1WXUA

Solution structure of the sh3 domain of mouse peroxisomal biogenesis factor 13
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
93
structure length
93
Chain Sequence
b'GSSGSSGTNWASGEDDHVVARAEYDFVAVSDEEISFRAGDMLNLALKEQQPKVRGWLLASLDGQTTGLIPANYVKILGKRRGRKTIESGPSSG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords peroxisomal biogenesis factor 13
publication title Solution structure of the SH3 domain of mouse peroxisomal biogenesis factor 13
rcsb
source organism Mus musculus
molecule tags Protein transport
total genus 7
structure length 93
sequence length 93
ec nomenclature
pdb deposition date 2005-02-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14604 SH3_9 Variant SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 1wxuA01
1UGVA 4RUGA 3UF4A 1PHTA 2KYBA 2L0AA 2L3QA 2VWFA 2SEMA 1BBZA 2GTJA 3EG0A 5FW9A 4RTVA 4GLMA 2JMCA 2O2OA 2JW4A 1QCFA 1T3SA 4CC7A 2O9VA 2M51A 1BK2A 2M0YA 1VYTA 2A28A 2JS0A 1UHFA 1UHCA 1YWOA 2KRSA 3SEMA 2KEAA 1K4US 2K9GA 2GGRA 2PTKA 4AFQC 1SRMA 2OJ2A 2LQWA 1K9AA 4CC3A 1WI7A 2DBKA 1I1JA 2YUOA 2FPFA 3R6NA 2L3SA 4LN2A 2J6FA 3GBQA 2DF6A 2RQWA 3M0PA 1WYXA 4JZ3A 2DE0X 4J9IA 2K2MA 2DYBA 1QWEA 1X2QA 4EIKA 1WDXA 4HXJA 4CC4B 3I5SA 3I35A 2LJ3A 2AKKA 2LQNA 2G6FX 2ED1A 4IIOA 4D8KA 2GQIA 1K0XA 1I0CA 1KFZA 1NEGA 2DL7A 2X3XD 2D8JA 4J9CA 1VA7A 1UFFA 4J9FA 4GBQA 1X43A 2EKHA 1WX6A 4J9HA 2DX1A 2JTEA 3TVTA 3FJ5A 1AWOA 1CKBA 1OEBA 1JXOA 1SSHA 3NGPA 2BZYA 2HBWA 1B3QA 3TSWA 1RLPC 4HVVA 2EVRA 3M0QA 1OPLA 2CREA 4DEYA 1Y57A 2EGCA 5L23A 2DM1A 2EYYA 1WLPB 2ABLA 4X1VA 1UDLA 2RNAA 1AWXA 2KROA 2OAWA 1ZSGA 2YSQA 3UATA 2KXCA 1PKSA 2EYZA 1JXMA 1T3LA 1CSKA 2DVJA 5IHIA 1PWTA 1RLQC 1GCQA 3THKA 5IHNA 1GL5A 2FG0A 2VKNA 1AWWA 1M27C 2GTOA 1X6GA 2KGTA 2KNBB 1V1CA 2H8HA 3QWYA 2YUNA 2HSPA 2LZ6B 3U23A 1AOJA 2O31A 2I0NA 5I22A 5ECAA 2P4RA 2D0NA 2LJ1A 2ENMA 1EFNA 2QDLA 1M3CA 1ABQA 3PE0A 1SHFA 1JQQA 1OV3A 5FWCA 2YT6A 2NWMA 5EC7A 2FPDA 2CSQA 2CSIA 1T0JA 1KIKA 2EYWA 2V1RA 2AK5A 2F2VA 2PNIA 1OOTA 2DL5A 4J9BA 2RQVA 1JU5C 1UECA 1QLYA 2KRMA 3UA6A 1WXTA 3ZL7C 2K6DA 4OMPA 1Y0MA 3KFVA 4KRTA 2J6OA 1AD5A 2DLPA 1GBQA 1CKAA 2DNUA 3VS6A 1T0HA 1ZX6A 1QWFA 3VS0A 4M4ZA 4E6RA 1MV0B 1NG2A 3UA7A 3I9QA 5GJWB 1KJWA 2FEIA 1U06A 2OI3A 1NYGA 2ED0A 1ARKA 3QWXX 2CH4A 4OMQA 2CT3A 2FPEA 3VRYA 2JMAA 1QKXA 4JZ4A 1K0SA 4AFUC 1TUCA 2DILA 4K11A 2JXBA 1YN8A 1AZEA 5HCKA 1SRLA 4HVUA 4RTTA 2K7AA 1M3AA 1GRIA 2X3WD 1PRLC 3ULRB 4F14A 1H3HA 1K1ZA 1B07A 5IHKA 1Z9QA 2RF0A 2DL3A 1OPKA 2A08A 2FRYA 1WFWA 1M3BA 4RTWA 3M0TA 2RMOA 4J9EA 1SEMA 2CDTA 2DL8A 1M8MA 3EG2A 4JJBA 4AFZC 2CT4A 2EBPA 4RTXA 3REBB 1GFCA 4AFSC 3M0RA 2W10A 3C0CA 1YCSB 2ROLA 3REAB 1HJDA 2FRWA 4ZNXA 1UUEA 3EHRA 4RTYA 1NM7A 2NUZA 1X6BA 2KRNA 2XMFA 2MOXA 4AG2C 2L3PA 5IXBA 1W70A 2C0TA 2DA9A 2EGEA 3H0FA 1SHGA 2YUQA 2K79A 2HDAA 1W6XA 2DJQA 3H0HA 1ABOA 3H0IA 3JV3A 2F2XA 3O5ZA 4R0KA 3NPFA 3LH5A 4J9GA 1U3OA 2KT1A 2LP5A 3A98A 1NEBA 1NYFA 2RPNA 2BTTA 3EHQA 4HVWA 4IIMA 1JO8A 4Z88A 2CUDA 4JJCA 2LNHB 2RQRA 2YUPA 3PVLA 3H41A 1UTIA 4QT7A 3VRZA 1KSWA 2DMOA 1GFDA 2V1QA 3EG3A 3RBBB 2AKLA 1X27A 1NLOC 2ROTA 2A37A 2BZXA 2MIOA 2RN8A 1NLPC 2LJ0A 3EGUA 4OMMA 1W1FA 4RTZA 2KE9A 2RQUA 1JEGA 1H92A 4ESRA 1WA7A 1AZGB 2AZVA 1ZLMA 2MCNA 1RI9A 4JPBW 4F17A 2L2PA 1X2KA 1YNZA 2LMJA 2F2WA 3VS5A 1XOVA 1MV3A 1PKTA 2C0OA 1K76A 1Z9ZA 4FSSA 3EG1A 1X69A 2JS2A 4RTUA 5IH2A 1VYVA 2EYXA 1H8KA 4JJDA 4HCKA 1ZUYA 4AG1C 2HEQA 2EQIA 2ESWA 5IXFA 1FMKA 3PVQA 2DRMA 2E5KA 4WCIA 5FWBA 2KT8A 3VS1A 2J05A 1UJYA 1WIEA 1HSQA 2D1XA 4LE9A 1E7OA 1UJ0A 4A63B 1M30A 2GNCA 1ZBJA 2GBQA 3VS7A 1HD3A 5GJVB 1TUDA 1UG1A 1UE9A 1AEYA 4Z8AA 2LCSA 4Y92A 1AWJA 2DL4A 2KYMA 1BU1A 3NMZC 1WXUA 4LUEA 2A36A 1GBRA 1VYUA 2KXDA 2AZSA 2W0ZA 1SPKA 1MUZA 3I5RA 2YDLA 2PZ1A 2K3BA 2ECZA 4OMLA 2EGAA 1I07A 2CUBA 2JT4A 4OMNA 3M0UA 2J6KA 4J9DA 1IO6A 2JM8A 4DEXA 5I11A 2LX7A 3CQTA 1G83A 2B86A 2SRCA 3IQLA 2D8HA 2KR3A 1E6GA 4F16A 2FO0A 1GCPA 1YWPA 1YP5A 1S1NA 4CC2A 1J3TA 2EPDA 2EW3A 1FYNA 2CH4W 2KBTA 4ORZA 1A0NB 2J06A 2J7IA 4LUDA 2VVKA 3VS4A 2DRKA 1ZUKA 1G2BA 2RQTA 1QKWA 2O88A 4OMOA 1N5ZA 1PNJA 1BB9A 2C0IA 2HCKA 3TSZA 1AVZC 3VS3A 1PRMC 1WXBA 3RNJA 1RUWA 4Z89A 1GCQC 2IIMA 4D8DA 1E6HA 1U5SA 1ZUUA 2O9SA 2BZ8A 2JM9A 3NHNA 2DBMA 3M0SA 4LNPA 3VS2A 3SHWA 1LCKA 1TG0A
chains in the Genus database with same CATH superfamily
1UGVA 3ZEHA 3EG9A 4Y28E 1KK7A 1MHNA 2KYBA 4XTVA 4D6WA 1QVGS 2VWFA 3RKWA 3JCMg 4C92E 1QCFA 3EAEA 1KD1R 3JRZA 2KEAA 2X4YA 2OJ2A 2LQWA 1K9AA 1WI7A 2DBKA 3QPHA 4E7IA 1I1JA 2QQ9A 1I5LA 5KE3A 4M77F 3TCJA 4M7DG 2PVDB 2J6FA 4OB1B 4N0AC 2DF6A 1Y71A 1B34A 3RKXA 1QWEA 2MI6A 3AHUA 3HL8A 1QP3A 3OBWA 4CC4B 4PKCC 1YJNA 1M9SA 2LQNA 1W2BA 2RI5A 2GQVA 2GQIA 4C92D 1RAGB 3CCLQ 1Q82R 3JB9F 1NEGA 3CMEA 2DL7A 3PNWC 5CAIA 5FU7B 2D8JA 4J9CA 1UFFA 1X43A 3X26B 3FIFA 2EJFA 2WACA 1TTHB 3G71A 2YRCA 5D6YA 1SSHA 4A4GA 3RERA 5GAMe 5KYWB 3QJ6A 4HVVA 2EVRA 2QGGA 1VQ5T 1Y57A 1U1SA 1YJ9Q 3OYHA 2LVMA 1VQ6Q 1UDLA 2RNAA 1N6AA 2VXFA 4IURA 1ZSGA 3HP9A 2EYZA 1G3WA 2E65A 2DVJA 3GOXA 4N4HA 1BI2A 4L6V5 2GTOA 3CMAQ 1AHJB 2KGTA 1V1CA 1PD0A 3L2WA 4M7DD 1Q81R 2HSPA 3U23A 4C8QA 1OI1A 2DZCA 5FU6B 3QDFA 1WZOA 2EJ9A 2CP2A 2D0NA 2LT4A 2LJ1A 2YHTA 4C92C 4PFOA 1FMWA 3PIPA 1JQQA 4PJJA 3L2QA 1OV3A 1I5OB 1K8AR 2QEXA 1G5VA 2RD1A 2COWA 1KIKA 2O01E 4FYYB 2HKQB 3PGGA 1ACMB 2R57A 2DL5A 4J9BA 1KQSA 2RQVA 1UECA 1RL2A 1QLYA 2KRMA 1WXTA 3RUXA 1Y0MA 1NJIC 2J6OA 1GBQA 3VS6A 1T0HA 4M78E 1ZX6A 4E6RA 3JB9I 1MV0B 3UA7A 1YJWA 1PSEA 4XU3A 1ZA1B 3I9QA 5GMKh 5GJWB 1WHGA 4LD6A 3OSSC 4XU1A 1VQKQ 1ARKA 2FB7A 2CT3A 4M7DA 4QVZA 2QDYB 1X6OA 4II1A 4O6JA 3C4SA 1ZHIA 4M7DC 1AZEA 4X34A 1M3AA 2HD0A 4XAXB 3EGXA 1QVFS 1BKBA 4FW2A 4QQ6A 1K1ZA 2RF0A 4JLGA 3LH0A 2YRDA 3ME9A 3GIBA 3DB3A 1OPKA 3BW1A 1R0CB 2G3RA 2FRYA 1QW1A 3DLMA 5GMKj 4ZTJA 4ZGJB 3F70A 4C0ZA 2CZ7B 2XU8A 1BYMA 3I56A 2CDTA 1M8MA 2H3EB 2E1HA 2XHCA 3HRUA 3UDCA 1GFCA 1YI2T 4JJNK 1RAHB 3REAB 4ELZC 4ZNXA 1K73R 4RTYA 3PIOA 2F5KA 1UGQB 3SB2A 2XMFA 1TWBA 4DOWA 4M7DF 1MNEA 4XU0A 2XIDA 1W70A 4N4IA 3VUBA 1C1AA 3OYJA 4OP0A 1Y07A 3T9NA 2MK5A 3H0FA 4EPCA 3I55T 4KULA 3NTHA 3G4SA 4M78B 1W6XA 2ZPGB 3NPFA 3CCMT 3LH5A 3L2RA 3CCVQ 4E7JA 3GF5A 3CC2Q 1U3OA 4PNOA 4M75A 2DD5A 2BTTA 4HVWA 1JO8A 3MP6A 1BI0A 2RQRA 1C6VX 1Q86R 1SKUB 3JCMe 4F7UE 4QT7A 1KQSP 2DMOA 3RBBB 1N8RR 3M53A 3META 4XK8E 2K3XA 1M2VB 3CCSQ 1NLOC 2JUFA 3ASKA 3EGDA 3EGUA 4OMMA 1W1FA 5A0GA 2X51A 5GMKm 3OB9A 2RQUA 4X9DA 1WA7A 2AZVA 1ZLMA 4JPBW 3M5AA 2L2PA 1YNZA 2F2WA 3VS5A 4B9XA 1MV3A 1XOVA 2BUDA 3LW5E 1X69A 2JS2A 1O75A 5LJ3e 4JJDA 4AG1C 2HEQA 1K9MR 5M9OA 4NS5A 2NYSA 4WCIA 4EMKC 2HL3A 5FWBA 4EDUA 1LNXA 3MHXA 3JCMJ 2J05A 3P8DA 4FU6A 3SD4A 1WIEA 1HSQA 4LE9A 3WVDB 3RMQA 4A63B 4BY6B 3CC4A 1Q7YC 4MZMA 2LCCA 2GBQA 4IUVA 3G6EQ 2QA4T 1M1KC 2DERA 1MGQA 1AWJA 3QYGB 1W2BS 3NMZC 4A4FA 1VYUA 4E47A 4FW1A 1SPKA 3CC7A 3MCAB 4YTLA 3I5RA 4C5EA 2YDLA 5J26A 5CKFA 4L59A 1MMAA 3JCMb 2ZPHB 2CUBA 2JT4A 2E70A 2NUPB 3M0UA 3M4YA 1RABB 4PJOG 4DQ2A 1VUBA 2KVQG 4F7UB 3L2ZA 1MMNA 4LDUA 1WJRA 4KGZB 1VQMT 1P92A 1M90U 1QVPA 3LLRA 1YP5A 1VQ4T 3I55Q 1J3TA 2EPDA 1FYNA 2CH4W 2KBTA 2J06A 2J7IA 4LUDA 1YHQT 1YIJQ 1UGPB 1IHWA 4TVRA 3BDUA 2EIFA 5KYNA 3CCMQ 1RACB 3X20B 1ZSZA 2C0IA 1VQOT 4C0DC 2LC4A 1EZZB 2B8AA 2O4XB 1TS9A 4D8DA 3JB9H 1ZUUA 2VV5A 3M0SA 1VQLQ 3D7SB 5KE2A 3L1AA 4BE2A 4RUGA 3UF4A 1PHTA 5KH6A 1HXDA 2L0AA 1KD1U 2L3QA 1FXXA 2GTJA 4BI3A 3OW2S 4JS4A 3MEVA 2JW4A 1T3SA 1BI1A 2M51A 4FSXA 3CCUA 2A28A 1UHCA 4ATOA 5LJ5e 3SEMA 5C0MA 1RAAB 2L89A 2OTJA 2RHIA 2BKDN 4AFQC 3CCRT 1OYXA 3JCMQ 2HZYA 1HYOA 2K5IA 2CKKA 2NUTB 3JSCA 4RCBA 1XQHA 2YUOA 1BCOA 1M1GA 2K5LA 4PJOD 3R6NA 4LN2A 2RQWA 3M0PA 1RAFB 3CCJA 3E2UA 4JZ3A 5GAN2 4BE1A 2K2MA 2ZZDA 2RJFA 4PLIA 3DB4A 4EIKA 1WDXA 1WQWA 4A4EA 4ELYC 3MKDA 1Q82U 2YLBA 3I35A 3OYCA 2LJ3A 2AKKA 2DTHA 5FLXE 4KBMB 2ED1A 3QXEB 2X35A 5GMKe 2F5TX 3CCLT 4AT1B 2DJZA 2RK1A 4PJNA 1VA7A 1VQ8Q 1D09B 4ZTFA 4ANJA 2RH2A 3TVTA 3FJ5A 1CKBA 1OEBA 1B7TA 1JXOA 3NGPA 3E19A 1RLPC 4LXCA 3FEOA 3VU3C 4DEYA 1R77A 2DM1A 5DLOA 2DXCA 3FJPA 2ABLA 1JJ2A 1VQ4Q 4C5HA 2OAWA 1SG5A 2YSQA 1D1CA 3UATA 4PJOC 3JCMh 4J5YA 1M90R 4XU2A 2DYIA 1CSKA 1PWTA 1GCQA 3THKA 1VQOQ 4HCBA 3A1PA 3C94A 2FG0A 2VKNA 3JB9J 3UT1A 4JRKA 4FCYA 3CMAT 2KNBB 3OS5A 1N27A 3EG9B 2YRVA 2YUNA 2HAXA 3URGA 2QTXA 1FX7A 1AOJA 2O31A 2F69A 5I22A 3S3NA 2M16A 1VQPA 1EIFA 1NZ9A 1X01A 1K8AU 3L2UA 2A0FB 3NFCA 1YJNT 2XD0A 5LJ3h 4KUDK 3PMTA 5FWCA 5J39A 1KC8R 2HQXA 2NWMA 3KXTA 2RHUA 5EC7A 2FPDA 2CSQA 2NLUA 5GAMd 2CSIA 2RB6A 1T0JA 2EYWA 4FT4A 4A4KA 4PJOF 2F2VA 4HKEA 3CCRQ 1JU5C 1VQ9A 5GAOq 2Y4XA 3G71T 3OMCA 3M54A 5GAMf 4OMPA 4C8QE 2DLPA 2DNUA 2EAYA 3OYKA 1B34B 4N0AA 1YITA 5J3BA 2YLCA 1YJ9A 2E41A 3OS2A 3MO8A 1NG2A 3CCQQ 3OYAA 2FEIA 3QSUA 2P0PA 1VQKT 4RG8A 5LJ3g 4QVCA 5LJ3j 3SDZA 2CH4A 4KT0E 1JBMA 2DEUA 2EWNA 3HSBA 4HT8A 2CP5A 5KYUA 1QKXA 3ER0A 1K0SA 1TUCA 4CI0C 5KYXA 5D6WA 2P84A 2DO3A 4HVUA 4RTTA 2K7AA 3MEWA 5CKEA 1G3YA 1GRIA 2X3WD 6AT1B 1M4ZA 3ULRB 1QP2A 3RR6A 4F14A 1F1BB 1B07A 4WF2A 2DL3A 2FZCB 2RHYA 2MMPA 2L3RA 3V7CA 4J9EA 1SEMA 2DL8A 1K73U 3VYGA 2V8IA 1ZQ1A 4RTXA 1KG1A 2QG9B 4MZPA 1JJ2P 1IXDA 1YCSB 1Q95G 4DOVA 1VQNT 2ZPBB 3VYHB 2K5FA 3OYGA 2ZPEB 4KH0B 2RHZA 2KRNA 2EFIA 5FU7C 4AMCA 2C0TA 4R55A 2DA9A 1M1KR 1YJWT 3WXMB 2E3HA 2EGEA 4BDZA 4C8QB 3O8VA 4CRIA 2MAMA 1O9SA 2HDAA 5LJ5h 1AT1B 3JV3A 5DY9A 4C92A 3CCVT 3CC2T 2PUKB 2KT1A 2LP5A 2E4HA 1Q86U 2RI2A 4JRIA 2RPNA 1YJNQ 1U8RA 4M78G 1N8RU 2RI3A 4XTZA 5A2QE 2LNHB 4JRQA 2X4WA 4DBRA 2EKOA 2ZPFB 3CMEQ 2FL7A 1UTIA 1R0BG 1SSFA 2D6FA 1KSWA 5GAN5 3M55A 1GFDA 3INZA 4BUGA 3HRTA 1IRXA 3G71Q 5LJ5g 2DIQA 5LJ5j 3CCST 3HRSA 1OX9A 2MIOA 2CP6A 1NLPC 2LJ0A 4M75E 2A3LA 5FU6C 1VQ5A 3FRNA 1I4K1 2HKNA 1HK9A 3CBPA 1N9SA 1G3TA 3JCMW 2QXFA 1RI9A 1WJQA 4F17A 3J7AF 2LMJA 1K9MU 1U1TA 2C0OA 1K76A 1Z9ZA 4WTOB 4N4GA 4EMGA 5C6SA 5KYYB 4RTUA 5IH2A 4C92F 2VYTA 1VYVA 1PG5B 3EGXB 2VGNA 2DVEA 2HSEB 2EQIA 2M1HA 2ZGWA 2ESWA 1FMKA 2DRMA 5CKHA 5FRNA 1X75C 2IPOB 3LYIA 2KT8A 4EMHA 3QDRB 1E7OA 4M7AE 5GANg 1M30A 1ZBJA 3TEEA 5IAYA 2VC8A 3G6ET 1HD3A 2FYKA 3MJXA 1MMGA 2JJ9A 2VB6A 3HHTB 4J8OA 2A36A 2AZSA 4M78D 4B6MA 3JCMf 2Y90A 2PZ1A 4JLIA 1VQNQ 2DIGA 2A7YA 2EGAA 1WHMA 1I07A 4OMNA 3PT9A 3GPLA 2J6KA 4DEXA 3MP1A 1KQ2A 2B86A 2SRCA 3IQLA 2D8HA 3PFSA 3QJYA 4XTYA 5GAN3 1YJWQ 2R5AA 1S1NA 4M75B 3ZBDA 1YIJT 2C06A 3VS4A 1G2BA 4DA4A 4F7UG 2O88A 4MMLA 4OMOA 1PNJA 5LJ3f 1BB9A 1D0ZA 3TSZA 1AVZC 3VS3A 2VXEA 1PRMC 1WXBA 1IGUA 1S72T 2JZ2A 3TQ7P 1RUWA 1Y96A 2IIMA 3JCMc 1U5SA 1KHCA 5CQYA 3AT1B 4E7SA 3QUIA 5HK3A 3HFOA 4FYWB 2CYZB 3NHNA 1VQLT 2E12A 5CR2A 2QQAA 3VS2A 1TG0A 4LDVA 4M78A 1QVGA 4NOYA 3JCMV 3EGDB 2M9UA 3S6WA 2BE9B 4M78C 4RTVA 3FB9A 3CCEA 3I56Q 4M7AB 2O2OA 4CC7A 1BK2A 3OYMA 4F04B 2CP3A 1K4US 2GGRA 1YI2A 3OYYA 2DD4A 4BI4A 4CC3A 4FYVB 2V8KA 3X25B 4FT2A 3HKSA 1D3BA 2FPFA 4EMKA 4IKFA 1Q82C 4ZN1A 1QCOA 3GBQA 3I55A 1QMCA 4OB2B 2DE0X 3OQ5A 4J9IA 3E1SA 2DYBA 1QQJA 1X2QA 3TREA 2CP0A 4HXJA 4X9CA 5CIUA 4M78F 3I5SA 3P8BB 4KGVB 5GMKl 2FVUA 1PC0A 1OU8A 3BDLA 4IIOA 3OBYA 1Y7XA 1K0XA 1I0CA 1KFZA 1NPRA 1ZA2B 5L8RE 2X3XD 1M2OA 3LGLA 4BB7A 1H3ZA 1VQ8T 2EKHA 1WX6A 2JVVA 2WSEE 2DX1A 3PMIA 4BACA 3R6OA 1AWOA 4KUIA 2BZYA 3QKJA 1B3QA 4J7IA 3RDVA 2CREA 4C5GA 2EGCA 1VQ7A 4BY6C 1V76A 1Q81C 1WLPB 2ZCFB 4X1VA 2OTJT 1RI0A 4XTWA 1ZSZB 2KXCA 1PKSA 1JXMA 1T3LA 3WVEB 5GAN8 2HBPA 5GAOr 4DBHA 3OYDA 1RLQC 3QBYA 5IHNA 1ZBXA 5DLQE 2KMTA 1S72Q 1YCYA 3QYHB 1X6GA 2QQRA 2HL5C 2LZ6B 5ECAA 1KC8U 5GMKi 1QVGP 3E9GA 3CC4Q 2ENMA 1EFNA 5I2SA 2QDLA 1M3CA 2QA4A 4GLKA 3PE0A 1SHFA 1YBYA 2DETA 4E7HA 2CZ1B 4PFPA 5CCAA 4M77E 2JN0A 3S3MA 2V1RA 3CC7Q 5CK9A 2PNIA 1OOTA 3JB9G 5IT9E 3UA6A 3KBGA 2K6DA 1KQSS 4A54A 3KFVA 3OYBA 1AD5A 1CKAA 2GFAA 3M9QA 5D7UA 3VS0A 1QWFA 5CKDA 1VQMA 3CCQT 2K57A 2QQSA 4A53A 1VQ4A 5KCHA 4F7UF 2OI3A 3CD6T 1NYGA 1YHQA 4OMQA 2EJGA 2FPEA 3VRYA 2JMAA 1OZ3A 4XTXA 4JZ4A 1IHVA 1VQOA 3EFOA 4IUUA 2DILA 2QQBA 2JXBA 1YN8A 2NUTA 4A4HA 1NJIR 3X24B 5GANe 1V29B 1PRLC 3CXCA 7AT1B 1LVKA 2CZ0B 5GAN7 2DKGA 1H3HA 5DM7R 2OTLA 5IHKA 1Z9QA 2PVOB 4RMOA 3V8KA 2PVGB 1WHLA 2A08A 4HT9A 1WFWA 4RTWA 3M0TA 3EH1A 3SWNB 4UC4A 3DLLA 3RMSA 2CT4A 2EBPA 3H9NA 3CCUQ 2CP7A 1G8XA 2LCLA 1D0YA 4PJOA 2RJCA 3M0RA 3C0CA 2OTJQ 3CCRA 1M1KU 2FRWA 4J83A 2JNGA 4M77B 1NM7A 2NUZA 1X6BA 2MOXA 4AG2C 2R5MA 3JB9D 2JTMA 2R58A 2L3PA 5IXBA 2DTIA 3MEUA 3GNGA 1Q86C 1NPPA 4MDWA 3EFSA 3E9FA 2YUQA 2LTOA 3H0HA 1LOJA 3H0IA 2F2XA 3O5ZA 4HA8A 4J9GA 1FWZA 3A98A 2E64A 3FLGA 4C8QG 3OY9A 2ZPIB 5IN1A 4Z88A 2CUDA 1RAEB 3CCLA 2JOYA 3Q1JA 3CMET 2K3YA 4MZTA 3VJPA 5GAN6 2MWPA 2V1QA 3VUZA 2AKLA 1K9MC 3V7RA 2BZXA 2RN8A 5HY6A 2EQMA 2GF7A 3M58A 4RTZA 1VQ6A 3M56A 2KE9A 4VUBA 1SF9A 4ESRA 1JEGA 1H92A 5KYUB 4QVDA 3CD6Q 5KYXB 2KAFA 2JTFA 5EG2A 4FSSA 1RADB 2KSSA 2HQHA 1MMDA 1D1AA 1TU0B 1QVFP 3CMAA 4PJLA 3CXCP 5IXFA 2GFUA 3PVQA 1FMVA 3QZ5B 4RG2A 1I8FA 4OF1A 4ZGDB 2D1XA 1VQPQ 1C0MA 2XICA 3CBMA 3LGFA 2GNCA 4LD9K 2COYA 5GJVB 4QW2A 1TUDA 2OX7A 1UE9A 2VUBA 4M7DE 2LCSA 1XNIA 5HK0A 4C8QD 3VKIA 4LUEA 2QEXT 1GBRA 2CZ6B 2W0ZA 2DFUA 2K3BA 5A0DA 2ECZA 1VQ9Q 3A8HB 3LWIA 3OA6A 1Q7YR 1IO6A 2RM4A 3OSVA 5I11A 2LX7A 3CQTA 1G83A 3CEYA 3BY7A 2KR3A 1UGRB 2XDPA 1YITQ 3H6ZA 4F16A 2FO0A 1GCPA 3RESA 1YWPA 4CC2A 1OULA 4E2FB 4C92B 5KYWA 1VQKA 3M59A 1A0NB 4C0FA 2DRKA 1ZUKA 2E5QA 2RQTA 1QKWA 2Z0WA 1N5ZA 2E3IA 2HCKA 5LL6S 2M0OA 4Z89A 1QCNA 4M75G 1TUGB 3BE3A 2O9SA 5FRMA 2BZ8A 3M4GA 2EQKA 9ATCB 1D0XA 2V8JA 2MPXC 2EQJA 1WJSA 4C8QC 3X28B 3L42A 2QYZA 2P4TA 2SEMA 1BBZA 3EG0A 5FW9A 3OW2A 4J6YA 4GLMA 3I56T 2JMCA 2MF2A 3RIRA 2O9VA 2M0YA 2LT1A 1VYTA 5GANh 2JS0A 1UHFA 2KRSA 1YWOA 4NL2A 4M7DB 2K9GA 4BE0A 5D6XA 2DEQA 2PTKA 1VQNA 3SFMA 2Y4YA 5CKBA 3OYNA 1SRMA 3V8LA 4M7AG 2X4XA 3KUFA 4OB0B 4PFZA 1WNLA 1PCXA 2L3SA 2YWWA 4OMFB 1WYXA 2XKOC 4LDXA 3G4ST 1WGSA 1LPLA 1PM3A 4QKUA 3TU4K 3C12A 3MEAA 3CCVA 4C8QF 2DK3A 2XG8D 3CC2A 5GANj 2AT1B 1NE8A 4E7LA 5KYYA 3JCMd 1W2BP 5GAOm 2G6FX 3RKYA 4D8KA 3A8OB 4RKUE 3CXCS 2ZAEA 1VIFA 5KCOA 2QEXQ 2WSCE 1OQKA 1UEBA 4M75D 2QASA 4J9FA 4GBQA 1M90C 4J9HA 2V26A 2JTEA 2K4YA 2VASA 2VGMA 1TSFA 3CCSA 3CCET 2HBWA 1BCMA 3TSWA 4IUQA 8AT1B 3M0QA 4BD3A 1OPLA 1VQ5Q 5L23A 2EYYA 2D0QB 2PU9B 4XTUA 4JDSA 3OS1A 1MNDA 1W4SA 1AWXA 4PK4A 5LJ3d 1JB0E 2KROA 1D1BA 1JJ2S 1IGQA 2DZ9A 1M8VA 3GP8A 5GAOl 1Y96B 1H641 4ZGEB 1OU9A 5IHIA 5CQXA 1GL5A 1KC8C 4M7AD 1UB4A 3CPWA 3HTRA 1AWWA 1IZ6A 1M27C 2RJEA 1KD1C 2KK4A 2H8HA 2IVWA 3NTKA 5I21A 3A8MB 5A0LA 3QWYA 4JUVA 1RAIB 4OVAA 2I0NA 2P4RA 4RCCA 3CBOA 1YFNA 3CC4T 2OAUA 1OX8A 3OW2P 3G6EA 2HMAA 4C5IA 2KY9A 4M75C 1ABQA 2YT6A 3OYLA 2DXBA 2I2LA 2PQWA 3J81E 2DTOA 3CC7T 2QAZA 1VOMA 2EYQA 2AK5A 1D3BB 2DPPB 4NL3A 2EQUA 3ZL7C 4EMKB 4L5GA 4KRTA 4E7ZA 2FZGB 4M4ZA 3N5BB 1VQ7T 1M2VA 1KJWA 4M7AA 4QQDA 2LNVA 3DKMA 2XI9A 1U06A 3OYIA 1IREB 3G4SQ 2K2VA 1NJIU 2ED0A 1YIJA 3QWXX 3LX7A 4M7AC 1OZ2A 2KDSA 3JAME 3NTIA 4R56A 2LX9A 3CCMA 3QIIA 4AFUC 1N9RA 3CPFA 4PJMA 1KQ1A 2LRQA 4M75F 2DAQA 5GAMh 4K11A 1I81A 1XJWB 5HCKA 1S72A 1SRLA 2XDBA 4FYXB 4Z02A 1R8OB 5AYFA 2RK2A 2GCXA 1VQLA 2RHXA 4HCCA 1M5Q1 2BIVA 1M3BA 4FL6A 2LQKA 5LJ5d 1BIAA 2RMOA 3CCEQ 1WHJA 5AT1B 3JCMX 3EG2A 4E7KA 1G3SA 5HKCA 4JRPA 2LQ8A 4JJBA 4AFZC 3A5ZB 3CCUT 5LJ5f 3REBB 5FROA 2WSFE 5GAMg 4AFSC 4C0DB 4C0GA 5GAMj 5GAOn 4M7AF 2W10A 2FHDA 3A8GB 1YI2Q 2HNIA 2ROLA 1TH7A 1HJDA 2X4JA 3OMGA 1UUEA 3EHRA 3LWHA 1WHKA 2IG0A 4DBFA 2ATCB 3CPWP 4ZN3A 1K8AC 3MPUB 2NUPA 2H3JA 1EX4A 3J80E 3P8HA 1SHGA 4F7UA 3CCJT 3EH2A 2K79A 2HQEA 3FC3A 4M77G 2DJQA 2QGFB 3G7ZA 1ABOA 5GANd 3M57A 4R0KA 1WQ7A 4PJOE 2BE7D 3GNFB 1M1FA 1NEBA 1NYFA 3A8LB 2XK0A 4IIMA 3MP8A 3EHQA 4O5VA 1ZSZC 2E10A 3HFNA 4JJCA 1VIEA 5GANf 1JRIA 3G1JA 2RO0A 4KH1B 1PD1A 1WPYA 3OYFA 2YUPA 2OTLT 3PVLA 2O4XA 4Y91A 4HCZA 3H41A 3QHSA 2AIRB 1VQ8A 3C95A 2E6ZA 2MWOA 3VRZA 3EG3A 2RA2A 4PL6A 2LDMA 3OYEA 1X27A 1GXIE 2ROTA 2A37A 2CS7A 2KI7A 2D9TA 3QZ9B 4LDWA 4Q5WA 4B9WA 2QTVA 4J6WA 1VQ7Q 4JS5A 5CVIA 3L2VA 1AZGB 2MCNA 4KGXB 1X2KA 2P0QA 5I2MA 3EFOB 1PKTA 3EG1A 4IUTA 3FDRA 3OS0A 2EYXA 3EFRA 1H8KA 4HCKA 1ZUYA 3GLXA 8ATCB 1QVFA 1KHIA 2E5KA 2KQWA 4DBQA 1WHHA 2QK0A 3VS1A 1K73C 1UJYA 4OGEA 1LJOA 1VQPT 1BI3A 1UJ0A 4M77D 5CO7A 3VS7A 4QQGA 3UWNA 1UG1A 2QA4Q 3S3OA 1AEYA 2XDDA 4Z8AA 4PJOB 4Y92A 2DL4A 2KYMA 4J7FA 1BU1A 3BFMA 1WXUA 1BIBA 2RJDA 4P5NA 2M02A 3H8ZA 2KXDA 1Q7YU 1MUZA 2L8DA 4MMKA 3JCMP 2AHJB 1VQ9T 4OMLA 4GY5A 4OB3B 4PLLA 5GAOp 4J9DA 4LDYA 2JM8A 4OGCA 1PSFA 4FM4B 4XQ3A 3V7SA 1YITT 4V2SA 2F1LA 1E6GA 3SWNA 1YJ9T 3CCQA 1VQ6T 1VQMQ 2DXTA 1UGSB 4BI8B 3ZFJA 3QO3A 3SWNC 3CCJQ 2L5QA 3QG1A 3CD6A 2EW3A 1XTDA 4ORZA 2PUOB 3V8JA 2VVKA 3PTAA 2FZKB 1YHQQ 1N8RC 2QI2A 1TOVA 2COZA 4MDXA 4ME7A 1Q81U 2DXUA 3VV0A 4J6XA 3UPUA 2CGHA 4M77A 1DJ7B 4BDYA 3RNJA 4C92G 3CPWS 1GCQC 1TXQA 2X9HA 2P0KA 1E6HA 4IUPA 4M77C 3HPWA 5GAN4 1NBEB 4FIBA 2E6NA 2MYSA 2JM9A 2YXYA 2DBMA 2OTLQ 4LNPA 1IB8A 3SHWA 1LCKA
chains in the Genus database with same CATH topology
1UGVA 4RUGA 3UF4A 1PHTA 2KYBA 2L0AA 2L3QA 2VWFA 2SEMA 1BBZA 2GTJA 3EG0A 5FW9A 4RTVA 4GLMA 2JMCA 2O2OA 2JW4A 1QCFA 1T3SA 4CC7A 2O9VA 2M51A 1BK2A 2M0YA 1VYTA 2A28A 2JS0A 1UHFA 1UHCA 1YWOA 2KRSA 3SEMA 2KEAA 1K4US 2K9GA 2GGRA 2PTKA 4AFQC 1SRMA 2OJ2A 2LQWA 1K9AA 4CC3A 1WI7A 2DBKA 1I1JA 2YUOA 2FPFA 3R6NA 2L3SA 4LN2A 2J6FA 3GBQA 2DF6A 2RQWA 3M0PA 1WYXA 4JZ3A 2DE0X 4J9IA 2K2MA 2DYBA 1QWEA 1X2QA 4EIKA 1WDXA 4HXJA 4CC4B 3I5SA 3I35A 2LJ3A 2AKKA 2LQNA 2G6FX 2ED1A 4IIOA 4D8KA 2GQIA 1K0XA 1I0CA 1KFZA 1NEGA 2DL7A 2X3XD 2D8JA 4J9CA 1VA7A 1UFFA 4J9FA 4GBQA 1X43A 2EKHA 1WX6A 4J9HA 2DX1A 2JTEA 3TVTA 3FJ5A 1AWOA 1CKBA 1OEBA 1JXOA 1SSHA 3NGPA 2BZYA 2HBWA 1B3QA 3TSWA 1RLPC 4HVVA 2EVRA 3M0QA 1OPLA 2CREA 4DEYA 1Y57A 2EGCA 5L23A 2DM1A 2EYYA 1WLPB 2ABLA 4X1VA 1UDLA 2RNAA 1AWXA 2KROA 2OAWA 1ZSGA 2YSQA 3UATA 2KXCA 1PKSA 2EYZA 1JXMA 1T3LA 1CSKA 2DVJA 5IHIA 1PWTA 1RLQC 1GCQA 3THKA 5IHNA 1GL5A 2FG0A 2VKNA 1AWWA 1M27C 2GTOA 1X6GA 2KGTA 2KNBB 1V1CA 2H8HA 3QWYA 2YUNA 2HSPA 2LZ6B 3U23A 1AOJA 2O31A 2I0NA 5I22A 5ECAA 2P4RA 2D0NA 2LJ1A 2ENMA 1EFNA 2QDLA 1M3CA 1ABQA 3PE0A 1SHFA 1JQQA 1OV3A 5FWCA 2YT6A 2NWMA 5EC7A 2FPDA 2CSQA 2CSIA 1T0JA 1KIKA 2EYWA 2V1RA 2AK5A 2F2VA 2PNIA 1OOTA 2DL5A 4J9BA 2RQVA 1JU5C 1UECA 1QLYA 2KRMA 3UA6A 1WXTA 3ZL7C 2K6DA 4OMPA 1Y0MA 3KFVA 4KRTA 2J6OA 1AD5A 2DLPA 1GBQA 1CKAA 2DNUA 3VS6A 1T0HA 1ZX6A 1QWFA 3VS0A 4M4ZA 4E6RA 1MV0B 1NG2A 3UA7A 3I9QA 5GJWB 1KJWA 2FEIA 1U06A 2OI3A 1NYGA 2ED0A 1ARKA 3QWXX 2CH4A 4OMQA 2CT3A 2FPEA 3VRYA 2JMAA 1QKXA 4JZ4A 1K0SA 4AFUC 1TUCA 2DILA 4K11A 2JXBA 1YN8A 1AZEA 5HCKA 1SRLA 4HVUA 4RTTA 2K7AA 1M3AA 1GRIA 2X3WD 1PRLC 3ULRB 4F14A 1H3HA 1K1ZA 1B07A 5IHKA 1Z9QA 2RF0A 2DL3A 1OPKA 2A08A 2FRYA 1WFWA 1M3BA 4RTWA 3M0TA 2RMOA 4J9EA 1SEMA 2CDTA 2DL8A 1M8MA 3EG2A 4JJBA 4AFZC 2CT4A 2EBPA 4RTXA 3REBB 1GFCA 4AFSC 3M0RA 2W10A 3C0CA 1YCSB 2ROLA 3REAB 1HJDA 2FRWA 4ZNXA 1UUEA 3EHRA 4RTYA 1NM7A 2NUZA 1X6BA 2KRNA 2XMFA 2MOXA 4AG2C 2L3PA 5IXBA 1W70A 2C0TA 2DA9A 2EGEA 3H0FA 1SHGA 2YUQA 2K79A 2HDAA 1W6XA 2DJQA 3H0HA 1ABOA 3H0IA 3JV3A 2F2XA 3O5ZA 4R0KA 3NPFA 3LH5A 4J9GA 1U3OA 2KT1A 2LP5A 3A98A 1NEBA 1NYFA 2RPNA 2BTTA 3EHQA 4HVWA 4IIMA 1JO8A 4Z88A 2CUDA 4JJCA 2LNHB 2RQRA 2YUPA 3PVLA 3H41A 1UTIA 4QT7A 3VRZA 1KSWA 2DMOA 1GFDA 2V1QA 3EG3A 3RBBB 2AKLA 1X27A 1NLOC 2ROTA 2A37A 2BZXA 2MIOA 2RN8A 1NLPC 2LJ0A 3EGUA 4OMMA 1W1FA 4RTZA 2KE9A 2RQUA 1JEGA 1H92A 4ESRA 1WA7A 1AZGB 2AZVA 1ZLMA 2MCNA 1RI9A 4JPBW 4F17A 2L2PA 1X2KA 1YNZA 2LMJA 2F2WA 3VS5A 1XOVA 1MV3A 1PKTA 2C0OA 1K76A 1Z9ZA 4FSSA 3EG1A 1X69A 2JS2A 4RTUA 5IH2A 1VYVA 2EYXA 1H8KA 4JJDA 4HCKA 1ZUYA 4AG1C 2HEQA 2EQIA 2ESWA 5IXFA 1FMKA 3PVQA 2DRMA 2E5KA 4WCIA 5FWBA 2KT8A 3VS1A 2J05A 1UJYA 1WIEA 1HSQA 2D1XA 4LE9A 1E7OA 1UJ0A 4A63B 1M30A 2GNCA 1ZBJA 2GBQA 3VS7A 1HD3A 5GJVB 1TUDA 1UG1A 1UE9A 1AEYA 4Z8AA 2LCSA 4Y92A 1AWJA 2DL4A 2KYMA 1BU1A 3NMZC 1WXUA 4LUEA 2A36A 1GBRA 1VYUA 2KXDA 2AZSA 2W0ZA 1SPKA 1MUZA 3I5RA 2YDLA 2PZ1A 2K3BA 2ECZA 4OMLA 2EGAA 1I07A 2CUBA 2JT4A 4OMNA 3M0UA 2J6KA 4J9DA 1IO6A 2JM8A 4DEXA 5I11A 2LX7A 3CQTA 1G83A 2B86A 2SRCA 3IQLA 2D8HA 2KR3A 1E6GA 4F16A 2FO0A 1GCPA 1YWPA 1YP5A 1S1NA 4CC2A 1J3TA 2EPDA 2EW3A 1FYNA 2CH4W 2KBTA 4ORZA 1A0NB 2J06A 2J7IA 4LUDA 2VVKA 3VS4A 2DRKA 1ZUKA 1G2BA 2RQTA 1QKWA 2O88A 4OMOA 1N5ZA 1PNJA 1BB9A 2C0IA 2HCKA 3TSZA 1AVZC 3VS3A 1PRMC 1WXBA 3RNJA 1RUWA 4Z89A 1GCQC 2IIMA 4D8DA 1E6HA 1U5SA 1ZUUA 2O9SA 2BZ8A 2JM9A 3NHNA 2DBMA 3M0SA 4LNPA 3VS2A 3SHWA 1LCKA 1TG0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1UGV A;  4RUG A;  3UF4 A;  1PHT A;  2KYB A;  2L0A A;  2L3Q A;  2VWF A;  2SEM A;  1BBZ A;  2GTJ A;  3EG0 A;  5FW9 A;  4RTV A;  4GLM A;  2JMC A;  2O2O A;  2JW4 A;  1QCF A;  1T3S A;  4CC7 A;  2O9V A;  2M51 A;  1BK2 A;  2M0Y A;  1VYT A;  2A28 A;  2JS0 A;  1UHF A;  1UHC A;  1YWO A;  2KRS A;  3SEM A;  2KEA A;  1K4U S;  2K9G A;  2GGR A;  2PTK A;  4AFQ C;  1SRM A;  2OJ2 A;  2LQW A;  1K9A A;  4CC3 A;  1WI7 A;  2DBK A;  1I1J A;  2YUO A;  2FPF A;  3R6N A;  2L3S A;  4LN2 A;  2J6F A;  3GBQ A;  2DF6 A;  2RQW A;  3M0P A;  1WYX A;  4JZ3 A;  2DE0 X;  4J9I A;  2K2M A;  2DYB A;  1QWE A;  1X2Q A;  4EIK A;  1WDX A;  4HXJ A;  4CC4 B;  3I5S A;  3I35 A;  2LJ3 A;  2AKK A;  2LQN A;  2G6F X;  2ED1 A;  4IIO A;  4D8K A;  2GQI A;  1K0X A;  1I0C A;  1KFZ A;  1NEG A;  2DL7 A;  2X3X D;  2D8J A;  4J9C A;  1VA7 A;  1UFF A;  4J9F A;  4GBQ A;  1X43 A;  2EKH A;  1WX6 A;  4J9H A;  2DX1 A;  2JTE A;  3TVT A;  3FJ5 A;  1AWO A;  1CKB A;  1OEB A;  1JXO A;  1SSH A;  3NGP A;  2BZY A;  2HBW A;  1B3Q A;  3TSW A;  1RLP C;  4HVV A;  2EVR A;  3M0Q A;  1OPL A;  2CRE A;  4DEY A;  1Y57 A;  2EGC A;  5L23 A;  2DM1 A;  2EYY A;  1WLP B;  2ABL A;  4X1V A;  1UDL A;  2RNA A;  1AWX A;  2KRO A;  2OAW A;  1ZSG A;  2YSQ A;  3UAT A;  2KXC A;  1PKS A;  2EYZ A;  1JXM A;  1T3L A;  1CSK A;  2DVJ A;  5IHI A;  1PWT A;  1RLQ C;  1GCQ A;  3THK A;  5IHN A;  1GL5 A;  2FG0 A;  2VKN A;  1AWW A;  1M27 C;  2GTO A;  1X6G A;  2KGT A;  2KNB B;  1V1C A;  2H8H A;  3QWY A;  2YUN A;  2HSP A;  2LZ6 B;  3U23 A;  1AOJ A;  2O31 A;  2I0N A;  5I22 A;  5ECA A;  2P4R A;  2D0N A;  2LJ1 A;  2ENM A;  1EFN A;  2QDL A;  1M3C A;  1ABQ A;  3PE0 A;  1SHF A;  1JQQ A;  1OV3 A;  5FWC A;  2YT6 A;  2NWM A;  5EC7 A;  2FPD A;  2CSQ A;  2CSI A;  1T0J A;  1KIK A;  2EYW A;  2V1R A;  2AK5 A;  2F2V A;  2PNI A;  1OOT A;  2DL5 A;  4J9B A;  2RQV A;  1JU5 C;  1UEC A;  1QLY A;  2KRM A;  3UA6 A;  1WXT A;  3ZL7 C;  2K6D A;  4OMP A;  1Y0M A;  3KFV A;  4KRT A;  2J6O A;  1AD5 A;  2DLP A;  1GBQ A;  1CKA A;  2DNU A;  3VS6 A;  1T0H A;  1ZX6 A;  1QWF A;  3VS0 A;  4M4Z A;  4E6R A;  1MV0 B;  1NG2 A;  3UA7 A;  3I9Q A;  5GJW B;  1KJW A;  2FEI A;  1U06 A;  2OI3 A;  1NYG A;  2ED0 A;  1ARK A;  3QWX X;  2CH4 A;  4OMQ A;  2CT3 A;  2FPE A;  3VRY A;  2JMA A;  1QKX A;  4JZ4 A;  1K0S A;  4AFU C;  1TUC A;  2DIL A;  4K11 A;  2JXB A;  1YN8 A;  1AZE A;  5HCK A;  1SRL A;  4HVU A;  4RTT A;  2K7A A;  1M3A A;  1GRI A;  2X3W D;  1PRL C;  3ULR B;  4F14 A;  1H3H A;  1K1Z A;  1B07 A;  5IHK A;  1Z9Q A;  2RF0 A;  2DL3 A;  1OPK A;  2A08 A;  2FRY A;  1WFW A;  1M3B A;  4RTW A;  3M0T A;  2RMO A;  4J9E A;  1SEM A;  2CDT A;  2DL8 A;  1M8M A;  3EG2 A;  4JJB A;  4AFZ C;  2CT4 A;  2EBP A;  4RTX A;  3REB B;  1GFC A;  4AFS C;  3M0R A;  2W10 A;  3C0C A;  1YCS B;  2ROL A;  3REA B;  1HJD A;  2FRW A;  4ZNX A;  1UUE A;  3EHR A;  4RTY A;  1NM7 A;  2NUZ A;  1X6B A;  2KRN A;  2XMF A;  2MOX A;  4AG2 C;  2L3P A;  5IXB A;  1W70 A;  2C0T A;  2DA9 A;  2EGE A;  3H0F A;  1SHG A;  2YUQ A;  2K79 A;  2HDA A;  1W6X A;  2DJQ A;  3H0H A;  1ABO A;  3H0I A;  3JV3 A;  2F2X A;  3O5Z A;  4R0K A;  3NPF A;  3LH5 A;  4J9G A;  1U3O A;  2KT1 A;  2LP5 A;  3A98 A;  1NEB A;  1NYF A;  2RPN A;  2BTT A;  3EHQ A;  4HVW A;  4IIM A;  1JO8 A;  4Z88 A;  2CUD A;  4JJC A;  2LNH B;  2RQR A;  2YUP A;  3PVL A;  3H41 A;  1UTI A;  4QT7 A;  3VRZ A;  1KSW A;  2DMO A;  1GFD A;  2V1Q A;  3EG3 A;  3RBB B;  2AKL A;  1X27 A;  1NLO C;  2ROT A;  2A37 A;  2BZX A;  2MIO A;  2RN8 A;  1NLP C;  2LJ0 A;  3EGU A;  4OMM A;  1W1F A;  4RTZ A;  2KE9 A;  2RQU A;  1JEG A;  1H92 A;  4ESR A;  1WA7 A;  1AZG B;  2AZV A;  1ZLM A;  2MCN A;  1RI9 A;  4JPB W;  4F17 A;  2L2P A;  1X2K A;  1YNZ A;  2LMJ A;  2F2W A;  3VS5 A;  1XOV A;  1MV3 A;  1PKT A;  2C0O A;  1K76 A;  1Z9Z A;  4FSS A;  3EG1 A;  1X69 A;  2JS2 A;  4RTU A;  5IH2 A;  1VYV A;  2EYX A;  1H8K A;  4JJD A;  4HCK A;  1ZUY A;  4AG1 C;  2HEQ A;  2EQI A;  2ESW A;  5IXF A;  1FMK A;  3PVQ A;  2DRM A;  2E5K A;  4WCI A;  5FWB A;  2KT8 A;  3VS1 A;  2J05 A;  1UJY A;  1WIE A;  1HSQ A;  2D1X A;  4LE9 A;  1E7O A;  1UJ0 A;  4A63 B;  1M30 A;  2GNC A;  1ZBJ A;  2GBQ A;  3VS7 A;  1HD3 A;  5GJV B;  1TUD A;  1UG1 A;  1UE9 A;  1AEY A;  4Z8A A;  2LCS A;  4Y92 A;  1AWJ A;  2DL4 A;  2KYM A;  1BU1 A;  3NMZ C;  1WXU A;  4LUE A;  2A36 A;  1GBR A;  1VYU A;  2KXD A;  2AZS A;  2W0Z A;  1SPK A;  1MUZ A;  3I5R A;  2YDL A;  2PZ1 A;  2K3B A;  2ECZ A;  4OML A;  2EGA A;  1I07 A;  2CUB A;  2JT4 A;  4OMN A;  3M0U A;  2J6K A;  4J9D A;  1IO6 A;  2JM8 A;  4DEX A;  5I11 A;  2LX7 A;  3CQT A;  1G83 A;  2B86 A;  2SRC A;  3IQL A;  2D8H A;  2KR3 A;  1E6G A;  4F16 A;  2FO0 A;  1GCP A;  1YWP A;  1YP5 A;  1S1N A;  4CC2 A;  1J3T A;  2EPD A;  2EW3 A;  1FYN A;  2CH4 W;  2KBT A;  4ORZ A;  1A0N B;  2J06 A;  2J7I A;  4LUD A;  2VVK A;  3VS4 A;  2DRK A;  1ZUK A;  1G2B A;  2RQT A;  1QKW A;  2O88 A;  4OMO A;  1N5Z A;  1PNJ A;  1BB9 A;  2C0I A;  2HCK A;  3TSZ A;  1AVZ C;  3VS3 A;  1PRM C;  1WXB A;  3RNJ A;  1RUW A;  4Z89 A;  1GCQ C;  2IIM A;  4D8D A;  1E6H A;  1U5S A;  1ZUU A;  2O9S A;  2BZ8 A;  2JM9 A;  3NHN A;  2DBM A;  3M0S A;  4LNP A;  3VS2 A;  3SHW A;  1LCK A;  1TG0 A; 
#chains in the Genus database with same CATH topology
 1UGV A;  3ZEH A;  3EG9 A;  4Y28 E;  1KK7 A;  1MHN A;  2KYB A;  4XTV A;  4D6W A;  1QVG S;  2VWF A;  3RKW A;  3JCM g;  4C92 E;  1QCF A;  3EAE A;  1KD1 R;  3JRZ A;  2KEA A;  2X4Y A;  2OJ2 A;  2LQW A;  1K9A A;  1WI7 A;  2DBK A;  3QPH A;  4E7I A;  1I1J A;  2QQ9 A;  1I5L A;  5KE3 A;  4M77 F;  3TCJ A;  4M7D G;  2PVD B;  2J6F A;  4OB1 B;  4N0A C;  2DF6 A;  1Y71 A;  1B34 A;  3RKX A;  1QWE A;  2MI6 A;  3AHU A;  3HL8 A;  1QP3 A;  3OBW A;  4CC4 B;  4PKC C;  1YJN A;  1M9S A;  2LQN A;  1W2B A;  2RI5 A;  2GQV A;  2GQI A;  4C92 D;  1RAG B;  3CCL Q;  1Q82 R;  3JB9 F;  1NEG A;  3CME A;  2DL7 A;  3PNW C;  5CAI A;  5FU7 B;  2D8J A;  4J9C A;  1UFF A;  1X43 A;  3X26 B;  3FIF A;  2EJF A;  2WAC A;  1TTH B;  3G71 A;  2YRC A;  5D6Y A;  1SSH A;  4A4G A;  3RER A;  5GAM e;  5KYW B;  3QJ6 A;  4HVV A;  2EVR A;  2QGG A;  1VQ5 T;  1Y57 A;  1U1S A;  1YJ9 Q;  3OYH A;  2LVM A;  1VQ6 Q;  1UDL A;  2RNA A;  1N6A A;  2VXF A;  4IUR A;  1ZSG A;  3HP9 A;  2EYZ A;  1G3W A;  2E65 A;  2DVJ A;  3GOX A;  4N4H A;  1BI2 A;  4L6V 5;  2GTO A;  3CMA Q;  1AHJ B;  2KGT A;  1V1C A;  1PD0 A;  3L2W A;  4M7D D;  1Q81 R;  2HSP A;  3U23 A;  4C8Q A;  1OI1 A;  2DZC A;  5FU6 B;  3QDF A;  1WZO A;  2EJ9 A;  2CP2 A;  2D0N A;  2LT4 A;  2LJ1 A;  2YHT A;  4C92 C;  4PFO A;  1FMW A;  3PIP A;  1JQQ A;  4PJJ A;  3L2Q A;  1OV3 A;  1I5O B;  1K8A R;  2QEX A;  1G5V A;  2RD1 A;  2COW A;  1KIK A;  2O01 E;  4FYY B;  2HKQ B;  3PGG A;  1ACM B;  2R57 A;  2DL5 A;  4J9B A;  1KQS A;  2RQV A;  1UEC A;  1RL2 A;  1QLY A;  2KRM A;  1WXT A;  3RUX A;  1Y0M A;  1NJI C;  2J6O A;  1GBQ A;  3VS6 A;  1T0H A;  4M78 E;  1ZX6 A;  4E6R A;  3JB9 I;  1MV0 B;  3UA7 A;  1YJW A;  1PSE A;  4XU3 A;  1ZA1 B;  3I9Q A;  5GMK h;  5GJW B;  1WHG A;  4LD6 A;  3OSS C;  4XU1 A;  1VQK Q;  1ARK A;  2FB7 A;  2CT3 A;  4M7D A;  4QVZ A;  2QDY B;  1X6O A;  4II1 A;  4O6J A;  3C4S A;  1ZHI A;  4M7D C;  1AZE A;  4X34 A;  1M3A A;  2HD0 A;  4XAX B;  3EGX A;  1QVF S;  1BKB A;  4FW2 A;  4QQ6 A;  1K1Z A;  2RF0 A;  4JLG A;  3LH0 A;  2YRD A;  3ME9 A;  3GIB A;  3DB3 A;  1OPK A;  3BW1 A;  1R0C B;  2G3R A;  2FRY A;  1QW1 A;  3DLM A;  5GMK j;  4ZTJ A;  4ZGJ B;  3F70 A;  4C0Z A;  2CZ7 B;  2XU8 A;  1BYM A;  3I56 A;  2CDT A;  1M8M A;  2H3E B;  2E1H A;  2XHC A;  3HRU A;  3UDC A;  1GFC A;  1YI2 T;  4JJN K;  1RAH B;  3REA B;  4ELZ C;  4ZNX A;  1K73 R;  4RTY A;  3PIO A;  2F5K A;  1UGQ B;  3SB2 A;  2XMF A;  1TWB A;  4DOW A;  4M7D F;  1MNE A;  4XU0 A;  2XID A;  1W70 A;  4N4I A;  3VUB A;  1C1A A;  3OYJ A;  4OP0 A;  1Y07 A;  3T9N A;  2MK5 A;  3H0F A;  4EPC A;  3I55 T;  4KUL A;  3NTH A;  3G4S A;  4M78 B;  1W6X A;  2ZPG B;  3NPF A;  3CCM T;  3LH5 A;  3L2R A;  3CCV Q;  4E7J A;  3GF5 A;  3CC2 Q;  1U3O A;  4PNO A;  4M75 A;  2DD5 A;  2BTT A;  4HVW A;  1JO8 A;  3MP6 A;  1BI0 A;  2RQR A;  1C6V X;  1Q86 R;  1SKU B;  3JCM e;  4F7U E;  4QT7 A;  1KQS P;  2DMO A;  3RBB B;  1N8R R;  3M53 A;  3MET A;  4XK8 E;  2K3X A;  1M2V B;  3CCS Q;  1NLO C;  2JUF A;  3ASK A;  3EGD A;  3EGU A;  4OMM A;  1W1F A;  5A0G A;  2X51 A;  5GMK m;  3OB9 A;  2RQU A;  4X9D A;  1WA7 A;  2AZV A;  1ZLM A;  4JPB W;  3M5A A;  2L2P A;  1YNZ A;  2F2W A;  3VS5 A;  4B9X A;  1MV3 A;  1XOV A;  2BUD A;  3LW5 E;  1X69 A;  2JS2 A;  1O75 A;  5LJ3 e;  4JJD A;  4AG1 C;  2HEQ A;  1K9M R;  5M9O A;  4NS5 A;  2NYS A;  4WCI A;  4EMK C;  2HL3 A;  5FWB A;  4EDU A;  1LNX A;  3MHX A;  3JCM J;  2J05 A;  3P8D A;  4FU6 A;  3SD4 A;  1WIE A;  1HSQ A;  4LE9 A;  3WVD B;  3RMQ A;  4A63 B;  4BY6 B;  3CC4 A;  1Q7Y C;  4MZM A;  2LCC A;  2GBQ A;  4IUV A;  3G6E Q;  2QA4 T;  1M1K C;  2DER A;  1MGQ A;  1AWJ A;  3QYG B;  1W2B S;  3NMZ C;  4A4F A;  1VYU A;  4E47 A;  4FW1 A;  1SPK A;  3CC7 A;  3MCA B;  4YTL A;  3I5R A;  4C5E A;  2YDL A;  5J26 A;  5CKF A;  4L59 A;  1MMA A;  3JCM b;  2ZPH B;  2CUB A;  2JT4 A;  2E70 A;  2NUP B;  3M0U A;  3M4Y A;  1RAB B;  4PJO G;  4DQ2 A;  1VUB A;  2KVQ G;  4F7U B;  3L2Z A;  1MMN A;  4LDU A;  1WJR A;  4KGZ B;  1VQM T;  1P92 A;  1M90 U;  1QVP A;  3LLR A;  1YP5 A;  1VQ4 T;  3I55 Q;  1J3T A;  2EPD A;  1FYN A;  2CH4 W;  2KBT A;  2J06 A;  2J7I A;  4LUD A;  1YHQ T;  1YIJ Q;  1UGP B;  1IHW A;  4TVR A;  3BDU A;  2EIF A;  5KYN A;  3CCM Q;  1RAC B;  3X20 B;  1ZSZ A;  2C0I A;  1VQO T;  4C0D C;  2LC4 A;  1EZZ B;  2B8A A;  2O4X B;  1TS9 A;  4D8D A;  3JB9 H;  1ZUU A;  2VV5 A;  3M0S A;  1VQL Q;  3D7S B;  5KE2 A;  3L1A A;  4BE2 A;  4RUG A;  3UF4 A;  1PHT A;  5KH6 A;  1HXD A;  2L0A A;  1KD1 U;  2L3Q A;  1FXX A;  2GTJ A;  4BI3 A;  3OW2 S;  4JS4 A;  3MEV A;  2JW4 A;  1T3S A;  1BI1 A;  2M51 A;  4FSX A;  3CCU A;  2A28 A;  1UHC A;  4ATO A;  5LJ5 e;  3SEM A;  5C0M A;  1RAA B;  2L89 A;  2OTJ A;  2RHI A;  2BKD N;  4AFQ C;  3CCR T;  1OYX A;  3JCM Q;  2HZY A;  1HYO A;  2K5I A;  2CKK A;  2NUT B;  3JSC A;  4RCB A;  1XQH A;  2YUO A;  1BCO A;  1M1G A;  2K5L A;  4PJO D;  3R6N A;  4LN2 A;  2RQW A;  3M0P A;  1RAF B;  3CCJ A;  3E2U A;  4JZ3 A;  5GAN 2;  4BE1 A;  2K2M A;  2ZZD A;  2RJF A;  4PLI A;  3DB4 A;  4EIK A;  1WDX A;  1WQW A;  4A4E A;  4ELY C;  3MKD A;  1Q82 U;  2YLB A;  3I35 A;  3OYC A;  2LJ3 A;  2AKK A;  2DTH A;  5FLX E;  4KBM B;  2ED1 A;  3QXE B;  2X35 A;  5GMK e;  2F5T X;  3CCL T;  4AT1 B;  2DJZ A;  2RK1 A;  4PJN A;  1VA7 A;  1VQ8 Q;  1D09 B;  4ZTF A;  4ANJ A;  2RH2 A;  3TVT A;  3FJ5 A;  1CKB A;  1OEB A;  1B7T A;  1JXO A;  3NGP A;  3E19 A;  1RLP C;  4LXC A;  3FEO A;  3VU3 C;  4DEY A;  1R77 A;  2DM1 A;  5DLO A;  2DXC A;  3FJP A;  2ABL A;  1JJ2 A;  1VQ4 Q;  4C5H A;  2OAW A;  1SG5 A;  2YSQ A;  1D1C A;  3UAT A;  4PJO C;  3JCM h;  4J5Y A;  1M90 R;  4XU2 A;  2DYI A;  1CSK A;  1PWT A;  1GCQ A;  3THK A;  1VQO Q;  4HCB A;  3A1P A;  3C94 A;  2FG0 A;  2VKN A;  3JB9 J;  3UT1 A;  4JRK A;  4FCY A;  3CMA T;  2KNB B;  3OS5 A;  1N27 A;  3EG9 B;  2YRV A;  2YUN A;  2HAX A;  3URG A;  2QTX A;  1FX7 A;  1AOJ A;  2O31 A;  2F69 A;  5I22 A;  3S3N A;  2M16 A;  1VQP A;  1EIF A;  1NZ9 A;  1X01 A;  1K8A U;  3L2U A;  2A0F B;  3NFC A;  1YJN T;  2XD0 A;  5LJ3 h;  4KUD K;  3PMT A;  5FWC A;  5J39 A;  1KC8 R;  2HQX A;  2NWM A;  3KXT A;  2RHU A;  5EC7 A;  2FPD A;  2CSQ A;  2NLU A;  5GAM d;  2CSI A;  2RB6 A;  1T0J A;  2EYW A;  4FT4 A;  4A4K A;  4PJO F;  2F2V A;  4HKE A;  3CCR Q;  1JU5 C;  1VQ9 A;  5GAO q;  2Y4X A;  3G71 T;  3OMC A;  3M54 A;  5GAM f;  4OMP A;  4C8Q E;  2DLP A;  2DNU A;  2EAY A;  3OYK A;  1B34 B;  4N0A A;  1YIT A;  5J3B A;  2YLC A;  1YJ9 A;  2E41 A;  3OS2 A;  3MO8 A;  1NG2 A;  3CCQ Q;  3OYA A;  2FEI A;  3QSU A;  2P0P A;  1VQK T;  4RG8 A;  5LJ3 g;  4QVC A;  5LJ3 j;  3SDZ A;  2CH4 A;  4KT0 E;  1JBM A;  2DEU A;  2EWN A;  3HSB A;  4HT8 A;  2CP5 A;  5KYU A;  1QKX A;  3ER0 A;  1K0S A;  1TUC A;  4CI0 C;  5KYX A;  5D6W A;  2P84 A;  2DO3 A;  4HVU A;  4RTT A;  2K7A A;  3MEW A;  5CKE A;  1G3Y A;  1GRI A;  2X3W D;  6AT1 B;  1M4Z A;  3ULR B;  1QP2 A;  3RR6 A;  4F14 A;  1F1B B;  1B07 A;  4WF2 A;  2DL3 A;  2FZC B;  2RHY A;  2MMP A;  2L3R A;  3V7C A;  4J9E A;  1SEM A;  2DL8 A;  1K73 U;  3VYG A;  2V8I A;  1ZQ1 A;  4RTX A;  1KG1 A;  2QG9 B;  4MZP A;  1JJ2 P;  1IXD A;  1YCS B;  1Q95 G;  4DOV A;  1VQN T;  2ZPB B;  3VYH B;  2K5F A;  3OYG A;  2ZPE B;  4KH0 B;  2RHZ A;  2KRN A;  2EFI A;  5FU7 C;  4AMC A;  2C0T A;  4R55 A;  2DA9 A;  1M1K R;  1YJW T;  3WXM B;  2E3H A;  2EGE A;  4BDZ A;  4C8Q B;  3O8V A;  4CRI A;  2MAM A;  1O9S A;  2HDA A;  5LJ5 h;  1AT1 B;  3JV3 A;  5DY9 A;  4C92 A;  3CCV T;  3CC2 T;  2PUK B;  2KT1 A;  2LP5 A;  2E4H A;  1Q86 U;  2RI2 A;  4JRI A;  2RPN A;  1YJN Q;  1U8R A;  4M78 G;  1N8R U;  2RI3 A;  4XTZ A;  5A2Q E;  2LNH B;  4JRQ A;  2X4W A;  4DBR A;  2EKO A;  2ZPF B;  3CME Q;  2FL7 A;  1UTI A;  1R0B G;  1SSF A;  2D6F A;  1KSW A;  5GAN 5;  3M55 A;  1GFD A;  3INZ A;  4BUG A;  3HRT A;  1IRX A;  3G71 Q;  5LJ5 g;  2DIQ A;  5LJ5 j;  3CCS T;  3HRS A;  1OX9 A;  2MIO A;  2CP6 A;  1NLP C;  2LJ0 A;  4M75 E;  2A3L A;  5FU6 C;  1VQ5 A;  3FRN A;  1I4K 1;  2HKN A;  1HK9 A;  3CBP A;  1N9S A;  1G3T A;  3JCM W;  2QXF A;  1RI9 A;  1WJQ A;  4F17 A;  3J7A F;  2LMJ A;  1K9M U;  1U1T A;  2C0O A;  1K76 A;  1Z9Z A;  4WTO B;  4N4G A;  4EMG A;  5C6S A;  5KYY B;  4RTU A;  5IH2 A;  4C92 F;  2VYT A;  1VYV A;  1PG5 B;  3EGX B;  2VGN A;  2DVE A;  2HSE B;  2EQI A;  2M1H A;  2ZGW A;  2ESW A;  1FMK A;  2DRM A;  5CKH A;  5FRN A;  1X75 C;  2IPO B;  3LYI A;  2KT8 A;  4EMH A;  3QDR B;  1E7O A;  4M7A E;  5GAN g;  1M30 A;  1ZBJ A;  3TEE A;  5IAY A;  2VC8 A;  3G6E T;  1HD3 A;  2FYK A;  3MJX A;  1MMG A;  2JJ9 A;  2VB6 A;  3HHT B;  4J8O A;  2A36 A;  2AZS A;  4M78 D;  4B6M A;  3JCM f;  2Y90 A;  2PZ1 A;  4JLI A;  1VQN Q;  2DIG A;  2A7Y A;  2EGA A;  1WHM A;  1I07 A;  4OMN A;  3PT9 A;  3GPL A;  2J6K A;  4DEX A;  3MP1 A;  1KQ2 A;  2B86 A;  2SRC A;  3IQL A;  2D8H A;  3PFS A;  3QJY A;  4XTY A;  5GAN 3;  1YJW Q;  2R5A A;  1S1N A;  4M75 B;  3ZBD A;  1YIJ T;  2C06 A;  3VS4 A;  1G2B A;  4DA4 A;  4F7U G;  2O88 A;  4MML A;  4OMO A;  1PNJ A;  5LJ3 f;  1BB9 A;  1D0Z A;  3TSZ A;  1AVZ C;  3VS3 A;  2VXE A;  1PRM C;  1WXB A;  1IGU A;  1S72 T;  2JZ2 A;  3TQ7 P;  1RUW A;  1Y96 A;  2IIM A;  3JCM c;  1U5S A;  1KHC A;  5CQY A;  3AT1 B;  4E7S A;  3QUI A;  5HK3 A;  3HFO A;  4FYW B;  2CYZ B;  3NHN A;  1VQL T;  2E12 A;  5CR2 A;  2QQA A;  3VS2 A;  1TG0 A;  4LDV A;  4M78 A;  1QVG A;  4NOY A;  3JCM V;  3EGD B;  2M9U A;  3S6W A;  2BE9 B;  4M78 C;  4RTV A;  3FB9 A;  3CCE A;  3I56 Q;  4M7A B;  2O2O A;  4CC7 A;  1BK2 A;  3OYM A;  4F04 B;  2CP3 A;  1K4U S;  2GGR A;  1YI2 A;  3OYY A;  2DD4 A;  4BI4 A;  4CC3 A;  4FYV B;  2V8K A;  3X25 B;  4FT2 A;  3HKS A;  1D3B A;  2FPF A;  4EMK A;  4IKF A;  1Q82 C;  4ZN1 A;  1QCO A;  3GBQ A;  3I55 A;  1QMC A;  4OB2 B;  2DE0 X;  3OQ5 A;  4J9I A;  3E1S A;  2DYB A;  1QQJ A;  1X2Q A;  3TRE A;  2CP0 A;  4HXJ A;  4X9C A;  5CIU A;  4M78 F;  3I5S A;  3P8B B;  4KGV B;  5GMK l;  2FVU A;  1PC0 A;  1OU8 A;  3BDL A;  4IIO A;  3OBY A;  1Y7X A;  1K0X A;  1I0C A;  1KFZ A;  1NPR A;  1ZA2 B;  5L8R E;  2X3X D;  1M2O A;  3LGL A;  4BB7 A;  1H3Z A;  1VQ8 T;  2EKH A;  1WX6 A;  2JVV A;  2WSE E;  2DX1 A;  3PMI A;  4BAC A;  3R6O A;  1AWO A;  4KUI A;  2BZY A;  3QKJ A;  1B3Q A;  4J7I A;  3RDV A;  2CRE A;  4C5G A;  2EGC A;  1VQ7 A;  4BY6 C;  1V76 A;  1Q81 C;  1WLP B;  2ZCF B;  4X1V A;  2OTJ T;  1RI0 A;  4XTW A;  1ZSZ B;  2KXC A;  1PKS A;  1JXM A;  1T3L A;  3WVE B;  5GAN 8;  2HBP A;  5GAO r;  4DBH A;  3OYD A;  1RLQ C;  3QBY A;  5IHN A;  1ZBX A;  5DLQ E;  2KMT A;  1S72 Q;  1YCY A;  3QYH B;  1X6G A;  2QQR A;  2HL5 C;  2LZ6 B;  5ECA A;  1KC8 U;  5GMK i;  1QVG P;  3E9G A;  3CC4 Q;  2ENM A;  1EFN A;  5I2S A;  2QDL A;  1M3C A;  2QA4 A;  4GLK A;  3PE0 A;  1SHF A;  1YBY A;  2DET A;  4E7H A;  2CZ1 B;  4PFP A;  5CCA A;  4M77 E;  2JN0 A;  3S3M A;  2V1R A;  3CC7 Q;  5CK9 A;  2PNI A;  1OOT A;  3JB9 G;  5IT9 E;  3UA6 A;  3KBG A;  2K6D A;  1KQS S;  4A54 A;  3KFV A;  3OYB A;  1AD5 A;  1CKA A;  2GFA A;  3M9Q A;  5D7U A;  3VS0 A;  1QWF A;  5CKD A;  1VQM A;  3CCQ T;  2K57 A;  2QQS A;  4A53 A;  1VQ4 A;  5KCH A;  4F7U F;  2OI3 A;  3CD6 T;  1NYG A;  1YHQ A;  4OMQ A;  2EJG A;  2FPE A;  3VRY A;  2JMA A;  1OZ3 A;  4XTX A;  4JZ4 A;  1IHV A;  1VQO A;  3EFO A;  4IUU A;  2DIL A;  2QQB A;  2JXB A;  1YN8 A;  2NUT A;  4A4H A;  1NJI R;  3X24 B;  5GAN e;  1V29 B;  1PRL C;  3CXC A;  7AT1 B;  1LVK A;  2CZ0 B;  5GAN 7;  2DKG A;  1H3H A;  5DM7 R;  2OTL A;  5IHK A;  1Z9Q A;  2PVO B;  4RMO A;  3V8K A;  2PVG B;  1WHL A;  2A08 A;  4HT9 A;  1WFW A;  4RTW A;  3M0T A;  3EH1 A;  3SWN B;  4UC4 A;  3DLL A;  3RMS A;  2CT4 A;  2EBP A;  3H9N A;  3CCU Q;  2CP7 A;  1G8X A;  2LCL A;  1D0Y A;  4PJO A;  2RJC A;  3M0R A;  3C0C A;  2OTJ Q;  3CCR A;  1M1K U;  2FRW A;  4J83 A;  2JNG A;  4M77 B;  1NM7 A;  2NUZ A;  1X6B A;  2MOX A;  4AG2 C;  2R5M A;  3JB9 D;  2JTM A;  2R58 A;  2L3P A;  5IXB A;  2DTI A;  3MEU A;  3GNG A;  1Q86 C;  1NPP A;  4MDW A;  3EFS A;  3E9F A;  2YUQ A;  2LTO A;  3H0H A;  1LOJ A;  3H0I A;  2F2X A;  3O5Z A;  4HA8 A;  4J9G A;  1FWZ A;  3A98 A;  2E64 A;  3FLG A;  4C8Q G;  3OY9 A;  2ZPI B;  5IN1 A;  4Z88 A;  2CUD A;  1RAE B;  3CCL A;  2JOY A;  3Q1J A;  3CME T;  2K3Y A;  4MZT A;  3VJP A;  5GAN 6;  2MWP A;  2V1Q A;  3VUZ A;  2AKL A;  1K9M C;  3V7R A;  2BZX A;  2RN8 A;  5HY6 A;  2EQM A;  2GF7 A;  3M58 A;  4RTZ A;  1VQ6 A;  3M56 A;  2KE9 A;  4VUB A;  1SF9 A;  4ESR A;  1JEG A;  1H92 A;  5KYU B;  4QVD A;  3CD6 Q;  5KYX B;  2KAF A;  2JTF A;  5EG2 A;  4FSS A;  1RAD B;  2KSS A;  2HQH A;  1MMD A;  1D1A A;  1TU0 B;  1QVF P;  3CMA A;  4PJL A;  3CXC P;  5IXF A;  2GFU A;  3PVQ A;  1FMV A;  3QZ5 B;  4RG2 A;  1I8F A;  4OF1 A;  4ZGD B;  2D1X A;  1VQP Q;  1C0M A;  2XIC A;  3CBM A;  3LGF A;  2GNC A;  4LD9 K;  2COY A;  5GJV B;  4QW2 A;  1TUD A;  2OX7 A;  1UE9 A;  2VUB A;  4M7D E;  2LCS A;  1XNI A;  5HK0 A;  4C8Q D;  3VKI A;  4LUE A;  2QEX T;  1GBR A;  2CZ6 B;  2W0Z A;  2DFU A;  2K3B A;  5A0D A;  2ECZ A;  1VQ9 Q;  3A8H B;  3LWI A;  3OA6 A;  1Q7Y R;  1IO6 A;  2RM4 A;  3OSV A;  5I11 A;  2LX7 A;  3CQT A;  1G83 A;  3CEY A;  3BY7 A;  2KR3 A;  1UGR B;  2XDP A;  1YIT Q;  3H6Z A;  4F16 A;  2FO0 A;  1GCP A;  3RES A;  1YWP A;  4CC2 A;  1OUL A;  4E2F B;  4C92 B;  5KYW A;  1VQK A;  3M59 A;  1A0N B;  4C0F A;  2DRK A;  1ZUK A;  2E5Q A;  2RQT A;  1QKW A;  2Z0W A;  1N5Z A;  2E3I A;  2HCK A;  5LL6 S;  2M0O A;  4Z89 A;  1QCN A;  4M75 G;  1TUG B;  3BE3 A;  2O9S A;  5FRM A;  2BZ8 A;  3M4G A;  2EQK A;  9ATC B;  1D0X A;  2V8J A;  2MPX C;  2EQJ A;  1WJS A;  4C8Q C;  3X28 B;  3L42 A;  2QYZ A;  2P4T A;  2SEM A;  1BBZ A;  3EG0 A;  5FW9 A;  3OW2 A;  4J6Y A;  4GLM A;  3I56 T;  2JMC A;  2MF2 A;  3RIR A;  2O9V A;  2M0Y A;  2LT1 A;  1VYT A;  5GAN h;  2JS0 A;  1UHF A;  2KRS A;  1YWO A;  4NL2 A;  4M7D B;  2K9G A;  4BE0 A;  5D6X A;  2DEQ A;  2PTK A;  1VQN A;  3SFM A;  2Y4Y A;  5CKB A;  3OYN A;  1SRM A;  3V8L A;  4M7A G;  2X4X A;  3KUF A;  4OB0 B;  4PFZ A;  1WNL A;  1PCX A;  2L3S A;  2YWW A;  4OMF B;  1WYX A;  2XKO C;  4LDX A;  3G4S T;  1WGS A;  1LPL A;  1PM3 A;  4QKU A;  3TU4 K;  3C12 A;  3MEA A;  3CCV A;  4C8Q F;  2DK3 A;  2XG8 D;  3CC2 A;  5GAN j;  2AT1 B;  1NE8 A;  4E7L A;  5KYY A;  3JCM d;  1W2B P;  5GAO m;  2G6F X;  3RKY A;  4D8K A;  3A8O B;  4RKU E;  3CXC S;  2ZAE A;  1VIF A;  5KCO A;  2QEX Q;  2WSC E;  1OQK A;  1UEB A;  4M75 D;  2QAS A;  4J9F A;  4GBQ A;  1M90 C;  4J9H A;  2V26 A;  2JTE A;  2K4Y A;  2VAS A;  2VGM A;  1TSF A;  3CCS A;  3CCE T;  2HBW A;  1BCM A;  3TSW A;  4IUQ A;  8AT1 B;  3M0Q A;  4BD3 A;  1OPL A;  1VQ5 Q;  5L23 A;  2EYY A;  2D0Q B;  2PU9 B;  4XTU A;  4JDS A;  3OS1 A;  1MND A;  1W4S A;  1AWX A;  4PK4 A;  5LJ3 d;  1JB0 E;  2KRO A;  1D1B A;  1JJ2 S;  1IGQ A;  2DZ9 A;  1M8V A;  3GP8 A;  5GAO l;  1Y96 B;  1H64 1;  4ZGE B;  1OU9 A;  5IHI A;  5CQX A;  1GL5 A;  1KC8 C;  4M7A D;  1UB4 A;  3CPW A;  3HTR A;  1AWW A;  1IZ6 A;  1M27 C;  2RJE A;  1KD1 C;  2KK4 A;  2H8H A;  2IVW A;  3NTK A;  5I21 A;  3A8M B;  5A0L A;  3QWY A;  4JUV A;  1RAI B;  4OVA A;  2I0N A;  2P4R A;  4RCC A;  3CBO A;  1YFN A;  3CC4 T;  2OAU A;  1OX8 A;  3OW2 P;  3G6E A;  2HMA A;  4C5I A;  2KY9 A;  4M75 C;  1ABQ A;  2YT6 A;  3OYL A;  2DXB A;  2I2L A;  2PQW A;  3J81 E;  2DTO A;  3CC7 T;  2QAZ A;  1VOM A;  2EYQ A;  2AK5 A;  1D3B B;  2DPP B;  4NL3 A;  2EQU A;  3ZL7 C;  4EMK B;  4L5G A;  4KRT A;  4E7Z A;  2FZG B;  4M4Z A;  3N5B B;  1VQ7 T;  1M2V A;  1KJW A;  4M7A A;  4QQD A;  2LNV A;  3DKM A;  2XI9 A;  1U06 A;  3OYI A;  1IRE B;  3G4S Q;  2K2V A;  1NJI U;  2ED0 A;  1YIJ A;  3QWX X;  3LX7 A;  4M7A C;  1OZ2 A;  2KDS A;  3JAM E;  3NTI A;  4R56 A;  2LX9 A;  3CCM A;  3QII A;  4AFU C;  1N9R A;  3CPF A;  4PJM A;  1KQ1 A;  2LRQ A;  4M75 F;  2DAQ A;  5GAM h;  4K11 A;  1I81 A;  1XJW B;  5HCK A;  1S72 A;  1SRL A;  2XDB A;  4FYX B;  4Z02 A;  1R8O B;  5AYF A;  2RK2 A;  2GCX A;  1VQL A;  2RHX A;  4HCC A;  1M5Q 1;  2BIV A;  1M3B A;  4FL6 A;  2LQK A;  5LJ5 d;  1BIA A;  2RMO A;  3CCE Q;  1WHJ A;  5AT1 B;  3JCM X;  3EG2 A;  4E7K A;  1G3S A;  5HKC A;  4JRP A;  2LQ8 A;  4JJB A;  4AFZ C;  3A5Z B;  3CCU T;  5LJ5 f;  3REB B;  5FRO A;  2WSF E;  5GAM g;  4AFS C;  4C0D B;  4C0G A;  5GAM j;  5GAO n;  4M7A F;  2W10 A;  2FHD A;  3A8G B;  1YI2 Q;  2HNI A;  2ROL A;  1TH7 A;  1HJD A;  2X4J A;  3OMG A;  1UUE A;  3EHR A;  3LWH A;  1WHK A;  2IG0 A;  4DBF A;  2ATC B;  3CPW P;  4ZN3 A;  1K8A C;  3MPU B;  2NUP A;  2H3J A;  1EX4 A;  3J80 E;  3P8H A;  1SHG A;  4F7U A;  3CCJ T;  3EH2 A;  2K79 A;  2HQE A;  3FC3 A;  4M77 G;  2DJQ A;  2QGF B;  3G7Z A;  1ABO A;  5GAN d;  3M57 A;  4R0K A;  1WQ7 A;  4PJO E;  2BE7 D;  3GNF B;  1M1F A;  1NEB A;  1NYF A;  3A8L B;  2XK0 A;  4IIM A;  3MP8 A;  3EHQ A;  4O5V A;  1ZSZ C;  2E10 A;  3HFN A;  4JJC A;  1VIE A;  5GAN f;  1JRI A;  3G1J A;  2RO0 A;  4KH1 B;  1PD1 A;  1WPY A;  3OYF A;  2YUP A;  2OTL T;  3PVL A;  2O4X A;  4Y91 A;  4HCZ A;  3H41 A;  3QHS A;  2AIR B;  1VQ8 A;  3C95 A;  2E6Z A;  2MWO A;  3VRZ A;  3EG3 A;  2RA2 A;  4PL6 A;  2LDM A;  3OYE A;  1X27 A;  1GXI E;  2ROT A;  2A37 A;  2CS7 A;  2KI7 A;  2D9T A;  3QZ9 B;  4LDW A;  4Q5W A;  4B9W A;  2QTV A;  4J6W A;  1VQ7 Q;  4JS5 A;  5CVI A;  3L2V A;  1AZG B;  2MCN A;  4KGX B;  1X2K A;  2P0Q A;  5I2M A;  3EFO B;  1PKT A;  3EG1 A;  4IUT A;  3FDR A;  3OS0 A;  2EYX A;  3EFR A;  1H8K A;  4HCK A;  1ZUY A;  3GLX A;  8ATC B;  1QVF A;  1KHI A;  2E5K A;  2KQW A;  4DBQ A;  1WHH A;  2QK0 A;  3VS1 A;  1K73 C;  1UJY A;  4OGE A;  1LJO A;  1VQP T;  1BI3 A;  1UJ0 A;  4M77 D;  5CO7 A;  3VS7 A;  4QQG A;  3UWN A;  1UG1 A;  2QA4 Q;  3S3O A;  1AEY A;  2XDD A;  4Z8A A;  4PJO B;  4Y92 A;  2DL4 A;  2KYM A;  4J7F A;  1BU1 A;  3BFM A;  1WXU A;  1BIB A;  2RJD A;  4P5N A;  2M02 A;  3H8Z A;  2KXD A;  1Q7Y U;  1MUZ A;  2L8D A;  4MMK A;  3JCM P;  2AHJ B;  1VQ9 T;  4OML A;  4GY5 A;  4OB3 B;  4PLL A;  5GAO p;  4J9D A;  4LDY A;  2JM8 A;  4OGC A;  1PSF A;  4FM4 B;  4XQ3 A;  3V7S A;  1YIT T;  4V2S A;  2F1L A;  1E6G A;  3SWN A;  1YJ9 T;  3CCQ A;  1VQ6 T;  1VQM Q;  2DXT A;  1UGS B;  4BI8 B;  3ZFJ A;  3QO3 A;  3SWN C;  3CCJ Q;  2L5Q A;  3QG1 A;  3CD6 A;  2EW3 A;  1XTD A;  4ORZ A;  2PUO B;  3V8J A;  2VVK A;  3PTA A;  2FZK B;  1YHQ Q;  1N8R C;  2QI2 A;  1TOV A;  2COZ A;  4MDX A;  4ME7 A;  1Q81 U;  2DXU A;  3VV0 A;  4J6X A;  3UPU A;  2CGH A;  4M77 A;  1DJ7 B;  4BDY A;  3RNJ A;  4C92 G;  3CPW S;  1GCQ C;  1TXQ A;  2X9H A;  2P0K A;  1E6H A;  4IUP A;  4M77 C;  3HPW A;  5GAN 4;  1NBE B;  4FIB A;  2E6N A;  2MYS A;  2JM9 A;  2YXY A;  2DBM A;  2OTL Q;  4LNP A;  1IB8 A;  3SHW A;  1LCK A; 
#chains in the Genus database with same CATH homology
 1UGV A;  4RUG A;  3UF4 A;  1PHT A;  2KYB A;  2L0A A;  2L3Q A;  2VWF A;  2SEM A;  1BBZ A;  2GTJ A;  3EG0 A;  5FW9 A;  4RTV A;  4GLM A;  2JMC A;  2O2O A;  2JW4 A;  1QCF A;  1T3S A;  4CC7 A;  2O9V A;  2M51 A;  1BK2 A;  2M0Y A;  1VYT A;  2A28 A;  2JS0 A;  1UHF A;  1UHC A;  1YWO A;  2KRS A;  3SEM A;  2KEA A;  1K4U S;  2K9G A;  2GGR A;  2PTK A;  4AFQ C;  1SRM A;  2OJ2 A;  2LQW A;  1K9A A;  4CC3 A;  1WI7 A;  2DBK A;  1I1J A;  2YUO A;  2FPF A;  3R6N A;  2L3S A;  4LN2 A;  2J6F A;  3GBQ A;  2DF6 A;  2RQW A;  3M0P A;  1WYX A;  4JZ3 A;  2DE0 X;  4J9I A;  2K2M A;  2DYB A;  1QWE A;  1X2Q A;  4EIK A;  1WDX A;  4HXJ A;  4CC4 B;  3I5S A;  3I35 A;  2LJ3 A;  2AKK A;  2LQN A;  2G6F X;  2ED1 A;  4IIO A;  4D8K A;  2GQI A;  1K0X A;  1I0C A;  1KFZ A;  1NEG A;  2DL7 A;  2X3X D;  2D8J A;  4J9C A;  1VA7 A;  1UFF A;  4J9F A;  4GBQ A;  1X43 A;  2EKH A;  1WX6 A;  4J9H A;  2DX1 A;  2JTE A;  3TVT A;  3FJ5 A;  1AWO A;  1CKB A;  1OEB A;  1JXO A;  1SSH A;  3NGP A;  2BZY A;  2HBW A;  1B3Q A;  3TSW A;  1RLP C;  4HVV A;  2EVR A;  3M0Q A;  1OPL A;  2CRE A;  4DEY A;  1Y57 A;  2EGC A;  5L23 A;  2DM1 A;  2EYY A;  1WLP B;  2ABL A;  4X1V A;  1UDL A;  2RNA A;  1AWX A;  2KRO A;  2OAW A;  1ZSG A;  2YSQ A;  3UAT A;  2KXC A;  1PKS A;  2EYZ A;  1JXM A;  1T3L A;  1CSK A;  2DVJ A;  5IHI A;  1PWT A;  1RLQ C;  1GCQ A;  3THK A;  5IHN A;  1GL5 A;  2FG0 A;  2VKN A;  1AWW A;  1M27 C;  2GTO A;  1X6G A;  2KGT A;  2KNB B;  1V1C A;  2H8H A;  3QWY A;  2YUN A;  2HSP A;  2LZ6 B;  3U23 A;  1AOJ A;  2O31 A;  2I0N A;  5I22 A;  5ECA A;  2P4R A;  2D0N A;  2LJ1 A;  2ENM A;  1EFN A;  2QDL A;  1M3C A;  1ABQ A;  3PE0 A;  1SHF A;  1JQQ A;  1OV3 A;  5FWC A;  2YT6 A;  2NWM A;  5EC7 A;  2FPD A;  2CSQ A;  2CSI A;  1T0J A;  1KIK A;  2EYW A;  2V1R A;  2AK5 A;  2F2V A;  2PNI A;  1OOT A;  2DL5 A;  4J9B A;  2RQV A;  1JU5 C;  1UEC A;  1QLY A;  2KRM A;  3UA6 A;  1WXT A;  3ZL7 C;  2K6D A;  4OMP A;  1Y0M A;  3KFV A;  4KRT A;  2J6O A;  1AD5 A;  2DLP A;  1GBQ A;  1CKA A;  2DNU A;  3VS6 A;  1T0H A;  1ZX6 A;  1QWF A;  3VS0 A;  4M4Z A;  4E6R A;  1MV0 B;  1NG2 A;  3UA7 A;  3I9Q A;  5GJW B;  1KJW A;  2FEI A;  1U06 A;  2OI3 A;  1NYG A;  2ED0 A;  1ARK A;  3QWX X;  2CH4 A;  4OMQ A;  2CT3 A;  2FPE A;  3VRY A;  2JMA A;  1QKX A;  4JZ4 A;  1K0S A;  4AFU C;  1TUC A;  2DIL A;  4K11 A;  2JXB A;  1YN8 A;  1AZE A;  5HCK A;  1SRL A;  4HVU A;  4RTT A;  2K7A A;  1M3A A;  1GRI A;  2X3W D;  1PRL C;  3ULR B;  4F14 A;  1H3H A;  1K1Z A;  1B07 A;  5IHK A;  1Z9Q A;  2RF0 A;  2DL3 A;  1OPK A;  2A08 A;  2FRY A;  1WFW A;  1M3B A;  4RTW A;  3M0T A;  2RMO A;  4J9E A;  1SEM A;  2CDT A;  2DL8 A;  1M8M A;  3EG2 A;  4JJB A;  4AFZ C;  2CT4 A;  2EBP A;  4RTX A;  3REB B;  1GFC A;  4AFS C;  3M0R A;  2W10 A;  3C0C A;  1YCS B;  2ROL A;  3REA B;  1HJD A;  2FRW A;  4ZNX A;  1UUE A;  3EHR A;  4RTY A;  1NM7 A;  2NUZ A;  1X6B A;  2KRN A;  2XMF A;  2MOX A;  4AG2 C;  2L3P A;  5IXB A;  1W70 A;  2C0T A;  2DA9 A;  2EGE A;  3H0F A;  1SHG A;  2YUQ A;  2K79 A;  2HDA A;  1W6X A;  2DJQ A;  3H0H A;  1ABO A;  3H0I A;  3JV3 A;  2F2X A;  3O5Z A;  4R0K A;  3NPF A;  3LH5 A;  4J9G A;  1U3O A;  2KT1 A;  2LP5 A;  3A98 A;  1NEB A;  1NYF A;  2RPN A;  2BTT A;  3EHQ A;  4HVW A;  4IIM A;  1JO8 A;  4Z88 A;  2CUD A;  4JJC A;  2LNH B;  2RQR A;  2YUP A;  3PVL A;  3H41 A;  1UTI A;  4QT7 A;  3VRZ A;  1KSW A;  2DMO A;  1GFD A;  2V1Q A;  3EG3 A;  3RBB B;  2AKL A;  1X27 A;  1NLO C;  2ROT A;  2A37 A;  2BZX A;  2MIO A;  2RN8 A;  1NLP C;  2LJ0 A;  3EGU A;  4OMM A;  1W1F A;  4RTZ A;  2KE9 A;  2RQU A;  1JEG A;  1H92 A;  4ESR A;  1WA7 A;  1AZG B;  2AZV A;  1ZLM A;  2MCN A;  1RI9 A;  4JPB W;  4F17 A;  2L2P A;  1X2K A;  1YNZ A;  2LMJ A;  2F2W A;  3VS5 A;  1XOV A;  1MV3 A;  1PKT A;  2C0O A;  1K76 A;  1Z9Z A;  4FSS A;  3EG1 A;  1X69 A;  2JS2 A;  4RTU A;  5IH2 A;  1VYV A;  2EYX A;  1H8K A;  4JJD A;  4HCK A;  1ZUY A;  4AG1 C;  2HEQ A;  2EQI A;  2ESW A;  5IXF A;  1FMK A;  3PVQ A;  2DRM A;  2E5K A;  4WCI A;  5FWB A;  2KT8 A;  3VS1 A;  2J05 A;  1UJY A;  1WIE A;  1HSQ A;  2D1X A;  4LE9 A;  1E7O A;  1UJ0 A;  4A63 B;  1M30 A;  2GNC A;  1ZBJ A;  2GBQ A;  3VS7 A;  1HD3 A;  5GJV B;  1TUD A;  1UG1 A;  1UE9 A;  1AEY A;  4Z8A A;  2LCS A;  4Y92 A;  1AWJ A;  2DL4 A;  2KYM A;  1BU1 A;  3NMZ C;  1WXU A;  4LUE A;  2A36 A;  1GBR A;  1VYU A;  2KXD A;  2AZS A;  2W0Z A;  1SPK A;  1MUZ A;  3I5R A;  2YDL A;  2PZ1 A;  2K3B A;  2ECZ A;  4OML A;  2EGA A;  1I07 A;  2CUB A;  2JT4 A;  4OMN A;  3M0U A;  2J6K A;  4J9D A;  1IO6 A;  2JM8 A;  4DEX A;  5I11 A;  2LX7 A;  3CQT A;  1G83 A;  2B86 A;  2SRC A;  3IQL A;  2D8H A;  2KR3 A;  1E6G A;  4F16 A;  2FO0 A;  1GCP A;  1YWP A;  1YP5 A;  1S1N A;  4CC2 A;  1J3T A;  2EPD A;  2EW3 A;  1FYN A;  2CH4 W;  2KBT A;  4ORZ A;  1A0N B;  2J06 A;  2J7I A;  4LUD A;  2VVK A;  3VS4 A;  2DRK A;  1ZUK A;  1G2B A;  2RQT A;  1QKW A;  2O88 A;  4OMO A;  1N5Z A;  1PNJ A;  1BB9 A;  2C0I A;  2HCK A;  3TSZ A;  1AVZ C;  3VS3 A;  1PRM C;  1WXB A;  3RNJ A;  1RUW A;  4Z89 A;  1GCQ C;  2IIM A;  4D8D A;  1E6H A;  1U5S A;  1ZUU A;  2O9S A;  2BZ8 A;  2JM9 A;  3NHN A;  2DBM A;  3M0S A;  4LNP A;  3VS2 A;  3SHW A;  1LCK A;  1TG0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...