2D10A 2K6QA 3NHEB 5C23A 2WWZA 3DVNU 4K7UA 3T8MA 3VTVA 4A20A 2KWCA 2LUEA 3TIXA 1H8CA 3QJZA 1A5RA 1ZGUB 3WAOA 2WX0A 4DXAB 2C60A 2ZNVC 3NZSA 3A9JB 3SHQA 2PJHA 3HIZA 1S1QB 3QX1A 4NPNA 1WXAA 2CHZA 1GC7A 2KJRA 3DPDA 3KUZA 1LM8B 2VRRB 2MA9B 2FUHB 4JLCA 5CX3A 4KSLC 4TV3A 4KIKA 1AARA 2J0KA 3HM6X 3ZNZB 2V1YA 4GU2A 3UF8A 2MCNB 2LD9A 2AL3A 4HJKA 2G3QB 3SD5A 1T0YA 2R2OA 2ZZPB 1H4RA 4EEWA 3GOEA 2KVRA 5DPWA 3V61A 1M94A 3C0RB 2KK8A 2KMAA 3UIPB 2JRHA 3VDZA 1F9JA 3O65B 1D3ZA 5D94A 3VHTC 2IZVB 5IA7A 1OTRB 1ISNA 2NBWB 1YX5B 3LDZE 4GDLA 4AJYB 3ZTCA 4KDIC 1TGZB 1IYFA 1Q1OA 3NZUA 4K1RB 3PS6A 4IW0A 4XZ4A 1UBIA 4KV2A 3MHSD 4DK5A 2ZJDA 4B95A 2WDTB 1UELA 3N3KB 4ZRKA 2V4LA 2JVCA 4GGQA 4MSQB 2KDFB 3P2BA 3Q3JA 5AZHA 2ZCCA 4W9DA 3ZDTA 3GZNI 1V5TA 3ALBA 3TCAA 4FULA 2L00B 4AWJA 4A3OA 3NOBA 4BBNC 1E8YA 2M17A 3L10B 4GSWA 1SIFA 2C7NB 4ZRIA 3Q3FA 2KTRA 4LDTB 4F7ZA 4MJSA 3VH3B 2KQSA 2J7QB 3OAWA 2BWES 1WGHA 2HE7A 3APFA 2RD0A 3L08A 4LDTD 4NAWA 4TUUA 2KO3A 3KW5B 4RM8A 2CHWA 3RZFA 3H9DA 4DHJB 3MJWA 2FIFA 1WM3A 4KSKC 4GOCA 5L83A 4OVVA 3WANA 3H6NA 2A4ZA 2N7DA 2NBVB 2DYOA 2Z59B 2WYQA 1OQYA 2O6VA 4DHJD 5FR6A 3KYDD 4ASWC 2LASA 5BO4B 4DDID 2L7RA 5G2NA 2A5UA 1WX9A 3M3JA 1WM2A 2AL6A 4DWFA 4ICVA 2NVUI 2IO3B 3EECA 4KDLB 3A33B 4DHZB 2DZIA 2FCNA 3OJ3A 3DVGY 3L16A 5DPRA 4ANXA 2DYBA 3H7PA 3VTWA 2DX5B 2JWZA 3KVFB 4X57B 3PSEB 3VFKA 1WMHB 1V80A 4ANWA 2KLGA 2KTFA 1UH6A 4IWPA 4B6WA 1G6JA 2KWUB 4GXBA 5CTRC 4G11A 4FBJB 3ZNGC 2BKRB 1WJ4A 3W1SC 3ZO5B 3DVNV 2FAZA 3AU4A 4WWOA 2BWFA 4JQWC 2N1VA 2GBRA 1TBEA 3A9JA 3IVFA 4WJNA 2BYVE 4LJOB 4AUQC 4I6LB 1WJUA 3ENEA 2MP2B 3VVWB 3U7DA 4F8CB 4RMAA 5AEKB 2EKEC 3W1YA 2ZPYA 1E7VA 3VAWA 2REXA 2R2QA 2XK5B 1E90A 2BYEA 4P7IA 1HE8A 5JZEB 2ASQA 2FCQA 5AZGA 3VQIA 5AZFA 4URKA 1EUVB 1GG3A 1P0RA 4K7WA 4NNJB 4N9F4 3N30A 4TQ0A 2G4DB 3U8ZA 5C1ZA 1UZXB 4NQKE 1I35A 1KM7A 3VUWA 5E6NA 1EF1A 3W1SA 2L0TA 2PE9A 5DPTA 4HVBA 2GBMA 3OJ4B 2GMIC 1P98A 3L13A 4KZCA 3VH4B 3WIMA 1KJTA 1P1AA 3AI5A 4TKNA 1IPGA 2G4SA 4ANUA 1NBFC 4W9JA 2DAFA 1C1YB 5KHQA 3PLUA 4BKTA 3HHMA 5LLIA 3WALA 3A4SC 5J2RA 3RUIB 2MBQA 2LI5A 1NI2A 1V81A 1UD7A 4NJ6A 4FHKA 2NPTB 3AXCA 2AWTA 2EMSA 2YVCA 4DBGA 2LRUA 3CF6E 4EZJA 3QK0A 3B1LX 1WE6A 2PEAA 1WXSA 2MQJA 2QHOA 5EDSA 3IBEA 3RZWC 4G0NB 4E74A 4MH0E 3DBHI 3PT2B 5E6OA 3A1QB 2N4FA 2M0XA 3HM3A 4M0WB 2KFKB 2W9NA 1V86A 4E71A 4IM2A 2CHXA 2HJ8A 2JUOA 1WX7A 2DZKA 4NY0A 4W9FA 1I42A 5LXIB 2ZEQA 4FJZA 1NDDA 2RSUA 3EFUA 1WX8A 5GMVA 3JSVB 3ZRFA 3PV1A 2JRIB 1S3SG 4GB9A 3ZKJC 3CSTA 3QCAA 2IY0B 2K8CA 2N7EA 3DOWA 4EKUA 4ZDVA 4HCPB 1ZKHA 2Y5BB 3UINB 3V60A 1J8CA 2BF8B 5E6PA 3H7SA 1WXVA 4WJOA 3IFWB 1GC6A 2HTHA 2O2VB 2PPHA 3I3TB 2LGXA 4A3PA 3NS8A 4MDKE 3VTUA 2DHZA 2MX2A 3M63B 3UGBB 4BKSA 5CHVC 5DCNA 3ML9A 1VCBA 3ZLZA 1IP9A 3A9KA 4PYUA 2RPQA 5G55A 4WQOB 2D07B 1RLFA 3UQAA 4EFOA 1E8XA 1OGWA 2D2QA 1YQBA 2KOXA 4WAAA 1GJZA 2KN5A 2FIDA 4HPLB 3V62A 4BVUC 2IO0B 1WI0A 2MBOA 2LGDA 3DQVA 2CKHB 1Q0WB 2K6DB 3DBSA 4MGYE 1WGYA 2KDEB 3LJ3A 3X23A 3OLMD 3ZDMC 4WJPA 3APCA 2Z0EB 4FHJA 1YD8U 1WGGA 5TR5A 4AP4C 3R3MA 1WMHA 2KZRA 2LVQA 4J6IA 3RULA 3R7RA 1WZ3A 1Z2MA 4GDKA 2IY1B 3QHTA 2RR9A 4M8NA 4YL8A 3H1UA 3ZRCA 4CHKA 3X0WA 3WAPA 3KH0A 4W9CA 4ZRJA 3IHPC 2JZZA 4MGZE 1RFAA 3JW0X 2PE6B 4W9EA 4ZYNA 3RT3B 4MM3A 2HD5B 4CYEA 4TQ1A 1BT0A 2LZ6A 4FADA 3ZVVA 1V6EA 4KVGB 2WX1A 2L76A 3APDA 3PHWB 1KLVA 1WYWB 2MSED 2KKCA 3K9OB 2KTRB 2M8SA 3KYCD 1Z5SB 2DYMA 3PPAA 4EZLA 1PQSA 2NBUA 2ZPNA 1R4NI 3ONSA 1ZW7A 2N1WA 2XBBC 4W9LA 3AU5A 4HCNB 4F1SA 2FCSA 2OJRA 1V2YA 4NQLB 3PREA 3R66C 3PTFC 2CU1A 5CHFA 4HK2A 4AJWA 2V3SA 3B08A 4ICUA 4KZ0A 2KDIA 3JVZX 3ZNID 1CMXB 4XC2A 2K1FA 4II3B 4GIVA 3WAMA 2IYDB 1SGHA 4FN2A 3TBLD 1R4MI 3R7QA 2NPTA 4LJPB 4PS3A 2XEWA 3S2AA 4CO7A 5J17A 4K81A 4FJYA 2LWPA 4B9KA 3VUYA 1MG8A 2RGFA 4HWIB 2MWSB 3K9PB 1TZ1A 1WGRA 4WWNA 3A1QA 2KLCA 1J0GA 3DVGX 1VD2A 3H7PB 3V6CB 2CR5A 1LFDA 5HKHA 1WGDA 3B0AA 4E3CA 2DENB 2CS4A 2MBEA 2KJHB 3QAQA 4K7SA 1L2NA 4IG7B 1Q5WB 5D2MB 1EO6A 4MELA 3QC8B 3ZW3A 1SE9A 1WR6E 2NR2A 3JSVA 4EUTA 1Y8RC 2NCNA 2KMCA 2EMTA 4MGIE 1YX6B 2LGYA 4HDQA 3PZDA 1EF5A 2GBJA 2AYOB 4G3XB 5J18A 4EZKA 4RM9A 1WXMA 3KUCB 3QARA 2JXXA 2O2VA 3PLVA 3ML8A 4JGHB 3HK0A 1WH3A 5D6JB 3KUDB 3M95A 3RD2A 3PRZA 4G50A 2KC1A 2M1MA 4WWPA 2ZVNA 4BOSC 5JH5C 3ZNHB 1V9JA 3DDCB 3UQBA 4OVUA 2C5LC 4FLHA 4HLEA 2I1JA 2K8BA 3TL5A 2N9PC 3D32A 3JYUA 1XQQA 5D7GA 2KANA 3MTNB 1FXTB 2FCMA 3EHVA 1V49A 4NJ7A 2C7HA 2GBNA 1U4AA 2JY6A 3BINA 3ZTDA 2KXJA 5JHBA 4KIKB 5DPSA 4HPMB 2KX3A 2N9EB 4FA6A 1X1MA 1WZ0A 2FNJB 1WIAA 2GOWA 2K25A 3TMPB 2UWQA 2JF5A 3QIJA 4IWOA 1E7UA 2KNBA 4PS7A 4II2B 2LXCA 3ECIA 3PRPB 3VXWA 1XT9B 2UYZB 2KDBA 1GNUA 1E5WA 3T9LA 1GUAB 5LXHA 2IBIB 4PS8A 3DBRI 2BYFA 3QQ8B 4W9HA 2KX0A 2ZNVB 2LVPA 2BGFA 3L54A 4BBNF 1WFYA 3A4RA 3WA0A 2J0MA 4JIOU 1L7YA 4XX5A 4IWQA 4W9IA 1UBQA 3ZIMA 4GDLB 1RAXA 2ZVOA 3BY4B 1OEYA 2IO2B 4IUMB 3EC8A 3DBLI 2M4NA 1WY8A 2L0FA 3SDLC 1XD3B 2LRWA 3M62B 4PYZA 4LCDE 1LXDA 1WF9A 1E8ZA 1WE7A 2JT4B 2NS5A 5KHOA 5L95C 2LJ5A 4BOZB 2C7MB 3ZUNA 1TTNA 2MRPA 3DCGA 2C9WB 2MP2A 3CMMB 4FJVB 2L8JA 2JPHA 2J0JA 5IAAC 4MSMB 1LQBA 2DZJA 4M8MA 5CHWA 1E8WA 3A9KB 2G45B 2OOBB 2XK5A 1P3QU 1V5OA 2Z0DB 1YJ1A 3TJPA 4BKSD 4I6NB 2BPSA 4MJSB 4DHZE 2N9XA 3N32A 4IM0A 2KHWB 4BFRA
chains in the Genus database with same CATH superfamily
4A90A 1RFKA 2M19A 4O1NA 1OEYJ 4NAWB 3PRMB 1FXIA 4AOFA 3SU8X 3AE1B 3L0WB 2KJ6A 4A55A 2MLBA 4GOCA 4A3PA 3FKYA 2LVOA 2L05A 2O6VB 4GMVA 4ZHOA 1JRUA 3AULA 2GRIA 1MHHE 1WJ6A 2EKIA 3VR8B 2BKFA 4BKGA 2YLMA 2IGHA 3ZGZA 4M0WA 2KFKA 2KFJA 4WJQA 4YTNB 1K8RB 2IJ0A 5C2TB 3T8MA 2WWZA 1XXGA 3VTVA 3TIXA 3WAOA 1N62A 3QX1A 3DBRB 2CHZA 1STEA 3KUZA 4JWSC 2MA9B 1Y56A 3AM9A 3DHHC 2V1YA 5D3IB 3UF8A 3AECB 3N1YC 2BB5A 2L52A 4ARIA 4HKQA 2ZZPB 1P7FA 4NJCA 4EEWA 5DPWA 1NENB 1D3ZA 5D94A 1YN3A 1OTRB 2BVCA 2EELA 3GE8C 4LNFA 1ISNA 2WXLA 2GI9A 2X38A 2I38A 3ZTCA 1F0ZA 1PGBA 1Q1OA 4K1RB 4JWUC 3NRZA 4RH6A 4YTMB 2WDTB 1E9MA 4ZRKA 1VR9A 2JVCA 4GGQA 3P2BA 4LNOA 1J7BA 2INDC 1BUIC 3GZNI 3TCAA 4FULA 2L00B 2BS3B 2WXMA 4AWJA 1UUPA 2PLPA 1F1HA 1E8YA 3L10B 1SIFA 4ZRIA 4LDTB 4MJSA 4YWGG 2BWES 1TKGA 4HKZE 2RD0A 4HRSA 2KO3A 3KW5B 3HRDD 1RM6C 4DHJB 3EUB2 4A6QA 2A4ZA 2Z59B 2WXFA 1VLBA 3ZXVA 1FNVA 2LASA 3P4SB 2RDGA 1MHXA 1WM2A 4WH4A 4P1CC 4ICVA 4USAA 4KDLB 1WYGA 3AEBB 2FCNA 3OJ3A 3DVGY 3L16A 5DPRA 1V1PB 3VFKA 1WMHB 1V80A 2KTFA 4IWPA 4B6WA 1TZOA 3ZQ4A 4G11A 2BW2A 3ZNGC 2KQ4X 2FAZA 3SEBA 4WWOA 4JQWC 2GBRA 3A9JA 4L1BA 2JYEA 2MP2B 1TT5B 3U7DA 3W1YA 3EGRA 2REXA 2R2QA 2XK5B 2BYEA 1M4VA 4P7IA 1NYRA 3I5JC 2FCQA 5AZGA 3IAS1 4URKA 4N58A 4TMAB 1GG3A 1P0RA 2G4DB 1UZXB 1I4GA 5LNK1 1I35A 5IOIA 1KM7A 3RMKC 2PE9A 3L13A 4KZCA 2ZW0A 1P1AA 2DAFA 1YN5A 5KHQA 4BKTA 1T5XD 1C78A 3HHMA 5LLIA 3WALA 1V81A 1F2RC 1WE6A 2PEAA 1WXSA 5EDSA 3PT2B 3HM3A 1IBXA 4E71A 4IM2A 1WXQA 2CHXA 4WURA 4KGSA 4ZRPA 2DZKA 3B2GA 4FJZA 4PT5A 5GMVA 3ZKJC 1YJIA 2IY0B 4EKUA 1C4CA 1N61A 4HCPB 3V60A 4MH8A 4WJOA 1IGCA 4YSZB 2HTHA 2PPHA 3I3TB 2PVGC 2LGXA 3NS8A 1ZXIA 4L2YA 2PKOA 1R7SA 2KOXA 1PUTA 4HPLB 2LHEA 1WI0A 2HJ1A 2CKHB 2JQRB 1GPXA 2KDEB 3X23A 1WWTA 3ZDMC 3U2SC 1N6ZA 4XDDA 2Z0EB 1C76A 1MFWA 2QJLA 3Q69A 1YD8U 4AP4C 4J6IA 1Z2MA 1R4MB 2RR9A 5BMGA 3ZRCA 1JWMD 2FUG1 3AE5B 3IHPC 4MGZE 3JW0X 2BS2B 2PE6B 4ZYNA 4TQ1A 1QOFA 2AQ3B 5G5HA 4KVGB 3KWVA 3W9CB 2KTRB 2DYMA 3PPAA 2DBYA 2NBUA 3ONSA 2BS4B 1ZW7A 1GB1A 2FCSA 3R66C 2YEPF 3PTFC 5CHFA 1FRDA 5FK9C 1JMLA 2V3SA 3JVZX 4II3B 2RPVA 1SGHA 2LGSA 2XN9C 4FN2A 4RF1A 5EE9A 2XEWA 4CO7A 4RGTA 4K81A 3NVZA 2RGFA 4HWIB 3BVGA 2MWSB 3P42A 3DVGX 2N9KA 1WGDA 1UGJA 4E3CA 2DWQA 3AE7B 2KJHB 1AYFA 1L2NA 1Q5WB 2J4XA 1EO6A 4MELA 2AQ1B 2NR2A 4EUTA 3P63A 4EZKA 3MC0B 3O13A 1SJHD 4C56C 3ML8A 1WH3A 2K0PA 3GP7A 1MJDA 4G50A 2M1MA 2ZVNA 1QKZA 3ZNHB 4HLEA 2I1JA 1XQQA 5D7GA 3RNAC 3MTNB 3R2TA 2D5GA 2GBNA 3LB8C 4LK0M 3NS1A 3AMZA 5JHBA 1XF5L 2KACA 1X1MA 1WZ0A 1WIAA 1AWDA 4IWOA 4PS7A 4II2B 4C4VA 3VXWA 1XT9B 1GNUA 3T9LA 3Q8CA 4PS8A 2BYFA 4W9HA 1YMHE 2OEDA 1WFYA 2NMQA 1L7YA 2QEJC 4XX5A 2RDBC 1IUEA 4ARCA 2ZVOA 4H2AA 2WHIA 1I7HA 3DBLI 2J53A 3SDLC 1WRIA 5KHOA 2WGSA 4BOZB 2C7MB 3OG5A 1T6BX 2INPE 2MRPA 3DCGA 3N9YC 1WGKA 3BWUD 1EM7A 2W55A 3A9KB 2OOBB 2R61A 2BPSA 1JALA 2AEHA 4I6PA 5E6JA 5JHAA 3ZJVA 2JXTA 4YSXB 2KDMA 2K39A 2E6XA 2MBHA 3TEZA 3V6EB 1VZ7A 3PGEA 1YIWA 2D3GA 4GN1A 4EE2A 4W9GA 1TS2A 4P1BC 2DZMA 5BYQA 2WXPA 3LXFA 4IM3A 1ZP0B 4XE0A 2L3ZA 2MBBB 3IT6B 1KF6B 2DAJA 2I1KA 1KOTA 4W9KA 1N60A 2B3AA 1FCCC 3DVNU 4K7UA 1F52A 4IDIA 3QJZA 4DXAB 2W82A 3NZSA 3HIZA 1WXAA 3IXSA 2KJRA 2VRRB 3KLSX 2FUHB 5CX3A 4KIKA 2VH2A 2IPKD 3DBLB 4HJKA 3AEDB 3SD5A 5IP4D 1T0YA 2LJIA 2WS3B 1C4AA 4YSYB 1C77A 3Q3NC 1ET6A 3GOEA 2V3PA 1M94A 3B2FA 2KYWA 1F9JA 3O65B 2LUMA 3VHTC 1I4HA 2IZVB 4GDLA 1BMLC 4KDIC 4WWMA 3TEYA 1Q10A 1TGZB 3NZUA 1YN4A 1UBIA 4KV2A 4B95A 1UELA 1QOBA 3ETRA 2KDFB 1LGRA 1V5TA 3ALBA 4A3OA 3NOBA 2L1AA 3W5UB 2C7NB 3Q3FA 2IDYA 1SF0A 2KQSA 2J7QB 4NAWA 4TUUA 3RZFA 4XWWA 2FIFA 4KSKC 2BBCA 2JU6X 4ITKA 3BK1A 1HZ5A 5L83A 2DYOA 1OQYA 2O6VA 2FE8A 2L7RA 3DHIC 3M3JA 5BMHA 1XLNA 2NVUI 4DHZB 2DZIA 4YTPB 1FCLA 2L83A 1B9RA 3N20C 2J52A 2K22A 2JWZA 3KVFB 4X57B 3PSEB 4ANWA 2KLGA 3FC4A 1UH6A 1ESFA 2WQYB 4FBJB 3ZO5B 3AU4A 2FBWB 4WJNA 5IKCM 2BYVE 4AUQC 4WAFA 4RGNA 1WJUA 3GB1A 4MM3B 1UNSA 4F8CB 4HPPA 1I4QA 1HE8A 5JZEB 2ASQA 2E3TA 1EUVB 4NNJB 2RDHA 1JWSD 2JX5A 1XCTL 5T8IA 3W1SA 3AV8A 3WIMA 3AI5A 4TKNA 1IPGA 4ANUA 1NBFC 1C1YB 2M0AA 3PLUA 3A4SC 5J2RA 1NI2A 4NJ6A 2NPTB 2AWTA 3MC9A 4MH0E 5E6OA 3A1QB 1L0YB 2M0XA 4M0WB 1CQVA 1HXYD 2KFKB 2W9NA 4OZAA 1TS3A 1WX7A 3ZRFA 2V3NA 3Q14C 3PV1A 3VRAB 4GB9A 1XLOA 2LFIA 3C8YA 3QCAA 4J3OD 1J8CA 1UWMA 1WXVA 1GC6A 2MX2A 3UGBB 3V3XA 4BKSA 4JX1C 1VCBA 1FXAA 1IP9A 4WQOB 5D3DA 2GLSA 4OZBA 4ACFA 3UQAA 2D2QA 2Y5CA 1YQBA 3Q8BA 1KLGD 3V62A 3FILA 2IO0B 4BVUC 2LGDA 2DLBA 2K6DB 4MGYE 1WGYA 1YQ4B 1RWSA 1JCKB 1V1PA 2H88B 3L4PA 3PZ7A 1WGGA 5TR5A 1WMHA 1E6EB 4KGTA 2ICIA 4GDKA 4US9A 4YL8A 1T0QC 1XLQA 1I4PA 3AE2B 5AUKA 4W9CA 2KMMA 1RFAA 1ENFA 2HD5B 4CYEA 4TSSA 2LZ6A 1V6EA 5BMIA 3PHWB 3BK2A 3U4EG 1WYWB 3P1MA 2MSED 3K9OB 2M8SA 3FAHA 1BXTA 1R4NI 4W9LA 4HCNB 4F1SA 2WU5B 2OJRA 2CU3A 3UI3A 1TS5A 2N0SB 1K52A 2KDIA 4KZ0A 2K9XA 3ZNID 5I4DA 2K1FA 4XDCA 4ZYSA 1R4MI 4PS3A 4LJPB 3S2AA 2QIEB 1PGXA 1MG8A 5FR3A 1NEKB 1WGRA 4WWNA 1J0GA 1VD2A 3B0AA 2DENB 1SIJA 2CS4A 2MBEA 4K7SA 2VZKD 1SE9A 1WR6E 2BB6A 2EMTA 4KX6B 4HDQA 2GBJA 2AYOB 4G3XB 5HI1A 3BVZA 2VH1A 3QARA 3RN9C 3TEWA 3PLVA 1V8CA 1JRPA 1DOXA 4HJGE 2KC1A 4WWPA 4BOSC 1NVID 3DDCB 3UQBA 4OVUA 2C5LC 2WNMA 4RFBA 2N9PC 3JYUA 4LNKA 4K3BA 1FXTB 2FCMA 4RGOS 1V49A 1U4AA 4BZAA 4ZOHC 2V0GA 3BINA 3ZTDA 5DPSA 4FA6A 2GOWA 2K25A 2UWQA 2JF5A 2JSVX 3RPFC 1YNTE 1R4NB 2WXJA 4XWTA 3W5VB 1L5PA 3QQ8B 1KLUD 1IBXB 3HVZA 3L54A 3HUIA 3RI7C 3RNBC 3PZ8A 1CJEA 2AQ2B 2IO2B 4IUMB 3OWEB 3LYYA 2M4NA 1TY2A 1XD3B 2C9WB 3CMMB 2J0JA 4MSMB 1LQBA 2DZJA 1E8WA 3I9V1 3N1ZC 3ZYYX 1P3QU 4K3CA 2LEKA 4BKSD 3N32A 3VDZA 1L6UA 2JZ3B 2KQ7A 3IG3A 2ACZB 4IC7B 3RYTA 3PVLA 4JL9A 4MACA 3P4PB 3VUXA 1PFDA 2ZCBA 3EFCA 2KD0A 3L17A 1QZEA 2KWVB 1V97A 4HDOA 2D11A 3RCZA 4C7YA 2KC2A 2QSDA 5H92C 3CSFA 1VZ8A 2GBKA 4HXDA 1F2RI 2MW5A 1TS4A 5HFYA 1TKEA 2K6QA 5C23A 1ZDXA 4A20A 1H8CA 4HROA 1ZGUB 2WX0A 2C60A 2V4IB 2ZNVC 4NPNA 1GC7A 1XCQL 1XO3A 1LM8B 4JLCA 5MPOA 2BTEA 1I4XA 4TV3A 4GU2A 2MCNB 2LD9A 2G3QB 3MHZA 2OHFA 1H4RA 2K5PA 2KVRA 1C4PA 2KK8A 1C79A 1N63A 2NBWB 4ZHPA 2LHDA 3LDZE 4AJYB 2Y5PA 1L6VA 3PS6A 4IW0A 3V05A 4XZ4A 2CJOA 3MHSD 4KKIA 2ZJDA 3NVYA 1TYGB 2V4LA 3AE9B 3Q2AC 2BYTA 4W9DA 2PMVA 4BBNC 4GSWA 1ET9A 4L23A 1ZUD2 1JROA 1SXTA 3VH3B 3OAWA 1WGHA 2HE7A 5GXGB 1SE3A 2CHWA 3MJWA 1D4BA 1WM3A 4P6VF 4OVVA 3WANA 3H6NA 2NBVB 3KYDD 4ASWC 5G2NA 3HVDA 4C4VB 1WX9A 1MI0A 2AL6A 4DWFA 2IO3B 1TJEA 1E0ZA 4ANXA 1JW9D 4HEA1 3H7PA 1N5WA 2W54A 2NTTA 2M56B 2KWUB 1HZ6A 5CTRC 2BKRB 1WJ4A 3W1SC 1XLPA 3IVFA 3AEAB 1E10A 4LJOB 4I6LB 1NI3A 3ENEA 4Q2JA 1UF0A 3VVWB 4RMAA 5AEKB 2EKEC 1E7VA 3VAWA 4IKGA 1EU4A 3U8ZA 3AE3B 5C1ZA 2I2YA 1XEEA 4NQKE 5FKAC 3VUWA 1EF1A 2L0TA 2GBMA 3OJ4B 1DGJA 1P98A 4N6EB 2WXNA 4PK1A 5BYRA 3MFGA 2WXOA 4OZCA 3Q3OC 1EU3A 2WXKA 4FHKA 3AXCA 4B0EA 4DBGA 2LRUA 3CF6E 4EZJA 1YOVB 2MH7A 3NG0A 3P4RB 3RZWC 4E74A 3NVWA 1QLBB 3IAM1 3AEEB 2HJ8A 4NY0A 1I42A 5LXIB 2ZEQA 1NDDA 2RSUA 3CIRB 1WX8A 3EFUA 3JSVB 5IO9A 2ONQA 3CSTA 1ROEA 2K8CA 3DOWA 4ZDVA 1ZKHA 2Y5BB 1HTOA 1OFFA 2BF8B 3Q8AA 5E6PA 4FXCA 1KTKA 2O2VB 3VTUA 1LO5D 2N7JA 2G9HD 3ZLZA 2X8XX 4PYUA 2RPQA 2D07B 4DQOC 4RNAA 1OGWA 4OW0A 4WAAA 1GJZA 1PYWD 2FIDA 1P7EA 1TY0A 3BVMA 3DQVA 2PTLA 3DBSA 1FM0D 1T3QA 1F77A 1UWXA 3OLMD 1FD6A 4WJPA 3APCA 4LLGM 4M00A 5HHDG 3ABVB 2K3UA 3R3MA 2KZRA 2LVQA 3R7RA 2WDQB 1WZ3A 1VJKA 2IY1B 3QHTA 3H1UA 3X0WA 3WAPA 3AE8B 2JZZA 4W9EA 1DOYA 3RT3B 4MM3A 5IN7A 3J9CA 1IGDA 4FADA 3AH7A 2WXGA 2WX1A 2L76A 3APDA 4US8A 3KYCD 4EZLA 1PQSA 2ZPNA 1DOIA 3MJ5A 2KAJA 1KFYB 1VRAB 3VR9B 2Q5WD 3U7ZA 3B9JA 3AB5A 1V2YA 4NQLB 4HK2A 4AJWA 3B08A 4ICUA 4RF0A 1CMXB 1JWUD 4GIVA 3WAMA 2NPTA 5J17A 1VDVA 3K9PB 4LNNA 3A1QA 3TUOA 2VZKB 5EE3A 4KKJA 5HKHA 1ACCA 3Q3MC 3QAQA 4IG7B 1QF6A 3QC8B 1Y8RC 2QC8A 4MGIE 2B76B 2GB1A 4NAMA 1EF5A 4C00A 5J18A 3W2DA 1WXMA 4N59A 3KUCB 2JXXA 4JGHB 3MC8A 2L32A 1CK1A 1FPYA 3KUDB 3ZJUA 3NJTA 1L0XB 2AX5A 3N1XC 3GS2A 1QQRA 2K8BA 3D32A 3RNCC 4HPMB 2KX3A 2N9EB 3TMPB 1FRRA 2XNAC 3EA6A 2KNBA 2LXCA 3ECIA 1WSPA 2UYZB 3DWGC 3DWMA 2IBIB 2NTSA 4D2KA 1SE2A 1SEBD 2LVPA 2BGFA 3WA0A 4MT5A 4IWQA 4YT0B 4W9IA 1UBQA 5H8YE 3ZIMA 1OEYA 4KGRA 3EC8A 1ZXHA 2L0FA 4AQ7A 2G1EA 3M62B 4PYZA 1E8ZA 2JT4B 3MP9A 2BT6A 1TTNA 2MP2A 4FJVB 2IGDA 4M8MA 3Q6BA 5CHWA 2V9HA 4WIPA 2XK5A 1V5OA 1NYQA 1YJ1A 2Z0DB 4MJSB 4DHZE 4A8XC 4REZA 1WR1A 3FILB 4ANVA 1MPEA 3NY5A 1J19A 1WJNA 2W3SA 2INCC 2TSSA 4LNIA 4UDUC 1P9DU 1C3TA 2QILA 3NZ3A 2K8HA 4MGKE 4B0MA 2JZPA 3PHXB 4MEMA 1JWBD 2PVOD 2IO1B 3SFDB 2PW9A 4GDKB 4XGAB 1WRDB 2WLBA 3SR6A 2WXHA 2O6VD 4LTUA 3QA8A 3U30A 1RRBA 4EOYA 3ZXRA 3QWZB 4P16A 2LXAA 1UGMA 4DDGD 1KH0A 3UIOB 2D10A 3NHEB 2WDVB 3NUHB 2KWCA 2LUEA 1FO4A 3GE3C 1QT9A 1A5RA 2MEKA 1ZE3D 2W3RA 3A9JB 3SHQA 2PJHA 4RGMA 1S1QB 2INNE 3DPDA 1N5XA 3BZDB 3GZNB 4KSLC 1AARA 2J0KA 3HM6X 3ZNZB 5TSSA 3T3NA 3KWLA 5BYSA 2AL3A 2D3BA 2R2OA 4AS1A 3V61A 3C0RB 2KWDA 3UIPB 2KMAA 2JRHA 4NZLB 4S17A 5IA7A 3SFEB 1YX5B 1AN8A 3WCQA 4BAXA 4ZRQA 3Q8EA 1IYFA 5AUIA 4DK5A 2QCZA 1J7AA 3N3KB 3U52E 4MSQB 1SB3C 3Q3JA 5AZHA 2ZCCA 1K51A 3ZDTA 4CQNA 1QOGA 2M17A 4F7ZA 2KTRA 1CZPA 2Z8LA 3AE4B 2Y3AA 3APFA 3I63C 3L08A 4LDTD 4RM8A 1L0VB 2CJNA 4IOIE 1HEZE 3H9DA 1MG4A 3AEGB 1C9FA 4DXFA 2N7DA 2WYQA 4DHJD 5FR6A 1TKYA 1FFVA 5BO4B 4DDID 2A5UA 3H8HA 2SAKA 3EECA 3A33B 1K53A 4OHJA 2WXQA 1K50A 2DYBA 3VTWA 2DX5B 4QAYA 2PIAA 1G6JA 4GXBA 3E9SA 3DVNV 2BWFA 2N1VA 1FFUA 1TBEA 1EWYC 3BIID 1HQRD 5EE1A 1PDXA 1V1OA 2MJDA 2ZPYA 1E90A 5HG2A 3VQIA 5AZFA 3TEXA 4K7WA 2UU7A 4N9F4 3N30A 3Q8FA 4TQ0A 1GB4A 1T0RC 2KN4A 3TSSA 1AW7A 5E6NA 4HVBA 5DPTA 1FEHA 1EWCA 2GMIC 3VH4B 1KJTA 2G4SA 2HTME 4W9JA 2MJ3A 3KQ4A 3RUIB 2MBQA 2LI5A 1UD7A 3DHGC 3T3OA 2EMSA 2YVCA 2HDEA 3QK0A 3B1LX 2QHOA 3VRBB 2MQJA 1FMAD 3IBEA 2LGIA 4G0NB 3DBHI 3CWIA 1D6EC 2N4FA 1J7CA 1V86A 1KRHA 2LMCA 2N9LA 2JUOA 4W9FA 3C19A 1PGAA 2JRIB 4M01A 1S3SG 3AN1A 2QMTA 1DYQA 2N7EA 2RMMA 3UINB 1GAQB 3BYYB 2YEPB 3H7SA 4S0RA 3IFWB 2BQQA 1GOZA 1QILA 2J42A 3RNFC 4MDKE 2DHZA 3URYA 3M63B 5CHVC 5DCNA 1D5MC 3ML9A 1ZDVA 3A9KA 5G55A 1SSNA 1RLFA 4EFOA 3E56A 2MJEA 1E8XA 3RFZB 4M02A 2SEBD 2KN5A 2MBOA 3I57A 1HTQA 1Q0WB 3R2IA 3LJ3A 3AEFB 4RCOA 4XYCA 2H89B 4FHJA 1L4ZB 1L4DB 3RULA 4M8NA 4CHKA 4C80A 3KH0A 4ZRJA 1YQ3B 3P4QB 1BT0A 3ZVVA 1KLVA 2JWUA 2ON8A 1T0SC 2D3CA 2KKCA 1ZOYB 5JXVA 1D5XC 1Z5SB 1D5ZC 5G5GA 2N1WA 2XBBC 1HA5A 3DBHB 3AU5A 2WXRA 4YXDB 5C3JB 2DNFA 3PREA 2CU1A 1FNWA 3NVVA 2QDFA 4OVZA 3PO0A 4XC2A 2WXIA 2IYDB 3TBLD 3R7QA 4FJYA 2LWPA 4B9KA 3VUYA 1TZ1A 1MVKA 2KLCA 4C7ZA 3H7PB 3V6CB 2CR5A 1LFDA 1JWAD 2D3AA 3IT4B 1A70A 5D2MB 1SE4A 3ZW3A 3JSVA 1JQ4A 2NCNA 2KMCA 4DXGA 2KVZA 1YX6B 2LGYA 3PZDA 2KT7A 4RM9A 1OQRA 1SJED 2O2VA 3HK0A 1B1ZA 5D6JB 3M95A 3RD2A 3PRZA 1VZ6A 3RNGC 5JH5C 1V9JA 4FLHA 3TL5A 2KANA 4JE3B 1OQQA 3EHVA 4NJ7A 2C7HA 2MHJA 2KHWB 1E7PB 2JYTA 2JY6A 2KXJA 4KIKB 3R8BA 2FNJB 3RNEC 3QIJA 1E7UA 3PRPB 4JPSA 2KDBA 3AE6B 1E5WA 1GUAB 5LXHA 2WU2B 1FNUA 1FIQA 3DBRI 2ZW1A 2KX0A 2ZNVB 4BBNF 2WDRB 3A4RA 3BYTB 2J0MA 4JIOU 2OJWA 3ZJTA 4GDLB 1RAXA 3BY4B 1WY8A 2LRWA 4LCDE 1LXDA 1WF9A 1WE7A 1TIFA 2NS5A 2WP9B 5L95C 2LJ5A 4A9AA 1I4RA 3ZUNA 4WQMA 2IGGA 2L8JA 2JPHA 5IAAC 1SBBB 1RYJA 1YJJA 2G45B 4R3DA 5EE0A 1ZPSA 3TJPA 4I6NB 1QOAA 2N9XA 4IM0A 4GLSC 4BFRA
chains in the Genus database with same CATH topology
1WR1A 2AEHA 4I6PA 4ANVA 3NY5A 1J19A 1OEYJ 1WJNA 2JZ3B 5JHAA 2KQ7A 4NAWB 3IG3A 4IC7B 1P9DU 3PRMB 3RYTA 1C3TA 2K39A 2K8HA 4MGKE 2MBHA 3PVLA 3SU8X 4AOFA 4JL9A 3L0WB 3PHXB 2KJ6A 3VUXA 3V6EB 4MEMA 2MLBA 2ZCBA 1YIWA 3PGEA 2KD0A 2LVOA 3L17A 2D3GA 2L05A 2IO1B 2O6VB 4GMVA 4GN1A 1QZEA 4GDKB 1JRUA 1WRDB 3AULA 2KWVB 4W9GA 2DZMA 4HDOA 2D11A 4IM3A 2O6VD 1WJ6A 3RCZA 2BKFA 2KC2A 4BKGA 2YLMA 3CSFA 3QA8A 2L3ZA 2MBBB 3U30A 2GBKA 4HXDA 2KFKA 1RRBA 2KFJA 4EOYA 3QWZB 2MW5A 4WJQA 2LXAA 1UGMA 2DAJA 4DDGD 2I1KA 1KOTA 4W9KA 3UIOB 2B3AA 1K8RB 2D10A 2K6QA 3NHEB 5C23A 2WWZA 3DVNU 4K7UA 3T8MA 3VTVA 4A20A 2KWCA 2LUEA 3TIXA 1H8CA 3QJZA 1A5RA 1ZGUB 3WAOA 2WX0A 4DXAB 2C60A 2ZNVC 3NZSA 3A9JB 3SHQA 2PJHA 3HIZA 1S1QB 3QX1A 4NPNA 1WXAA 2CHZA 1GC7A 2KJRA 3DPDA 3KUZA 1LM8B 2VRRB 2MA9B 2FUHB 4JLCA 5CX3A 4KSLC 4TV3A 4KIKA 1AARA 2J0KA 3HM6X 3ZNZB 2V1YA 4GU2A 3UF8A 2MCNB 2LD9A 2AL3A 4HJKA 2G3QB 3SD5A 1T0YA 2R2OA 2ZZPB 1H4RA 4EEWA 3GOEA 2KVRA 5DPWA 3V61A 1M94A 3C0RB 2KK8A 2KMAA 3UIPB 2JRHA 3VDZA 1F9JA 3O65B 1D3ZA 5D94A 3VHTC 2IZVB 5IA7A 1OTRB 1ISNA 2NBWB 1YX5B 3LDZE 4GDLA 4AJYB 3ZTCA 4KDIC 1TGZB 1IYFA 1Q1OA 3NZUA 4K1RB 3PS6A 4IW0A 4XZ4A 1UBIA 4KV2A 3MHSD 4DK5A 2ZJDA 4B95A 2WDTB 1UELA 3N3KB 4ZRKA 2V4LA 2JVCA 4GGQA 4MSQB 2KDFB 3P2BA 3Q3JA 5AZHA 2ZCCA 4W9DA 3ZDTA 3GZNI 1V5TA 3ALBA 3TCAA 4FULA 2L00B 4AWJA 4A3OA 3NOBA 4BBNC 1E8YA 2M17A 3L10B 4GSWA 1SIFA 2C7NB 4ZRIA 3Q3FA 2KTRA 4LDTB 4F7ZA 4MJSA 3VH3B 2KQSA 2J7QB 3OAWA 2BWES 1WGHA 2HE7A 3APFA 2RD0A 3L08A 4LDTD 4NAWA 4TUUA 2KO3A 3KW5B 4RM8A 2CHWA 3RZFA 3H9DA 4DHJB 3MJWA 2FIFA 1WM3A 4KSKC 4GOCA 5L83A 4OVVA 3WANA 3H6NA 2A4ZA 2N7DA 2NBVB 2DYOA 2Z59B 2WYQA 1OQYA 2O6VA 4DHJD 5FR6A 3KYDD 4ASWC 2LASA 5BO4B 4DDID 2L7RA 5G2NA 2A5UA 1WX9A 3M3JA 1WM2A 2AL6A 4DWFA 4ICVA 2NVUI 2IO3B 3EECA 4KDLB 3A33B 4DHZB 2DZIA 2FCNA 3OJ3A 3DVGY 3L16A 5DPRA 4ANXA 2DYBA 3H7PA 3VTWA 2DX5B 2JWZA 3KVFB 4X57B 3PSEB 3VFKA 1WMHB 1V80A 4ANWA 2KLGA 2KTFA 1UH6A 4IWPA 4B6WA 1G6JA 2KWUB 4GXBA 5CTRC 4G11A 4FBJB 3ZNGC 2BKRB 1WJ4A 3W1SC 3ZO5B 3DVNV 2FAZA 3AU4A 4WWOA 2BWFA 4JQWC 2N1VA 2GBRA 1TBEA 3A9JA 3IVFA 4WJNA 2BYVE 4LJOB 4AUQC 4I6LB 1WJUA 3ENEA 2MP2B 3VVWB 3U7DA 4F8CB 4RMAA 5AEKB 2EKEC 3W1YA 2ZPYA 1E7VA 3VAWA 2REXA 2R2QA 2XK5B 1E90A 2BYEA 4P7IA 1HE8A 5JZEB 2ASQA 2FCQA 5AZGA 3VQIA 5AZFA 4URKA 1EUVB 1GG3A 1P0RA 4K7WA 4NNJB 4N9F4 3N30A 4TQ0A 2G4DB 3U8ZA 5C1ZA 1UZXB 4NQKE 1I35A 1KM7A 3VUWA 5E6NA 1EF1A 3W1SA 2L0TA 2PE9A 5DPTA 4HVBA 2GBMA 3OJ4B 2GMIC 1P98A 3L13A 4KZCA 3VH4B 3WIMA 1KJTA 1P1AA 3AI5A 4TKNA 1IPGA 2G4SA 4ANUA 1NBFC 4W9JA 2DAFA 1C1YB 5KHQA 3PLUA 4BKTA 3HHMA 5LLIA 3WALA 3A4SC 5J2RA 3RUIB 2MBQA 2LI5A 1NI2A 1V81A 1UD7A 4NJ6A 4FHKA 2NPTB 3AXCA 2AWTA 2EMSA 2YVCA 4DBGA 2LRUA 3CF6E 4EZJA 3QK0A 3B1LX 1WE6A 2PEAA 1WXSA 2MQJA 2QHOA 5EDSA 3IBEA 3RZWC 4G0NB 4E74A 4MH0E 3DBHI 3PT2B 5E6OA 3A1QB 2N4FA 2M0XA 3HM3A 4M0WB 2KFKB 2W9NA 1V86A 4E71A 4IM2A 2CHXA 2HJ8A 2JUOA 1WX7A 2DZKA 4NY0A 4W9FA 1I42A 5LXIB 2ZEQA 4FJZA 1NDDA 2RSUA 3EFUA 1WX8A 5GMVA 3JSVB 3ZRFA 3PV1A 2JRIB 1S3SG 4GB9A 3ZKJC 3CSTA 3QCAA 2IY0B 2K8CA 2N7EA 3DOWA 4EKUA 4ZDVA 4HCPB 1ZKHA 2Y5BB 3UINB 3V60A 1J8CA 2BF8B 5E6PA 3H7SA 1WXVA 4WJOA 3IFWB 1GC6A 2HTHA 2O2VB 2PPHA 3I3TB 2LGXA 4A3PA 3NS8A 4MDKE 3VTUA 2DHZA 2MX2A 3M63B 3UGBB 4BKSA 5CHVC 5DCNA 3ML9A 1VCBA 3ZLZA 1IP9A 3A9KA 4PYUA 2RPQA 5G55A 4WQOB 2D07B 1RLFA 3UQAA 4EFOA 1E8XA 1OGWA 2D2QA 1YQBA 2KOXA 4WAAA 1GJZA 2KN5A 2FIDA 4HPLB 3V62A 4BVUC 2IO0B 1WI0A 2MBOA 2LGDA 3DQVA 2CKHB 1Q0WB 2K6DB 3DBSA 4MGYE 1WGYA 2KDEB 3LJ3A 3X23A 3OLMD 3ZDMC 4WJPA 3APCA 2Z0EB 4FHJA 1YD8U 1WGGA 5TR5A 4AP4C 3R3MA 1WMHA 2KZRA 2LVQA 4J6IA 3RULA 3R7RA 1WZ3A 1Z2MA 4GDKA 2IY1B 3QHTA 2RR9A 4M8NA 4YL8A 3H1UA 3ZRCA 4CHKA 3X0WA 3WAPA 3KH0A 4W9CA 4ZRJA 3IHPC 2JZZA 4MGZE 1RFAA 3JW0X 2PE6B 4W9EA 4ZYNA 3RT3B 4MM3A 2HD5B 4CYEA 4TQ1A 1BT0A 2LZ6A 4FADA 3ZVVA 1V6EA 4KVGB 2WX1A 2L76A 3APDA 3PHWB 1KLVA 1WYWB 2MSED 2KKCA 3K9OB 2KTRB 2M8SA 3KYCD 1Z5SB 2DYMA 3PPAA 4EZLA 1PQSA 2NBUA 2ZPNA 1R4NI 3ONSA 1ZW7A 2N1WA 2XBBC 4W9LA 3AU5A 4HCNB 4F1SA 2FCSA 2OJRA 1V2YA 4NQLB 3PREA 3R66C 3PTFC 2CU1A 5CHFA 4HK2A 4AJWA 2V3SA 3B08A 4ICUA 4KZ0A 2KDIA 3JVZX 3ZNID 1CMXB 4XC2A 2K1FA 4II3B 4GIVA 3WAMA 2IYDB 1SGHA 4FN2A 3TBLD 1R4MI 3R7QA 2NPTA 4LJPB 4PS3A 2XEWA 3S2AA 4CO7A 5J17A 4K81A 4FJYA 2LWPA 4B9KA 3VUYA 1MG8A 2RGFA 4HWIB 2MWSB 3K9PB 1TZ1A 1WGRA 4WWNA 3A1QA 2KLCA 1J0GA 3DVGX 1VD2A 3H7PB 3V6CB 2CR5A 1LFDA 5HKHA 1WGDA 3B0AA 4E3CA 2DENB 2CS4A 2MBEA 2KJHB 3QAQA 4K7SA 1L2NA 4IG7B 1Q5WB 5D2MB 1EO6A 4MELA 3QC8B 3ZW3A 1SE9A 1WR6E 2NR2A 3JSVA 4EUTA 1Y8RC 2NCNA 2KMCA 2EMTA 4MGIE 1YX6B 2LGYA 4HDQA 3PZDA 1EF5A 2GBJA 2AYOB 4G3XB 5J18A 4EZKA 4RM9A 1WXMA 3KUCB 3QARA 2JXXA 2O2VA 3PLVA 3ML8A 4JGHB 3HK0A 1WH3A 5D6JB 3KUDB 3M95A 3RD2A 3PRZA 4G50A 2KC1A 2M1MA 4WWPA 2ZVNA 4BOSC 5JH5C 3ZNHB 1V9JA 3DDCB 3UQBA 4OVUA 2C5LC 4FLHA 4HLEA 2I1JA 2K8BA 3TL5A 2N9PC 3D32A 3JYUA 1XQQA 5D7GA 2KANA 3MTNB 1FXTB 2FCMA 3EHVA 1V49A 4NJ7A 2C7HA 2GBNA 1U4AA 2JY6A 3BINA 3ZTDA 2KXJA 5JHBA 4KIKB 5DPSA 4HPMB 2KX3A 2N9EB 4FA6A 1X1MA 1WZ0A 2FNJB 1WIAA 2GOWA 2K25A 3TMPB 2UWQA 2JF5A 3QIJA 4IWOA 1E7UA 2KNBA 4PS7A 4II2B 2LXCA 3ECIA 3PRPB 3VXWA 1XT9B 2UYZB 2KDBA 1GNUA 1E5WA 3T9LA 1GUAB 5LXHA 2IBIB 4PS8A 3DBRI 2BYFA 3QQ8B 4W9HA 2KX0A 2ZNVB 2LVPA 2BGFA 3L54A 4BBNF 1WFYA 3A4RA 3WA0A 2J0MA 4JIOU 1L7YA 4XX5A 4IWQA 4W9IA 1UBQA 3ZIMA 4GDLB 1RAXA 2ZVOA 3BY4B 1OEYA 2IO2B 4IUMB 3EC8A 3DBLI 2M4NA 1WY8A 2L0FA 3SDLC 1XD3B 2LRWA 3M62B 4PYZA 4LCDE 1LXDA 1WF9A 1E8ZA 1WE7A 2JT4B 2NS5A 5KHOA 5L95C 2LJ5A 4BOZB 2C7MB 3ZUNA 1TTNA 2MRPA 3DCGA 2C9WB 2MP2A 3CMMB 4FJVB 2L8JA 2JPHA 2J0JA 5IAAC 4MSMB 1LQBA 2DZJA 4M8MA 5CHWA 1E8WA 3A9KB 2G45B 2OOBB 2XK5A 1P3QU 1V5OA 2Z0DB 1YJ1A 3TJPA 4BKSD 4I6NB 2BPSA 4MJSB 4DHZE 2N9XA 3N32A 4IM0A 2KHWB 4BFRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WR1 A;  2AEH A;  4I6P A;  4ANV A;  3NY5 A;  1J19 A;  1OEY J;  1WJN A;  2JZ3 B;  5JHA A;  2KQ7 A;  4NAW B;  3IG3 A;  4IC7 B;  1P9D U;  3PRM B;  3RYT A;  1C3T A;  2K39 A;  2K8H A;  4MGK E;  2MBH A;  3PVL A;  3SU8 X;  4AOF A;  4JL9 A;  3L0W B;  3PHX B;  2KJ6 A;  3VUX A;  3V6E B;  4MEM A;  2MLB A;  2ZCB A;  1YIW A;  3PGE A;  2KD0 A;  2LVO A;  3L17 A;  2D3G A;  2L05 A;  2IO1 B;  2O6V B;  4GMV A;  4GN1 A;  1QZE A;  4GDK B;  1JRU A;  1WRD B;  3AUL A;  2KWV B;  4W9G A;  2DZM A;  4HDO A;  2D11 A;  4IM3 A;  2O6V D;  1WJ6 A;  3RCZ A;  2BKF A;  2KC2 A;  4BKG A;  2YLM A;  3CSF A;  3QA8 A;  2L3Z A;  2MBB B;  3U30 A;  2GBK A;  4HXD A;  2KFK A;  1RRB A;  2KFJ A;  4EOY A;  3QWZ B;  2MW5 A;  4WJQ A;  2LXA A;  1UGM A;  2DAJ A;  4DDG D;  2I1K A;  1KOT A;  4W9K A;  3UIO B;  2B3A A;  1K8R B;  2D10 A;  2K6Q A;  3NHE B;  5C23 A;  2WWZ A;  3DVN U;  4K7U A;  3T8M A;  3VTV A;  4A20 A;  2KWC A;  2LUE A;  3TIX A;  1H8C A;  3QJZ A;  1A5R A;  1ZGU B;  3WAO A;  2WX0 A;  4DXA B;  2C60 A;  2ZNV C;  3NZS A;  3A9J B;  3SHQ A;  2PJH A;  3HIZ A;  1S1Q B;  3QX1 A;  4NPN A;  1WXA A;  2CHZ A;  1GC7 A;  2KJR A;  3DPD A;  3KUZ A;  1LM8 B;  2VRR B;  2MA9 B;  2FUH B;  4JLC A;  5CX3 A;  4KSL C;  4TV3 A;  4KIK A;  1AAR A;  2J0K A;  3HM6 X;  3ZNZ B;  2V1Y A;  4GU2 A;  3UF8 A;  2MCN B;  2LD9 A;  2AL3 A;  4HJK A;  2G3Q B;  3SD5 A;  1T0Y A;  2R2O A;  2ZZP B;  1H4R A;  4EEW A;  3GOE A;  2KVR A;  5DPW A;  3V61 A;  1M94 A;  3C0R B;  2KK8 A;  2KMA A;  3UIP B;  2JRH A;  3VDZ A;  1F9J A;  3O65 B;  1D3Z A;  5D94 A;  3VHT C;  2IZV B;  5IA7 A;  1OTR B;  1ISN A;  2NBW B;  1YX5 B;  3LDZ E;  4GDL A;  4AJY B;  3ZTC A;  4KDI C;  1TGZ B;  1IYF A;  1Q1O A;  3NZU A;  4K1R B;  3PS6 A;  4IW0 A;  4XZ4 A;  1UBI A;  4KV2 A;  3MHS D;  4DK5 A;  2ZJD A;  4B95 A;  2WDT B;  1UEL A;  3N3K B;  4ZRK A;  2V4L A;  2JVC A;  4GGQ A;  4MSQ B;  2KDF B;  3P2B A;  3Q3J A;  5AZH A;  2ZCC A;  4W9D A;  3ZDT A;  3GZN I;  1V5T A;  3ALB A;  3TCA A;  4FUL A;  2L00 B;  4AWJ A;  4A3O A;  3NOB A;  4BBN C;  1E8Y A;  2M17 A;  3L10 B;  4GSW A;  1SIF A;  2C7N B;  4ZRI A;  3Q3F A;  2KTR A;  4LDT B;  4F7Z A;  4MJS A;  3VH3 B;  2KQS A;  2J7Q B;  3OAW A;  2BWE S;  1WGH A;  2HE7 A;  3APF A;  2RD0 A;  3L08 A;  4LDT D;  4NAW A;  4TUU A;  2KO3 A;  3KW5 B;  4RM8 A;  2CHW A;  3RZF A;  3H9D A;  4DHJ B;  3MJW A;  2FIF A;  1WM3 A;  4KSK C;  4GOC A;  5L83 A;  4OVV A;  3WAN A;  3H6N A;  2A4Z A;  2N7D A;  2NBV B;  2DYO A;  2Z59 B;  2WYQ A;  1OQY A;  2O6V A;  4DHJ D;  5FR6 A;  3KYD D;  4ASW C;  2LAS A;  5BO4 B;  4DDI D;  2L7R A;  5G2N A;  2A5U A;  1WX9 A;  3M3J A;  1WM2 A;  2AL6 A;  4DWF A;  4ICV A;  2NVU I;  2IO3 B;  3EEC A;  4KDL B;  3A33 B;  4DHZ B;  2DZI A;  2FCN A;  3OJ3 A;  3DVG Y;  3L16 A;  5DPR A;  4ANX A;  2DYB A;  3H7P A;  3VTW A;  2DX5 B;  2JWZ A;  3KVF B;  4X57 B;  3PSE B;  3VFK A;  1WMH B;  1V80 A;  4ANW A;  2KLG A;  2KTF A;  1UH6 A;  4IWP A;  4B6W A;  1G6J A;  2KWU B;  4GXB A;  5CTR C;  4G11 A;  4FBJ B;  3ZNG C;  2BKR B;  1WJ4 A;  3W1S C;  3ZO5 B;  3DVN V;  2FAZ A;  3AU4 A;  4WWO A;  2BWF A;  4JQW C;  2N1V A;  2GBR A;  1TBE A;  3A9J A;  3IVF A;  4WJN A;  2BYV E;  4LJO B;  4AUQ C;  4I6L B;  1WJU A;  3ENE A;  2MP2 B;  3VVW B;  3U7D A;  4F8C B;  4RMA A;  5AEK B;  2EKE C;  3W1Y A;  2ZPY A;  1E7V A;  3VAW A;  2REX A;  2R2Q A;  2XK5 B;  1E90 A;  2BYE A;  4P7I A;  1HE8 A;  5JZE B;  2ASQ A;  2FCQ A;  5AZG A;  3VQI A;  5AZF A;  4URK A;  1EUV B;  1GG3 A;  1P0R A;  4K7W A;  4NNJ B;  4N9F 4;  3N30 A;  4TQ0 A;  2G4D B;  3U8Z A;  5C1Z A;  1UZX B;  4NQK E;  1I35 A;  1KM7 A;  3VUW A;  5E6N A;  1EF1 A;  3W1S A;  2L0T A;  2PE9 A;  5DPT A;  4HVB A;  2GBM A;  3OJ4 B;  2GMI C;  1P98 A;  3L13 A;  4KZC A;  3VH4 B;  3WIM A;  1KJT A;  1P1A A;  3AI5 A;  4TKN A;  1IPG A;  2G4S A;  4ANU A;  1NBF C;  4W9J A;  2DAF A;  1C1Y B;  5KHQ A;  3PLU A;  4BKT A;  3HHM A;  5LLI A;  3WAL A;  3A4S C;  5J2R A;  3RUI B;  2MBQ A;  2LI5 A;  1NI2 A;  1V81 A;  1UD7 A;  4NJ6 A;  4FHK A;  2NPT B;  3AXC A;  2AWT A;  2EMS A;  2YVC A;  4DBG A;  2LRU A;  3CF6 E;  4EZJ A;  3QK0 A;  3B1L X;  1WE6 A;  2PEA A;  1WXS A;  2MQJ A;  2QHO A;  5EDS A;  3IBE A;  3RZW C;  4G0N B;  4E74 A;  4MH0 E;  3DBH I;  3PT2 B;  5E6O A;  3A1Q B;  2N4F A;  2M0X A;  3HM3 A;  4M0W B;  2KFK B;  2W9N A;  1V86 A;  4E71 A;  4IM2 A;  2CHX A;  2HJ8 A;  2JUO A;  1WX7 A;  2DZK A;  4NY0 A;  4W9F A;  1I42 A;  5LXI B;  2ZEQ A;  4FJZ A;  1NDD A;  2RSU A;  3EFU A;  1WX8 A;  5GMV A;  3JSV B;  3ZRF A;  3PV1 A;  2JRI B;  1S3S G;  4GB9 A;  3ZKJ C;  3CST A;  3QCA A;  2IY0 B;  2K8C A;  2N7E A;  3DOW A;  4EKU A;  4ZDV A;  4HCP B;  1ZKH A;  2Y5B B;  3UIN B;  3V60 A;  1J8C A;  2BF8 B;  5E6P A;  3H7S A;  1WXV A;  4WJO A;  3IFW B;  1GC6 A;  2HTH A;  2O2V B;  2PPH A;  3I3T B;  2LGX A;  4A3P A;  3NS8 A;  4MDK E;  3VTU A;  2DHZ A;  2MX2 A;  3M63 B;  3UGB B;  4BKS A;  5CHV C;  5DCN A;  3ML9 A;  1VCB A;  3ZLZ A;  1IP9 A;  3A9K A;  4PYU A;  2RPQ A;  5G55 A;  4WQO B;  2D07 B;  1RLF A;  3UQA A;  4EFO A;  1E8X A;  1OGW A;  2D2Q A;  1YQB A;  2KOX A;  4WAA A;  1GJZ A;  2KN5 A;  2FID A;  4HPL B;  3V62 A;  4BVU C;  2IO0 B;  1WI0 A;  2MBO A;  2LGD A;  3DQV A;  2CKH B;  1Q0W B;  2K6D B;  3DBS A;  4MGY E;  1WGY A;  2KDE B;  3LJ3 A;  3X23 A;  3OLM D;  3ZDM C;  4WJP A;  3APC A;  2Z0E B;  4FHJ A;  1YD8 U;  1WGG A;  5TR5 A;  4AP4 C;  3R3M A;  1WMH A;  2KZR A;  2LVQ A;  4J6I A;  3RUL A;  3R7R A;  1WZ3 A;  1Z2M A;  4GDK A;  2IY1 B;  3QHT A;  2RR9 A;  4M8N A;  4YL8 A;  3H1U A;  3ZRC A;  4CHK A;  3X0W A;  3WAP A;  3KH0 A;  4W9C A;  4ZRJ A;  3IHP C;  2JZZ A;  4MGZ E;  1RFA A;  3JW0 X;  2PE6 B;  4W9E A;  4ZYN A;  3RT3 B;  4MM3 A;  2HD5 B;  4CYE A;  4TQ1 A;  1BT0 A;  2LZ6 A;  4FAD A;  3ZVV A;  1V6E A;  4KVG B;  2WX1 A;  2L76 A;  3APD A;  3PHW B;  1KLV A;  1WYW B;  2MSE D;  2KKC A;  3K9O B;  2KTR B;  2M8S A;  3KYC D;  1Z5S B;  2DYM A;  3PPA A;  4EZL A;  1PQS A;  2NBU A;  2ZPN A;  1R4N I;  3ONS A;  1ZW7 A;  2N1W A;  2XBB C;  4W9L A;  3AU5 A;  4HCN B;  4F1S A;  2FCS A;  2OJR A;  1V2Y A;  4NQL B;  3PRE A;  3R66 C;  3PTF C;  2CU1 A;  5CHF A;  4HK2 A;  4AJW A;  2V3S A;  3B08 A;  4ICU A;  4KZ0 A;  2KDI A;  3JVZ X;  3ZNI D;  1CMX B;  4XC2 A;  2K1F A;  4II3 B;  4GIV A;  3WAM A;  2IYD B;  1SGH A;  4FN2 A;  3TBL D;  1R4M I;  3R7Q A;  2NPT A;  4LJP B;  4PS3 A;  2XEW A;  3S2A A;  4CO7 A;  5J17 A;  4K81 A;  4FJY A;  2LWP A;  4B9K A;  3VUY A;  1MG8 A;  2RGF A;  4HWI B;  2MWS B;  3K9P B;  1TZ1 A;  1WGR A;  4WWN A;  3A1Q A;  2KLC A;  1J0G A;  3DVG X;  1VD2 A;  3H7P B;  3V6C B;  2CR5 A;  1LFD A;  5HKH A;  1WGD A;  3B0A A;  4E3C A;  2DEN B;  2CS4 A;  2MBE A;  2KJH B;  3QAQ A;  4K7S A;  1L2N A;  4IG7 B;  1Q5W B;  5D2M B;  1EO6 A;  4MEL A;  3QC8 B;  3ZW3 A;  1SE9 A;  1WR6 E;  2NR2 A;  3JSV A;  4EUT A;  1Y8R C;  2NCN A;  2KMC A;  2EMT A;  4MGI E;  1YX6 B;  2LGY A;  4HDQ A;  3PZD A;  1EF5 A;  2GBJ A;  2AYO B;  4G3X B;  5J18 A;  4EZK A;  4RM9 A;  1WXM A;  3KUC B;  3QAR A;  2JXX A;  2O2V A;  3PLV A;  3ML8 A;  4JGH B;  3HK0 A;  1WH3 A;  5D6J B;  3KUD B;  3M95 A;  3RD2 A;  3PRZ A;  4G50 A;  2KC1 A;  2M1M A;  4WWP A;  2ZVN A;  4BOS C;  5JH5 C;  3ZNH B;  1V9J A;  3DDC B;  3UQB A;  4OVU A;  2C5L C;  4FLH A;  4HLE A;  2I1J A;  2K8B A;  3TL5 A;  2N9P C;  3D32 A;  3JYU A;  1XQQ A;  5D7G A;  2KAN A;  3MTN B;  1FXT B;  2FCM A;  3EHV A;  1V49 A;  4NJ7 A;  2C7H A;  2GBN A;  1U4A A;  2JY6 A;  3BIN A;  3ZTD A;  2KXJ A;  5JHB A;  4KIK B;  5DPS A;  4HPM B;  2KX3 A;  2N9E B;  4FA6 A;  1X1M A;  1WZ0 A;  2FNJ B;  1WIA A;  2GOW A;  2K25 A;  3TMP B;  2UWQ A;  2JF5 A;  3QIJ A;  4IWO A;  1E7U A;  2KNB A;  4PS7 A;  4II2 B;  2LXC A;  3ECI A;  3PRP B;  3VXW A;  1XT9 B;  2UYZ B;  2KDB A;  1GNU A;  1E5W A;  3T9L A;  1GUA B;  5LXH A;  2IBI B;  4PS8 A;  3DBR I;  2BYF A;  3QQ8 B;  4W9H A;  2KX0 A;  2ZNV B;  2LVP A;  2BGF A;  3L54 A;  4BBN F;  1WFY A;  3A4R A;  3WA0 A;  2J0M A;  4JIO U;  1L7Y A;  4XX5 A;  4IWQ A;  4W9I A;  1UBQ A;  3ZIM A;  4GDL B;  1RAX A;  2ZVO A;  3BY4 B;  1OEY A;  2IO2 B;  4IUM B;  3EC8 A;  3DBL I;  2M4N A;  1WY8 A;  2L0F A;  3SDL C;  1XD3 B;  2LRW A;  3M62 B;  4PYZ A;  4LCD E;  1LXD A;  1WF9 A;  1E8Z A;  1WE7 A;  2JT4 B;  2NS5 A;  5KHO A;  5L95 C;  2LJ5 A;  4BOZ B;  2C7M B;  3ZUN A;  1TTN A;  2MRP A;  3DCG A;  2C9W B;  2MP2 A;  3CMM B;  4FJV B;  2L8J A;  2JPH A;  2J0J A;  5IAA C;  4MSM B;  1LQB A;  2DZJ A;  4M8M A;  5CHW A;  1E8W A;  3A9K B;  2G45 B;  2OOB B;  2XK5 A;  1P3Q U;  1V5O A;  2Z0D B;  1YJ1 A;  3TJP A;  4BKS D;  4I6N B;  2BPS A;  4MJS B;  4DHZ E;  2N9X A;  3N32 A;  4IM0 A;  2KHW B;  4BFR A; 
#chains in the Genus database with same CATH topology
 4A90 A;  1RFK A;  2M19 A;  4O1N A;  1OEY J;  4NAW B;  3PRM B;  1FXI A;  4AOF A;  3SU8 X;  3AE1 B;  3L0W B;  2KJ6 A;  4A55 A;  2MLB A;  4GOC A;  4A3P A;  3FKY A;  2LVO A;  2L05 A;  2O6V B;  4GMV A;  4ZHO A;  1JRU A;  3AUL A;  2GRI A;  1MHH E;  1WJ6 A;  2EKI A;  3VR8 B;  2BKF A;  4BKG A;  2YLM A;  2IGH A;  3ZGZ A;  4M0W A;  2KFK A;  2KFJ A;  4WJQ A;  4YTN B;  1K8R B;  2IJ0 A;  5C2T B;  3T8M A;  2WWZ A;  1XXG A;  3VTV A;  3TIX A;  3WAO A;  1N62 A;  3QX1 A;  3DBR B;  2CHZ A;  1STE A;  3KUZ A;  4JWS C;  2MA9 B;  1Y56 A;  3AM9 A;  3DHH C;  2V1Y A;  5D3I B;  3UF8 A;  3AEC B;  3N1Y C;  2BB5 A;  2L52 A;  4ARI A;  4HKQ A;  2ZZP B;  1P7F A;  4NJC A;  4EEW A;  5DPW A;  1NEN B;  1D3Z A;  5D94 A;  1YN3 A;  1OTR B;  2BVC A;  2EEL A;  3GE8 C;  4LNF A;  1ISN A;  2WXL A;  2GI9 A;  2X38 A;  2I38 A;  3ZTC A;  1F0Z A;  1PGB A;  1Q1O A;  4K1R B;  4JWU C;  3NRZ A;  4RH6 A;  4YTM B;  2WDT B;  1E9M A;  4ZRK A;  1VR9 A;  2JVC A;  4GGQ A;  3P2B A;  4LNO A;  1J7B A;  2IND C;  1BUI C;  3GZN I;  3TCA A;  4FUL A;  2L00 B;  2BS3 B;  2WXM A;  4AWJ A;  1UUP A;  2PLP A;  1F1H A;  1E8Y A;  3L10 B;  1SIF A;  4ZRI A;  4LDT B;  4MJS A;  4YWG G;  2BWE S;  1TKG A;  4HKZ E;  2RD0 A;  4HRS A;  2KO3 A;  3KW5 B;  3HRD D;  1RM6 C;  4DHJ B;  3EUB 2;  4A6Q A;  2A4Z A;  2Z59 B;  2WXF A;  1VLB A;  3ZXV A;  1FNV A;  2LAS A;  3P4S B;  2RDG A;  1MHX A;  1WM2 A;  4WH4 A;  4P1C C;  4ICV A;  4USA A;  4KDL B;  1WYG A;  3AEB B;  2FCN A;  3OJ3 A;  3DVG Y;  3L16 A;  5DPR A;  1V1P B;  3VFK A;  1WMH B;  1V80 A;  2KTF A;  4IWP A;  4B6W A;  1TZO A;  3ZQ4 A;  4G11 A;  2BW2 A;  3ZNG C;  2KQ4 X;  2FAZ A;  3SEB A;  4WWO A;  4JQW C;  2GBR A;  3A9J A;  4L1B A;  2JYE A;  2MP2 B;  1TT5 B;  3U7D A;  3W1Y A;  3EGR A;  2REX A;  2R2Q A;  2XK5 B;  2BYE A;  1M4V A;  4P7I A;  1NYR A;  3I5J C;  2FCQ A;  5AZG A;  3IAS 1;  4URK A;  4N58 A;  4TMA B;  1GG3 A;  1P0R A;  2G4D B;  1UZX B;  1I4G A;  5LNK 1;  1I35 A;  5IOI A;  1KM7 A;  3RMK C;  2PE9 A;  3L13 A;  4KZC A;  2ZW0 A;  1P1A A;  2DAF A;  1YN5 A;  5KHQ A;  4BKT A;  1T5X D;  1C78 A;  3HHM A;  5LLI A;  3WAL A;  1V81 A;  1F2R C;  1WE6 A;  2PEA A;  1WXS A;  5EDS A;  3PT2 B;  3HM3 A;  1IBX A;  4E71 A;  4IM2 A;  1WXQ A;  2CHX A;  4WUR A;  4KGS A;  4ZRP A;  2DZK A;  3B2G A;  4FJZ A;  4PT5 A;  5GMV A;  3ZKJ C;  1YJI A;  2IY0 B;  4EKU A;  1C4C A;  1N61 A;  4HCP B;  3V60 A;  4MH8 A;  4WJO A;  1IGC A;  4YSZ B;  2HTH A;  2PPH A;  3I3T B;  2PVG C;  2LGX A;  3NS8 A;  1ZXI A;  4L2Y A;  2PKO A;  1R7S A;  2KOX A;  1PUT A;  4HPL B;  2LHE A;  1WI0 A;  2HJ1 A;  2CKH B;  2JQR B;  1GPX A;  2KDE B;  3X23 A;  1WWT A;  3ZDM C;  3U2S C;  1N6Z A;  4XDD A;  2Z0E B;  1C76 A;  1MFW A;  2QJL A;  3Q69 A;  1YD8 U;  4AP4 C;  4J6I A;  1Z2M A;  1R4M B;  2RR9 A;  5BMG A;  3ZRC A;  1JWM D;  2FUG 1;  3AE5 B;  3IHP C;  4MGZ E;  3JW0 X;  2BS2 B;  2PE6 B;  4ZYN A;  4TQ1 A;  1QOF A;  2AQ3 B;  5G5H A;  4KVG B;  3KWV A;  3W9C B;  2KTR B;  2DYM A;  3PPA A;  2DBY A;  2NBU A;  3ONS A;  2BS4 B;  1ZW7 A;  1GB1 A;  2FCS A;  3R66 C;  2YEP F;  3PTF C;  5CHF A;  1FRD A;  5FK9 C;  1JML A;  2V3S A;  3JVZ X;  4II3 B;  2RPV A;  1SGH A;  2LGS A;  2XN9 C;  4FN2 A;  4RF1 A;  5EE9 A;  2XEW A;  4CO7 A;  4RGT A;  4K81 A;  3NVZ A;  2RGF A;  4HWI B;  3BVG A;  2MWS B;  3P42 A;  3DVG X;  2N9K A;  1WGD A;  1UGJ A;  4E3C A;  2DWQ A;  3AE7 B;  2KJH B;  1AYF A;  1L2N A;  1Q5W B;  2J4X A;  1EO6 A;  4MEL A;  2AQ1 B;  2NR2 A;  4EUT A;  3P63 A;  4EZK A;  3MC0 B;  3O13 A;  1SJH D;  4C56 C;  3ML8 A;  1WH3 A;  2K0P A;  3GP7 A;  1MJD A;  4G50 A;  2M1M A;  2ZVN A;  1QKZ A;  3ZNH B;  4HLE A;  2I1J A;  1XQQ A;  5D7G A;  3RNA C;  3MTN B;  3R2T A;  2D5G A;  2GBN A;  3LB8 C;  4LK0 M;  3NS1 A;  3AMZ A;  5JHB A;  1XF5 L;  2KAC A;  1X1M A;  1WZ0 A;  1WIA A;  1AWD A;  4IWO A;  4PS7 A;  4II2 B;  4C4V A;  3VXW A;  1XT9 B;  1GNU A;  3T9L A;  3Q8C A;  4PS8 A;  2BYF A;  4W9H A;  1YMH E;  2OED A;  1WFY A;  2NMQ A;  1L7Y A;  2QEJ C;  4XX5 A;  2RDB C;  1IUE A;  4ARC A;  2ZVO A;  4H2A A;  2WHI A;  1I7H A;  3DBL I;  2J53 A;  3SDL C;  1WRI A;  5KHO A;  2WGS A;  4BOZ B;  2C7M B;  3OG5 A;  1T6B X;  2INP E;  2MRP A;  3DCG A;  3N9Y C;  1WGK A;  3BWU D;  1EM7 A;  2W55 A;  3A9K B;  2OOB B;  2R61 A;  2BPS A;  1JAL A;  2AEH A;  4I6P A;  5E6J A;  5JHA A;  3ZJV A;  2JXT A;  4YSX B;  2KDM A;  2K39 A;  2E6X A;  2MBH A;  3TEZ A;  3V6E B;  1VZ7 A;  3PGE A;  1YIW A;  2D3G A;  4GN1 A;  4EE2 A;  4W9G A;  1TS2 A;  4P1B C;  2DZM A;  5BYQ A;  2WXP A;  3LXF A;  4IM3 A;  1ZP0 B;  4XE0 A;  2L3Z A;  2MBB B;  3IT6 B;  1KF6 B;  2DAJ A;  2I1K A;  1KOT A;  4W9K A;  1N60 A;  2B3A A;  1FCC C;  3DVN U;  4K7U A;  1F52 A;  4IDI A;  3QJZ A;  4DXA B;  2W82 A;  3NZS A;  3HIZ A;  1WXA A;  3IXS A;  2KJR A;  2VRR B;  3KLS X;  2FUH B;  5CX3 A;  4KIK A;  2VH2 A;  2IPK D;  3DBL B;  4HJK A;  3AED B;  3SD5 A;  5IP4 D;  1T0Y A;  2LJI A;  2WS3 B;  1C4A A;  4YSY B;  1C77 A;  3Q3N C;  1ET6 A;  3GOE A;  2V3P A;  1M94 A;  3B2F A;  2KYW A;  1F9J A;  3O65 B;  2LUM A;  3VHT C;  1I4H A;  2IZV B;  4GDL A;  1BML C;  4KDI C;  4WWM A;  3TEY A;  1Q10 A;  1TGZ B;  3NZU A;  1YN4 A;  1UBI A;  4KV2 A;  4B95 A;  1UEL A;  1QOB A;  3ETR A;  2KDF B;  1LGR A;  1V5T A;  3ALB A;  4A3O A;  3NOB A;  2L1A A;  3W5U B;  2C7N B;  3Q3F A;  2IDY A;  1SF0 A;  2KQS A;  2J7Q B;  4NAW A;  4TUU A;  3RZF A;  4XWW A;  2FIF A;  4KSK C;  2BBC A;  2JU6 X;  4ITK A;  3BK1 A;  1HZ5 A;  5L83 A;  2DYO A;  1OQY A;  2O6V A;  2FE8 A;  2L7R A;  3DHI C;  3M3J A;  5BMH A;  1XLN A;  2NVU I;  4DHZ B;  2DZI A;  4YTP B;  1FCL A;  2L83 A;  1B9R A;  3N20 C;  2J52 A;  2K22 A;  2JWZ A;  3KVF B;  4X57 B;  3PSE B;  4ANW A;  2KLG A;  3FC4 A;  1UH6 A;  1ESF A;  2WQY B;  4FBJ B;  3ZO5 B;  3AU4 A;  2FBW B;  4WJN A;  5IKC M;  2BYV E;  4AUQ C;  4WAF A;  4RGN A;  1WJU A;  3GB1 A;  4MM3 B;  1UNS A;  4F8C B;  4HPP A;  1I4Q A;  1HE8 A;  5JZE B;  2ASQ A;  2E3T A;  1EUV B;  4NNJ B;  2RDH A;  1JWS D;  2JX5 A;  1XCT L;  5T8I A;  3W1S A;  3AV8 A;  3WIM A;  3AI5 A;  4TKN A;  1IPG A;  4ANU A;  1NBF C;  1C1Y B;  2M0A A;  3PLU A;  3A4S C;  5J2R A;  1NI2 A;  4NJ6 A;  2NPT B;  2AWT A;  3MC9 A;  4MH0 E;  5E6O A;  3A1Q B;  1L0Y B;  2M0X A;  4M0W B;  1CQV A;  1HXY D;  2KFK B;  2W9N A;  4OZA A;  1TS3 A;  1WX7 A;  3ZRF A;  2V3N A;  3Q14 C;  3PV1 A;  3VRA B;  4GB9 A;  1XLO A;  2LFI A;  3C8Y A;  3QCA A;  4J3O D;  1J8C A;  1UWM A;  1WXV A;  1GC6 A;  2MX2 A;  3UGB B;  3V3X A;  4BKS A;  4JX1 C;  1VCB A;  1FXA A;  1IP9 A;  4WQO B;  5D3D A;  2GLS A;  4OZB A;  4ACF A;  3UQA A;  2D2Q A;  2Y5C A;  1YQB A;  3Q8B A;  1KLG D;  3V62 A;  3FIL A;  2IO0 B;  4BVU C;  2LGD A;  2DLB A;  2K6D B;  4MGY E;  1WGY A;  1YQ4 B;  1RWS A;  1JCK B;  1V1P A;  2H88 B;  3L4P A;  3PZ7 A;  1WGG A;  5TR5 A;  1WMH A;  1E6E B;  4KGT A;  2ICI A;  4GDK A;  4US9 A;  4YL8 A;  1T0Q C;  1XLQ A;  1I4P A;  3AE2 B;  5AUK A;  4W9C A;  2KMM A;  1RFA A;  1ENF A;  2HD5 B;  4CYE A;  4TSS A;  2LZ6 A;  1V6E A;  5BMI A;  3PHW B;  3BK2 A;  3U4E G;  1WYW B;  3P1M A;  2MSE D;  3K9O B;  2M8S A;  3FAH A;  1BXT A;  1R4N I;  4W9L A;  4HCN B;  4F1S A;  2WU5 B;  2OJR A;  2CU3 A;  3UI3 A;  1TS5 A;  2N0S B;  1K52 A;  2KDI A;  4KZ0 A;  2K9X A;  3ZNI D;  5I4D A;  2K1F A;  4XDC A;  4ZYS A;  1R4M I;  4PS3 A;  4LJP B;  3S2A A;  2QIE B;  1PGX A;  1MG8 A;  5FR3 A;  1NEK B;  1WGR A;  4WWN A;  1J0G A;  1VD2 A;  3B0A A;  2DEN B;  1SIJ A;  2CS4 A;  2MBE A;  4K7S A;  2VZK D;  1SE9 A;  1WR6 E;  2BB6 A;  2EMT A;  4KX6 B;  4HDQ A;  2GBJ A;  2AYO B;  4G3X B;  5HI1 A;  3BVZ A;  2VH1 A;  3QAR A;  3RN9 C;  3TEW A;  3PLV A;  1V8C A;  1JRP A;  1DOX A;  4HJG E;  2KC1 A;  4WWP A;  4BOS C;  1NVI D;  3DDC B;  3UQB A;  4OVU A;  2C5L C;  2WNM A;  4RFB A;  2N9P C;  3JYU A;  4LNK A;  4K3B A;  1FXT B;  2FCM A;  4RGO S;  1V49 A;  1U4A A;  4BZA A;  4ZOH C;  2V0G A;  3BIN A;  3ZTD A;  5DPS A;  4FA6 A;  2GOW A;  2K25 A;  2UWQ A;  2JF5 A;  2JSV X;  3RPF C;  1YNT E;  1R4N B;  2WXJ A;  4XWT A;  3W5V B;  1L5P A;  3QQ8 B;  1KLU D;  1IBX B;  3HVZ A;  3L54 A;  3HUI A;  3RI7 C;  3RNB C;  3PZ8 A;  1CJE A;  2AQ2 B;  2IO2 B;  4IUM B;  3OWE B;  3LYY A;  2M4N A;  1TY2 A;  1XD3 B;  2C9W B;  3CMM B;  2J0J A;  4MSM B;  1LQB A;  2DZJ A;  1E8W A;  3I9V 1;  3N1Z C;  3ZYY X;  1P3Q U;  4K3C A;  2LEK A;  4BKS D;  3N32 A;  3VDZ A;  1L6U A;  2JZ3 B;  2KQ7 A;  3IG3 A;  2ACZ B;  4IC7 B;  3RYT A;  3PVL A;  4JL9 A;  4MAC A;  3P4P B;  3VUX A;  1PFD A;  2ZCB A;  3EFC A;  2KD0 A;  3L17 A;  1QZE A;  2KWV B;  1V97 A;  4HDO A;  2D11 A;  3RCZ A;  4C7Y A;  2KC2 A;  2QSD A;  5H92 C;  3CSF A;  1VZ8 A;  2GBK A;  4HXD A;  1F2R I;  2MW5 A;  1TS4 A;  5HFY A;  1TKE A;  2K6Q A;  5C23 A;  1ZDX A;  4A20 A;  1H8C A;  4HRO A;  1ZGU B;  2WX0 A;  2C60 A;  2V4I B;  2ZNV C;  4NPN A;  1GC7 A;  1XCQ L;  1XO3 A;  1LM8 B;  4JLC A;  5MPO A;  2BTE A;  1I4X A;  4TV3 A;  4GU2 A;  2MCN B;  2LD9 A;  2G3Q B;  3MHZ A;  2OHF A;  1H4R A;  2K5P A;  2KVR A;  1C4P A;  2KK8 A;  1C79 A;  1N63 A;  2NBW B;  4ZHP A;  2LHD A;  3LDZ E;  4AJY B;  2Y5P A;  1L6V A;  3PS6 A;  4IW0 A;  3V05 A;  4XZ4 A;  2CJO A;  3MHS D;  4KKI A;  2ZJD A;  3NVY A;  1TYG B;  2V4L A;  3AE9 B;  3Q2A C;  2BYT A;  4W9D A;  2PMV A;  4BBN C;  4GSW A;  1ET9 A;  4L23 A;  1ZUD 2;  1JRO A;  1SXT A;  3VH3 B;  3OAW A;  1WGH A;  2HE7 A;  5GXG B;  1SE3 A;  2CHW A;  3MJW A;  1D4B A;  1WM3 A;  4P6V F;  4OVV A;  3WAN A;  3H6N A;  2NBV B;  3KYD D;  4ASW C;  5G2N A;  3HVD A;  4C4V B;  1WX9 A;  1MI0 A;  2AL6 A;  4DWF A;  2IO3 B;  1TJE A;  1E0Z A;  4ANX A;  1JW9 D;  4HEA 1;  3H7P A;  1N5W A;  2W54 A;  2NTT A;  2M56 B;  2KWU B;  1HZ6 A;  5CTR C;  2BKR B;  1WJ4 A;  3W1S C;  1XLP A;  3IVF A;  3AEA B;  1E10 A;  4LJO B;  4I6L B;  1NI3 A;  3ENE A;  4Q2J A;  1UF0 A;  3VVW B;  4RMA A;  5AEK B;  2EKE C;  1E7V A;  3VAW A;  4IKG A;  1EU4 A;  3U8Z A;  3AE3 B;  5C1Z A;  2I2Y A;  1XEE A;  4NQK E;  5FKA C;  3VUW A;  1EF1 A;  2L0T A;  2GBM A;  3OJ4 B;  1DGJ A;  1P98 A;  4N6E B;  2WXN A;  4PK1 A;  5BYR A;  3MFG A;  2WXO A;  4OZC A;  3Q3O C;  1EU3 A;  2WXK A;  4FHK A;  3AXC A;  4B0E A;  4DBG A;  2LRU A;  3CF6 E;  4EZJ A;  1YOV B;  2MH7 A;  3NG0 A;  3P4R B;  3RZW C;  4E74 A;  3NVW A;  1QLB B;  3IAM 1;  3AEE B;  2HJ8 A;  4NY0 A;  1I42 A;  5LXI B;  2ZEQ A;  1NDD A;  2RSU A;  3CIR B;  1WX8 A;  3EFU A;  3JSV B;  5IO9 A;  2ONQ A;  3CST A;  1ROE A;  2K8C A;  3DOW A;  4ZDV A;  1ZKH A;  2Y5B B;  1HTO A;  1OFF A;  2BF8 B;  3Q8A A;  5E6P A;  4FXC A;  1KTK A;  2O2V B;  3VTU A;  1LO5 D;  2N7J A;  2G9H D;  3ZLZ A;  2X8X X;  4PYU A;  2RPQ A;  2D07 B;  4DQO C;  4RNA A;  1OGW A;  4OW0 A;  4WAA A;  1GJZ A;  1PYW D;  2FID A;  1P7E A;  1TY0 A;  3BVM A;  3DQV A;  2PTL A;  3DBS A;  1FM0 D;  1T3Q A;  1F77 A;  1UWX A;  3OLM D;  1FD6 A;  4WJP A;  3APC A;  4LLG M;  4M00 A;  5HHD G;  3ABV B;  2K3U A;  3R3M A;  2KZR A;  2LVQ A;  3R7R A;  2WDQ B;  1WZ3 A;  1VJK A;  2IY1 B;  3QHT A;  3H1U A;  3X0W A;  3WAP A;  3AE8 B;  2JZZ A;  4W9E A;  1DOY A;  3RT3 B;  4MM3 A;  5IN7 A;  3J9C A;  1IGD A;  4FAD A;  3AH7 A;  2WXG A;  2WX1 A;  2L76 A;  3APD A;  4US8 A;  3KYC D;  4EZL A;  1PQS A;  2ZPN A;  1DOI A;  3MJ5 A;  2KAJ A;  1KFY B;  1VRA B;  3VR9 B;  2Q5W D;  3U7Z A;  3B9J A;  3AB5 A;  1V2Y A;  4NQL B;  4HK2 A;  4AJW A;  3B08 A;  4ICU A;  4RF0 A;  1CMX B;  1JWU D;  4GIV A;  3WAM A;  2NPT A;  5J17 A;  1VDV A;  3K9P B;  4LNN A;  3A1Q A;  3TUO A;  2VZK B;  5EE3 A;  4KKJ A;  5HKH A;  1ACC A;  3Q3M C;  3QAQ A;  4IG7 B;  1QF6 A;  3QC8 B;  1Y8R C;  2QC8 A;  4MGI E;  2B76 B;  2GB1 A;  4NAM A;  1EF5 A;  4C00 A;  5J18 A;  3W2D A;  1WXM A;  4N59 A;  3KUC B;  2JXX A;  4JGH B;  3MC8 A;  2L32 A;  1CK1 A;  1FPY A;  3KUD B;  3ZJU A;  3NJT A;  1L0X B;  2AX5 A;  3N1X C;  3GS2 A;  1QQR A;  2K8B A;  3D32 A;  3RNC C;  4HPM B;  2KX3 A;  2N9E B;  3TMP B;  1FRR A;  2XNA C;  3EA6 A;  2KNB A;  2LXC A;  3ECI A;  1WSP A;  2UYZ B;  3DWG C;  3DWM A;  2IBI B;  2NTS A;  4D2K A;  1SE2 A;  1SEB D;  2LVP A;  2BGF A;  3WA0 A;  4MT5 A;  4IWQ A;  4YT0 B;  4W9I A;  1UBQ A;  5H8Y E;  3ZIM A;  1OEY A;  4KGR A;  3EC8 A;  1ZXH A;  2L0F A;  4AQ7 A;  2G1E A;  3M62 B;  4PYZ A;  1E8Z A;  2JT4 B;  3MP9 A;  2BT6 A;  1TTN A;  2MP2 A;  4FJV B;  2IGD A;  4M8M A;  3Q6B A;  5CHW A;  2V9H A;  4WIP A;  2XK5 A;  1V5O A;  1NYQ A;  1YJ1 A;  2Z0D B;  4MJS B;  4DHZ E;  4A8X C;  4REZ A;  1WR1 A;  3FIL B;  4ANV A;  1MPE A;  3NY5 A;  1J19 A;  1WJN A;  2W3S A;  2INC C;  2TSS A;  4LNI A;  4UDU C;  1P9D U;  1C3T A;  2QIL A;  3NZ3 A;  2K8H A;  4MGK E;  4B0M A;  2JZP A;  3PHX B;  4MEM A;  1JWB D;  2PVO D;  2IO1 B;  3SFD B;  2PW9 A;  4GDK B;  4XGA B;  1WRD B;  2WLB A;  3SR6 A;  2WXH A;  2O6V D;  4LTU A;  3QA8 A;  3U30 A;  1RRB A;  4EOY A;  3ZXR A;  3QWZ B;  4P16 A;  2LXA A;  1UGM A;  4DDG D;  1KH0 A;  3UIO B;  2D10 A;  3NHE B;  2WDV B;  3NUH B;  2KWC A;  2LUE A;  1FO4 A;  3GE3 C;  1QT9 A;  1A5R A;  2MEK A;  1ZE3 D;  2W3R A;  3A9J B;  3SHQ A;  2PJH A;  4RGM A;  1S1Q B;  2INN E;  3DPD A;  1N5X A;  3BZD B;  3GZN B;  4KSL C;  1AAR A;  2J0K A;  3HM6 X;  3ZNZ B;  5TSS A;  3T3N A;  3KWL A;  5BYS A;  2AL3 A;  2D3B A;  2R2O A;  4AS1 A;  3V61 A;  3C0R B;  2KWD A;  3UIP B;  2KMA A;  2JRH A;  4NZL B;  4S17 A;  5IA7 A;  3SFE B;  1YX5 B;  1AN8 A;  3WCQ A;  4BAX A;  4ZRQ A;  3Q8E A;  1IYF A;  5AUI A;  4DK5 A;  2QCZ A;  1J7A A;  3N3K B;  3U52 E;  4MSQ B;  1SB3 C;  3Q3J A;  5AZH A;  2ZCC A;  1K51 A;  3ZDT A;  4CQN A;  1QOG A;  2M17 A;  4F7Z A;  2KTR A;  1CZP A;  2Z8L A;  3AE4 B;  2Y3A A;  3APF A;  3I63 C;  3L08 A;  4LDT D;  4RM8 A;  1L0V B;  2CJN A;  4IOI E;  1HEZ E;  3H9D A;  1MG4 A;  3AEG B;  1C9F A;  4DXF A;  2N7D A;  2WYQ A;  4DHJ D;  5FR6 A;  1TKY A;  1FFV A;  5BO4 B;  4DDI D;  2A5U A;  3H8H A;  2SAK A;  3EEC A;  3A33 B;  1K53 A;  4OHJ A;  2WXQ A;  1K50 A;  2DYB A;  3VTW A;  2DX5 B;  4QAY A;  2PIA A;  1G6J A;  4GXB A;  3E9S A;  3DVN V;  2BWF A;  2N1V A;  1FFU A;  1TBE A;  1EWY C;  3BII D;  1HQR D;  5EE1 A;  1PDX A;  1V1O A;  2MJD A;  2ZPY A;  1E90 A;  5HG2 A;  3VQI A;  5AZF A;  3TEX A;  4K7W A;  2UU7 A;  4N9F 4;  3N30 A;  3Q8F A;  4TQ0 A;  1GB4 A;  1T0R C;  2KN4 A;  3TSS A;  1AW7 A;  5E6N A;  4HVB A;  5DPT A;  1FEH A;  1EWC A;  2GMI C;  3VH4 B;  1KJT A;  2G4S A;  2HTM E;  4W9J A;  2MJ3 A;  3KQ4 A;  3RUI B;  2MBQ A;  2LI5 A;  1UD7 A;  3DHG C;  3T3O A;  2EMS A;  2YVC A;  2HDE A;  3QK0 A;  3B1L X;  2QHO A;  3VRB B;  2MQJ A;  1FMA D;  3IBE A;  2LGI A;  4G0N B;  3DBH I;  3CWI A;  1D6E C;  2N4F A;  1J7C A;  1V86 A;  1KRH A;  2LMC A;  2N9L A;  2JUO A;  4W9F A;  3C19 A;  1PGA A;  2JRI B;  4M01 A;  1S3S G;  3AN1 A;  2QMT A;  1DYQ A;  2N7E A;  2RMM A;  3UIN B;  1GAQ B;  3BYY B;  2YEP B;  3H7S A;  4S0R A;  3IFW B;  2BQQ A;  1GOZ A;  1QIL A;  2J42 A;  3RNF C;  4MDK E;  2DHZ A;  3URY A;  3M63 B;  5CHV C;  5DCN A;  1D5M C;  3ML9 A;  1ZDV A;  3A9K A;  5G55 A;  1SSN A;  1RLF A;  4EFO A;  3E56 A;  2MJE A;  1E8X A;  3RFZ B;  4M02 A;  2SEB D;  2KN5 A;  2MBO A;  3I57 A;  1HTQ A;  1Q0W B;  3R2I A;  3LJ3 A;  3AEF B;  4RCO A;  4XYC A;  2H89 B;  4FHJ A;  1L4Z B;  1L4D B;  3RUL A;  4M8N A;  4CHK A;  4C80 A;  3KH0 A;  4ZRJ A;  1YQ3 B;  3P4Q B;  1BT0 A;  3ZVV A;  1KLV A;  2JWU A;  2ON8 A;  1T0S C;  2D3C A;  2KKC A;  1ZOY B;  5JXV A;  1D5X C;  1Z5S B;  1D5Z C;  5G5G A;  2N1W A;  2XBB C;  1HA5 A;  3DBH B;  3AU5 A;  2WXR A;  4YXD B;  5C3J B;  2DNF A;  3PRE A;  2CU1 A;  1FNW A;  3NVV A;  2QDF A;  4OVZ A;  3PO0 A;  4XC2 A;  2WXI A;  2IYD B;  3TBL D;  3R7Q A;  4FJY A;  2LWP A;  4B9K A;  3VUY A;  1TZ1 A;  1MVK A;  2KLC A;  4C7Z A;  3H7P B;  3V6C B;  2CR5 A;  1LFD A;  1JWA D;  2D3A A;  3IT4 B;  1A70 A;  5D2M B;  1SE4 A;  3ZW3 A;  3JSV A;  1JQ4 A;  2NCN A;  2KMC A;  4DXG A;  2KVZ A;  1YX6 B;  2LGY A;  3PZD A;  2KT7 A;  4RM9 A;  1OQR A;  1SJE D;  2O2V A;  3HK0 A;  1B1Z A;  5D6J B;  3M95 A;  3RD2 A;  3PRZ A;  1VZ6 A;  3RNG C;  5JH5 C;  1V9J A;  4FLH A;  3TL5 A;  2KAN A;  4JE3 B;  1OQQ A;  3EHV A;  4NJ7 A;  2C7H A;  2MHJ A;  2KHW B;  1E7P B;  2JYT A;  2JY6 A;  2KXJ A;  4KIK B;  3R8B A;  2FNJ B;  3RNE C;  3QIJ A;  1E7U A;  3PRP B;  4JPS A;  2KDB A;  3AE6 B;  1E5W A;  1GUA B;  5LXH A;  2WU2 B;  1FNU A;  1FIQ A;  3DBR I;  2ZW1 A;  2KX0 A;  2ZNV B;  4BBN F;  2WDR B;  3A4R A;  3BYT B;  2J0M A;  4JIO U;  2OJW A;  3ZJT A;  4GDL B;  1RAX A;  3BY4 B;  1WY8 A;  2LRW A;  4LCD E;  1LXD A;  1WF9 A;  1WE7 A;  1TIF A;  2NS5 A;  2WP9 B;  5L95 C;  2LJ5 A;  4A9A A;  1I4R A;  3ZUN A;  4WQM A;  2IGG A;  2L8J A;  2JPH A;  5IAA C;  1SBB B;  1RYJ A;  1YJJ A;  2G45 B;  4R3D A;  5EE0 A;  1ZPS A;  3TJP A;  4I6N B;  1QOA A;  2N9X A;  4IM0 A;  4GLS C;  4BFR A; 
#chains in the Genus database with same CATH homology
 1WR1 A;  2AEH A;  4I6P A;  4ANV A;  3NY5 A;  1J19 A;  1OEY J;  1WJN A;  2JZ3 B;  5JHA A;  2KQ7 A;  4NAW B;  3IG3 A;  4IC7 B;  1P9D U;  3PRM B;  3RYT A;  1C3T A;  2K39 A;  2K8H A;  4MGK E;  2MBH A;  3PVL A;  3SU8 X;  4AOF A;  4JL9 A;  3L0W B;  3PHX B;  2KJ6 A;  3VUX A;  3V6E B;  4MEM A;  2MLB A;  2ZCB A;  1YIW A;  3PGE A;  2KD0 A;  2LVO A;  3L17 A;  2D3G A;  2L05 A;  2IO1 B;  2O6V B;  4GMV A;  4GN1 A;  1QZE A;  4GDK B;  1JRU A;  1WRD B;  3AUL A;  2KWV B;  4W9G A;  2DZM A;  4HDO A;  2D11 A;  4IM3 A;  2O6V D;  1WJ6 A;  3RCZ A;  2BKF A;  2KC2 A;  4BKG A;  2YLM A;  3CSF A;  3QA8 A;  2L3Z A;  2MBB B;  3U30 A;  2GBK A;  4HXD A;  2KFK A;  1RRB A;  2KFJ A;  4EOY A;  3QWZ B;  2MW5 A;  4WJQ A;  2LXA A;  1UGM A;  2DAJ A;  4DDG D;  2I1K A;  1KOT A;  4W9K A;  3UIO B;  2B3A A;  1K8R B;  2D10 A;  2K6Q A;  3NHE B;  5C23 A;  2WWZ A;  3DVN U;  4K7U A;  3T8M A;  3VTV A;  4A20 A;  2KWC A;  2LUE A;  3TIX A;  1H8C A;  3QJZ A;  1A5R A;  1ZGU B;  3WAO A;  2WX0 A;  4DXA B;  2C60 A;  2ZNV C;  3NZS A;  3A9J B;  3SHQ A;  2PJH A;  3HIZ A;  1S1Q B;  3QX1 A;  4NPN A;  1WXA A;  2CHZ A;  1GC7 A;  2KJR A;  3DPD A;  3KUZ A;  1LM8 B;  2VRR B;  2MA9 B;  2FUH B;  4JLC A;  5CX3 A;  4KSL C;  4TV3 A;  4KIK A;  1AAR A;  2J0K A;  3HM6 X;  3ZNZ B;  2V1Y A;  4GU2 A;  3UF8 A;  2MCN B;  2LD9 A;  2AL3 A;  4HJK A;  2G3Q B;  3SD5 A;  1T0Y A;  2R2O A;  2ZZP B;  1H4R A;  4EEW A;  3GOE A;  2KVR A;  5DPW A;  3V61 A;  1M94 A;  3C0R B;  2KK8 A;  2KMA A;  3UIP B;  2JRH A;  3VDZ A;  1F9J A;  3O65 B;  1D3Z A;  5D94 A;  3VHT C;  2IZV B;  5IA7 A;  1OTR B;  1ISN A;  2NBW B;  1YX5 B;  3LDZ E;  4GDL A;  4AJY B;  3ZTC A;  4KDI C;  1TGZ B;  1IYF A;  1Q1O A;  3NZU A;  4K1R B;  3PS6 A;  4IW0 A;  4XZ4 A;  1UBI A;  4KV2 A;  3MHS D;  4DK5 A;  2ZJD A;  4B95 A;  2WDT B;  1UEL A;  3N3K B;  4ZRK A;  2V4L A;  2JVC A;  4GGQ A;  4MSQ B;  2KDF B;  3P2B A;  3Q3J A;  5AZH A;  2ZCC A;  4W9D A;  3ZDT A;  3GZN I;  1V5T A;  3ALB A;  3TCA A;  4FUL A;  2L00 B;  4AWJ A;  4A3O A;  3NOB A;  4BBN C;  1E8Y A;  2M17 A;  3L10 B;  4GSW A;  1SIF A;  2C7N B;  4ZRI A;  3Q3F A;  2KTR A;  4LDT B;  4F7Z A;  4MJS A;  3VH3 B;  2KQS A;  2J7Q B;  3OAW A;  2BWE S;  1WGH A;  2HE7 A;  3APF A;  2RD0 A;  3L08 A;  4LDT D;  4NAW A;  4TUU A;  2KO3 A;  3KW5 B;  4RM8 A;  2CHW A;  3RZF A;  3H9D A;  4DHJ B;  3MJW A;  2FIF A;  1WM3 A;  4KSK C;  4GOC A;  5L83 A;  4OVV A;  3WAN A;  3H6N A;  2A4Z A;  2N7D A;  2NBV B;  2DYO A;  2Z59 B;  2WYQ A;  1OQY A;  2O6V A;  4DHJ D;  5FR6 A;  3KYD D;  4ASW C;  2LAS A;  5BO4 B;  4DDI D;  2L7R A;  5G2N A;  2A5U A;  1WX9 A;  3M3J A;  1WM2 A;  2AL6 A;  4DWF A;  4ICV A;  2NVU I;  2IO3 B;  3EEC A;  4KDL B;  3A33 B;  4DHZ B;  2DZI A;  2FCN A;  3OJ3 A;  3DVG Y;  3L16 A;  5DPR A;  4ANX A;  2DYB A;  3H7P A;  3VTW A;  2DX5 B;  2JWZ A;  3KVF B;  4X57 B;  3PSE B;  3VFK A;  1WMH B;  1V80 A;  4ANW A;  2KLG A;  2KTF A;  1UH6 A;  4IWP A;  4B6W A;  1G6J A;  2KWU B;  4GXB A;  5CTR C;  4G11 A;  4FBJ B;  3ZNG C;  2BKR B;  1WJ4 A;  3W1S C;  3ZO5 B;  3DVN V;  2FAZ A;  3AU4 A;  4WWO A;  2BWF A;  4JQW C;  2N1V A;  2GBR A;  1TBE A;  3A9J A;  3IVF A;  4WJN A;  2BYV E;  4LJO B;  4AUQ C;  4I6L B;  1WJU A;  3ENE A;  2MP2 B;  3VVW B;  3U7D A;  4F8C B;  4RMA A;  5AEK B;  2EKE C;  3W1Y A;  2ZPY A;  1E7V A;  3VAW A;  2REX A;  2R2Q A;  2XK5 B;  1E90 A;  2BYE A;  4P7I A;  1HE8 A;  5JZE B;  2ASQ A;  2FCQ A;  5AZG A;  3VQI A;  5AZF A;  4URK A;  1EUV B;  1GG3 A;  1P0R A;  4K7W A;  4NNJ B;  4N9F 4;  3N30 A;  4TQ0 A;  2G4D B;  3U8Z A;  5C1Z A;  1UZX B;  4NQK E;  1I35 A;  1KM7 A;  3VUW A;  5E6N A;  1EF1 A;  3W1S A;  2L0T A;  2PE9 A;  5DPT A;  4HVB A;  2GBM A;  3OJ4 B;  2GMI C;  1P98 A;  3L13 A;  4KZC A;  3VH4 B;  3WIM A;  1KJT A;  1P1A A;  3AI5 A;  4TKN A;  1IPG A;  2G4S A;  4ANU A;  1NBF C;  4W9J A;  2DAF A;  1C1Y B;  5KHQ A;  3PLU A;  4BKT A;  3HHM A;  5LLI A;  3WAL A;  3A4S C;  5J2R A;  3RUI B;  2MBQ A;  2LI5 A;  1NI2 A;  1V81 A;  1UD7 A;  4NJ6 A;  4FHK A;  2NPT B;  3AXC A;  2AWT A;  2EMS A;  2YVC A;  4DBG A;  2LRU A;  3CF6 E;  4EZJ A;  3QK0 A;  3B1L X;  1WE6 A;  2PEA A;  1WXS A;  2MQJ A;  2QHO A;  5EDS A;  3IBE A;  3RZW C;  4G0N B;  4E74 A;  4MH0 E;  3DBH I;  3PT2 B;  5E6O A;  3A1Q B;  2N4F A;  2M0X A;  3HM3 A;  4M0W B;  2KFK B;  2W9N A;  1V86 A;  4E71 A;  4IM2 A;  2CHX A;  2HJ8 A;  2JUO A;  1WX7 A;  2DZK A;  4NY0 A;  4W9F A;  1I42 A;  5LXI B;  2ZEQ A;  4FJZ A;  1NDD A;  2RSU A;  3EFU A;  1WX8 A;  5GMV A;  3JSV B;  3ZRF A;  3PV1 A;  2JRI B;  1S3S G;  4GB9 A;  3ZKJ C;  3CST A;  3QCA A;  2IY0 B;  2K8C A;  2N7E A;  3DOW A;  4EKU A;  4ZDV A;  4HCP B;  1ZKH A;  2Y5B B;  3UIN B;  3V60 A;  1J8C A;  2BF8 B;  5E6P A;  3H7S A;  1WXV A;  4WJO A;  3IFW B;  1GC6 A;  2HTH A;  2O2V B;  2PPH A;  3I3T B;  2LGX A;  4A3P A;  3NS8 A;  4MDK E;  3VTU A;  2DHZ A;  2MX2 A;  3M63 B;  3UGB B;  4BKS A;  5CHV C;  5DCN A;  3ML9 A;  1VCB A;  3ZLZ A;  1IP9 A;  3A9K A;  4PYU A;  2RPQ A;  5G55 A;  4WQO B;  2D07 B;  1RLF A;  3UQA A;  4EFO A;  1E8X A;  1OGW A;  2D2Q A;  1YQB A;  2KOX A;  4WAA A;  1GJZ A;  2KN5 A;  2FID A;  4HPL B;  3V62 A;  4BVU C;  2IO0 B;  1WI0 A;  2MBO A;  2LGD A;  3DQV A;  2CKH B;  1Q0W B;  2K6D B;  3DBS A;  4MGY E;  1WGY A;  2KDE B;  3LJ3 A;  3X23 A;  3OLM D;  3ZDM C;  4WJP A;  3APC A;  2Z0E B;  4FHJ A;  1YD8 U;  1WGG A;  5TR5 A;  4AP4 C;  3R3M A;  1WMH A;  2KZR A;  2LVQ A;  4J6I A;  3RUL A;  3R7R A;  1WZ3 A;  1Z2M A;  4GDK A;  2IY1 B;  3QHT A;  2RR9 A;  4M8N A;  4YL8 A;  3H1U A;  3ZRC A;  4CHK A;  3X0W A;  3WAP A;  3KH0 A;  4W9C A;  4ZRJ A;  3IHP C;  2JZZ A;  4MGZ E;  1RFA A;  3JW0 X;  2PE6 B;  4W9E A;  4ZYN A;  3RT3 B;  4MM3 A;  2HD5 B;  4CYE A;  4TQ1 A;  1BT0 A;  2LZ6 A;  4FAD A;  3ZVV A;  1V6E A;  4KVG B;  2WX1 A;  2L76 A;  3APD A;  3PHW B;  1KLV A;  1WYW B;  2MSE D;  2KKC A;  3K9O B;  2KTR B;  2M8S A;  3KYC D;  1Z5S B;  2DYM A;  3PPA A;  4EZL A;  1PQS A;  2NBU A;  2ZPN A;  1R4N I;  3ONS A;  1ZW7 A;  2N1W A;  2XBB C;  4W9L A;  3AU5 A;  4HCN B;  4F1S A;  2FCS A;  2OJR A;  1V2Y A;  4NQL B;  3PRE A;  3R66 C;  3PTF C;  2CU1 A;  5CHF A;  4HK2 A;  4AJW A;  2V3S A;  3B08 A;  4ICU A;  4KZ0 A;  2KDI A;  3JVZ X;  3ZNI D;  1CMX B;  4XC2 A;  2K1F A;  4II3 B;  4GIV A;  3WAM A;  2IYD B;  1SGH A;  4FN2 A;  3TBL D;  1R4M I;  3R7Q A;  2NPT A;  4LJP B;  4PS3 A;  2XEW A;  3S2A A;  4CO7 A;  5J17 A;  4K81 A;  4FJY A;  2LWP A;  4B9K A;  3VUY A;  1MG8 A;  2RGF A;  4HWI B;  2MWS B;  3K9P B;  1TZ1 A;  1WGR A;  4WWN A;  3A1Q A;  2KLC A;  1J0G A;  3DVG X;  1VD2 A;  3H7P B;  3V6C B;  2CR5 A;  1LFD A;  5HKH A;  1WGD A;  3B0A A;  4E3C A;  2DEN B;  2CS4 A;  2MBE A;  2KJH B;  3QAQ A;  4K7S A;  1L2N A;  4IG7 B;  1Q5W B;  5D2M B;  1EO6 A;  4MEL A;  3QC8 B;  3ZW3 A;  1SE9 A;  1WR6 E;  2NR2 A;  3JSV A;  4EUT A;  1Y8R C;  2NCN A;  2KMC A;  2EMT A;  4MGI E;  1YX6 B;  2LGY A;  4HDQ A;  3PZD A;  1EF5 A;  2GBJ A;  2AYO B;  4G3X B;  5J18 A;  4EZK A;  4RM9 A;  1WXM A;  3KUC B;  3QAR A;  2JXX A;  2O2V A;  3PLV A;  3ML8 A;  4JGH B;  3HK0 A;  1WH3 A;  5D6J B;  3KUD B;  3M95 A;  3RD2 A;  3PRZ A;  4G50 A;  2KC1 A;  2M1M A;  4WWP A;  2ZVN A;  4BOS C;  5JH5 C;  3ZNH B;  1V9J A;  3DDC B;  3UQB A;  4OVU A;  2C5L C;  4FLH A;  4HLE A;  2I1J A;  2K8B A;  3TL5 A;  2N9P C;  3D32 A;  3JYU A;  1XQQ A;  5D7G A;  2KAN A;  3MTN B;  1FXT B;  2FCM A;  3EHV A;  1V49 A;  4NJ7 A;  2C7H A;  2GBN A;  1U4A A;  2JY6 A;  3BIN A;  3ZTD A;  2KXJ A;  5JHB A;  4KIK B;  5DPS A;  4HPM B;  2KX3 A;  2N9E B;  4FA6 A;  1X1M A;  1WZ0 A;  2FNJ B;  1WIA A;  2GOW A;  2K25 A;  3TMP B;  2UWQ A;  2JF5 A;  3QIJ A;  4IWO A;  1E7U A;  2KNB A;  4PS7 A;  4II2 B;  2LXC A;  3ECI A;  3PRP B;  3VXW A;  1XT9 B;  2UYZ B;  2KDB A;  1GNU A;  1E5W A;  3T9L A;  1GUA B;  5LXH A;  2IBI B;  4PS8 A;  3DBR I;  2BYF A;  3QQ8 B;  4W9H A;  2KX0 A;  2ZNV B;  2LVP A;  2BGF A;  3L54 A;  4BBN F;  1WFY A;  3A4R A;  3WA0 A;  2J0M A;  4JIO U;  1L7Y A;  4XX5 A;  4IWQ A;  4W9I A;  1UBQ A;  3ZIM A;  4GDL B;  1RAX A;  2ZVO A;  3BY4 B;  1OEY A;  2IO2 B;  4IUM B;  3EC8 A;  3DBL I;  2M4N A;  1WY8 A;  2L0F A;  3SDL C;  1XD3 B;  2LRW A;  3M62 B;  4PYZ A;  4LCD E;  1LXD A;  1WF9 A;  1E8Z A;  1WE7 A;  2JT4 B;  2NS5 A;  5KHO A;  5L95 C;  2LJ5 A;  4BOZ B;  2C7M B;  3ZUN A;  1TTN A;  2MRP A;  3DCG A;  2C9W B;  2MP2 A;  3CMM B;  4FJV B;  2L8J A;  2JPH A;  2J0J A;  5IAA C;  4MSM B;  1LQB A;  2DZJ A;  4M8M A;  5CHW A;  1E8W A;  3A9K B;  2G45 B;  2OOB B;  2XK5 A;  1P3Q U;  1V5O A;  2Z0D B;  1YJ1 A;  3TJP A;  4BKS D;  4I6N B;  2BPS A;  4MJS B;  4DHZ E;  2N9X A;  3N32 A;  4IM0 A;  2KHW B;  4BFR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...