1WXPA

Solution structure of the death domain of nuclear matrix protein p84
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
110
structure length
110
Chain Sequence
GSSGSSGPDVRRDKPVTGEQIEVFANKLGEQWKILAPYLEMKDSEIRQIECDSEDMKMRAKQLLVAWQDQEGVHATPENLINALNKSGLSDLAESLTNDNETNSSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of the death domain of nuclear matrix protein p84
rcsb
source organism Homo sapiens
molecule tags Transport protein
molecule keywords THO complex subunit 1
total genus 27
structure length 110
sequence length 110
ec nomenclature
pdb deposition date 2005-01-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00531 Death Death domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.533.10 Mainly Alpha Orthogonal Bundle Death Domain, Fas Death Domain, Fas 1wxpA01
3MOPA 2MN4A 2KN6A 4RHWA 4JUPA 1E41A 4ZBWA 4FH0A 4O6XA 4M9ZA 2LWDA 1PN5A 4N1JA 2MS7A 3KATA 2B1WA 2N80A 2KM6A 2MPCA 4DWNA 3CL3A 1C15A 2P1HA 3LQRA 3MOPK 3YGSP 3EZQB 4UZ0A 2N1FA 2YU0A 2MS8A 2YVIA 4N1LA 4A2QA 1DGNA 1E3YA 2DBHA 2HM2Q 2NZ7A 3QF2A 4RHWE 1A1WA 3J6JA 2F1SA 2LS7A 3YGSC 3J63A 3MOPG 4IZ7B 1ICHA 4M9XA 2BBRA 1WMGA 2M5VA 2DO9A 2NAQA 4N1KA 4EWIA 4O9FA 4E9MA 4P4HI 4P4HA 2L6AA 2A9IA 2A5YB 4JQWA 2D96A 2DBDA 4D8OA 1WH4A 1CWWA 1NGRA 2MB9A 1DDFA 2N00A 3EZQA 2YQFA 1WXPA 2O71A 2L9MA 4I16A 4IZAB 2LWEA 2OF5H 3CRDA 4F42A 2G7RA 2DBGA 1CY5A 1Z6TA 1UCPA 4M9SA 4F44A 4O7QA 3LQQA 1YGOA 1D2ZB 3T6PA 1N3KA 4QOBA 2GF5A 1A1ZA 2N83A 2N7ZA 1FADA 4O9LA 2YGSA 2N97A 1D2ZA 4LWDA 4IZ5E 2NSNA 4A2WA 2OF5A 2VGQA 2IB1A 4NQKA 2DBFA 2BBZA
chains in the Genus database with same CATH superfamily
3MOPA 2MN4A 2KN6A 4RHWA 4JUPA 1E41A 4ZBWA 4FH0A 4O6XA 4M9ZA 2LWDA 1PN5A 4N1JA 2MS7A 2XV9A 3KATA 2B1WA 2N80A 2KM6A 2MPCA 4DWNA 3CL3A 1C15A 2P1HA 3LQRA 3MOPK 3YGSP 3EZQB 4UZ0A 2N1FA 2YU0A 2MS8A 2YVIA 4N1LA 4A2QA 1DGNA 1E3YA 2DBHA 2HM2Q 2NZ7A 3QF2A 4RHWE 1A1WA 3J6JA 2F1SA 2LS7A 3YGSC 3J63A 3MOPG 4IZ7B 1ICHA 4M9XA 2MJMA 2BBRA 1WMGA 2M5VA 2DO9A 2NAQA 4N1KA 4EWIA 4O9FA 4E9MA 4P4HI 4P4HA 2L6AA 2A9IA 2A5YB 4JQWA 2D96A 2DBDA 4D8OA 1WH4A 1CWWA 1NGRA 2MB9A 1DDFA 2N00A 3EZQA 2YQFA 1WXPA 2O71A 2L9MA 4I16A 4IZAB 2LWEA 2OF5H 3CRDA 4F42A 2G7RA 2DBGA 1CY5A 1Z6TA 1UCPA 4M9SA 4F44A 4O7QA 3LQQA 1YGOA 1D2ZB 3T6PA 1N3KA 4QOBA 2GF5A 1A1ZA 2N83A 2N7ZA 1FADA 4O9LA 2YGSA 2N97A 1D2ZA 4LWDA 4IZ5E 2NSNA 4A2WA 2OF5A 2VGQA 2IB1A 4NQKA 2DBFA 2BBZA
chains in the Genus database with same CATH topology
3MOPA 2MN4A 2KN6A 4RHWA 4JUPA 1E41A 4ZBWA 4FH0A 4O6XA 4M9ZA 2LWDA 1PN5A 4N1JA 2MS7A 2XV9A 3KATA 2B1WA 2N80A 2KM6A 2MPCA 4DWNA 3CL3A 1C15A 2P1HA 3LQRA 3MOPK 3YGSP 3EZQB 4UZ0A 2N1FA 2YU0A 2MS8A 2YVIA 4N1LA 4A2QA 1DGNA 1E3YA 2DBHA 2HM2Q 2NZ7A 3QF2A 4RHWE 1A1WA 3J6JA 2F1SA 2LS7A 3YGSC 3J63A 3MOPG 4IZ7B 1ICHA 4M9XA 2MJMA 2BBRA 1WMGA 2M5VA 2DO9A 2NAQA 4N1KA 4EWIA 4O9FA 4E9MA 4P4HI 4P4HA 2L6AA 2A9IA 2A5YB 4JQWA 2D96A 2DBDA 4D8OA 1WH4A 1CWWA 1NGRA 2MB9A 1DDFA 2N00A 3EZQA 2YQFA 1WXPA 2O71A 2L9MA 4I16A 4IZAB 2LWEA 2OF5H 3CRDA 4F42A 2G7RA 2DBGA 1CY5A 1Z6TA 1UCPA 4M9SA 4F44A 4O7QA 3LQQA 1YGOA 1D2ZB 3T6PA 1N3KA 4QOBA 2GF5A 1A1ZA 2N83A 2N7ZA 1FADA 4O9LA 2YGSA 2N97A 1D2ZA 4LWDA 4IZ5E 2NSNA 4A2WA 2OF5A 2VGQA 2IB1A 4NQKA 2DBFA 2BBZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3MOP A;  2MN4 A;  2KN6 A;  4RHW A;  4JUP A;  1E41 A;  4ZBW A;  4FH0 A;  4O6X A;  4M9Z A;  2LWD A;  1PN5 A;  4N1J A;  2MS7 A;  3KAT A;  2B1W A;  2N80 A;  2KM6 A;  2MPC A;  4DWN A;  3CL3 A;  1C15 A;  2P1H A;  3LQR A;  3MOP K;  3YGS P;  3EZQ B;  4UZ0 A;  2N1F A;  2YU0 A;  2MS8 A;  2YVI A;  4N1L A;  4A2Q A;  1DGN A;  1E3Y A;  2DBH A;  2HM2 Q;  2NZ7 A;  3QF2 A;  4RHW E;  1A1W A;  3J6J A;  2F1S A;  2LS7 A;  3YGS C;  3J63 A;  3MOP G;  4IZ7 B;  1ICH A;  4M9X A;  2BBR A;  1WMG A;  2M5V A;  2DO9 A;  2NAQ A;  4N1K A;  4EWI A;  4O9F A;  4E9M A;  4P4H I;  4P4H A;  2L6A A;  2A9I A;  2A5Y B;  4JQW A;  2D96 A;  2DBD A;  4D8O A;  1WH4 A;  1CWW A;  1NGR A;  2MB9 A;  1DDF A;  2N00 A;  3EZQ A;  2YQF A;  1WXP A;  2O71 A;  2L9M A;  4I16 A;  4IZA B;  2LWE A;  2OF5 H;  3CRD A;  4F42 A;  2G7R A;  2DBG A;  1CY5 A;  1Z6T A;  1UCP A;  4M9S A;  4F44 A;  4O7Q A;  3LQQ A;  1YGO A;  1D2Z B;  3T6P A;  1N3K A;  4QOB A;  2GF5 A;  1A1Z A;  2N83 A;  2N7Z A;  1FAD A;  4O9L A;  2YGS A;  2N97 A;  1D2Z A;  4LWD A;  4IZ5 E;  2NSN A;  4A2W A;  2OF5 A;  2VGQ A;  2IB1 A;  4NQK A;  2DBF A;  2BBZ A; 
#chains in the Genus database with same CATH topology
 3MOP A;  2MN4 A;  2KN6 A;  4RHW A;  4JUP A;  1E41 A;  4ZBW A;  4FH0 A;  4O6X A;  4M9Z A;  2LWD A;  1PN5 A;  4N1J A;  2MS7 A;  2XV9 A;  3KAT A;  2B1W A;  2N80 A;  2KM6 A;  2MPC A;  4DWN A;  3CL3 A;  1C15 A;  2P1H A;  3LQR A;  3MOP K;  3YGS P;  3EZQ B;  4UZ0 A;  2N1F A;  2YU0 A;  2MS8 A;  2YVI A;  4N1L A;  4A2Q A;  1DGN A;  1E3Y A;  2DBH A;  2HM2 Q;  2NZ7 A;  3QF2 A;  4RHW E;  1A1W A;  3J6J A;  2F1S A;  2LS7 A;  3YGS C;  3J63 A;  3MOP G;  4IZ7 B;  1ICH A;  4M9X A;  2MJM A;  2BBR A;  1WMG A;  2M5V A;  2DO9 A;  2NAQ A;  4N1K A;  4EWI A;  4O9F A;  4E9M A;  4P4H I;  4P4H A;  2L6A A;  2A9I A;  2A5Y B;  4JQW A;  2D96 A;  2DBD A;  4D8O A;  1WH4 A;  1CWW A;  1NGR A;  2MB9 A;  1DDF A;  2N00 A;  3EZQ A;  2YQF A;  1WXP A;  2O71 A;  2L9M A;  4I16 A;  4IZA B;  2LWE A;  2OF5 H;  3CRD A;  4F42 A;  2G7R A;  2DBG A;  1CY5 A;  1Z6T A;  1UCP A;  4M9S A;  4F44 A;  4O7Q A;  3LQQ A;  1YGO A;  1D2Z B;  3T6P A;  1N3K A;  4QOB A;  2GF5 A;  1A1Z A;  2N83 A;  2N7Z A;  1FAD A;  4O9L A;  2YGS A;  2N97 A;  1D2Z A;  4LWD A;  4IZ5 E;  2NSN A;  4A2W A;  2OF5 A;  2VGQ A;  2IB1 A;  4NQK A;  2DBF A;  2BBZ A; 
#chains in the Genus database with same CATH homology
 3MOP A;  2MN4 A;  2KN6 A;  4RHW A;  4JUP A;  1E41 A;  4ZBW A;  4FH0 A;  4O6X A;  4M9Z A;  2LWD A;  1PN5 A;  4N1J A;  2MS7 A;  2XV9 A;  3KAT A;  2B1W A;  2N80 A;  2KM6 A;  2MPC A;  4DWN A;  3CL3 A;  1C15 A;  2P1H A;  3LQR A;  3MOP K;  3YGS P;  3EZQ B;  4UZ0 A;  2N1F A;  2YU0 A;  2MS8 A;  2YVI A;  4N1L A;  4A2Q A;  1DGN A;  1E3Y A;  2DBH A;  2HM2 Q;  2NZ7 A;  3QF2 A;  4RHW E;  1A1W A;  3J6J A;  2F1S A;  2LS7 A;  3YGS C;  3J63 A;  3MOP G;  4IZ7 B;  1ICH A;  4M9X A;  2MJM A;  2BBR A;  1WMG A;  2M5V A;  2DO9 A;  2NAQ A;  4N1K A;  4EWI A;  4O9F A;  4E9M A;  4P4H I;  4P4H A;  2L6A A;  2A9I A;  2A5Y B;  4JQW A;  2D96 A;  2DBD A;  4D8O A;  1WH4 A;  1CWW A;  1NGR A;  2MB9 A;  1DDF A;  2N00 A;  3EZQ A;  2YQF A;  1WXP A;  2O71 A;  2L9M A;  4I16 A;  4IZA B;  2LWE A;  2OF5 H;  3CRD A;  4F42 A;  2G7R A;  2DBG A;  1CY5 A;  1Z6T A;  1UCP A;  4M9S A;  4F44 A;  4O7Q A;  3LQQ A;  1YGO A;  1D2Z B;  3T6P A;  1N3K A;  4QOB A;  2GF5 A;  1A1Z A;  2N83 A;  2N7Z A;  1FAD A;  4O9L A;  2YGS A;  2N97 A;  1D2Z A;  4LWD A;  4IZ5 E;  2NSN A;  4A2W A;  2OF5 A;  2VGQ A;  2IB1 A;  4NQK A;  2DBF A;  2BBZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...