1WXMA

Solution structure of the n-terminal ras-binding domain (rbd) in human a-raf kinase
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
86
structure length
86
Chain Sequence
GSSGSSGGTVKVYLPNKQRTVVTVRDGMSVYDSLDKALKVRGLNQDCCVVYRLIKGRKTVTAWDTAIAPLDGEELIVEVLSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords A-Raf proto-oncogene serine/threonine-protein kinase
publication title Solution Structure of the N-terminal Ras-binding Domain (RBD) in Human a-Raf Kinase
rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 7
structure length 86
sequence length 86
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2005-01-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02196 RBD Raf-like Ras-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 1wxmA01
1V81A 3MTNB 4II3B 2V4LA 1UBQA 3A9JB 1V2YA 3T9LA 5JZEB 4E3CA 1F9JA 4M0WB 4EZLA 3EC8A 3X0WA 2CKHB 5J17A 1P1AA 4W9FA 2AL3A 2JRHA 4X57B 2CHXA 3NOBA 3HM3A 2ZNVC 1UBIA 2LVPA 2ZPNA 2V3SA 3PPAA 1M94A 1LXDA 4P7IA 4TQ1A 2BKFA 4PS3A 4W9EA 2CR5A 3VH4B 3V60A 2UYZB 2Z59B 2ZVNA 3KYDD 3UINB 4EOYA 3PHWB 2N1WA 4NJ6A 2IZVB 3U30A 2EKEC 1HE8A 5LXHA 2XK5A 3ENEA 4IM2A 1WJNA 3TL5A 3Q3JA 4HVBA 4KZ0A 4ZRKA 3IBEA 2IY0B 3QQ8B 5KHOA 4G0NB 1Q5WB 3B08A 3UQBA 3KUZA 4XZ4A 2GBKA 2JVCA 5L95C 2BWFA 3WAOA 1XD3B 1J19A 2LVQA 1GNUA 2M1MA 2KDIA 3ECIA 3A1QA 3C0RB 4GDLB 2HTHA 3SDLC 2OOBB 3RULA 2I1KA 4IG7B 1T0YA 2JUOA 4G3XB 4DHZB 1WXVA 2L00B 4NNJB 3PREA 4AUQC 3WALA 1EUVB 4GIVA 1WZ0A 3LDZE 3ZNHB 2C7MB 1EO6A 2L8JA 4PS7A 2IBIB 3A4RA 3V61A 1P98A 2WWZA 5J18A 2MWSB 2DENB 3N32A 4KIKA 2LGXA 3AXCA 3APDA 5CTRC 1TZ1A 2J0MA 2MBHA 2KTRA 2IO1B 2YVCA 2FIDA 3VTUA 3H9DA 2ZZPB 2DAJA 3R7RA 2KOXA 3DVNU 1WGGA 2KX0A 2LRUA 3NZUA 3PRMB 3ZDTA 2G45B 2D2QA 2KC2A 4NAWB 3JSVB 2ZJDA 4PYUA 3UQAA 1WGRA 2C7HA 2LD9A 4WAAA 4GN1A 4OVVA 1YX6B 4ZRIA 1Z2MA 3A4SC 3V6EB 3QX1A 2AYOB 4G50A 2KWVB 2LI5A 3KYCD 2HD5B 1ZW7A 3OAWA 2KJHB 4BKGA 4EEWA 3QC8B 4HWIB 4IWOA 3L13A 3VTVA 3KUDB 2M17A 4AWJA 3LJ3A 4TUUA 2C7NB 3DBRI 1WH3A 4HDQA 3P2BA 3QARA 4LCDE 1OEYJ 2N1VA 4ANWA 4NQLB 4K7SA 5CHFA 3RZFA 2Z0EB 3APCA 1NDDA 4W9CA 1I42A 2L7RA 2D07B 3DBLI 3H6NA 4IC7B 1ISNA 2CHWA 3A33B 2O2VA 1YJ1A 3ZDMC 2NPTB 4JGHB 4IM3A 4MJSA 4PS8A 3B1LX 3CMMB 2RR9A 3PVLA 3ML8A 4BVUC 3VTWA 5C1ZA 4YL8A 1I35A 1GC6A 5LLIA 4DDID 3M3JA 2WDTB 3O65B 2KNBA 3QHTA 3NHEB 3ZIMA 4DHJD 1NI2A 1RFAA 3JYUA 3VVWB 3TMPB 1K8RB 1WMHA 2ZVOA 3R3MA 3ML9A 2ASQA 1LFDA 2MBQA 1OTRB 3VFKA 1TBEA 2GBRA 2KFKB 3DVGY 2NBUA 3Q3FA 4MM3A 3EECA 3WANA 3ZRCA 1GG3A 3QWZB 5D6JB 4WQOB 2JXXA 1WYWB 2IO2B 1TGZB 1UD7A 4JL9A 4M8MA 1IP9A 1A5RA 3WA0A 3DOWA 4KV2A 1D3ZA 3PRPB 2LGYA 4FLHA 4E74A 3JW0X 2GMIC 3DBHI 3KH0A 2HE7A 3U8ZA 4DDGD 3VUWA 2C60A 2W9NA 4MGZE 2KWCA 3GOEA 1V5TA 2N9XA 4GGQA 4HK2A 1WE7A 4AJWA 2JPHA 1IYFA 1PQSA 4W9GA 2EMTA 5CX3A 1L2NA 2CU1A 1WM2A 2KJRA 3I3TB 1WR6E 2DZKA 5D7GA 2KQ7A 2K8CA 4F8CB 2BKRB 2KD0A 3A9KB 2D11A 3HM6X 2KJ6A 3A1QB 3ALBA 3NY5A 2KKCA 2D10A 4A3PA 5JHBA 1G6JA 3HK0A 4DWFA 4WJPA 5DPSA 1KJTA 1WGHA 3TIXA 2JF5A 5DPTA 1H4RA 2L0TA 1S3SG 3CF6E 2PPHA 3V62A 4CO7A 4CYEA 4I6LB 2C9WB 2N7DA 2VRRB 3QCAA 2L0FA 2JZ3B 2PE9A 2WX0A 3PSEB 1WR1A 2K1FA 2NS5A 2AL6A 3PRZA 4RMAA 2FNJB 2OJRA 5JH5C 3CSFA 1WX8A 3IFWB 3S2AA 3KW5B 3DPDA 3OJ4B 4MSQB 4EKUA 1JRUA 2O6VB 4BOZB 4GXBA 3K9PB 3KUCB 5E6PA 4KSKC 2FAZA 2V1YA 4MELA 3A9JA 4K7UA 2BWES 2G4DB 2Y5BB 3WIMA 1J8CA 5GMVA 3H7PB 4MEMA 1WY8A 2DZMA 2M8SA 2NVUI 1SGHA 3VHTC 2DX5B 4WWPA 3SU8X 3NS8A 3VH3B 3DVNV 4WWOA 4MGIE 1Q0WB 4J6IA 2FIFA 3NZSA 4ZRJA 3K9OB 4RM9A 1WE6A 3HIZA 3PLUA 3QAQA 5FR6A 4JLCA 2YLMA 3IVFA 2NBVB 4FJVB 4GSWA 4ZDVA 4LDTD 2GBNA 3PV1A 2KLCA 5E6OA 4B95A 4EZKA 3ZNZB 3ZLZA 2XEWA 5D94A 2LJ5A 5AZGA 1WZ3A 1L7YA 3L54A 4KSLC 2L3ZA 1SIFA 3TBLD 2KK8A 3VXWA 1V9JA 2KFJA 4II2B 3IG3A 5KHQA 1Q1OA 4GDLA 4JQWC 2JRIB 3VUYA 3HHMA 2MSED 4MGKE 4NY0A 4ANXA 5DPWA 2CS4A 1UGMA 2WYQA 4M8NA 4FULA 2J0JA 4MSMB 4N9F4 2BYEA 2M0XA 5BO4B 3BINA 4BKSD 2MP2B 4NPNA 4XX5A 3RUIB 3ZRFA 4F1SA 1KOTA 3RD2A 2ZNVB 4URKA 4AP4C 2KMAA 4BOSC 3PGEA 1YX5B 4ICVA 5TR5A 5LXIB 1E8ZA 3TJPA 2DYBA 2G4SA 3H1UA 2B3AA 1WFYA 2EMSA 2QHOA 1V5OA 5DCNA 3R7QA 4A3OA 4TQ0A 4B9KA 3W1YA 3L16A 4B6WA 1WRDB 2KLGA 1QZEA 2JZZA 2PJHA 4DHJB 3V6CB 4NAWA 3JSVA 2GOWA 2RGFA 2KDBA 2IO3B 2KXJA 3VUXA 2N9EB 1P0RA 2KX3A 4BKSA 4W9DA 4ZYNA 2G3QB 3ZKJC 2A5UA 2KDFB 2MX2A 4W9LA 3UIPB 2I1JA 4GDKA 4W9IA 4AOFA 2XK5B 3VQIA 5J2RA 4FBJB 4I6NB 4GU2A 2RSUA 2DYMA 3RZWC 2K8BA 5AZFA 1TTNA 4HXDA 1E7VA 2N4FA 1BT0A 1GC7A 1LM8B 2NBWB 3PS6A 3ZTCA 2CHZA 2NPTA 2NR2A 1WXMA 2AWTA 3L10B 4LJOB 4WWNA 2REXA 5HKHA 1GUAB 4TV3A 5DPRA 2A4ZA 4XC2A 4AJYB 4F7ZA 3DDCB 3QIJA 1C1YB 1GJZA 2MQJA 4K1RB 2BGFA 5EDSA 3DQVA 3N30A 2LXCA 2N7EA 3UGBB 2JT4B 1AARA 1X1MA 4HPLB 2HJ8A 4KVGB 2XBBC 2MCNB 1UELA 1FXTB 1WXSA 1CMXB 1E90A 3R66C 4NJ7A 4HCPB 2KFKA 4DBGA 4KIKB 1KLVA 2UWQA 3L08A 3WAMA 1RLFA 2FCNA 3M62B 2KANA 2KTRB 4GOCA 2KZRA 2AEHA 3EHVA 4MH0E 4G11A 5G2NA 2RPQA 4ASWC 1YIWA 4E71A 2KWUB 4BBNF 1E7UA 4FN2A 3AULA 2ZCCA 4HLEA 1LQBA 4IWQA 2KHWB 2MW5A 4FA6A 1RRBA 1EF5A 1YD8U 3KVFB 4KDLB 2M4NA 4EFOA 3ZO5B 2LRWA 1SE9A 2K25A 3AU4A 3X23A 3ZTDA 4K81A 2K6QA 4I6PA 4BKTA 1WXAA 3JVZX 1RAXA 3PLVA 3A9KA 4GB9A 4DHZE 2ZCBA 1WGYA 4ICUA 3ZVVA 1V6EA 5L83A 2O6VD 2C5LC 4KZCA 3AU5A 2KVRA 4PYZA 3L0WB 3APFA 2MLBA 1WI0A 3ZNGC 2IY1B 5E6NA 3W1SA 1WX7A 2RD0A 2PEAA 3EFUA 1WJ6A 2IYDB 3M63B 3TCAA 2LUEA 2L05A 2O2VB 4HPMB 4IM0A 4LDTB 1C3TA 1R4MI 4MJSB 4FHKA 3H7SA 2KN5A 2LZ6A 4JIOU 2GBMA 3MJWA 2IO0B 2MBEA 3RT3B 3N3KB 5IA7A 1WM3A 3ZUNA 1H8CA 2JWZA 4FADA 2GBJA 4HDOA 1XT9B 1ZKHA 2FCQA 1WX9A 5C23A 2FUHB 2DHZA 1V80A 1WJ4A 2LGDA 1WMHB 2MBBB 1NBFC 2Z0DB 2FCSA 3W1SC 3OJ3A 2DAFA 3SD5A 2R2QA 4FJZA 4EUTA 3RYTA 2O6VA 1E8YA 2KTFA 2BYFA 2MBOA 4DK5A 3U7DA 3SHQA 1VCBA 2KMCA 2MRPA 1YQBA 3H7PA 3M95A 1UZXB 2ZPYA 2J0KA 1UH6A 2DYOA 1E5WA 3QJZA 1R4NI 4TKNA 4W9HA 3L17A 4GDKB 4IWPA 2K8HA 2KDEB 4DXAB 1WF9A 2BF8B 1OGWA 2LWPA 3GZNI 3IHPC 3PZDA 3VDZA 2FCMA 3DBSA 2KQSA 5G55A 4ANVA 4OVUA 2L76A 4A20A 5JHAA 4IW0A 1XQQA 2KO3A 1ZGUB 3DCGA 4RM8A 4FJYA 1MG8A 4W9JA 4ANUA 2N9PC 4MGYE 4BBNC 2DZJA 1E8XA 4LJPB 4KDIC 3PT2B 3UIOB 4FHJA 2BPSA 3VAWA 1KM7A 1V86A 1P3QU 2MA9B 1S1QB 3OLMD 4WJOA 3ZW3A 1VD2A 4WJNA 1WIAA 1Y8RC 2KC1A 1U4AA 2LASA 5IAAC 2JY6A 4CHKA 3QK0A 3CSTA 3RCZA 4GMVA 2LVOA 2WX1A 3ZNID 4HJKA 1EF1A 3QA8A 5D2MB 3PTFC 3AI5A 2K39A 2MP2A 1WJUA 2D3GA 3B0AA 3D32A 4NQKE 1OEYA 1OQYA 2K6DB 1V49A 1IPGA 4IUMB 4BFRA 5CHVC 5AZHA 2DZIA 3DVGX 4MDKE 2J7QB 2BYVE 2NCNA 2ZEQA 5CHWA 5AEKB 3WAPA 1J0GA 3MHSD 3PHXB 2PE6B 2LXAA 4HCNB 3ONSA 4EZJA 3BY4B 4WJQA 4W9KA 1Z5SB 3T8MA 4K7WA 3UF8A 1P9DU 2R2OA 1E8WA 1WGDA
chains in the Genus database with same CATH superfamily
4E3CA 1TIFA 3X0WA 4W9FA 2BBCA 2JRHA 2M56B 1WXQA 2ZNVC 1N61A 2KN4A 2V3SA 2CR5A 4FXCA 4EOYA 4XWTA 2BB6A 3PHWB 1NENB 1HE8A 5LXHA 2XK5A 1WJNA 4HVBA 2IY0B 3ABVB 4G0NB 2KWDA 3B08A 3UQBA 3OWEB 2BWFA 3HRDD 1JWBD 1GNUA 4NZLB 1ZUD2 2HTHA 1BMLC 3IT6B 3RULA 4RGNA 3WALA 3AM9A 3V05A 2L32A 4WAFA 3LDZE 1K53A 3ZNHB 1B9RA 2TSSA 3V61A 1VDVA 2MWSB 2DENB 3I63C 3N32A 5I4DA 3AXCA 3VRAB 1TZ1A 2MBHA 1HZ6A 2QILA 2WS3B 2ZZPB 3GP7A 2JQRB 2JU6X 1C79A 1L0VB 2N0SB 1OFFA 3PRMB 3B9JA 3JSVB 1QOBA 4PYUA 3UQAA 1FXIA 1YX6B 1Z2MA 2PIAA 2AYOB 2BVCA 4BKGA 2KWVB 3OAWA 4EEWA 4IWOA 3VTVA 2M17A 4AWJA 3BYTB 4TUUA 2B76B 1WH3A 3QARA 4LCDE 2N1VA 4ANWA 4NQLB 4K7SA 5CHFA 1TS2A 1NDDA 4W9CA 1I42A 4LLGM 2QIEB 4IC7B 3A33B 3ZDMC 1YJ1A 2NPTB 4HPPA 2RDHA 3B1LX 2RR9A 4BVUC 1GC6A 1VZ6A 5LLIA 1MVKA 3NHEB 1PYWD 2LMCA 1NI2A 1ZP0B 1WMHA 3R3MA 3ML9A 2ASQA 2INNE 2GBRA 4ZOHC 3DBRB 1RFKA 3ZRCA 1GG3A 4LTUA 2BQQA 1WYWB 1UD7A 3I9V1 3IXSA 4KV2A 2L1AA 1WYGA 4FLHA 4E74A 3JW0X 1VZ7A 2OEDA 2HTME 2QCZA 3U8ZA 3R2IA 2C60A 2W9NA 4ARCA 2K3UA 3RPFC 2KWCA 3GOEA 4GGQA 1KH0A 1MHHE 4AJWA 1PQSA 3FILA 3I3TB 1WR6E 5FK9C 2KD0A 3A9KB 2D11A 3A1QB 3ALBA 2KKCA 3ZQ4A 4DWFA 2HDEA 1WGHA 3TIXA 2JF5A 2PPHA 2C9WB 3TEZA 3DBHB 2CU3A 3PSEB 1WR1A 2NS5A 4RMAA 2M19A 3RN9C 5JH5C 3CSFA 3IFWB 4CQNA 3S2AA 4MSQB 4RCOA 1JRUA 3K9PB 3KUCB 3W9CB 2FAZA 4MELA 2G4DB 4YSXB 4M0WA 1WY8A 3ZJTA 2NVUI 5E6JA 2CJNA 2DX5B 4WWPA 1HTOA 3FKYA 3DVNV 1YJJA 2J52A 3NZSA 2WXIA 3P63A 3HIZA 3PLUA 5FR6A 4ZDVA 4GSWA 4L1BA 2KLCA 1PGAA 3NVZA 2LJ5A 4XGAB 3HVZA 1WZ3A 1L7YA 2HJ1A 4KSLC 2L3ZA 2W55A 2VZKB 2MJ3A 3TBLD 4JQWC 2KT7A 3BYYB 1B1ZA 1JROA 1JWAD 2M0XA 1SJHD 3BINA 4ITKA 3W5UB 4BKSD 2MP2B 1FFVA 2ZNVB 4AP4C 2KMAA 5LXIB 1FNWA 2DYBA 2KACA 2B3AA 2J53A 5DCNA 3R7QA 3L16A 2KLGA 1QZEA 1ZXIA 2QDFA 4ARIA 2GOWA 2KXJA 2WHIA 4BKSA 2KX3A 1TS3A 3ZKJC 2KDFB 2WLBA 1VZ8A 1TY2A 2XK5B 3TEYA 3AEFB 4I6NB 4GU2A 4A90A 1T0QC 3AE8B 2N4FA 1LM8B 3PS6A 5AUIA 2WDQB 1UWMA 3MC9A 1F2RI 5HKHA 1GUAB 2ONQA 5H92C 1DGJA 3BWUD 1F0ZA 1C1YB 2UU7A 2MQJA 4K1RB 1L6UA 1JQ4A 1E10A 4A9AA 4Q2JA 2IGDA 1C78A 1CK1A 4HPLB 2IDYA 2XBBC 4KGTA 3R66C 1RWSA 3P1MA 1EU4A 1IGDA 5JXVA 3L08A 2KANA 3Q2AC 2WXJA 2ZW1A 3I5JC 3PZ8A 2AQ2B 4YWGG 1ZE3D 2AQ3B 4FA6A 1RRBA 1J7AA 1EF5A 4KDLB 4EFOA 3ZO5B 3BZDB 3AU4A 3X23A 4K81A 2K6QA 4BKTA 2K22A 3AE7B 3JVZX 2XNAC 3PLVA 1WGYA 1JRPA 2O6VD 4KZCA 3AU5A 2EELA 4PYZA 1R7SA 2IY1B 2M0AA 1C76A 2L05A 1R4MI 1XF5L 1KFYB 3RT3B 5IA7A 1QOGA 2GBJA 4HDOA 1V80A 1D5ZC 2LGDA 1WMHB 2FCSA 1HZ5A 4EUTA 2O6VA 2KTFA 1K52A 2MBOA 2BS2B 3H7PA 1YQBA 1UZXB 2ZPYA 2DYOA 4TKNA 2KDEB 1VJKA 1WF9A 4ANVA 2FCMA 2KQSA 2DBYA 2L76A 2AQ1B 4IW0A 1D5MC 3FILB 4LNFA 3DCGA 1ZGUB 1MG8A 2N9PC 4MGYE 1E8XA 1QOFA 5EE0A 4KKIA 3UIOB 4FHJA 4LNOA 1P3QU 1MJDA 1Y8RC 1U4AA 5IAAC 4GMVA 2WX1A 4HJKA 4M00A 3B0AA 3D32A 4RGMA 1TS5A 1V49A 4OVZA 4BFRA 5AZHA 1J0GA 2NCNA 4HCNB 2LXAA 4WJQA 1CZPA 3T8MA 2W54A 4K7WA 1DOXA 1E8WA 1V81A 2V3PA 3PO0A 2JSVX 5JZEB 4M0WB 2GI9A 1Y56A 2CKHB 1P1AA 3AMZA 2AL3A 1HA5A 4X57B 2J42A 3NOBA 2LVPA 1E7PB 2J4XA 1LXDA 4P7IA 3VH4B 4NAMA 3B2GA 2ZVNA 3N1ZC 4WURA 2N1WA 4NJ6A 2IZVB 2K5PA 2W82A 3U30A 1TZOA 2SAKA 3ZJVA 3IBEA 3QQ8B 1Q5WB 3KUZA 2GBKA 1JALA 5L95C 1XD3B 3W2DA 3P4QB 5C2TB 4KGRA 4ZHOA 4PT5A 3ECIA 3A1QA 2K0PA 4RGTA 1T0YA 1ROEA 2JUOA 2R61A 4REZA 1P9DU 2WXKA 3MC0B 3A4RA 2KAJA 4KIKA 1I4QA 2LGXA 3Q8EA 3APDA 5CTRC 3DHIC 3SR6A 2KTRA 2FIDA 3H9DA 1FEHA 2G9HD 3DVNU 3AE3B 2LRUA 1YN3A 3Q8BA 2KC2A 2V4IB 1TJEA 4JWUC 2PVOD 2X38A 4ZRPA 5IKCM 3A4SC 3V6EB 2LGSA 4G50A 4P16A 3QC8B 3L13A 4C80A 1SF0A 1FPYA 3ETRA 2Z0EB 3EA6A 1P7FA 3TEWA 3DBLI 2CHWA 3AEGB 4MJSA 5D3IB 3HVDA 3Q3MC 3VTWA 5C1ZA 1FCCC 3O65B 3ZIMA 2MJEA 1K8RB 3H8HA 4IOIE 5EE9A 3NVYA 4OW0A 3VFKA 4B0MA 1TBEA 3Q3FA 1N5XA 1N5WA 4WQOB 4JL9A 4OZAA 3WA0A 3DOWA 1D3ZA 2LGYA 1JWUD 3Q3NC 1F77A 4DDGD 4L2YA 1TKGA 1YQ4B 2JPHA 3RFZB 1IYFA 3NJTA 4W9GA 5CX3A 2KJRA 3NRZA 2JX5A 2DZKA 2EKIA 2BKRB 2Y5PA 2YEPB 3UI3A 3T3OA 3L4PA 1G6JA 1NI3A 4WJPA 4YT0B 4LNKA 5HG2A 1SJED 2X8XX 1H4RA 1S3SG 4CYEA 4HKQA 3WCQA 2L0FA 2PE9A 1DOIA 1VR9A 2OJRA 3VRBB 1PUTA 1WX8A 1I7HA 4XDCA 2O6VB 4IKGA 4KSKC 2V1YA 4TSSA 1J8CA 3H7PB 4MEMA 2WXRA 2ZW0A 3SU8X 3NS8A 3DHGC 3BK2A 3ZJUA 1C4AA 4JLCA 2YLMA 5GXGB 2NBVB 1WSPA 2GBNA 3PV1A 1NEKB 2NMQA 1EU3A 1IBXA 2L83A 5AZGA 3L54A 1AWDA 2KK8A 3VXWA 1EWYC 1V9JA 4II2B 5KHQA 2E6XA 1FXAA 3VUYA 4ZYSA 2LHDA 4NY0A 3N1YC 4FULA 4N9F4 2DWQA 4MACA 3RUIB 1KF6B 1L0XB 3RD2A 2WP9B 3RI7C 4BOSC 2OJWA 2QMTA 3TJPA 2G4SA 3H1UA 3GE3C 3LB8C 4N6EB 1V5OA 4TQ0A 4A3OA 1TT5B 1QQRA 1WRDB 1T3QA 4DHJB 1FFUA 2IO3B 2KDMA 2QJLA 4RF0A 4C56C 3VUXA 4K3CA 1AN8A 4W9DA 3AE2B 2WXNA 1I4GA 2MX2A 5H8YE 2JYTA 3UIPB 4D2KA 3C19A 3NUHB 1OQQA 2I2YA 1GOZA 2SEBD 5AZFA 4HXDA 2CHZA 4LJOB 2AWTA 2WDRB 1YN4A 4F7ZA 3QIJA 2BGFA 4HJGE 4US9A 1X1MA 2JWUA 3EUB2 1E90A 4HCPB 2KFKA 1AW7A 4KIKB 1E9MA 2KTRB 3RNAC 2PLPA 2PTLA 3DWGC 4G11A 1T5XD 2RPQA 4ASWC 1FM0D 2ON8A 2ZCCA 4HLEA 1LQBA 2MW5A 2M4NA 3Q69A 2LRWA 1UWXA 1SE9A 1QLBB 2K25A 3ZTDA 4M02A 2G1EA 3U7ZA 1WXAA 4DHZE 2ZCBA 1PGXA 5L83A 3VR8B 5IN7A 3L0WB 2D3BA 1FNVA 2RDBC 1YOVB 2MHJA 2PEAA 3GS2A 2IYDB 4YTMB 2LUEA 5FR3A 4IM0A 3EFCA 4MJSB 3H7SA 2GBMA 2MBEA 3ZUNA 5IOIA 4KX6B 2JWZA 3Q6BA 1PGBA 1XT9B 1ZKHA 2FCQA 1JCKB 5IO9A 1WX9A 2DHZA 1NBFC 4K3BA 3SD5A 2R2QA 4MT5A 1GPXA 2WGSA 4HEA1 1C77A 1MG4A 2MRPA 2OHFA 1TY0A 1UH6A 4DQOC 3QJZA 1QOAA 3L17A 3AEEB 4GDKB 2K8HA 2BF8B 1OGWA 3MJ5A 3VDZA 3GZNI 4OVUA 4ANUA 3Q8AA 2BPSA 2NTSA 1L6VA 1V86A 3P4SB 2MA9B 1L0YB 3OLMD 4WJOA 3RNGC 4WJNA 5HI1A 4CHKA 2DLBA 3ZNID 1PDXA 3QA8A 2RPVA 2K39A 4NQKE 1WJUA 1TKEA 1SE2A 1VLBA 3DVGX 4MDKE 2ZEQA 2PE6B 3ONSA 3BY4B 1Z5SB 3ZXVA 2R2OA 1YJIA 3MTNB 2V4LA 1UBQA 3ZXRA 1T6BX 3EC8A 1VRAB 3HM3A 1TYGB 4A6QA 3DHHC 2LUMA 1I4RA 4W9EA 4PS3A 2BTEA 3V60A 3KYDD 1NYRA 2EKEC 3ENEA 3Q3JA 5KHOA 1IBXB 2WXPA 3WAOA 1YNTE 1J19A 2LVQA 3AB5A 3C0RB 1D5XC 2I1KA 1WWTA 4IG7B 4G3XB 3PREA 4AUQC 1WZ0A 1EO6A 4PS7A 5J18A 2WXOA 4US8A 2J0MA 3AV8A 4XWWA 2IO1B 3VTUA 2WXMA 4P6VF 2FUG1 3LYYA 4OZCA 1WGGA 3O13A 3NZUA 1UNSA 3ZDTA 2G45B 4S17A 1WGRA 2LD9A 4WAAA 1BUIC 4GN1A 4OVVA 3KWVA 3RNCC 3QX1A 2LI5A 2GLSA 1ZW7A 2KJHB 3KUDB 2JYEA 3LJ3A 2C7NB 4HDQA 3P2BA 3W5VB 3RZFA 2L7RA 3P42A 3EGRA 1T0SC 1ISNA 3R2TA 2CJOA 4JGHB 4IM3A 4PS8A 3CMMB 1I4PA 2H88B 5BMIA 4KKJA 3M3JA 2WDTB 3BVZA 4DHJD 1RFAA 2ZVOA 4H2AA 1J7CA 1LFDA 2MBQA 2RMMA 4N58A 1OTRB 2KFKB 4MM3A 1ACCA 3EECA 4A55A 1MI0A 3QWZB 5D6JB 4WQMA 4M8MA 4RFBA 3RMKC 3DBLB 3AH7A 3KH0A 2HE7A 3VUWA 3NVVA 1BXTA 2GRIA 4HK2A 2N9XA 1WE7A 2L52A 1L2NA 4F8CB 1MPEA 2KJ6A 3NY5A 5JHBA 3HK0A 1F52A 2MH7A 3IT4B 3NS1A 5DPSA 1SIJA 1KJTA 2E3TA 2L0TA 3CF6E 4O1NA 2VRRB 1HQRD 2WX0A 2FBWB 3Q14C 3MHZA 3OG5A 3KW5B 3OJ4B 1FNUA 1L4DB 2D3CA 1V1OA 1SE3A 4BOZB 3P4RB 3A9JA 4K7UA 2Y5BB 3WIMA 1XO3A 3NVWA 2DZMA 1UF0A 3VHTC 2PVGC 3VH3B 2LGIA 1Q0WB 4J6IA 4RM9A 1WE6A 1ENFA 1L5PA 4FJVB 4B95A 1NYQA 2XEWA 2DNFA 5BYQA 5D3DA 4B0EA 4KGSA 5LNK1 3IG3A 1Q1OA 4GDLA 2JRIB 2JXTA 4ANXA 3T3NA 1I4HA 5DPWA 3V3XA 1F2RC 2WYQA 4M8NA 2J0JA 2BYEA 1LGRA 2Y5CA 5BO4B 4DXFA 4NPNA 5HHDG 1FRRA 3MFGA 3ZRFA 4URKA 2ICIA 1YX5B 4ICVA 1E8ZA 2EMSA 4JE3B 5BMHA 2QHOA 4B9KA 3W1YA 4B6WA 2JZZA 3V6CB 1XXGA 4NAWA 2RGFA 2KDBA 1D6EC 4A8XC 3C8YA 2N9EB 1P0RA 1SBBB 2G3QB 2A5UA 1K50A 3J9CA 4AS1A 4HRSA 5MPOA 4GDKA 4W9IA 4NJCA 1FO4A 3SFEB 2PKOA 3VQIA 1FCLA 2RSUA 2K8BA 3HUIA 2WXGA 1TTNA 3KQ4A 1BT0A 2NBWB 3ZTCA 1HTQA 1WXMA 3L10B 4TV3A 5DPRA 2A4ZA 4XC2A 4YSYB 3DDCB 1GJZA 2KQ4X 2LXCA 3UGBB 2JT4B 2INPE 1AARA 4KVGB 2MCNB 1UELA 1IGCA 1CMXB 4NJ7A 2UWQA 3TSSA 1RLFA 2FCNA 4AQ7A 4OZBA 4GOCA 2KZRA 3B2FA 1WGKA 1KLUD 3NZ3A 1V1PA 1YIWA 1IUEA 4E71A 4BBNF 1OQRA 4FN2A 3AULA 4P1CC 2JZPA 4IWQA 4C4VB 1YD8U 3KVFB 3AE5B 3IAS1 1RAXA 4ICUA 3ZVVA 3VR9B 3MP9A 1I4XA 2C5LC 2WXLA 2KVRA 1ZPSA 2MLBA 5E6NA 3W1SA 3M63B 3TCAA 4PK1A 1F1HA 1XLQA 4LDTB 1C3TA 2Y3AA 2LEKA 2KN5A 1L4ZB 3MJWA 2IO0B 1UGJA 3E9SA 1JWSD 2FUHB 2MBBB 3W1SC 2Z0DB 3NG0A 4ZHPA 1V97A 3OJ3A 3RYTA 2BS3B 2BYFA 4MM3B 4DK5A 3U7DA 3SHQA 1VCBA 3M95A 2MJDA 2QSDA 3P4PB 1R4NI 5BYSA 4W9HA 2WXFA 2XN9C 3AEDB 1WRIA 4DXAB 1ZDXA 2BT6A 2LWPA 3IHPC 3PZDA 5EDSA 3DBSA 4A20A 5JHAA 4M01A 1XQQA 2N9LA 2PW9A 2BW2A 4FJYA 5EE1A 4KDIC 3PT2B 3ZW3A 4UDUC 1WIAA 2KC1A 4R3DA 3RCZA 3CSTA 2LVOA 5T8IA 4JPSA 1EF1A 5D2MB 2VH2A 3LXFA 4P1BC 1IPGA 4IUMB 3GZNB 2DZIA 1RM6C 2J7QB 5AEKB 3WAPA 2N7JA 1TKYA 4II3B 3A9JB 1V2YA 3T9LA 3ZGZA 1F9JA 4EZLA 3BVMA 1XLNA 5J17A 2CHXA 1Q10A 1UBIA 2WDVB 2ZPNA 3PPAA 1M94A 4RF1A 2IGHA 2BKFA 3GB1A 4TQ1A 2UYZB 2Z59B 3UINB 1QKZA 4YSZB 4IM2A 3TL5A 4KZ0A 4ZRKA 2WXHA 4XZ4A 5TSSA 2JVCA 3AE9B 2I38A 2ACZB 3TUOA 2IJ0A 2M1MA 4C7ZA 2KDIA 3PZ7A 4GDLB 3SDLC 1QT9A 2OOBB 1J7BA 1C4CA 4DHZB 1WXVA 2MEKA 2L00B 4NNJB 1EUVB 4XDDA 4GIVA 2C7MB 1MFWA 1DOYA 2L8JA 3CIRB 2IBIB 1P98A 2WWZA 3AE4B 5FKAC 2YVCA 3Q3OC 2DAJA 3R7RA 2KOXA 1ZOYB 1JW9D 2KX0A 3AEBB 5G5HA 2WQYB 2D2QA 4LK0M 2N9KA 4NAWB 2ZJDA 2C7HA 4ZRIA 2KVZA 5AUKA 3KYCD 2HD5B 4YXDB 4HWIB 4DXGA 2QEJC 1SXTA 2KMMA 3DBRI 1R4MB 3RNFC 4YTPB 1OEYJ 3E56A 3URYA 1C4PA 3APCA 4RGOS 2D07B 3H6NA 2Q5WD 2O2VA 1V8CA 3PVLA 3ML8A 4LNIA 4YL8A 1I35A 5G5GA 4DDID 2KNBA 3QHTA 1D4BA 3JYUA 3VVWB 3TMPB 2Z8LA 5C3JB 4USAA 1SB3C 4RH6A 3DVGY 4LNNA 2NBUA 4WWMA 3AECB 3WANA 2JXXA 1IP9A 1GAQB 1TGZB 2IO2B 3U52E 1A5RA 1GB1A 2W3RA 3PRPB 3GE8C 1V1PB 2GMIC 3DBHI 1HEZE 1N62A 4MGZE 1V5TA 2AX5A 3FAHA 2EMTA 2D3AA 2BYTA 2CU1A 4XE0A 5IP4D 1WM2A 5D7GA 2KQ7A 2K8CA 4IDIA 3N1XC 3HM6X 3RNBC 2D10A 4A3PA 2BS4B 5DPTA 4CO7A 3V62A 4I6LB 2N7DA 3QCAA 2JZ3B 2WXQA 3CWIA 2K1FA 2AL6A 3PRZA 4JX1C 2FNJB 1TS4A 2LJIA 3DPDA 3KWLA 3TEXA 4EKUA 5HFYA 1N6ZA 3ZYYX 4GXBA 1QF6A 5E6PA 2BWES 2V9HA 5GMVA 2W3SA 2KYWA 1ZDVA 2M8SA 1SGHA 2WU2B 4WWOA 4MGIE 5EE3A 2FIFA 4ZRJA 2PMVA 3K9OB 3SFDB 3QAQA 5BYRA 1GB4A 3IVFA 2INCC 4LDTD 4C00A 4BAXA 3IAM1 5E6OA 4EZKA 3ZNZB 1KLGD 3ZLZA 5D94A 3SEBA 4J3OD 4C4VA 1E0ZA 1SIFA 2KFJA 1FIQA 3HHMA 2MSED 4MGKE 3AEAB 2CS4A 1UGMA 2RDGA 4MSMB 1ET9A 4XX5A 4F1SA 1KOTA 4WH4A 2LFIA 3PGEA 5TR5A 1WFYA 1YQ3B 4GLSC 1K51A 2PJHA 1XLOA 4JWSC 2K9XA 4L23A 3JSVA 1E6EB 1JWMD 4S0RA 1ET6A 4ZYNA 2V0GA 1CJEA 4W9LA 2I1JA 1DYQA 4AOFA 1A70A 1FD6A 4XYCA 5J2RA 4FBJB 2GB1A 2YEPF 2DYMA 3RZWC 2WU5B 1E7VA 1GC7A 4QAYA 4WIPA 2NPTA 2NR2A 4WWNA 2REXA 1SEBD 4AJYB 3KLSX 4EE2A 2VH1A 3DQVA 3N30A 2N7EA 3Q8CA 3BK1A 1EWCA 2HJ8A 4ACFA 1FXTB 1WXSA 2V3NA 3N20C 2H89B 4DBGA 3U2SC 1KLVA 3WAMA 3M62B 1UUPA 1XCQL 2AEHA 2INDC 3EHVA 4MH0E 4YTNB 5G2NA 3FC4A 2NTTA 1P7EA 2KWUB 1STEA 1E7UA 4BZAA 3BIID 3AE6B 1CQVA 2KHWB 4TMAB 3DWMA 1T0RC 4I6PA 1HXYD 3A9KA 4GB9A 3Q8FA 1V6EA 3APFA 3ZNGC 1WI0A 1C9FA 1WX7A 2RD0A 3EFUA 1WJ6A 1N60A 1XEEA 1FMAD 2O2VB 4HPMB 4RNAA 3N9YC 4HROA 4FHKA 2LZ6A 4JIOU 3AN1A 1NVID 3N3KB 4ZRQA 1WM3A 1H8CA 3BVGA 2IPKD 4FADA 1ZXHA 3I57A 1RYJA 1JMLA 5BMGA 4HKZE 3MC8A 5C23A 1WJ4A 1N63A 2D5GA 2DAFA 4FJZA 3R8BA 1EM7A 1YN5A 1E8YA 2LHEA 1SSNA 1XLPA 1PFDA 2VZKD 2KMCA 1XCTL 2WNMA 2J0KA 1E5WA 2FE8A 1LO5D 4IWPA 1FRDA 5G55A 1KRHA 2KO3A 4W9JA 4RM8A 1SE4A 1M4VA 1AYFA 4BBNC 2DZJA 4LJPB 1YMHE 1MHXA 3U4EG 4OHJA 3VAWA 1KM7A 1S1QB 1VD2A 2LASA 2JY6A 3AE1B 4N59A 4C7YA 2IGGA 3QK0A 1KTKA 1R4NB 3RNEC 3PTFC 3AI5A 2MP2A 2D3GA 1OEYA 1OQYA 2K6DB 5CHVC 2BYVE 5CHWA 3MHSD 3PHXB 4EZJA 2QC8A 4W9KA 4MH8A 1QILA 3UF8A 1ESFA 2BB5A 1WGDA
chains in the Genus database with same CATH topology
1V81A 3MTNB 4II3B 2V4LA 1UBQA 3A9JB 1V2YA 3T9LA 5JZEB 4E3CA 1F9JA 4M0WB 4EZLA 3EC8A 3X0WA 2CKHB 5J17A 1P1AA 4W9FA 2AL3A 2JRHA 4X57B 2CHXA 3NOBA 3HM3A 2ZNVC 1UBIA 2LVPA 2ZPNA 2V3SA 3PPAA 1M94A 1LXDA 4P7IA 4TQ1A 2BKFA 4PS3A 4W9EA 2CR5A 3VH4B 3V60A 2UYZB 2Z59B 2ZVNA 3KYDD 3UINB 4EOYA 3PHWB 2N1WA 4NJ6A 2IZVB 3U30A 2EKEC 1HE8A 5LXHA 2XK5A 3ENEA 4IM2A 1WJNA 3TL5A 3Q3JA 4HVBA 4KZ0A 4ZRKA 3IBEA 2IY0B 3QQ8B 5KHOA 4G0NB 1Q5WB 3B08A 3UQBA 3KUZA 4XZ4A 2GBKA 2JVCA 5L95C 2BWFA 3WAOA 1XD3B 1J19A 2LVQA 1GNUA 2M1MA 2KDIA 3ECIA 3A1QA 3C0RB 4GDLB 2HTHA 3SDLC 2OOBB 3RULA 2I1KA 4IG7B 1T0YA 2JUOA 4G3XB 4DHZB 1WXVA 2L00B 4NNJB 3PREA 4AUQC 3WALA 1EUVB 4GIVA 1WZ0A 3LDZE 3ZNHB 2C7MB 1EO6A 2L8JA 4PS7A 2IBIB 3A4RA 3V61A 1P98A 2WWZA 5J18A 2MWSB 2DENB 3N32A 4KIKA 2LGXA 3AXCA 3APDA 5CTRC 1TZ1A 2J0MA 2MBHA 2KTRA 2IO1B 2YVCA 2FIDA 3VTUA 3H9DA 2ZZPB 2DAJA 3R7RA 2KOXA 3DVNU 1WGGA 2KX0A 2LRUA 3NZUA 3PRMB 3ZDTA 2G45B 2D2QA 2KC2A 4NAWB 3JSVB 2ZJDA 4PYUA 3UQAA 1WGRA 2C7HA 2LD9A 4WAAA 4GN1A 4OVVA 1YX6B 4ZRIA 1Z2MA 3A4SC 3V6EB 3QX1A 2AYOB 4G50A 2KWVB 2LI5A 3KYCD 2HD5B 1ZW7A 3OAWA 2KJHB 4BKGA 4EEWA 3QC8B 4HWIB 4IWOA 3L13A 3VTVA 3KUDB 2M17A 4AWJA 3LJ3A 4TUUA 2C7NB 3DBRI 1WH3A 4HDQA 3P2BA 3QARA 4LCDE 1OEYJ 2N1VA 4ANWA 4NQLB 4K7SA 5CHFA 3RZFA 2Z0EB 3APCA 1NDDA 4W9CA 1I42A 2L7RA 2D07B 3DBLI 3H6NA 4IC7B 1ISNA 2CHWA 3A33B 2O2VA 1YJ1A 3ZDMC 2NPTB 4JGHB 4IM3A 4MJSA 4PS8A 3B1LX 3CMMB 2RR9A 3PVLA 3ML8A 4BVUC 3VTWA 5C1ZA 4YL8A 1I35A 1GC6A 5LLIA 4DDID 3M3JA 2WDTB 3O65B 2KNBA 3QHTA 3NHEB 3ZIMA 4DHJD 1NI2A 1RFAA 3JYUA 3VVWB 3TMPB 1K8RB 1WMHA 2ZVOA 3R3MA 3ML9A 2ASQA 1LFDA 2MBQA 1OTRB 3VFKA 1TBEA 2GBRA 2KFKB 3DVGY 2NBUA 3Q3FA 4MM3A 3EECA 3WANA 3ZRCA 1GG3A 3QWZB 5D6JB 4WQOB 2JXXA 1WYWB 2IO2B 1TGZB 1UD7A 4JL9A 4M8MA 1IP9A 1A5RA 3WA0A 3DOWA 4KV2A 1D3ZA 3PRPB 2LGYA 4FLHA 4E74A 3JW0X 2GMIC 3DBHI 3KH0A 2HE7A 3U8ZA 4DDGD 3VUWA 2C60A 2W9NA 4MGZE 2KWCA 3GOEA 1V5TA 2N9XA 4GGQA 4HK2A 1WE7A 4AJWA 2JPHA 1IYFA 1PQSA 4W9GA 2EMTA 5CX3A 1L2NA 2CU1A 1WM2A 2KJRA 3I3TB 1WR6E 2DZKA 5D7GA 2KQ7A 2K8CA 4F8CB 2BKRB 2KD0A 3A9KB 2D11A 3HM6X 2KJ6A 3A1QB 3ALBA 3NY5A 2KKCA 2D10A 4A3PA 5JHBA 1G6JA 3HK0A 4DWFA 4WJPA 5DPSA 1KJTA 1WGHA 3TIXA 2JF5A 5DPTA 1H4RA 2L0TA 1S3SG 3CF6E 2PPHA 3V62A 4CO7A 4CYEA 4I6LB 2C9WB 2N7DA 2VRRB 3QCAA 2L0FA 2JZ3B 2PE9A 2WX0A 3PSEB 1WR1A 2K1FA 2NS5A 2AL6A 3PRZA 4RMAA 2FNJB 2OJRA 5JH5C 3CSFA 1WX8A 3IFWB 3S2AA 3KW5B 3DPDA 3OJ4B 4MSQB 4EKUA 1JRUA 2O6VB 4BOZB 4GXBA 3K9PB 3KUCB 5E6PA 4KSKC 2FAZA 2V1YA 4MELA 3A9JA 4K7UA 2BWES 2G4DB 2Y5BB 3WIMA 1J8CA 5GMVA 3H7PB 4MEMA 1WY8A 2DZMA 2M8SA 2NVUI 1SGHA 3VHTC 2DX5B 4WWPA 3SU8X 3NS8A 3VH3B 3DVNV 4WWOA 4MGIE 1Q0WB 4J6IA 2FIFA 3NZSA 4ZRJA 3K9OB 4RM9A 1WE6A 3HIZA 3PLUA 3QAQA 5FR6A 4JLCA 2YLMA 3IVFA 2NBVB 4FJVB 4GSWA 4ZDVA 4LDTD 2GBNA 3PV1A 2KLCA 5E6OA 4B95A 4EZKA 3ZNZB 3ZLZA 2XEWA 5D94A 2LJ5A 5AZGA 1WZ3A 1L7YA 3L54A 4KSLC 2L3ZA 1SIFA 3TBLD 2KK8A 3VXWA 1V9JA 2KFJA 4II2B 3IG3A 5KHQA 1Q1OA 4GDLA 4JQWC 2JRIB 3VUYA 3HHMA 2MSED 4MGKE 4NY0A 4ANXA 5DPWA 2CS4A 1UGMA 2WYQA 4M8NA 4FULA 2J0JA 4MSMB 4N9F4 2BYEA 2M0XA 5BO4B 3BINA 4BKSD 2MP2B 4NPNA 4XX5A 3RUIB 3ZRFA 4F1SA 1KOTA 3RD2A 2ZNVB 4URKA 4AP4C 2KMAA 4BOSC 3PGEA 1YX5B 4ICVA 5TR5A 5LXIB 1E8ZA 3TJPA 2DYBA 2G4SA 3H1UA 2B3AA 1WFYA 2EMSA 2QHOA 1V5OA 5DCNA 3R7QA 4A3OA 4TQ0A 4B9KA 3W1YA 3L16A 4B6WA 1WRDB 2KLGA 1QZEA 2JZZA 2PJHA 4DHJB 3V6CB 4NAWA 3JSVA 2GOWA 2RGFA 2KDBA 2IO3B 2KXJA 3VUXA 2N9EB 1P0RA 2KX3A 4BKSA 4W9DA 4ZYNA 2G3QB 3ZKJC 2A5UA 2KDFB 2MX2A 4W9LA 3UIPB 2I1JA 4GDKA 4W9IA 4AOFA 2XK5B 3VQIA 5J2RA 4FBJB 4I6NB 4GU2A 2RSUA 2DYMA 3RZWC 2K8BA 5AZFA 1TTNA 4HXDA 1E7VA 2N4FA 1BT0A 1GC7A 1LM8B 2NBWB 3PS6A 3ZTCA 2CHZA 2NPTA 2NR2A 1WXMA 2AWTA 3L10B 4LJOB 4WWNA 2REXA 5HKHA 1GUAB 4TV3A 5DPRA 2A4ZA 4XC2A 4AJYB 4F7ZA 3DDCB 3QIJA 1C1YB 1GJZA 2MQJA 4K1RB 2BGFA 5EDSA 3DQVA 3N30A 2LXCA 2N7EA 3UGBB 2JT4B 1AARA 1X1MA 4HPLB 2HJ8A 4KVGB 2XBBC 2MCNB 1UELA 1FXTB 1WXSA 1CMXB 1E90A 3R66C 4NJ7A 4HCPB 2KFKA 4DBGA 4KIKB 1KLVA 2UWQA 3L08A 3WAMA 1RLFA 2FCNA 3M62B 2KANA 2KTRB 4GOCA 2KZRA 2AEHA 3EHVA 4MH0E 4G11A 5G2NA 2RPQA 4ASWC 1YIWA 4E71A 2KWUB 4BBNF 1E7UA 4FN2A 3AULA 2ZCCA 4HLEA 1LQBA 4IWQA 2KHWB 2MW5A 4FA6A 1RRBA 1EF5A 1YD8U 3KVFB 4KDLB 2M4NA 4EFOA 3ZO5B 2LRWA 1SE9A 2K25A 3AU4A 3X23A 3ZTDA 4K81A 2K6QA 4I6PA 4BKTA 1WXAA 3JVZX 1RAXA 3PLVA 3A9KA 4GB9A 4DHZE 2ZCBA 1WGYA 4ICUA 3ZVVA 1V6EA 5L83A 2O6VD 2C5LC 4KZCA 3AU5A 2KVRA 4PYZA 3L0WB 3APFA 2MLBA 1WI0A 3ZNGC 2IY1B 5E6NA 3W1SA 1WX7A 2RD0A 2PEAA 3EFUA 1WJ6A 2IYDB 3M63B 3TCAA 2LUEA 2L05A 2O2VB 4HPMB 4IM0A 4LDTB 1C3TA 1R4MI 4MJSB 4FHKA 3H7SA 2KN5A 2LZ6A 4JIOU 2GBMA 3MJWA 2IO0B 2MBEA 3RT3B 3N3KB 5IA7A 1WM3A 3ZUNA 1H8CA 2JWZA 4FADA 2GBJA 4HDOA 1XT9B 1ZKHA 2FCQA 1WX9A 5C23A 2FUHB 2DHZA 1V80A 1WJ4A 2LGDA 1WMHB 2MBBB 1NBFC 2Z0DB 2FCSA 3W1SC 3OJ3A 2DAFA 3SD5A 2R2QA 4FJZA 4EUTA 3RYTA 2O6VA 1E8YA 2KTFA 2BYFA 2MBOA 4DK5A 3U7DA 3SHQA 1VCBA 2KMCA 2MRPA 1YQBA 3H7PA 3M95A 1UZXB 2ZPYA 2J0KA 1UH6A 2DYOA 1E5WA 3QJZA 1R4NI 4TKNA 4W9HA 3L17A 4GDKB 4IWPA 2K8HA 2KDEB 4DXAB 1WF9A 2BF8B 1OGWA 2LWPA 3GZNI 3IHPC 3PZDA 3VDZA 2FCMA 3DBSA 2KQSA 5G55A 4ANVA 4OVUA 2L76A 4A20A 5JHAA 4IW0A 1XQQA 2KO3A 1ZGUB 3DCGA 4RM8A 4FJYA 1MG8A 4W9JA 4ANUA 2N9PC 4MGYE 4BBNC 2DZJA 1E8XA 4LJPB 4KDIC 3PT2B 3UIOB 4FHJA 2BPSA 3VAWA 1KM7A 1V86A 1P3QU 2MA9B 1S1QB 3OLMD 4WJOA 3ZW3A 1VD2A 4WJNA 1WIAA 1Y8RC 2KC1A 1U4AA 2LASA 5IAAC 2JY6A 4CHKA 3QK0A 3CSTA 3RCZA 4GMVA 2LVOA 2WX1A 3ZNID 4HJKA 1EF1A 3QA8A 5D2MB 3PTFC 3AI5A 2K39A 2MP2A 1WJUA 2D3GA 3B0AA 3D32A 4NQKE 1OEYA 1OQYA 2K6DB 1V49A 1IPGA 4IUMB 4BFRA 5CHVC 5AZHA 2DZIA 3DVGX 4MDKE 2J7QB 2BYVE 2NCNA 2ZEQA 5CHWA 5AEKB 3WAPA 1J0GA 3MHSD 3PHXB 2PE6B 2LXAA 4HCNB 3ONSA 4EZJA 3BY4B 4WJQA 4W9KA 1Z5SB 3T8MA 4K7WA 3UF8A 1P9DU 2R2OA 1E8WA 1WGDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1V81 A;  3MTN B;  4II3 B;  2V4L A;  1UBQ A;  3A9J B;  1V2Y A;  3T9L A;  5JZE B;  4E3C A;  1F9J A;  4M0W B;  4EZL A;  3EC8 A;  3X0W A;  2CKH B;  5J17 A;  1P1A A;  4W9F A;  2AL3 A;  2JRH A;  4X57 B;  2CHX A;  3NOB A;  3HM3 A;  2ZNV C;  1UBI A;  2LVP A;  2ZPN A;  2V3S A;  3PPA A;  1M94 A;  1LXD A;  4P7I A;  4TQ1 A;  2BKF A;  4PS3 A;  4W9E A;  2CR5 A;  3VH4 B;  3V60 A;  2UYZ B;  2Z59 B;  2ZVN A;  3KYD D;  3UIN B;  4EOY A;  3PHW B;  2N1W A;  4NJ6 A;  2IZV B;  3U30 A;  2EKE C;  1HE8 A;  5LXH A;  2XK5 A;  3ENE A;  4IM2 A;  1WJN A;  3TL5 A;  3Q3J A;  4HVB A;  4KZ0 A;  4ZRK A;  3IBE A;  2IY0 B;  3QQ8 B;  5KHO A;  4G0N B;  1Q5W B;  3B08 A;  3UQB A;  3KUZ A;  4XZ4 A;  2GBK A;  2JVC A;  5L95 C;  2BWF A;  3WAO A;  1XD3 B;  1J19 A;  2LVQ A;  1GNU A;  2M1M A;  2KDI A;  3ECI A;  3A1Q A;  3C0R B;  4GDL B;  2HTH A;  3SDL C;  2OOB B;  3RUL A;  2I1K A;  4IG7 B;  1T0Y A;  2JUO A;  4G3X B;  4DHZ B;  1WXV A;  2L00 B;  4NNJ B;  3PRE A;  4AUQ C;  3WAL A;  1EUV B;  4GIV A;  1WZ0 A;  3LDZ E;  3ZNH B;  2C7M B;  1EO6 A;  2L8J A;  4PS7 A;  2IBI B;  3A4R A;  3V61 A;  1P98 A;  2WWZ A;  5J18 A;  2MWS B;  2DEN B;  3N32 A;  4KIK A;  2LGX A;  3AXC A;  3APD A;  5CTR C;  1TZ1 A;  2J0M A;  2MBH A;  2KTR A;  2IO1 B;  2YVC A;  2FID A;  3VTU A;  3H9D A;  2ZZP B;  2DAJ A;  3R7R A;  2KOX A;  3DVN U;  1WGG A;  2KX0 A;  2LRU A;  3NZU A;  3PRM B;  3ZDT A;  2G45 B;  2D2Q A;  2KC2 A;  4NAW B;  3JSV B;  2ZJD A;  4PYU A;  3UQA A;  1WGR A;  2C7H A;  2LD9 A;  4WAA A;  4GN1 A;  4OVV A;  1YX6 B;  4ZRI A;  1Z2M A;  3A4S C;  3V6E B;  3QX1 A;  2AYO B;  4G50 A;  2KWV B;  2LI5 A;  3KYC D;  2HD5 B;  1ZW7 A;  3OAW A;  2KJH B;  4BKG A;  4EEW A;  3QC8 B;  4HWI B;  4IWO A;  3L13 A;  3VTV A;  3KUD B;  2M17 A;  4AWJ A;  3LJ3 A;  4TUU A;  2C7N B;  3DBR I;  1WH3 A;  4HDQ A;  3P2B A;  3QAR A;  4LCD E;  1OEY J;  2N1V A;  4ANW A;  4NQL B;  4K7S A;  5CHF A;  3RZF A;  2Z0E B;  3APC A;  1NDD A;  4W9C A;  1I42 A;  2L7R A;  2D07 B;  3DBL I;  3H6N A;  4IC7 B;  1ISN A;  2CHW A;  3A33 B;  2O2V A;  1YJ1 A;  3ZDM C;  2NPT B;  4JGH B;  4IM3 A;  4MJS A;  4PS8 A;  3B1L X;  3CMM B;  2RR9 A;  3PVL A;  3ML8 A;  4BVU C;  3VTW A;  5C1Z A;  4YL8 A;  1I35 A;  1GC6 A;  5LLI A;  4DDI D;  3M3J A;  2WDT B;  3O65 B;  2KNB A;  3QHT A;  3NHE B;  3ZIM A;  4DHJ D;  1NI2 A;  1RFA A;  3JYU A;  3VVW B;  3TMP B;  1K8R B;  1WMH A;  2ZVO A;  3R3M A;  3ML9 A;  2ASQ A;  1LFD A;  2MBQ A;  1OTR B;  3VFK A;  1TBE A;  2GBR A;  2KFK B;  3DVG Y;  2NBU A;  3Q3F A;  4MM3 A;  3EEC A;  3WAN A;  3ZRC A;  1GG3 A;  3QWZ B;  5D6J B;  4WQO B;  2JXX A;  1WYW B;  2IO2 B;  1TGZ B;  1UD7 A;  4JL9 A;  4M8M A;  1IP9 A;  1A5R A;  3WA0 A;  3DOW A;  4KV2 A;  1D3Z A;  3PRP B;  2LGY A;  4FLH A;  4E74 A;  3JW0 X;  2GMI C;  3DBH I;  3KH0 A;  2HE7 A;  3U8Z A;  4DDG D;  3VUW A;  2C60 A;  2W9N A;  4MGZ E;  2KWC A;  3GOE A;  1V5T A;  2N9X A;  4GGQ A;  4HK2 A;  1WE7 A;  4AJW A;  2JPH A;  1IYF A;  1PQS A;  4W9G A;  2EMT A;  5CX3 A;  1L2N A;  2CU1 A;  1WM2 A;  2KJR A;  3I3T B;  1WR6 E;  2DZK A;  5D7G A;  2KQ7 A;  2K8C A;  4F8C B;  2BKR B;  2KD0 A;  3A9K B;  2D11 A;  3HM6 X;  2KJ6 A;  3A1Q B;  3ALB A;  3NY5 A;  2KKC A;  2D10 A;  4A3P A;  5JHB A;  1G6J A;  3HK0 A;  4DWF A;  4WJP A;  5DPS A;  1KJT A;  1WGH A;  3TIX A;  2JF5 A;  5DPT A;  1H4R A;  2L0T A;  1S3S G;  3CF6 E;  2PPH A;  3V62 A;  4CO7 A;  4CYE A;  4I6L B;  2C9W B;  2N7D A;  2VRR B;  3QCA A;  2L0F A;  2JZ3 B;  2PE9 A;  2WX0 A;  3PSE B;  1WR1 A;  2K1F A;  2NS5 A;  2AL6 A;  3PRZ A;  4RMA A;  2FNJ B;  2OJR A;  5JH5 C;  3CSF A;  1WX8 A;  3IFW B;  3S2A A;  3KW5 B;  3DPD A;  3OJ4 B;  4MSQ B;  4EKU A;  1JRU A;  2O6V B;  4BOZ B;  4GXB A;  3K9P B;  3KUC B;  5E6P A;  4KSK C;  2FAZ A;  2V1Y A;  4MEL A;  3A9J A;  4K7U A;  2BWE S;  2G4D B;  2Y5B B;  3WIM A;  1J8C A;  5GMV A;  3H7P B;  4MEM A;  1WY8 A;  2DZM A;  2M8S A;  2NVU I;  1SGH A;  3VHT C;  2DX5 B;  4WWP A;  3SU8 X;  3NS8 A;  3VH3 B;  3DVN V;  4WWO A;  4MGI E;  1Q0W B;  4J6I A;  2FIF A;  3NZS A;  4ZRJ A;  3K9O B;  4RM9 A;  1WE6 A;  3HIZ A;  3PLU A;  3QAQ A;  5FR6 A;  4JLC A;  2YLM A;  3IVF A;  2NBV B;  4FJV B;  4GSW A;  4ZDV A;  4LDT D;  2GBN A;  3PV1 A;  2KLC A;  5E6O A;  4B95 A;  4EZK A;  3ZNZ B;  3ZLZ A;  2XEW A;  5D94 A;  2LJ5 A;  5AZG A;  1WZ3 A;  1L7Y A;  3L54 A;  4KSL C;  2L3Z A;  1SIF A;  3TBL D;  2KK8 A;  3VXW A;  1V9J A;  2KFJ A;  4II2 B;  3IG3 A;  5KHQ A;  1Q1O A;  4GDL A;  4JQW C;  2JRI B;  3VUY A;  3HHM A;  2MSE D;  4MGK E;  4NY0 A;  4ANX A;  5DPW A;  2CS4 A;  1UGM A;  2WYQ A;  4M8N A;  4FUL A;  2J0J A;  4MSM B;  4N9F 4;  2BYE A;  2M0X A;  5BO4 B;  3BIN A;  4BKS D;  2MP2 B;  4NPN A;  4XX5 A;  3RUI B;  3ZRF A;  4F1S A;  1KOT A;  3RD2 A;  2ZNV B;  4URK A;  4AP4 C;  2KMA A;  4BOS C;  3PGE A;  1YX5 B;  4ICV A;  5TR5 A;  5LXI B;  1E8Z A;  3TJP A;  2DYB A;  2G4S A;  3H1U A;  2B3A A;  1WFY A;  2EMS A;  2QHO A;  1V5O A;  5DCN A;  3R7Q A;  4A3O A;  4TQ0 A;  4B9K A;  3W1Y A;  3L16 A;  4B6W A;  1WRD B;  2KLG A;  1QZE A;  2JZZ A;  2PJH A;  4DHJ B;  3V6C B;  4NAW A;  3JSV A;  2GOW A;  2RGF A;  2KDB A;  2IO3 B;  2KXJ A;  3VUX A;  2N9E B;  1P0R A;  2KX3 A;  4BKS A;  4W9D A;  4ZYN A;  2G3Q B;  3ZKJ C;  2A5U A;  2KDF B;  2MX2 A;  4W9L A;  3UIP B;  2I1J A;  4GDK A;  4W9I A;  4AOF A;  2XK5 B;  3VQI A;  5J2R A;  4FBJ B;  4I6N B;  4GU2 A;  2RSU A;  2DYM A;  3RZW C;  2K8B A;  5AZF A;  1TTN A;  4HXD A;  1E7V A;  2N4F A;  1BT0 A;  1GC7 A;  1LM8 B;  2NBW B;  3PS6 A;  3ZTC A;  2CHZ A;  2NPT A;  2NR2 A;  1WXM A;  2AWT A;  3L10 B;  4LJO B;  4WWN A;  2REX A;  5HKH A;  1GUA B;  4TV3 A;  5DPR A;  2A4Z A;  4XC2 A;  4AJY B;  4F7Z A;  3DDC B;  3QIJ A;  1C1Y B;  1GJZ A;  2MQJ A;  4K1R B;  2BGF A;  5EDS A;  3DQV A;  3N30 A;  2LXC A;  2N7E A;  3UGB B;  2JT4 B;  1AAR A;  1X1M A;  4HPL B;  2HJ8 A;  4KVG B;  2XBB C;  2MCN B;  1UEL A;  1FXT B;  1WXS A;  1CMX B;  1E90 A;  3R66 C;  4NJ7 A;  4HCP B;  2KFK A;  4DBG A;  4KIK B;  1KLV A;  2UWQ A;  3L08 A;  3WAM A;  1RLF A;  2FCN A;  3M62 B;  2KAN A;  2KTR B;  4GOC A;  2KZR A;  2AEH A;  3EHV A;  4MH0 E;  4G11 A;  5G2N A;  2RPQ A;  4ASW C;  1YIW A;  4E71 A;  2KWU B;  4BBN F;  1E7U A;  4FN2 A;  3AUL A;  2ZCC A;  4HLE A;  1LQB A;  4IWQ A;  2KHW B;  2MW5 A;  4FA6 A;  1RRB A;  1EF5 A;  1YD8 U;  3KVF B;  4KDL B;  2M4N A;  4EFO A;  3ZO5 B;  2LRW A;  1SE9 A;  2K25 A;  3AU4 A;  3X23 A;  3ZTD A;  4K81 A;  2K6Q A;  4I6P A;  4BKT A;  1WXA A;  3JVZ X;  1RAX A;  3PLV A;  3A9K A;  4GB9 A;  4DHZ E;  2ZCB A;  1WGY A;  4ICU A;  3ZVV A;  1V6E A;  5L83 A;  2O6V D;  2C5L C;  4KZC A;  3AU5 A;  2KVR A;  4PYZ A;  3L0W B;  3APF A;  2MLB A;  1WI0 A;  3ZNG C;  2IY1 B;  5E6N A;  3W1S A;  1WX7 A;  2RD0 A;  2PEA A;  3EFU A;  1WJ6 A;  2IYD B;  3M63 B;  3TCA A;  2LUE A;  2L05 A;  2O2V B;  4HPM B;  4IM0 A;  4LDT B;  1C3T A;  1R4M I;  4MJS B;  4FHK A;  3H7S A;  2KN5 A;  2LZ6 A;  4JIO U;  2GBM A;  3MJW A;  2IO0 B;  2MBE A;  3RT3 B;  3N3K B;  5IA7 A;  1WM3 A;  3ZUN A;  1H8C A;  2JWZ A;  4FAD A;  2GBJ A;  4HDO A;  1XT9 B;  1ZKH A;  2FCQ A;  1WX9 A;  5C23 A;  2FUH B;  2DHZ A;  1V80 A;  1WJ4 A;  2LGD A;  1WMH B;  2MBB B;  1NBF C;  2Z0D B;  2FCS A;  3W1S C;  3OJ3 A;  2DAF A;  3SD5 A;  2R2Q A;  4FJZ A;  4EUT A;  3RYT A;  2O6V A;  1E8Y A;  2KTF A;  2BYF A;  2MBO A;  4DK5 A;  3U7D A;  3SHQ A;  1VCB A;  2KMC A;  2MRP A;  1YQB A;  3H7P A;  3M95 A;  1UZX B;  2ZPY A;  2J0K A;  1UH6 A;  2DYO A;  1E5W A;  3QJZ A;  1R4N I;  4TKN A;  4W9H A;  3L17 A;  4GDK B;  4IWP A;  2K8H A;  2KDE B;  4DXA B;  1WF9 A;  2BF8 B;  1OGW A;  2LWP A;  3GZN I;  3IHP C;  3PZD A;  3VDZ A;  2FCM A;  3DBS A;  2KQS A;  5G55 A;  4ANV A;  4OVU A;  2L76 A;  4A20 A;  5JHA A;  4IW0 A;  1XQQ A;  2KO3 A;  1ZGU B;  3DCG A;  4RM8 A;  4FJY A;  1MG8 A;  4W9J A;  4ANU A;  2N9P C;  4MGY E;  4BBN C;  2DZJ A;  1E8X A;  4LJP B;  4KDI C;  3PT2 B;  3UIO B;  4FHJ A;  2BPS A;  3VAW A;  1KM7 A;  1V86 A;  1P3Q U;  2MA9 B;  1S1Q B;  3OLM D;  4WJO A;  3ZW3 A;  1VD2 A;  4WJN A;  1WIA A;  1Y8R C;  2KC1 A;  1U4A A;  2LAS A;  5IAA C;  2JY6 A;  4CHK A;  3QK0 A;  3CST A;  3RCZ A;  4GMV A;  2LVO A;  2WX1 A;  3ZNI D;  4HJK A;  1EF1 A;  3QA8 A;  5D2M B;  3PTF C;  3AI5 A;  2K39 A;  2MP2 A;  1WJU A;  2D3G A;  3B0A A;  3D32 A;  4NQK E;  1OEY A;  1OQY A;  2K6D B;  1V49 A;  1IPG A;  4IUM B;  4BFR A;  5CHV C;  5AZH A;  2DZI A;  3DVG X;  4MDK E;  2J7Q B;  2BYV E;  2NCN A;  2ZEQ A;  5CHW A;  5AEK B;  3WAP A;  1J0G A;  3MHS D;  3PHX B;  2PE6 B;  2LXA A;  4HCN B;  3ONS A;  4EZJ A;  3BY4 B;  4WJQ A;  4W9K A;  1Z5S B;  3T8M A;  4K7W A;  3UF8 A;  1P9D U;  2R2O A;  1E8W A;  1WGD A; 
#chains in the Genus database with same CATH topology
 4E3C A;  1TIF A;  3X0W A;  4W9F A;  2BBC A;  2JRH A;  2M56 B;  1WXQ A;  2ZNV C;  1N61 A;  2KN4 A;  2V3S A;  2CR5 A;  4FXC A;  4EOY A;  4XWT A;  2BB6 A;  3PHW B;  1NEN B;  1HE8 A;  5LXH A;  2XK5 A;  1WJN A;  4HVB A;  2IY0 B;  3ABV B;  4G0N B;  2KWD A;  3B08 A;  3UQB A;  3OWE B;  2BWF A;  3HRD D;  1JWB D;  1GNU A;  4NZL B;  1ZUD 2;  2HTH A;  1BML C;  3IT6 B;  3RUL A;  4RGN A;  3WAL A;  3AM9 A;  3V05 A;  2L32 A;  4WAF A;  3LDZ E;  1K53 A;  3ZNH B;  1B9R A;  2TSS A;  3V61 A;  1VDV A;  2MWS B;  2DEN B;  3I63 C;  3N32 A;  5I4D A;  3AXC A;  3VRA B;  1TZ1 A;  2MBH A;  1HZ6 A;  2QIL A;  2WS3 B;  2ZZP B;  3GP7 A;  2JQR B;  2JU6 X;  1C79 A;  1L0V B;  2N0S B;  1OFF A;  3PRM B;  3B9J A;  3JSV B;  1QOB A;  4PYU A;  3UQA A;  1FXI A;  1YX6 B;  1Z2M A;  2PIA A;  2AYO B;  2BVC A;  4BKG A;  2KWV B;  3OAW A;  4EEW A;  4IWO A;  3VTV A;  2M17 A;  4AWJ A;  3BYT B;  4TUU A;  2B76 B;  1WH3 A;  3QAR A;  4LCD E;  2N1V A;  4ANW A;  4NQL B;  4K7S A;  5CHF A;  1TS2 A;  1NDD A;  4W9C A;  1I42 A;  4LLG M;  2QIE B;  4IC7 B;  3A33 B;  3ZDM C;  1YJ1 A;  2NPT B;  4HPP A;  2RDH A;  3B1L X;  2RR9 A;  4BVU C;  1GC6 A;  1VZ6 A;  5LLI A;  1MVK A;  3NHE B;  1PYW D;  2LMC A;  1NI2 A;  1ZP0 B;  1WMH A;  3R3M A;  3ML9 A;  2ASQ A;  2INN E;  2GBR A;  4ZOH C;  3DBR B;  1RFK A;  3ZRC A;  1GG3 A;  4LTU A;  2BQQ A;  1WYW B;  1UD7 A;  3I9V 1;  3IXS A;  4KV2 A;  2L1A A;  1WYG A;  4FLH A;  4E74 A;  3JW0 X;  1VZ7 A;  2OED A;  2HTM E;  2QCZ A;  3U8Z A;  3R2I A;  2C60 A;  2W9N A;  4ARC A;  2K3U A;  3RPF C;  2KWC A;  3GOE A;  4GGQ A;  1KH0 A;  1MHH E;  4AJW A;  1PQS A;  3FIL A;  3I3T B;  1WR6 E;  5FK9 C;  2KD0 A;  3A9K B;  2D11 A;  3A1Q B;  3ALB A;  2KKC A;  3ZQ4 A;  4DWF A;  2HDE A;  1WGH A;  3TIX A;  2JF5 A;  2PPH A;  2C9W B;  3TEZ A;  3DBH B;  2CU3 A;  3PSE B;  1WR1 A;  2NS5 A;  4RMA A;  2M19 A;  3RN9 C;  5JH5 C;  3CSF A;  3IFW B;  4CQN A;  3S2A A;  4MSQ B;  4RCO A;  1JRU A;  3K9P B;  3KUC B;  3W9C B;  2FAZ A;  4MEL A;  2G4D B;  4YSX B;  4M0W A;  1WY8 A;  3ZJT A;  2NVU I;  5E6J A;  2CJN A;  2DX5 B;  4WWP A;  1HTO A;  3FKY A;  3DVN V;  1YJJ A;  2J52 A;  3NZS A;  2WXI A;  3P63 A;  3HIZ A;  3PLU A;  5FR6 A;  4ZDV A;  4GSW A;  4L1B A;  2KLC A;  1PGA A;  3NVZ A;  2LJ5 A;  4XGA B;  3HVZ A;  1WZ3 A;  1L7Y A;  2HJ1 A;  4KSL C;  2L3Z A;  2W55 A;  2VZK B;  2MJ3 A;  3TBL D;  4JQW C;  2KT7 A;  3BYY B;  1B1Z A;  1JRO A;  1JWA D;  2M0X A;  1SJH D;  3BIN A;  4ITK A;  3W5U B;  4BKS D;  2MP2 B;  1FFV A;  2ZNV B;  4AP4 C;  2KMA A;  5LXI B;  1FNW A;  2DYB A;  2KAC A;  2B3A A;  2J53 A;  5DCN A;  3R7Q A;  3L16 A;  2KLG A;  1QZE A;  1ZXI A;  2QDF A;  4ARI A;  2GOW A;  2KXJ A;  2WHI A;  4BKS A;  2KX3 A;  1TS3 A;  3ZKJ C;  2KDF B;  2WLB A;  1VZ8 A;  1TY2 A;  2XK5 B;  3TEY A;  3AEF B;  4I6N B;  4GU2 A;  4A90 A;  1T0Q C;  3AE8 B;  2N4F A;  1LM8 B;  3PS6 A;  5AUI A;  2WDQ B;  1UWM A;  3MC9 A;  1F2R I;  5HKH A;  1GUA B;  2ONQ A;  5H92 C;  1DGJ A;  3BWU D;  1F0Z A;  1C1Y B;  2UU7 A;  2MQJ A;  4K1R B;  1L6U A;  1JQ4 A;  1E10 A;  4A9A A;  4Q2J A;  2IGD A;  1C78 A;  1CK1 A;  4HPL B;  2IDY A;  2XBB C;  4KGT A;  3R66 C;  1RWS A;  3P1M A;  1EU4 A;  1IGD A;  5JXV A;  3L08 A;  2KAN A;  3Q2A C;  2WXJ A;  2ZW1 A;  3I5J C;  3PZ8 A;  2AQ2 B;  4YWG G;  1ZE3 D;  2AQ3 B;  4FA6 A;  1RRB A;  1J7A A;  1EF5 A;  4KDL B;  4EFO A;  3ZO5 B;  3BZD B;  3AU4 A;  3X23 A;  4K81 A;  2K6Q A;  4BKT A;  2K22 A;  3AE7 B;  3JVZ X;  2XNA C;  3PLV A;  1WGY A;  1JRP A;  2O6V D;  4KZC A;  3AU5 A;  2EEL A;  4PYZ A;  1R7S A;  2IY1 B;  2M0A A;  1C76 A;  2L05 A;  1R4M I;  1XF5 L;  1KFY B;  3RT3 B;  5IA7 A;  1QOG A;  2GBJ A;  4HDO A;  1V80 A;  1D5Z C;  2LGD A;  1WMH B;  2FCS A;  1HZ5 A;  4EUT A;  2O6V A;  2KTF A;  1K52 A;  2MBO A;  2BS2 B;  3H7P A;  1YQB A;  1UZX B;  2ZPY A;  2DYO A;  4TKN A;  2KDE B;  1VJK A;  1WF9 A;  4ANV A;  2FCM A;  2KQS A;  2DBY A;  2L76 A;  2AQ1 B;  4IW0 A;  1D5M C;  3FIL B;  4LNF A;  3DCG A;  1ZGU B;  1MG8 A;  2N9P C;  4MGY E;  1E8X A;  1QOF A;  5EE0 A;  4KKI A;  3UIO B;  4FHJ A;  4LNO A;  1P3Q U;  1MJD A;  1Y8R C;  1U4A A;  5IAA C;  4GMV A;  2WX1 A;  4HJK A;  4M00 A;  3B0A A;  3D32 A;  4RGM A;  1TS5 A;  1V49 A;  4OVZ A;  4BFR A;  5AZH A;  1J0G A;  2NCN A;  4HCN B;  2LXA A;  4WJQ A;  1CZP A;  3T8M A;  2W54 A;  4K7W A;  1DOX A;  1E8W A;  1V81 A;  2V3P A;  3PO0 A;  2JSV X;  5JZE B;  4M0W B;  2GI9 A;  1Y56 A;  2CKH B;  1P1A A;  3AMZ A;  2AL3 A;  1HA5 A;  4X57 B;  2J42 A;  3NOB A;  2LVP A;  1E7P B;  2J4X A;  1LXD A;  4P7I A;  3VH4 B;  4NAM A;  3B2G A;  2ZVN A;  3N1Z C;  4WUR A;  2N1W A;  4NJ6 A;  2IZV B;  2K5P A;  2W82 A;  3U30 A;  1TZO A;  2SAK A;  3ZJV A;  3IBE A;  3QQ8 B;  1Q5W B;  3KUZ A;  2GBK A;  1JAL A;  5L95 C;  1XD3 B;  3W2D A;  3P4Q B;  5C2T B;  4KGR A;  4ZHO A;  4PT5 A;  3ECI A;  3A1Q A;  2K0P A;  4RGT A;  1T0Y A;  1ROE A;  2JUO A;  2R61 A;  4REZ A;  1P9D U;  2WXK A;  3MC0 B;  3A4R A;  2KAJ A;  4KIK A;  1I4Q A;  2LGX A;  3Q8E A;  3APD A;  5CTR C;  3DHI C;  3SR6 A;  2KTR A;  2FID A;  3H9D A;  1FEH A;  2G9H D;  3DVN U;  3AE3 B;  2LRU A;  1YN3 A;  3Q8B A;  2KC2 A;  2V4I B;  1TJE A;  4JWU C;  2PVO D;  2X38 A;  4ZRP A;  5IKC M;  3A4S C;  3V6E B;  2LGS A;  4G50 A;  4P16 A;  3QC8 B;  3L13 A;  4C80 A;  1SF0 A;  1FPY A;  3ETR A;  2Z0E B;  3EA6 A;  1P7F A;  3TEW A;  3DBL I;  2CHW A;  3AEG B;  4MJS A;  5D3I B;  3HVD A;  3Q3M C;  3VTW A;  5C1Z A;  1FCC C;  3O65 B;  3ZIM A;  2MJE A;  1K8R B;  3H8H A;  4IOI E;  5EE9 A;  3NVY A;  4OW0 A;  3VFK A;  4B0M A;  1TBE A;  3Q3F A;  1N5X A;  1N5W A;  4WQO B;  4JL9 A;  4OZA A;  3WA0 A;  3DOW A;  1D3Z A;  2LGY A;  1JWU D;  3Q3N C;  1F77 A;  4DDG D;  4L2Y A;  1TKG A;  1YQ4 B;  2JPH A;  3RFZ B;  1IYF A;  3NJT A;  4W9G A;  5CX3 A;  2KJR A;  3NRZ A;  2JX5 A;  2DZK A;  2EKI A;  2BKR B;  2Y5P A;  2YEP B;  3UI3 A;  3T3O A;  3L4P A;  1G6J A;  1NI3 A;  4WJP A;  4YT0 B;  4LNK A;  5HG2 A;  1SJE D;  2X8X X;  1H4R A;  1S3S G;  4CYE A;  4HKQ A;  3WCQ A;  2L0F A;  2PE9 A;  1DOI A;  1VR9 A;  2OJR A;  3VRB B;  1PUT A;  1WX8 A;  1I7H A;  4XDC A;  2O6V B;  4IKG A;  4KSK C;  2V1Y A;  4TSS A;  1J8C A;  3H7P B;  4MEM A;  2WXR A;  2ZW0 A;  3SU8 X;  3NS8 A;  3DHG C;  3BK2 A;  3ZJU A;  1C4A A;  4JLC A;  2YLM A;  5GXG B;  2NBV B;  1WSP A;  2GBN A;  3PV1 A;  1NEK B;  2NMQ A;  1EU3 A;  1IBX A;  2L83 A;  5AZG A;  3L54 A;  1AWD A;  2KK8 A;  3VXW A;  1EWY C;  1V9J A;  4II2 B;  5KHQ A;  2E6X A;  1FXA A;  3VUY A;  4ZYS A;  2LHD A;  4NY0 A;  3N1Y C;  4FUL A;  4N9F 4;  2DWQ A;  4MAC A;  3RUI B;  1KF6 B;  1L0X B;  3RD2 A;  2WP9 B;  3RI7 C;  4BOS C;  2OJW A;  2QMT A;  3TJP A;  2G4S A;  3H1U A;  3GE3 C;  3LB8 C;  4N6E B;  1V5O A;  4TQ0 A;  4A3O A;  1TT5 B;  1QQR A;  1WRD B;  1T3Q A;  4DHJ B;  1FFU A;  2IO3 B;  2KDM A;  2QJL A;  4RF0 A;  4C56 C;  3VUX A;  4K3C A;  1AN8 A;  4W9D A;  3AE2 B;  2WXN A;  1I4G A;  2MX2 A;  5H8Y E;  2JYT A;  3UIP B;  4D2K A;  3C19 A;  3NUH B;  1OQQ A;  2I2Y A;  1GOZ A;  2SEB D;  5AZF A;  4HXD A;  2CHZ A;  4LJO B;  2AWT A;  2WDR B;  1YN4 A;  4F7Z A;  3QIJ A;  2BGF A;  4HJG E;  4US9 A;  1X1M A;  2JWU A;  3EUB 2;  1E90 A;  4HCP B;  2KFK A;  1AW7 A;  4KIK B;  1E9M A;  2KTR B;  3RNA C;  2PLP A;  2PTL A;  3DWG C;  4G11 A;  1T5X D;  2RPQ A;  4ASW C;  1FM0 D;  2ON8 A;  2ZCC A;  4HLE A;  1LQB A;  2MW5 A;  2M4N A;  3Q69 A;  2LRW A;  1UWX A;  1SE9 A;  1QLB B;  2K25 A;  3ZTD A;  4M02 A;  2G1E A;  3U7Z A;  1WXA A;  4DHZ E;  2ZCB A;  1PGX A;  5L83 A;  3VR8 B;  5IN7 A;  3L0W B;  2D3B A;  1FNV A;  2RDB C;  1YOV B;  2MHJ A;  2PEA A;  3GS2 A;  2IYD B;  4YTM B;  2LUE A;  5FR3 A;  4IM0 A;  3EFC A;  4MJS B;  3H7S A;  2GBM A;  2MBE A;  3ZUN A;  5IOI A;  4KX6 B;  2JWZ A;  3Q6B A;  1PGB A;  1XT9 B;  1ZKH A;  2FCQ A;  1JCK B;  5IO9 A;  1WX9 A;  2DHZ A;  1NBF C;  4K3B A;  3SD5 A;  2R2Q A;  4MT5 A;  1GPX A;  2WGS A;  4HEA 1;  1C77 A;  1MG4 A;  2MRP A;  2OHF A;  1TY0 A;  1UH6 A;  4DQO C;  3QJZ A;  1QOA A;  3L17 A;  3AEE B;  4GDK B;  2K8H A;  2BF8 B;  1OGW A;  3MJ5 A;  3VDZ A;  3GZN I;  4OVU A;  4ANU A;  3Q8A A;  2BPS A;  2NTS A;  1L6V A;  1V86 A;  3P4S B;  2MA9 B;  1L0Y B;  3OLM D;  4WJO A;  3RNG C;  4WJN A;  5HI1 A;  4CHK A;  2DLB A;  3ZNI D;  1PDX A;  3QA8 A;  2RPV A;  2K39 A;  4NQK E;  1WJU A;  1TKE A;  1SE2 A;  1VLB A;  3DVG X;  4MDK E;  2ZEQ A;  2PE6 B;  3ONS A;  3BY4 B;  1Z5S B;  3ZXV A;  2R2O A;  1YJI A;  3MTN B;  2V4L A;  1UBQ A;  3ZXR A;  1T6B X;  3EC8 A;  1VRA B;  3HM3 A;  1TYG B;  4A6Q A;  3DHH C;  2LUM A;  1I4R A;  4W9E A;  4PS3 A;  2BTE A;  3V60 A;  3KYD D;  1NYR A;  2EKE C;  3ENE A;  3Q3J A;  5KHO A;  1IBX B;  2WXP A;  3WAO A;  1YNT E;  1J19 A;  2LVQ A;  3AB5 A;  3C0R B;  1D5X C;  2I1K A;  1WWT A;  4IG7 B;  4G3X B;  3PRE A;  4AUQ C;  1WZ0 A;  1EO6 A;  4PS7 A;  5J18 A;  2WXO A;  4US8 A;  2J0M A;  3AV8 A;  4XWW A;  2IO1 B;  3VTU A;  2WXM A;  4P6V F;  2FUG 1;  3LYY A;  4OZC A;  1WGG A;  3O13 A;  3NZU A;  1UNS A;  3ZDT A;  2G45 B;  4S17 A;  1WGR A;  2LD9 A;  4WAA A;  1BUI C;  4GN1 A;  4OVV A;  3KWV A;  3RNC C;  3QX1 A;  2LI5 A;  2GLS A;  1ZW7 A;  2KJH B;  3KUD B;  2JYE A;  3LJ3 A;  2C7N B;  4HDQ A;  3P2B A;  3W5V B;  3RZF A;  2L7R A;  3P42 A;  3EGR A;  1T0S C;  1ISN A;  3R2T A;  2CJO A;  4JGH B;  4IM3 A;  4PS8 A;  3CMM B;  1I4P A;  2H88 B;  5BMI A;  4KKJ A;  3M3J A;  2WDT B;  3BVZ A;  4DHJ D;  1RFA A;  2ZVO A;  4H2A A;  1J7C A;  1LFD A;  2MBQ A;  2RMM A;  4N58 A;  1OTR B;  2KFK B;  4MM3 A;  1ACC A;  3EEC A;  4A55 A;  1MI0 A;  3QWZ B;  5D6J B;  4WQM A;  4M8M A;  4RFB A;  3RMK C;  3DBL B;  3AH7 A;  3KH0 A;  2HE7 A;  3VUW A;  3NVV A;  1BXT A;  2GRI A;  4HK2 A;  2N9X A;  1WE7 A;  2L52 A;  1L2N A;  4F8C B;  1MPE A;  2KJ6 A;  3NY5 A;  5JHB A;  3HK0 A;  1F52 A;  2MH7 A;  3IT4 B;  3NS1 A;  5DPS A;  1SIJ A;  1KJT A;  2E3T A;  2L0T A;  3CF6 E;  4O1N A;  2VRR B;  1HQR D;  2WX0 A;  2FBW B;  3Q14 C;  3MHZ A;  3OG5 A;  3KW5 B;  3OJ4 B;  1FNU A;  1L4D B;  2D3C A;  1V1O A;  1SE3 A;  4BOZ B;  3P4R B;  3A9J A;  4K7U A;  2Y5B B;  3WIM A;  1XO3 A;  3NVW A;  2DZM A;  1UF0 A;  3VHT C;  2PVG C;  3VH3 B;  2LGI A;  1Q0W B;  4J6I A;  4RM9 A;  1WE6 A;  1ENF A;  1L5P A;  4FJV B;  4B95 A;  1NYQ A;  2XEW A;  2DNF A;  5BYQ A;  5D3D A;  4B0E A;  4KGS A;  5LNK 1;  3IG3 A;  1Q1O A;  4GDL A;  2JRI B;  2JXT A;  4ANX A;  3T3N A;  1I4H A;  5DPW A;  3V3X A;  1F2R C;  2WYQ A;  4M8N A;  2J0J A;  2BYE A;  1LGR A;  2Y5C A;  5BO4 B;  4DXF A;  4NPN A;  5HHD G;  1FRR A;  3MFG A;  3ZRF A;  4URK A;  2ICI A;  1YX5 B;  4ICV A;  1E8Z A;  2EMS A;  4JE3 B;  5BMH A;  2QHO A;  4B9K A;  3W1Y A;  4B6W A;  2JZZ A;  3V6C B;  1XXG A;  4NAW A;  2RGF A;  2KDB A;  1D6E C;  4A8X C;  3C8Y A;  2N9E B;  1P0R A;  1SBB B;  2G3Q B;  2A5U A;  1K50 A;  3J9C A;  4AS1 A;  4HRS A;  5MPO A;  4GDK A;  4W9I A;  4NJC A;  1FO4 A;  3SFE B;  2PKO A;  3VQI A;  1FCL A;  2RSU A;  2K8B A;  3HUI A;  2WXG A;  1TTN A;  3KQ4 A;  1BT0 A;  2NBW B;  3ZTC A;  1HTQ A;  1WXM A;  3L10 B;  4TV3 A;  5DPR A;  2A4Z A;  4XC2 A;  4YSY B;  3DDC B;  1GJZ A;  2KQ4 X;  2LXC A;  3UGB B;  2JT4 B;  2INP E;  1AAR A;  4KVG B;  2MCN B;  1UEL A;  1IGC A;  1CMX B;  4NJ7 A;  2UWQ A;  3TSS A;  1RLF A;  2FCN A;  4AQ7 A;  4OZB A;  4GOC A;  2KZR A;  3B2F A;  1WGK A;  1KLU D;  3NZ3 A;  1V1P A;  1YIW A;  1IUE A;  4E71 A;  4BBN F;  1OQR A;  4FN2 A;  3AUL A;  4P1C C;  2JZP A;  4IWQ A;  4C4V B;  1YD8 U;  3KVF B;  3AE5 B;  3IAS 1;  1RAX A;  4ICU A;  3ZVV A;  3VR9 B;  3MP9 A;  1I4X A;  2C5L C;  2WXL A;  2KVR A;  1ZPS A;  2MLB A;  5E6N A;  3W1S A;  3M63 B;  3TCA A;  4PK1 A;  1F1H A;  1XLQ A;  4LDT B;  1C3T A;  2Y3A A;  2LEK A;  2KN5 A;  1L4Z B;  3MJW A;  2IO0 B;  1UGJ A;  3E9S A;  1JWS D;  2FUH B;  2MBB B;  3W1S C;  2Z0D B;  3NG0 A;  4ZHP A;  1V97 A;  3OJ3 A;  3RYT A;  2BS3 B;  2BYF A;  4MM3 B;  4DK5 A;  3U7D A;  3SHQ A;  1VCB A;  3M95 A;  2MJD A;  2QSD A;  3P4P B;  1R4N I;  5BYS A;  4W9H A;  2WXF A;  2XN9 C;  3AED B;  1WRI A;  4DXA B;  1ZDX A;  2BT6 A;  2LWP A;  3IHP C;  3PZD A;  5EDS A;  3DBS A;  4A20 A;  5JHA A;  4M01 A;  1XQQ A;  2N9L A;  2PW9 A;  2BW2 A;  4FJY A;  5EE1 A;  4KDI C;  3PT2 B;  3ZW3 A;  4UDU C;  1WIA A;  2KC1 A;  4R3D A;  3RCZ A;  3CST A;  2LVO A;  5T8I A;  4JPS A;  1EF1 A;  5D2M B;  2VH2 A;  3LXF A;  4P1B C;  1IPG A;  4IUM B;  3GZN B;  2DZI A;  1RM6 C;  2J7Q B;  5AEK B;  3WAP A;  2N7J A;  1TKY A;  4II3 B;  3A9J B;  1V2Y A;  3T9L A;  3ZGZ A;  1F9J A;  4EZL A;  3BVM A;  1XLN A;  5J17 A;  2CHX A;  1Q10 A;  1UBI A;  2WDV B;  2ZPN A;  3PPA A;  1M94 A;  4RF1 A;  2IGH A;  2BKF A;  3GB1 A;  4TQ1 A;  2UYZ B;  2Z59 B;  3UIN B;  1QKZ A;  4YSZ B;  4IM2 A;  3TL5 A;  4KZ0 A;  4ZRK A;  2WXH A;  4XZ4 A;  5TSS A;  2JVC A;  3AE9 B;  2I38 A;  2ACZ B;  3TUO A;  2IJ0 A;  2M1M A;  4C7Z A;  2KDI A;  3PZ7 A;  4GDL B;  3SDL C;  1QT9 A;  2OOB B;  1J7B A;  1C4C A;  4DHZ B;  1WXV A;  2MEK A;  2L00 B;  4NNJ B;  1EUV B;  4XDD A;  4GIV A;  2C7M B;  1MFW A;  1DOY A;  2L8J A;  3CIR B;  2IBI B;  1P98 A;  2WWZ A;  3AE4 B;  5FKA C;  2YVC A;  3Q3O C;  2DAJ A;  3R7R A;  2KOX A;  1ZOY B;  1JW9 D;  2KX0 A;  3AEB B;  5G5H A;  2WQY B;  2D2Q A;  4LK0 M;  2N9K A;  4NAW B;  2ZJD A;  2C7H A;  4ZRI A;  2KVZ A;  5AUK A;  3KYC D;  2HD5 B;  4YXD B;  4HWI B;  4DXG A;  2QEJ C;  1SXT A;  2KMM A;  3DBR I;  1R4M B;  3RNF C;  4YTP B;  1OEY J;  3E56 A;  3URY A;  1C4P A;  3APC A;  4RGO S;  2D07 B;  3H6N A;  2Q5W D;  2O2V A;  1V8C A;  3PVL A;  3ML8 A;  4LNI A;  4YL8 A;  1I35 A;  5G5G A;  4DDI D;  2KNB A;  3QHT A;  1D4B A;  3JYU A;  3VVW B;  3TMP B;  2Z8L A;  5C3J B;  4USA A;  1SB3 C;  4RH6 A;  3DVG Y;  4LNN A;  2NBU A;  4WWM A;  3AEC B;  3WAN A;  2JXX A;  1IP9 A;  1GAQ B;  1TGZ B;  2IO2 B;  3U52 E;  1A5R A;  1GB1 A;  2W3R A;  3PRP B;  3GE8 C;  1V1P B;  2GMI C;  3DBH I;  1HEZ E;  1N62 A;  4MGZ E;  1V5T A;  2AX5 A;  3FAH A;  2EMT A;  2D3A A;  2BYT A;  2CU1 A;  4XE0 A;  5IP4 D;  1WM2 A;  5D7G A;  2KQ7 A;  2K8C A;  4IDI A;  3N1X C;  3HM6 X;  3RNB C;  2D10 A;  4A3P A;  2BS4 B;  5DPT A;  4CO7 A;  3V62 A;  4I6L B;  2N7D A;  3QCA A;  2JZ3 B;  2WXQ A;  3CWI A;  2K1F A;  2AL6 A;  3PRZ A;  4JX1 C;  2FNJ B;  1TS4 A;  2LJI A;  3DPD A;  3KWL A;  3TEX A;  4EKU A;  5HFY A;  1N6Z A;  3ZYY X;  4GXB A;  1QF6 A;  5E6P A;  2BWE S;  2V9H A;  5GMV A;  2W3S A;  2KYW A;  1ZDV A;  2M8S A;  1SGH A;  2WU2 B;  4WWO A;  4MGI E;  5EE3 A;  2FIF A;  4ZRJ A;  2PMV A;  3K9O B;  3SFD B;  3QAQ A;  5BYR A;  1GB4 A;  3IVF A;  2INC C;  4LDT D;  4C00 A;  4BAX A;  3IAM 1;  5E6O A;  4EZK A;  3ZNZ B;  1KLG D;  3ZLZ A;  5D94 A;  3SEB A;  4J3O D;  4C4V A;  1E0Z A;  1SIF A;  2KFJ A;  1FIQ A;  3HHM A;  2MSE D;  4MGK E;  3AEA B;  2CS4 A;  1UGM A;  2RDG A;  4MSM B;  1ET9 A;  4XX5 A;  4F1S A;  1KOT A;  4WH4 A;  2LFI A;  3PGE A;  5TR5 A;  1WFY A;  1YQ3 B;  4GLS C;  1K51 A;  2PJH A;  1XLO A;  4JWS C;  2K9X A;  4L23 A;  3JSV A;  1E6E B;  1JWM D;  4S0R A;  1ET6 A;  4ZYN A;  2V0G A;  1CJE A;  4W9L A;  2I1J A;  1DYQ A;  4AOF A;  1A70 A;  1FD6 A;  4XYC A;  5J2R A;  4FBJ B;  2GB1 A;  2YEP F;  2DYM A;  3RZW C;  2WU5 B;  1E7V A;  1GC7 A;  4QAY A;  4WIP A;  2NPT A;  2NR2 A;  4WWN A;  2REX A;  1SEB D;  4AJY B;  3KLS X;  4EE2 A;  2VH1 A;  3DQV A;  3N30 A;  2N7E A;  3Q8C A;  3BK1 A;  1EWC A;  2HJ8 A;  4ACF A;  1FXT B;  1WXS A;  2V3N A;  3N20 C;  2H89 B;  4DBG A;  3U2S C;  1KLV A;  3WAM A;  3M62 B;  1UUP A;  1XCQ L;  2AEH A;  2IND C;  3EHV A;  4MH0 E;  4YTN B;  5G2N A;  3FC4 A;  2NTT A;  1P7E A;  2KWU B;  1STE A;  1E7U A;  4BZA A;  3BII D;  3AE6 B;  1CQV A;  2KHW B;  4TMA B;  3DWM A;  1T0R C;  4I6P A;  1HXY D;  3A9K A;  4GB9 A;  3Q8F A;  1V6E A;  3APF A;  3ZNG C;  1WI0 A;  1C9F A;  1WX7 A;  2RD0 A;  3EFU A;  1WJ6 A;  1N60 A;  1XEE A;  1FMA D;  2O2V B;  4HPM B;  4RNA A;  3N9Y C;  4HRO A;  4FHK A;  2LZ6 A;  4JIO U;  3AN1 A;  1NVI D;  3N3K B;  4ZRQ A;  1WM3 A;  1H8C A;  3BVG A;  2IPK D;  4FAD A;  1ZXH A;  3I57 A;  1RYJ A;  1JML A;  5BMG A;  4HKZ E;  3MC8 A;  5C23 A;  1WJ4 A;  1N63 A;  2D5G A;  2DAF A;  4FJZ A;  3R8B A;  1EM7 A;  1YN5 A;  1E8Y A;  2LHE A;  1SSN A;  1XLP A;  1PFD A;  2VZK D;  2KMC A;  1XCT L;  2WNM A;  2J0K A;  1E5W A;  2FE8 A;  1LO5 D;  4IWP A;  1FRD A;  5G55 A;  1KRH A;  2KO3 A;  4W9J A;  4RM8 A;  1SE4 A;  1M4V A;  1AYF A;  4BBN C;  2DZJ A;  4LJP B;  1YMH E;  1MHX A;  3U4E G;  4OHJ A;  3VAW A;  1KM7 A;  1S1Q B;  1VD2 A;  2LAS A;  2JY6 A;  3AE1 B;  4N59 A;  4C7Y A;  2IGG A;  3QK0 A;  1KTK A;  1R4N B;  3RNE C;  3PTF C;  3AI5 A;  2MP2 A;  2D3G A;  1OEY A;  1OQY A;  2K6D B;  5CHV C;  2BYV E;  5CHW A;  3MHS D;  3PHX B;  4EZJ A;  2QC8 A;  4W9K A;  4MH8 A;  1QIL A;  3UF8 A;  1ESF A;  2BB5 A;  1WGD A; 
#chains in the Genus database with same CATH homology
 1V81 A;  3MTN B;  4II3 B;  2V4L A;  1UBQ A;  3A9J B;  1V2Y A;  3T9L A;  5JZE B;  4E3C A;  1F9J A;  4M0W B;  4EZL A;  3EC8 A;  3X0W A;  2CKH B;  5J17 A;  1P1A A;  4W9F A;  2AL3 A;  2JRH A;  4X57 B;  2CHX A;  3NOB A;  3HM3 A;  2ZNV C;  1UBI A;  2LVP A;  2ZPN A;  2V3S A;  3PPA A;  1M94 A;  1LXD A;  4P7I A;  4TQ1 A;  2BKF A;  4PS3 A;  4W9E A;  2CR5 A;  3VH4 B;  3V60 A;  2UYZ B;  2Z59 B;  2ZVN A;  3KYD D;  3UIN B;  4EOY A;  3PHW B;  2N1W A;  4NJ6 A;  2IZV B;  3U30 A;  2EKE C;  1HE8 A;  5LXH A;  2XK5 A;  3ENE A;  4IM2 A;  1WJN A;  3TL5 A;  3Q3J A;  4HVB A;  4KZ0 A;  4ZRK A;  3IBE A;  2IY0 B;  3QQ8 B;  5KHO A;  4G0N B;  1Q5W B;  3B08 A;  3UQB A;  3KUZ A;  4XZ4 A;  2GBK A;  2JVC A;  5L95 C;  2BWF A;  3WAO A;  1XD3 B;  1J19 A;  2LVQ A;  1GNU A;  2M1M A;  2KDI A;  3ECI A;  3A1Q A;  3C0R B;  4GDL B;  2HTH A;  3SDL C;  2OOB B;  3RUL A;  2I1K A;  4IG7 B;  1T0Y A;  2JUO A;  4G3X B;  4DHZ B;  1WXV A;  2L00 B;  4NNJ B;  3PRE A;  4AUQ C;  3WAL A;  1EUV B;  4GIV A;  1WZ0 A;  3LDZ E;  3ZNH B;  2C7M B;  1EO6 A;  2L8J A;  4PS7 A;  2IBI B;  3A4R A;  3V61 A;  1P98 A;  2WWZ A;  5J18 A;  2MWS B;  2DEN B;  3N32 A;  4KIK A;  2LGX A;  3AXC A;  3APD A;  5CTR C;  1TZ1 A;  2J0M A;  2MBH A;  2KTR A;  2IO1 B;  2YVC A;  2FID A;  3VTU A;  3H9D A;  2ZZP B;  2DAJ A;  3R7R A;  2KOX A;  3DVN U;  1WGG A;  2KX0 A;  2LRU A;  3NZU A;  3PRM B;  3ZDT A;  2G45 B;  2D2Q A;  2KC2 A;  4NAW B;  3JSV B;  2ZJD A;  4PYU A;  3UQA A;  1WGR A;  2C7H A;  2LD9 A;  4WAA A;  4GN1 A;  4OVV A;  1YX6 B;  4ZRI A;  1Z2M A;  3A4S C;  3V6E B;  3QX1 A;  2AYO B;  4G50 A;  2KWV B;  2LI5 A;  3KYC D;  2HD5 B;  1ZW7 A;  3OAW A;  2KJH B;  4BKG A;  4EEW A;  3QC8 B;  4HWI B;  4IWO A;  3L13 A;  3VTV A;  3KUD B;  2M17 A;  4AWJ A;  3LJ3 A;  4TUU A;  2C7N B;  3DBR I;  1WH3 A;  4HDQ A;  3P2B A;  3QAR A;  4LCD E;  1OEY J;  2N1V A;  4ANW A;  4NQL B;  4K7S A;  5CHF A;  3RZF A;  2Z0E B;  3APC A;  1NDD A;  4W9C A;  1I42 A;  2L7R A;  2D07 B;  3DBL I;  3H6N A;  4IC7 B;  1ISN A;  2CHW A;  3A33 B;  2O2V A;  1YJ1 A;  3ZDM C;  2NPT B;  4JGH B;  4IM3 A;  4MJS A;  4PS8 A;  3B1L X;  3CMM B;  2RR9 A;  3PVL A;  3ML8 A;  4BVU C;  3VTW A;  5C1Z A;  4YL8 A;  1I35 A;  1GC6 A;  5LLI A;  4DDI D;  3M3J A;  2WDT B;  3O65 B;  2KNB A;  3QHT A;  3NHE B;  3ZIM A;  4DHJ D;  1NI2 A;  1RFA A;  3JYU A;  3VVW B;  3TMP B;  1K8R B;  1WMH A;  2ZVO A;  3R3M A;  3ML9 A;  2ASQ A;  1LFD A;  2MBQ A;  1OTR B;  3VFK A;  1TBE A;  2GBR A;  2KFK B;  3DVG Y;  2NBU A;  3Q3F A;  4MM3 A;  3EEC A;  3WAN A;  3ZRC A;  1GG3 A;  3QWZ B;  5D6J B;  4WQO B;  2JXX A;  1WYW B;  2IO2 B;  1TGZ B;  1UD7 A;  4JL9 A;  4M8M A;  1IP9 A;  1A5R A;  3WA0 A;  3DOW A;  4KV2 A;  1D3Z A;  3PRP B;  2LGY A;  4FLH A;  4E74 A;  3JW0 X;  2GMI C;  3DBH I;  3KH0 A;  2HE7 A;  3U8Z A;  4DDG D;  3VUW A;  2C60 A;  2W9N A;  4MGZ E;  2KWC A;  3GOE A;  1V5T A;  2N9X A;  4GGQ A;  4HK2 A;  1WE7 A;  4AJW A;  2JPH A;  1IYF A;  1PQS A;  4W9G A;  2EMT A;  5CX3 A;  1L2N A;  2CU1 A;  1WM2 A;  2KJR A;  3I3T B;  1WR6 E;  2DZK A;  5D7G A;  2KQ7 A;  2K8C A;  4F8C B;  2BKR B;  2KD0 A;  3A9K B;  2D11 A;  3HM6 X;  2KJ6 A;  3A1Q B;  3ALB A;  3NY5 A;  2KKC A;  2D10 A;  4A3P A;  5JHB A;  1G6J A;  3HK0 A;  4DWF A;  4WJP A;  5DPS A;  1KJT A;  1WGH A;  3TIX A;  2JF5 A;  5DPT A;  1H4R A;  2L0T A;  1S3S G;  3CF6 E;  2PPH A;  3V62 A;  4CO7 A;  4CYE A;  4I6L B;  2C9W B;  2N7D A;  2VRR B;  3QCA A;  2L0F A;  2JZ3 B;  2PE9 A;  2WX0 A;  3PSE B;  1WR1 A;  2K1F A;  2NS5 A;  2AL6 A;  3PRZ A;  4RMA A;  2FNJ B;  2OJR A;  5JH5 C;  3CSF A;  1WX8 A;  3IFW B;  3S2A A;  3KW5 B;  3DPD A;  3OJ4 B;  4MSQ B;  4EKU A;  1JRU A;  2O6V B;  4BOZ B;  4GXB A;  3K9P B;  3KUC B;  5E6P A;  4KSK C;  2FAZ A;  2V1Y A;  4MEL A;  3A9J A;  4K7U A;  2BWE S;  2G4D B;  2Y5B B;  3WIM A;  1J8C A;  5GMV A;  3H7P B;  4MEM A;  1WY8 A;  2DZM A;  2M8S A;  2NVU I;  1SGH A;  3VHT C;  2DX5 B;  4WWP A;  3SU8 X;  3NS8 A;  3VH3 B;  3DVN V;  4WWO A;  4MGI E;  1Q0W B;  4J6I A;  2FIF A;  3NZS A;  4ZRJ A;  3K9O B;  4RM9 A;  1WE6 A;  3HIZ A;  3PLU A;  3QAQ A;  5FR6 A;  4JLC A;  2YLM A;  3IVF A;  2NBV B;  4FJV B;  4GSW A;  4ZDV A;  4LDT D;  2GBN A;  3PV1 A;  2KLC A;  5E6O A;  4B95 A;  4EZK A;  3ZNZ B;  3ZLZ A;  2XEW A;  5D94 A;  2LJ5 A;  5AZG A;  1WZ3 A;  1L7Y A;  3L54 A;  4KSL C;  2L3Z A;  1SIF A;  3TBL D;  2KK8 A;  3VXW A;  1V9J A;  2KFJ A;  4II2 B;  3IG3 A;  5KHQ A;  1Q1O A;  4GDL A;  4JQW C;  2JRI B;  3VUY A;  3HHM A;  2MSE D;  4MGK E;  4NY0 A;  4ANX A;  5DPW A;  2CS4 A;  1UGM A;  2WYQ A;  4M8N A;  4FUL A;  2J0J A;  4MSM B;  4N9F 4;  2BYE A;  2M0X A;  5BO4 B;  3BIN A;  4BKS D;  2MP2 B;  4NPN A;  4XX5 A;  3RUI B;  3ZRF A;  4F1S A;  1KOT A;  3RD2 A;  2ZNV B;  4URK A;  4AP4 C;  2KMA A;  4BOS C;  3PGE A;  1YX5 B;  4ICV A;  5TR5 A;  5LXI B;  1E8Z A;  3TJP A;  2DYB A;  2G4S A;  3H1U A;  2B3A A;  1WFY A;  2EMS A;  2QHO A;  1V5O A;  5DCN A;  3R7Q A;  4A3O A;  4TQ0 A;  4B9K A;  3W1Y A;  3L16 A;  4B6W A;  1WRD B;  2KLG A;  1QZE A;  2JZZ A;  2PJH A;  4DHJ B;  3V6C B;  4NAW A;  3JSV A;  2GOW A;  2RGF A;  2KDB A;  2IO3 B;  2KXJ A;  3VUX A;  2N9E B;  1P0R A;  2KX3 A;  4BKS A;  4W9D A;  4ZYN A;  2G3Q B;  3ZKJ C;  2A5U A;  2KDF B;  2MX2 A;  4W9L A;  3UIP B;  2I1J A;  4GDK A;  4W9I A;  4AOF A;  2XK5 B;  3VQI A;  5J2R A;  4FBJ B;  4I6N B;  4GU2 A;  2RSU A;  2DYM A;  3RZW C;  2K8B A;  5AZF A;  1TTN A;  4HXD A;  1E7V A;  2N4F A;  1BT0 A;  1GC7 A;  1LM8 B;  2NBW B;  3PS6 A;  3ZTC A;  2CHZ A;  2NPT A;  2NR2 A;  1WXM A;  2AWT A;  3L10 B;  4LJO B;  4WWN A;  2REX A;  5HKH A;  1GUA B;  4TV3 A;  5DPR A;  2A4Z A;  4XC2 A;  4AJY B;  4F7Z A;  3DDC B;  3QIJ A;  1C1Y B;  1GJZ A;  2MQJ A;  4K1R B;  2BGF A;  5EDS A;  3DQV A;  3N30 A;  2LXC A;  2N7E A;  3UGB B;  2JT4 B;  1AAR A;  1X1M A;  4HPL B;  2HJ8 A;  4KVG B;  2XBB C;  2MCN B;  1UEL A;  1FXT B;  1WXS A;  1CMX B;  1E90 A;  3R66 C;  4NJ7 A;  4HCP B;  2KFK A;  4DBG A;  4KIK B;  1KLV A;  2UWQ A;  3L08 A;  3WAM A;  1RLF A;  2FCN A;  3M62 B;  2KAN A;  2KTR B;  4GOC A;  2KZR A;  2AEH A;  3EHV A;  4MH0 E;  4G11 A;  5G2N A;  2RPQ A;  4ASW C;  1YIW A;  4E71 A;  2KWU B;  4BBN F;  1E7U A;  4FN2 A;  3AUL A;  2ZCC A;  4HLE A;  1LQB A;  4IWQ A;  2KHW B;  2MW5 A;  4FA6 A;  1RRB A;  1EF5 A;  1YD8 U;  3KVF B;  4KDL B;  2M4N A;  4EFO A;  3ZO5 B;  2LRW A;  1SE9 A;  2K25 A;  3AU4 A;  3X23 A;  3ZTD A;  4K81 A;  2K6Q A;  4I6P A;  4BKT A;  1WXA A;  3JVZ X;  1RAX A;  3PLV A;  3A9K A;  4GB9 A;  4DHZ E;  2ZCB A;  1WGY A;  4ICU A;  3ZVV A;  1V6E A;  5L83 A;  2O6V D;  2C5L C;  4KZC A;  3AU5 A;  2KVR A;  4PYZ A;  3L0W B;  3APF A;  2MLB A;  1WI0 A;  3ZNG C;  2IY1 B;  5E6N A;  3W1S A;  1WX7 A;  2RD0 A;  2PEA A;  3EFU A;  1WJ6 A;  2IYD B;  3M63 B;  3TCA A;  2LUE A;  2L05 A;  2O2V B;  4HPM B;  4IM0 A;  4LDT B;  1C3T A;  1R4M I;  4MJS B;  4FHK A;  3H7S A;  2KN5 A;  2LZ6 A;  4JIO U;  2GBM A;  3MJW A;  2IO0 B;  2MBE A;  3RT3 B;  3N3K B;  5IA7 A;  1WM3 A;  3ZUN A;  1H8C A;  2JWZ A;  4FAD A;  2GBJ A;  4HDO A;  1XT9 B;  1ZKH A;  2FCQ A;  1WX9 A;  5C23 A;  2FUH B;  2DHZ A;  1V80 A;  1WJ4 A;  2LGD A;  1WMH B;  2MBB B;  1NBF C;  2Z0D B;  2FCS A;  3W1S C;  3OJ3 A;  2DAF A;  3SD5 A;  2R2Q A;  4FJZ A;  4EUT A;  3RYT A;  2O6V A;  1E8Y A;  2KTF A;  2BYF A;  2MBO A;  4DK5 A;  3U7D A;  3SHQ A;  1VCB A;  2KMC A;  2MRP A;  1YQB A;  3H7P A;  3M95 A;  1UZX B;  2ZPY A;  2J0K A;  1UH6 A;  2DYO A;  1E5W A;  3QJZ A;  1R4N I;  4TKN A;  4W9H A;  3L17 A;  4GDK B;  4IWP A;  2K8H A;  2KDE B;  4DXA B;  1WF9 A;  2BF8 B;  1OGW A;  2LWP A;  3GZN I;  3IHP C;  3PZD A;  3VDZ A;  2FCM A;  3DBS A;  2KQS A;  5G55 A;  4ANV A;  4OVU A;  2L76 A;  4A20 A;  5JHA A;  4IW0 A;  1XQQ A;  2KO3 A;  1ZGU B;  3DCG A;  4RM8 A;  4FJY A;  1MG8 A;  4W9J A;  4ANU A;  2N9P C;  4MGY E;  4BBN C;  2DZJ A;  1E8X A;  4LJP B;  4KDI C;  3PT2 B;  3UIO B;  4FHJ A;  2BPS A;  3VAW A;  1KM7 A;  1V86 A;  1P3Q U;  2MA9 B;  1S1Q B;  3OLM D;  4WJO A;  3ZW3 A;  1VD2 A;  4WJN A;  1WIA A;  1Y8R C;  2KC1 A;  1U4A A;  2LAS A;  5IAA C;  2JY6 A;  4CHK A;  3QK0 A;  3CST A;  3RCZ A;  4GMV A;  2LVO A;  2WX1 A;  3ZNI D;  4HJK A;  1EF1 A;  3QA8 A;  5D2M B;  3PTF C;  3AI5 A;  2K39 A;  2MP2 A;  1WJU A;  2D3G A;  3B0A A;  3D32 A;  4NQK E;  1OEY A;  1OQY A;  2K6D B;  1V49 A;  1IPG A;  4IUM B;  4BFR A;  5CHV C;  5AZH A;  2DZI A;  3DVG X;  4MDK E;  2J7Q B;  2BYV E;  2NCN A;  2ZEQ A;  5CHW A;  5AEK B;  3WAP A;  1J0G A;  3MHS D;  3PHX B;  2PE6 B;  2LXA A;  4HCN B;  3ONS A;  4EZJ A;  3BY4 B;  4WJQ A;  4W9K A;  1Z5S B;  3T8M A;  4K7W A;  3UF8 A;  1P9D U;  2R2O A;  1E8W A;  1WGD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...