1WXUA

Solution structure of the sh3 domain of mouse peroxisomal biogenesis factor 13
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
93
structure length
93
Chain Sequence
GSSGSSGTNWASGEDDHVVARAEYDFVAVSDEEISFRAGDMLNLALKEQQPKVRGWLLASLDGQTTGLIPANYVKILGKRRGRKTIESGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords peroxisomal biogenesis factor 13
publication title Solution structure of the SH3 domain of mouse peroxisomal biogenesis factor 13
rcsb
source organism Mus musculus
molecule tags Protein transport
total genus 7
structure length 93
sequence length 93
ec nomenclature
pdb deposition date 2005-02-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14604 SH3_9 Variant SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 1wxuA01
1T3LA 2D8HA 4ORZA 2JW4A 1W1FA 2P4RA 3REAB 2LX7A 2J6KA 1ZLMA 1UG1A 2YUOA 1ABOA 4F14A 1QKWA 2DBMA 4ESRA 4J9HA 1SPKA 4CC4B 2YUPA 1GFDA 1QLYA 2SRCA 1QWFA 2HCKA 2KGTA 4RTUA 2JS2A 2G6FX 2EGAA 2GGRA 2M0YA 4J9GA 1S1NA 2LQNA 3UF4A 4AFUC 2XMFA 1ZUKA 4RUGA 3KFVA 2C0TA 3R6NA 1GL5A 2KRSA 4AFSC 4HCKA 2HBWA 1UHCA 5FWCA 2DILA 1YNZA 1UECA 3VS7A 2AK5A 1WDXA 3QWYA 2YDLA 1GCQA 5HCKA 2DJQA 1YWPA 2H8HA 1BBZA 1WFWA 1AD5A 4RTXA 2A28A 1OPLA 3EHQA 1CKBA 3UA6A 1WIEA 2KEAA 1UUEA 2LQWA 3VS4A 4JPBW 4RTVA 2VKNA 2DLPA 2JT4A 1B07A 1Z9ZA 1UGVA 2KROA 2GTOA 3NMZC 2OJ2A 4DEYA 1GBRA 2CUDA 2DF6A 3NHNA 4J9DA 5L23A 2VVKA 2DX1A 5IHKA 3I5RA 1AWJA 4Y92A 5IHIA 2EYXA 2PNIA 1U3OA 2DVJA 2JMCA 2HEQA 1OEBA 2LNHB 1BK2A 2YUQA 1UJYA 1XOVA 2AKLA 2AZVA 2W10A 4Z88A 4F16A 3C0CA 4A63B 1NM7A 1AWOA 1QKXA 2DRMA 2B86A 3ULRB 2KT8A 2KXCA 3EG0A 4CC3A 1K4US 1M3BA 1M27C 1AWWA 2EW3A 3CQTA 1U06A 1OOTA 2CREA 5GJVB 1ARKA 2ESWA 2F2VA 2LJ0A 3VS1A 1EFNA 2L2PA 2YSQA 2DA9A 4RTTA 1UTIA 1WX6A 4OMMA 1FYNA 1BB9A 1JXMA 2O9SA 2YUNA 2I0NA 2FPFA 3QWXX 1JEGA 5GJWB 4CC2A 5EC7A 1GBQA 1JO8A 2J6OA 1K1ZA 2KYMA 2RF0A 2GBQA 4CC7A 2K7AA 1M8MA 4FSSA 2KNBB 2BZYA 1SRMA 1YP5A 4OMOA 2JXBA 2J6FA 1QWEA 2KRMA 1ZSGA 1UJ0A 4JJCA 1JQQA 1GFCA 2J05A 2EPDA 3VRZA 2VWFA 3FJ5A 1X2KA 4KRTA 2FO0A 2FPDA 2X3XD 2O31A 2RNAA 3RNJA 1WYXA 2L3PA 2LMJA 2D1XA 2LZ6B 1V1CA 1X6BA 2ED0A 2E5KA 1AEYA 1UDLA 4LUDA 4J9FA 3NPFA 4GLMA 1ZUUA 1AWXA 2FEIA 4M4ZA 4E6RA 1MUZA 1AZGB 3TSWA 2FRWA 1PHTA 1M3AA 1OV3A 2CH4A 2KT1A 1I07A 1MV0B 2CH4W 2C0IA 2EYYA 1HJDA 1W70A 5FW9A 2K3BA 1PKTA 1NG2A 5IXBA 5FWBA 1UFFA 1K9AA 1GCPA 3EG2A 1T0HA 2RQUA 2IIMA 4J9EA 2KXDA 3M0TA 1W6XA 2LCSA 1G83A 2O88A 2KE9A 1JXOA 3M0UA 2YT6A 3VS3A 1Y57A 2O9VA 3EG1A 4JJDA 1AOJA 4D8KA 4HVUA 5I11A 2NUZA 2LJ3A 1H8KA 2DL8A 3EGUA 4HVWA 1KIKA 1TUDA 2CSIA 2OI3A 2V1QA 2A37A 2RQWA 1I0CA 2JMAA 1GCQC 2K6DA 4OMLA 1CSKA 4LNPA 2W0ZA 3TVTA 1AVZC 2K2MA 4HXJA 2LP5A 3I9QA 4OMNA 2K9GA 1HD3A 2L3SA 4Z8AA 4K11A 4J9CA 1J3TA 3THKA 2QDLA 1X43A 2CSQA 2A08A 4J9BA 1GRIA 4QT7A 3H0HA 1IO6A 3H0IA 3GBQA 1WI7A 2AKKA 2DMOA 2RQVA 1X27A 1RUWA 1SHFA 1VYVA 2M51A 2EBPA 1K0XA 1PRLC 1WXBA 1YCSB 3VS0A 1FMKA 2OAWA 1KJWA 2GNCA 1HSQA 3LH5A 2RPNA 4JZ4A 2X3WD 2DNUA 2GTJA 4DEXA 1NYGA 3IQLA 1VYUA 3NGPA 2CT3A 1PRMC 2MOXA 1CKAA 3VS2A 2O2OA 1QCFA 2D0NA 1TG0A 2J06A 1WXTA 2EGEA 2FRYA 5IHNA 1E6HA 1H92A 1NLOC 1ZUYA 2DBKA 2RQTA 3M0SA 2ED1A 3REBB 2RMOA 3SHWA 1H3HA 1NLPC 2SEMA 1X2QA 4RTYA 1PWTA 3EHRA 2J7IA 4ZNXA 4LE9A 2DL3A 5IH2A 1OPKA 2V1RA 1WA7A 1BU1A 1LCKA 2EKHA 2C0OA 3PE0A 2JS0A 2BZ8A 2KRNA 1MV3A 2HDAA 2L0AA 1NEGA 4EIKA 2K79A 1U5SA 4Z89A 1VA7A 2AZSA 1NYFA 2HSPA 1B3QA 4RTZA 4F17A 2PTKA 5ECAA 1K0SA 2F2WA 4AFQC 2CDTA 1RLQC 1SEMA 1KSWA 1JU5C 1SHGA 1UHFA 4LN2A 1ABQA 4OMPA 2D8JA 2DE0X 2NWMA 3M0RA 4AG2C 2FPEA 1RI9A 3TSZA 1E7OA 5I22A 2DYBA 1SSHA 1T0JA 1G2BA 1T3SA 2L3QA 3UA7A 1N5ZA 1YN8A 1M3CA 1X69A 1E6GA 1PKSA 2DL4A 1SRLA 2EVRA 1NEBA 1KFZA 3VRYA 3EG3A 2KBTA 4D8DA 1Y0MA 2MIOA 2DL5A 3RBBB 2PZ1A 4LUEA 1RLPC 1A0NB 4RTWA 3UATA 2BTTA 4AFZC 3PVLA 1X6GA 4GBQA 2FG0A 2DM1A 2CT4A 3O5ZA 1TUCA 3H0FA 3VS5A 2ENMA 1Z9QA 4IIOA 2A36A 1M30A 2DL7A 2LJ1A 4J9IA 2KYBA 1K76A 5IXFA 2GQIA 3ZL7C 1PNJA 2JM8A 1ZX6A 4JZ3A 3I35A 2MCNA 1I1JA 3M0QA 2RQRA 2ROLA 2ABLA 4X1VA 2F2XA 3PVQA 3I5SA 3U23A 1WLPB 2DRKA 3JV3A 2JM9A 2RN8A 1VYTA 2EGCA 2EYZA 1YWOA 2JTEA 2KR3A 4WCIA 4AG1C 4R0KA 1AZEA 2EYWA 4HVVA 4OMQA 2BZXA 1WXUA 3SEMA 2ECZA 1ZBJA 3VS6A 1UE9A 2ROTA 3A98A 2CUBA 4IIMA 3M0PA 3H41A 2EQIA 4JJBA
chains in the Genus database with same CATH superfamily
2CYZB 2JW4A 4BD3A 1QVGA 3OYKA 3ZEHA 1ABOA 4OB2B 3CCRA 5KYNA 1MGQA 3M9QA 4J9HA 2DTIA 3CC4T 4C8QB 2PUOB 3S3NA 1JRIA 1QLYA 2L3RA 2SRCA 2XIDA 1FXXA 2KGTA 3EAEA 4M78B 4NS5A 4QQGA 1S1NA 4PJOC 5GAOq 1BKBA 2X4JA 3CMEA 3JB9G 4XTXA 1NE8A 2DILA 3VS7A 2AK5A 1TWBA 1WDXA 3PT9A 2YDLA 3OQ5A 2DJQA 1YWPA 2DFUA 3M4YA 3CC7A 4B9XA 4RTXA 2A28A 3CXCP 2P84A 3EHQA 3UA6A 3CCJQ 2MMPA 3JB9I 2VASA 3CCUQ 2LQWA 3VS4A 1GXIE 4RTVA 1D0XA 3OYFA 4LD9K 1YIJT 3QJ6A 1RL2A 1Z9ZA 2DAQA 2GTOA 2CUDA 2DF6A 1VQ5A 4OP0A 1KD1U 3OA6A 2DXBA 4C92B 8AT1B 4Y92A 1Q86U 4M7AF 3LWIA 1SSFA 3A5ZB 1XJWB 3E9FA 3NTKA 3C0CA 1VQ9A 5D6YA 1QKXA 2DRMA 3URGA 1X75C 3QSUA 3CCEA 3CXCS 2MI6A 4MMKA 3ULRB 3MEWA 4QQDA 5KYXB 5LJ5e 1NJIR 3LH0A 2EKOA 2HSEB 3CCSA 3L2ZA 1M27C 2RJDA 3S3MA 1B7TA 3CQTA 4C8QA 1YI2Q 2CREA 2RH2A 5GJVB 3OW2S 1HK9A 2QQAA 4M78A 3VS1A 4KT0E 4A4KA 4BE1A 1EFNA 2L2PA 1FYNA 1ZA2B 1YJWA 4DBFA 2O9SA 5I21A 1BIBA 3CPWA 1VUBA 1RAAB 4CC2A 5EC7A 1JO8A 3L2WA 1M5Q1 1K1ZA 2RF0A 4C92D 2OTJQ 2KAFA 1XTDA 2K7AA 2BUDA 4B9WA 2BZYA 2QQBA 1VQ8T 1SRMA 4UC4A 5LJ5f 2E3HA 4FYYB 5LJ3e 2DEUA 2J6FA 3UT1A 1NJIC 4RKUE 2K5IA 4M7DF 1H3ZA 2HL3A 1M1KR 3OYIA 2KY9A 1IGQA 1JQQA 1ACMB 5AYFA 5CQXA 2EPDA 3GIBA 2VWFA 3TREA 3FC3A 2QA4A 2LX9A 4P5NA 1U1TA 2OX7A 1VQLT 2L3PA 4C92A 1X6OA 1X6BA 1UGQB 4KH0B 3M59A 2ED0A 4C0DC 5IN1A 2CKKA 3EH1A 5GAN6 2H3EB 3DLMA 1N9SA 3NPFA 5FU7B 3MEAA 5LJ3h 1ZBXA 3EFRA 4BI3A 5KYXA 3OSSC 1PHTA 1FWZA 2JVVA 4DA4A 4IUTA 2CH4A 2KT1A 4LXCA 1MV0B 4RCBA 1M1KC 4PJOB 3OYHA 1PSFA 1C1AA 1PKTA 5FWBA 1UFFA 1K9AA 5IT9E 2XI9A 3EG2A 2IIMA 2WACA 1IXDA 4JS5A 3JB9H 4FYXB 1W6XA 1G83A 3M5AA 3CCMA 3EG1A 3BY7A 2M1HA 3OS5A 3CC4Q 4QVDA 5I11A 2LJ3A 1H8KA 2DL8A 4HVWA 2DEQA 3I55T 3JCMe 1VQ6A 4YTLA 3VUBA 1Q81U 4E7LA 3VU3C 3CC2Q 1GCQC 3META 4L59A 2RJEA 1WHJA 2W0ZA 4LNPA 5GAOn 3TVTA 4HXJA 2LP5A 5LJ5d 3EFSA 4PFOA 5KYWB 3FRNA 4K11A 1MNDA 1J3TA 1YBYA 3KUFA 1GRIA 1WI7A 2AKKA 2DMOA 4L6V5 1K0XA 2DETA 1WXBA 4RCCA 4O5VA 4KUIA 3EG9B 4M75D 1OULA 2OAWA 2WSFE 1HSQA 3JCMh 4JRIA 1JJ2P 2CP5A 2GTJA 3QPHA 4DEXA 1VYUA 3QDRB 1CKAA 3MKDA 1IHVA 3Q1JA 4FIBA 4HCBA 3R6OA 4F04B 1K9MU 1YITQ 2FRYA 5DLQE 2F1LA 1Q82R 3ZBDA 1E6HA 4PJOA 2QEXT 2DBKA 4FW2A 2R5AA 3SHWA 4IUUA 2X51A 1K73U 1NLPC 2FZKB 2SEMA 2HQEA 2J7IA 4LE9A 2DL3A 2V1RA 4OVAA 1KC8R 2EKHA 3PE0A 1D0ZA 1JJ2S 1YHQA 1K8AU 1BI1A 5A0LA 4EIKA 5KYUB 1UB4A 3QIIA 1Y7XA 2CP2A 1KD1R 5KYWA 2HSPA 4RTZA 3CD6T 2X4XA 3TEEA 4F17A 1Q86R 4AFQC 4BI4A 2RHIA 1Q7YR 4C0DB 1YJNA 1QQJA 3MPUB 1KSWA 1JU5C 1SHGA 2QYZA 2EYQA 2MF2A 1UHFA 3KXTA 3QJYA 1VQ8Q 1RAHB 2ZPEB 3V8JA 3JB9J 1WZOA 4O6JA 2NWMA 3CCLT 3EG9A 4MZMA 1KC8C 2CGHA 1T0JA 4IUVA 4LD6A 1PKSA 4M7AD 2DL4A 3FB9A 1VQLQ 4DOWA 3G6EA 3VRYA 4QKUA 1Y0MA 4XU2A 5CKFA 4A4HA 4PLIA 2DL5A 2P0PA 3RBBB 2YWWA 4E7HA 1I5LA 4LDWA 3T9NA 4KGXB 4RTWA 3UATA 2EQJA 3JCMP 4QVCA 3PVLA 3VS5A 1NBEB 3A1PA 2D9TA 3BDUA 3OS2A 1O9SA 2LJ1A 4J9IA 4FYVB 2KYBA 3X20B 2GQIA 4Z02A 2COYA 2YXYA 2PVDB 1OX9A 5GMKl 5HY6A 3QO3A 1TUGB 5KYUA 2DK3A 3FIFA 5FU6C 3LGLA 3CMET 3PVQA 5GAN3 4LDXA 2JM9A 2ATCB 2CZ0B 2WSCE 3NTHA 5EG2A 4EPCA 1KQSP 1OU8A 2KR3A 4WCIA 4AG1C 4R0KA 5I2MA 4HVVA 2HQHA 4OMQA 1YFNA 3D7SB 4OGCA 3OYAA 3CMAA 3FDRA 4KBMB 2E12A 1QMCA 3M0PA 3JRZA 4LDUA 2QDYB 2YHTA 1MMAA 3RMQA 3QZ9B 2D8HA 1BI3A 2P4RA 1ZLMA 5D6XA 1UG1A 2MWPA 1VQ5T 4F14A 1QKWA 2DBMA 2GQVA 4JS4A 2E5QA 2YUPA 3BFMA 4ATOA 1RAFB 3MJXA 5CKBA 3MEUA 1KQSS 3EH2A 1QVGP 3G4SA 4J9GA 3LLRA 3CCET 2DTOA 2XMFA 1G8XA 1NPRA 2E6NA 4PJLA 2ZPHB 1Q81R 2C0TA 1GL5A 4HCKA 1UHCA 5FWCA 1YNZA 3CCST 5D7UA 5CAIA 1GCQA 2QI2A 2LQKA 4MZPA 2RHYA 2QEXQ 1AT1B 4WF2A 1VQ4Q 5GANf 4LDVA 1WIEA 2KEAA 4FU6A 2E3IA 3JCMQ 1YJWT 4Q5WA 3G7ZA 1B34A 1UGVA 2LVMA 3FJPA 4DBQA 1QVGS 4PJNA 5LJ5j 3OYEA 5GAN4 3NHNA 4KUDK 2RA2A 2BKDN 2O01E 2DX1A 2ZPBB 3I5RA 2K5FA 3NTIA 2PNIA 2DVJA 2HEQA 2R5MA 3X24B 2YUQA 3WVEB 2AKLA 3CCVA 5HKCA 1BYMA 2DXCA 3CD6Q 1K9MR 1OZ3A 2B86A 2RO0A 4A53A 2ZCFB 2KQWA 2CZ6B 3F70A 2EQKA 3EG0A 1K4US 1RADB 3VJPA 3RR6A 2M02A 4ELZC 1ZHIA 1U06A 4M75G 1OOTA 1QVPA 2L5QA 4J6WA 2A0FB 2NYSA 2FZGB 2D6FA 4JDSA 2DA9A 4RTTA 4CI0C 5GANg 4OMMA 3C4SA 3E2UA 4FL6A 1BB9A 3VKIA 2YUNA 2FPFA 4M78E 4C0GA 3QWXX 1K8AR 1BCMA 2QTVA 5GAMf 5FU6B 2C06A 3AT1B 3QYGB 3ZFJA 2KRMA 4PKCC 3QKJA 1UJ0A 4XU3A 5FU7C 4JJCA 3CCMT 3CCRQ 1BI2A 1GFCA 5FRNA 3VRZA 2FL7A 2E70A 2FPDA 1S72A 5AT1B 4ZTJA 1WYXA 1VQ6T 4ZGEB 3CC2T 2LMJA 2LZ6B 4OB0B 1V1CA 2E5KA 3CMEQ 1AEYA 4M75C 1UDLA 4C92E 1KK7A 4GLMA 1ZUUA 4XU0A 1AWXA 2FEIA 1Y71A 2DYIA 1UGPB 2FRWA 3WVDB 3CPWS 2YRVA 4EMKA 5J26A 2EYYA 1W70A 1SF9A 1NG2A 5GAMg 3H9NA 3OYJA 4XU1A 3OW2P 2RQUA 3E1SA 1G5VA 4J9EA 3JB9F 4M7AG 2O88A 1VQ5Q 3M0UA 3VS3A 1Y57A 2O9VA 1AOJA 3P8DA 4E7KA 4X34A 3OS0A 1YITT 2E6ZA 3EGUA 1KIKA 3CBOA 4FYWB 1TUDA 2CSIA 2R57A 3SDZA 4HCZA 2JZ2A 1MMGA 2RI3A 1VQ9Q 4QW2A 1VQMA 1CSKA 3CCEQ 2K9GA 2L3SA 4J9CA 1X43A 5KH6A 3CCSQ 2CSQA 2K57A 4XQ3A 1YJ9A 2X35A 1IO6A 3UPUA 3MCAB 3GBQA 1YHQT 2HNIA 3RKYA 4BB7A 2RK1A 3CBPA 1RUWA 3V7CA 2M51A 1PRLC 3SWNA 2HL5C 3VS0A 3FLGA 4J6YA 1YJWQ 3E9GA 1NYGA 4FM4B 1PRMC 1VIFA 4PK4A 3M53A 2MOXA 4PNOA 1YJNT 2EJ9A 2ZGWA 4M77D 1QCFA 4M7AC 5LJ5h 3LW5E 1RAGB 1NLOC 1ZUYA 3M0SA 3BE3A 2RMOA 2CP7A 1PD1A 2K3XA 4PJOE 1XQHA 1H3HA 3OSVA 3LX7A 4JLGA 1TS9A 1X2QA 3EGXA 1OI1A 2QA4Q 1BIAA 1RACB 4M75E 1OPKA 2E65A 1LCKA 4F7UF 4X9DA 2XG8D 2C0OA 5GAN8 2H3JA 3G6ET 4CRIA 2ZPIB 3OYLA 2JS0A 2HQXA 4M77A 2BZ8A 2KRNA 2VC8A 3RDVA 5GMKm 2DPPB 4IUQA 2DD5A 5KCHA 2KVQG 2IPOB 2Y4XA 1D1CA 3PMTA 1NYFA 3L1AA 3MP1A 1B3QA 4JRQA 3A8OB 2PTKA 1K0SA 4J5YA 1PSEA 2E10A 4ANJA 1N8RR 2E1HA 4XK8E 5GMKe 1SEMA 4NL2A 4LN2A 4M75B 2FHDA 1ABQA 4OMPA 2D8JA 2DE0X 2EIFA 1R0CB 1M1FA 2X9HA 2FPEA 3GNGA 3TSZA 4C0ZA 1G3YA 5I22A 3OMGA 3GF5A 3CCMQ 3V8KA 1G2BA 3OMCA 1FMVA 2QASA 3QYHB 1E6GA 5GAOl 1QVFP 1VQ6Q 1BI0A 1NPPA 1KFZA 3V7SA 4KH1B 3JCMX 3CMAT 2M9UA 2JTMA 2Y90A 2ZPGB 2BE9B 3P8HA 4D8DA 4RMOA 2MIOA 3OYCA 1FX7A 1WJQA 4LUEA 4OF1A 1A0NB 1N8RC 2BTTA 2HZYA 3O5ZA 3H0FA 2MK5A 2ENMA 4IIOA 2LCLA 3HFOA 4Y28E 2QTXA 3INZA 4FW1A 2A36A 4JLIA 1G3TA 2EJGA 4M7AE 3BDLA 2DD4A 2RB6A 2MCNA 1TU0B 1QVFS 2ZZDA 3G4ST 2IG0A 3M56A 3HPWA 2ABLA 4X1VA 3SFMA 1OU9A 5LJ3g 3A8HB 5DLOA 9ATCB 1VYTA 3G71A 2EGCA 1C6VX 1M90U 1P92A 4AT1B 3CCQA 1C0MA 2JTEA 3MEVA 4NOYA 2BZXA 1YIJA 1VQ4T 4M75A 3SEMA 1TSFA 3MP8A 4BDYA 1M1GA 4BUGA 2KMTA 4IIMA 1AHJB 1T3LA 2MPXC 4M7AB 1PG5B 2D0QB 2LX7A 5CO7A 4BI8B 1YHQQ 4ESRA 3EGDB 1TOVA 5KCOA 1VQPA 3VUZA 4CC4B 1I5OB 2JN0A 1QWFA 3DB3A 4C5IA 2HCKA 3CCVT 4RTUA 2GGRA 1Q82C 3RESA 4IURA 2CP3A 1EIFA 2A3LA 1VQOA 1YJNQ 2KRSA 2HBWA 1N27A 2LNVA 1UECA 1MMDA 1QP2A 3X25B 5HCKA 1WFWA 1AD5A 2LT1A 4XTZA 3GOXA 1OPLA 5HK0A 3QZ5B 3DLLA 2O4XB 5GAN2 4XTYA 3JCMg 2JTFA 2PVOB 1PCXA 1D3BB 2DTHA 1WQ7A 4PLLA 3LWHA 3G6EQ 1ZA1B 3NMZC 2YRCA 4TVRA 4DEYA 4ME7A 4ELYC 2GFAA 1KD1C 3I56A 5L23A 3QBYA 2WSEE 4MMLA 1Q86C 2VGMA 4RG2A 4EMKC 5IHKA 1Q7YC 1OEBA 1G3WA 1UJYA 1XOVA 2W10A 4A63B 1NM7A 3CCRT 2A7YA 1AWOA 2HAXA 2CZ7B 1D1BA 4AMCA 4DBRA 4M7AA 4C8QF 4II1A 1VOMA 1S72T 2KXCA 4V2SA 2XKOC 1M9SA 4OGEA 4CC3A 3EGDA 3V8LA 4M78F 1AWWA 2EW3A 1M8VA 1PD0A 1QCNA 2V8IA 1B34B 1ARKA 2QQ9A 1OX8A 2GF7A 5DM7R 1UTIA 1VQNA 1JXMA 3CC7T 4M77G 2XDDA 5GJWB 4ZN1A 4M7DD 2J6OA 3CMAQ 2VV5A 2KSSA 1JBMA 2KYMA 2EJFA 1RAIB 2FVUA 1N6AA 4BY6C 1VQKA 2GBQA 4D6WA 3PTAA 2VB6A 4XAXB 4FSSA 3SWNC 2COZA 2KNBB 2O4XA 4J7IA 1YP5A 2B8AA 3QHSA 3I55A 1NJIU 5GANe 1ZSGA 1D3BA 2J05A 4KGVB 5C6SA 3QG1A 4C92F 4KRTA 2O31A 2VYTA 3RNJA 4M7DA 3KBGA 1VQ9T 1RABB 2D1XA 3G4SQ 4XTVA 4N4GA 1EX4A 1ZSZA 2EWNA 1WNLA 4OB1B 3UWNA 3OB9A 2K3YA 3H8ZA 3A8GB 3HRUA 4E47A 1YJ9T 1D0YA 1WHMA 1MUZA 1AZGB 3TSWA 5GAOr 4GY5A 3HL8A 1DJ7B 5GANh 4MZTA 1M3AA 4JJNK 4M77C 3RIRA 1HJDA 3OY9A 1YCYA 2DVEA 1M1KU 2K3BA 5IXBA 4PFZA 2I2LA 1GCPA 2QQRA 2X4WA 1T0HA 2QGFB 4PL6A 5DY9A 2KE9A 1JXOA 2K5LA 4JJDA 4D8KA 4L5GA 4WTOB 4HVUA 2NUZA 3M58A 3OYNA 1Q81C 2V1QA 3CCVQ 2EFIA 1I0CA 2JMAA 2VUBA 3OS1A 4OMLA 5GAMe 1AVZC 2K2MA 2QA4T 4OMNA 1W4SA 3JCMc 5CQYA 2QDLA 5A2QE 4EMKB 2A08A 4J9BA 3H0HA 1RAEB 1K73R 3CBMA 4A54A 3QXEB 5IAYA 1WJSA 1LJOA 1VQ7A 3HHTB 4LDYA 2EBPA 2LQ8A 1YCSB 2QGGA 3L2RA 3PNWC 1KQSA 4QVZA 2OTLA 4J6XA 1W2BA 2X3WD 2NUPB 3AHUA 3CCLA 3NGPA 4PJOF 3MO8A 3E19A 3VS2A 2FYKA 2O2OA 3O8VA 1K9MC 5FRMA 1LNXA 4KULA 1TG0A 2J06A 2XDBA 2EGEA 4EMGA 1KQ2A 3RUXA 5GANd 1H92A 3CPWP 2KK4A 3PMIA 1F1BB 2ZAEA 2ED1A 2DJZA 4OMFB 2P0QA 3REBB 1OZ2A 4QQ6A 1K73C 2HD0A 4RTYA 1PWTA 1S72Q 2YRDA 4BY6B 4N4IA 5IH2A 1WA7A 3SWNB 4BE0A 1IB8A 6AT1B 5GMKj 1K8AC 1WJRA 2BIVA 3JCMb 1PC0A 1MV3A 1I4K1 2LCCA 2KDSA 2RHUA 3A8MB 1NEGA 2ZPFB 4M77E 2AHJB 2K79A 2XD0A 1U5SA 3L2QA 4Z89A 2PUKB 1VA7A 3CC7Q 4E7IA 4NL3A 5ECAA 2F2WA 1Q82U 1RLQC 4DBHA 3M54A 3L2UA 4PJMA 4AG2C 4N0AC 4HT9A 3EGXB 1RI9A 3L2VA 1E7OA 4J8OA 3M4GA 1KC8U 1IRXA 1SSHA 3CCJA 2R58A 3EFOA 1XNIA 2NUPA 5D6WA 1T3SA 3CCUA 3G71T 1N5ZA 1YN8A 1M3CA 4M77B 1X69A 4OB3B 3CCQT 2NUTB 3JCMW 3V7RA 4R55A 5CKEA 5GAMd 4C5GA 2YLCA 1VQMQ 1I81A 2CP6A 2PVGB 2EQUA 4C8QD 2PZ1A 2RM4A 1IREB 1RLPC 1ZQ1A 5GAN7 4DOVA 4AFZC 4ZN3A 1YJ9Q 1Q7YU 3RERA 4M78D 1V76A 2M0OA 4JRKA 1TUCA 1Z9QA 1VQPT 4XTUA 5KE3A 4RG8A 2QG9B 2DL7A 3HKSA 3VYGA 2MYSA 1M4ZA 1WPYA 1HYOA 2OAUA 2CS7A 3NFCA 3GPLA 1PNJA 2JM8A 1ZX6A 3I35A 3M0QA 2VXFA 2ROLA 2L89A 1YI2A 5J3BA 2F2XA 5KYYB 3SB2A 3U23A 1WLPB 2DRKA 3JV3A 3HTRA 4Y91A 5CR2A 2CP0A 3J80E 1VQOT 4M7DG 2DKGA 2RN8A 1QP3A 2MAMA 1MNEA 2EYZA 2COWA 2EYWA 2XICA 1KHIA 2DXTA 3HP9A 5A0DA 2LTOA 1WXUA 2ECZA 4ZGJB 3VS6A 4F7UG 1WHGA 1UE9A 3A98A 2CUBA 4HA8A 2OTJA 2M16A 1R8OB 3UDCA 2NLUA 5CCAA 1M2OA 1Y96B 4ORZA 1W1FA 3REAB 2MWOA 2QQSA 3OYBA 2J6KA 5J39A 2YUOA 1SKUB 2NUTA 3I56T 2EAYA 2HBPA 4XTWA 1SPKA 2RI5A 1GFDA 3HRSA 2V26A 3M57A 2P0KA 3HFNA 2X4YA 2JS2A 2G6FX 2EGAA 2K4YA 2M0YA 3CXCA 5FLXE 2LQNA 3UF4A 4AFUC 3QUIA 2E41A 1ZUKA 4RUGA 3KFVA 3R6NA 2PU9B 4AFSC 2BE7D 3QWYA 4E7JA 1OYXA 2H8HA 4M7DC 1BBZA 3OW2A 2F5KA 2JOYA 5LJ3f 1QCOA 1CKBA 2DO3A 2KI7A 2DERA 3C94A 2JJ9A 2HKNA 1ZSZC 1UUEA 4IUPA 4A4EA 3PIPA 4JPBW 1VQNT 2VKNA 2DXUA 5KYYA 2JUFA 2DLPA 2JT4A 1B07A 1KG1A 2KROA 2F69A 2OJ2A 4E2FB 1GBRA 5CK9A 7AT1B 5LJ5g 3DKMA 4J9DA 4E7ZA 1VQKT 2VVKA 3P8BB 5GMKh 3CC4A 1AWJA 4C5HA 5IHIA 4J83A 2EYXA 1U3OA 2JMCA 2LNHB 1BK2A 5GAOp 4Z88A 2AZVA 2HMAA 4F16A 3CC2A 4EMHA 3QDFA 1Y96A 1LVKA 2KT8A 4GLKA 1Q95G 1FMWA 1M3BA 3ME9A 2QAZA 3OYYA 4PJOD 1UEBA 2ESWA 2F2VA 2LJ0A 2YSQA 2RHZA 3RKXA 3G71Q 2QXFA 1D1AA 1WX6A 5GANj 1U1SA 3CCQQ 3HSBA 4BDZA 2I0NA 1YIJQ 3JCMf 1JEGA 1GBQA 5A0GA 1RI0A 2F5TX 3GP8A 4CC7A 1M8MA 5CKDA 5CKHA 4JUVA 4OMOA 5LJ3d 1YITA 2JXBA 4EDUA 3H6ZA 1QWEA 1TXQA 1WQWA 1JB0E 4JRPA 3N5BB 2XU8A 1VQPQ 3JAME 3GLXA 3FJ5A 1X2KA 2FO0A 1QW1A 2X3XD 2RNAA 4N0AA 2DIQA 2RI2A 2VXEA 4M7DE 1EZZB 4MDXA 3OBWA 1VQOQ 4LUDA 4J9FA 4E7SA 4C0FA 5CVIA 2V8KA 4IKFA 2XDPA 4M4ZA 4E6RA 2GFUA 4F7UE 3PFSA 1KHCA 3JB9D 1G3SA 1VQ7T 3JCMV 1OV3A 4FCYA 1I07A 2CH4W 2C0IA 8ATCB 2FZCB 5FW9A 2P4TA 1QVFA 4A4GA 5GAMj 1VQ8A 3VYHB 2OTLT 1WHKA 2QK0A 4N4HA 3DB4A 5HK3A 2KXDA 2GCXA 3M0TA 2LCSA 4M7DB 3I56Q 1IGUA 2YT6A 3BW1A 4MDWA 1IHWA 3LGFA 3SD4A 4BE2A 4KGZB 3JCMd 4C8QG 3C95A 1HXDA 1ZSZB 1WGSA 2OI3A 3OBYA 2A37A 2RQWA 2AIRB 1VQLA 4A4FA 4F7UB 3HRTA 2Z0WA 3S3OA 2K6DA 1N9RA 4M78G 2IVWA 3I9QA 4PFPA 1HD3A 4Z8AA 3ASKA 3THKA 1JJ2A 4QT7A 3H0IA 1OQKA 5FROA 4FT4A 4VUBA 3MP6A 1U8RA 2DZCA 2RQVA 1X27A 1SHFA 1VYVA 2RHXA 2HKQB 5GMKi 1FMKA 2RJFA 3RMSA 1VQNQ 1KJWA 2GNCA 3LH5A 2RPNA 4B6MA 4JZ4A 2DNUA 2CZ1B 5LL6S 3IQLA 4BACA 1D09B 2CT3A 3M55A 1VQKQ 1IZ6A 2D0NA 1WXTA 2V8JA 4X9CA 1WHHA 1MMNA 5IHNA 1BCOA 4C92G 3PGGA 3I55Q 2PQWA 3A8LB 1LPLA 4J7FA 1W2BP 2RQTA 3VV0A 4C8QC 2Y4YA 3CCJT 1NZ9A 4FT2A 3CCUT 3OYMA 4M77F 2VGNA 1VIEA 2FB7A 1KQ1A 3EHRA 1R0BG 3PIOA 4ZNXA 4M78C 1M2VB 2G3RA 1TTHB 1WHLA 1BU1A 1TH7A 3JSCA 3TCJA 1VQMT 2LDMA 1PM3A 3ER0A 2HDAA 1Y07A 3X28B 2L0AA 4F7UA 5CIUA 2AZSA 2XK0A 1UGRB 4R56A 2RJCA 1W2BS 2CDTA 3FEOA 2DIGA 2L8DA 4DQ2A 3WXMB 3JCMJ 3X26B 3M0RA 1SG5A 1YI2T 4PJJA 2QEXA 1I8FA 4ZTFA 2AT1B 1VQ4A 4C92C 1O75A 2DYBA 2RK2A 2L3QA 3UA7A 3TU4K 2E4HA 1SRLA 2EVRA 4ZGDB 3J81E 1NEBA 4HT8A 3S6WA 3J7AF 3EG3A 2KBTA 1M90R 2LT4A 3MHXA 2OTJT 3LYIA 5M9OA 4C5EA 3CPFA 3G1JA 1X6GA 4FSXA 4GBQA 2FG0A 1N8RU 2DM1A 2CT4A 4HCCA 2YLBA 2E64A 2RD1A 1LOJA 2K2VA 1V29B 1M2VA 1VQ7Q 3CD6A 3GNFB 5GAN5 2LRQA 2DZ9A 1M30A 3TQ7P 3RKWA 3OYDA 1X01A 1K76A 5IXFA 1UGSB 1R77A 3ZL7C 4PJOG 5L8RE 4JZ3A 2OTLQ 3EFOB 1I1JA 1MHNA 2RQRA 3CCLQ 5GAOm 5GAMh 3I5SA 4C8QE 5LJ3j 2JNGA 1M90C 4M75F 3L42A 1YWOA 1AZEA 5I2SA 3OYGA 2XHCA 1H641 5KE2A 1ZBJA 3CEYA 2LC4A 2ROTA 3H41A 4HKEA 2EQIA 5C0MA 4JJBA 2EQMA 3C12A
chains in the Genus database with same CATH topology
1T3LA 2D8HA 4ORZA 2JW4A 1W1FA 2P4RA 3REAB 2LX7A 2J6KA 1ZLMA 1UG1A 2YUOA 1ABOA 4F14A 1QKWA 2DBMA 4ESRA 4J9HA 1SPKA 4CC4B 2YUPA 1GFDA 1QLYA 2SRCA 1QWFA 2HCKA 2KGTA 4RTUA 2JS2A 2G6FX 2EGAA 2GGRA 2M0YA 4J9GA 1S1NA 2LQNA 3UF4A 4AFUC 2XMFA 1ZUKA 4RUGA 3KFVA 2C0TA 3R6NA 1GL5A 2KRSA 4AFSC 4HCKA 2HBWA 1UHCA 5FWCA 2DILA 1YNZA 1UECA 3VS7A 2AK5A 1WDXA 3QWYA 2YDLA 1GCQA 5HCKA 2DJQA 1YWPA 2H8HA 1BBZA 1WFWA 1AD5A 4RTXA 2A28A 1OPLA 3EHQA 1CKBA 3UA6A 1WIEA 2KEAA 1UUEA 2LQWA 3VS4A 4JPBW 4RTVA 2VKNA 2DLPA 2JT4A 1B07A 1Z9ZA 1UGVA 2KROA 2GTOA 3NMZC 2OJ2A 4DEYA 1GBRA 2CUDA 2DF6A 3NHNA 4J9DA 5L23A 2VVKA 2DX1A 5IHKA 3I5RA 1AWJA 4Y92A 5IHIA 2EYXA 2PNIA 1U3OA 2DVJA 2JMCA 2HEQA 1OEBA 2LNHB 1BK2A 2YUQA 1UJYA 1XOVA 2AKLA 2AZVA 2W10A 4Z88A 4F16A 3C0CA 4A63B 1NM7A 1AWOA 1QKXA 2DRMA 2B86A 3ULRB 2KT8A 2KXCA 3EG0A 4CC3A 1K4US 1M3BA 1M27C 1AWWA 2EW3A 3CQTA 1U06A 1OOTA 2CREA 5GJVB 1ARKA 2ESWA 2F2VA 2LJ0A 3VS1A 1EFNA 2L2PA 2YSQA 2DA9A 4RTTA 1UTIA 1WX6A 4OMMA 1FYNA 1BB9A 1JXMA 2O9SA 2YUNA 2I0NA 2FPFA 3QWXX 1JEGA 5GJWB 4CC2A 5EC7A 1GBQA 1JO8A 2J6OA 1K1ZA 2KYMA 2RF0A 2GBQA 4CC7A 2K7AA 1M8MA 4FSSA 2KNBB 2BZYA 1SRMA 1YP5A 4OMOA 2JXBA 2J6FA 1QWEA 2KRMA 1ZSGA 1UJ0A 4JJCA 1JQQA 1GFCA 2J05A 2EPDA 3VRZA 2VWFA 3FJ5A 1X2KA 4KRTA 2FO0A 2FPDA 2X3XD 2O31A 2RNAA 3RNJA 1WYXA 2L3PA 2LMJA 2D1XA 2LZ6B 1V1CA 1X6BA 2ED0A 2E5KA 1AEYA 1UDLA 4LUDA 4J9FA 3NPFA 4GLMA 1ZUUA 1AWXA 2FEIA 4M4ZA 4E6RA 1MUZA 1AZGB 3TSWA 2FRWA 1PHTA 1M3AA 1OV3A 2CH4A 2KT1A 1I07A 1MV0B 2CH4W 2C0IA 2EYYA 1HJDA 1W70A 5FW9A 2K3BA 1PKTA 1NG2A 5IXBA 5FWBA 1UFFA 1K9AA 1GCPA 3EG2A 1T0HA 2RQUA 2IIMA 4J9EA 2KXDA 3M0TA 1W6XA 2LCSA 1G83A 2O88A 2KE9A 1JXOA 3M0UA 2YT6A 3VS3A 1Y57A 2O9VA 3EG1A 4JJDA 1AOJA 4D8KA 4HVUA 5I11A 2NUZA 2LJ3A 1H8KA 2DL8A 3EGUA 4HVWA 1KIKA 1TUDA 2CSIA 2OI3A 2V1QA 2A37A 2RQWA 1I0CA 2JMAA 1GCQC 2K6DA 4OMLA 1CSKA 4LNPA 2W0ZA 3TVTA 1AVZC 2K2MA 4HXJA 2LP5A 3I9QA 4OMNA 2K9GA 1HD3A 2L3SA 4Z8AA 4K11A 4J9CA 1J3TA 3THKA 2QDLA 1X43A 2CSQA 2A08A 4J9BA 1GRIA 4QT7A 3H0HA 1IO6A 3H0IA 3GBQA 1WI7A 2AKKA 2DMOA 2RQVA 1X27A 1RUWA 1SHFA 1VYVA 2M51A 2EBPA 1K0XA 1PRLC 1WXBA 1YCSB 3VS0A 1FMKA 2OAWA 1KJWA 2GNCA 1HSQA 3LH5A 2RPNA 4JZ4A 2X3WD 2DNUA 2GTJA 4DEXA 1NYGA 3IQLA 1VYUA 3NGPA 2CT3A 1PRMC 2MOXA 1CKAA 3VS2A 2O2OA 1QCFA 2D0NA 1TG0A 2J06A 1WXTA 2EGEA 2FRYA 5IHNA 1E6HA 1H92A 1NLOC 1ZUYA 2DBKA 2RQTA 3M0SA 2ED1A 3REBB 2RMOA 3SHWA 1H3HA 1NLPC 2SEMA 1X2QA 4RTYA 1PWTA 3EHRA 2J7IA 4ZNXA 4LE9A 2DL3A 5IH2A 1OPKA 2V1RA 1WA7A 1BU1A 1LCKA 2EKHA 2C0OA 3PE0A 2JS0A 2BZ8A 2KRNA 1MV3A 2HDAA 2L0AA 1NEGA 4EIKA 2K79A 1U5SA 4Z89A 1VA7A 2AZSA 1NYFA 2HSPA 1B3QA 4RTZA 4F17A 2PTKA 5ECAA 1K0SA 2F2WA 4AFQC 2CDTA 1RLQC 1SEMA 1KSWA 1JU5C 1SHGA 1UHFA 4LN2A 1ABQA 4OMPA 2D8JA 2DE0X 2NWMA 3M0RA 4AG2C 2FPEA 1RI9A 3TSZA 1E7OA 5I22A 2DYBA 1SSHA 1T0JA 1G2BA 1T3SA 2L3QA 3UA7A 1N5ZA 1YN8A 1M3CA 1X69A 1E6GA 1PKSA 2DL4A 1SRLA 2EVRA 1NEBA 1KFZA 3VRYA 3EG3A 2KBTA 4D8DA 1Y0MA 2MIOA 2DL5A 3RBBB 2PZ1A 4LUEA 1RLPC 1A0NB 4RTWA 3UATA 2BTTA 4AFZC 3PVLA 1X6GA 4GBQA 2FG0A 2DM1A 2CT4A 3O5ZA 1TUCA 3H0FA 3VS5A 2ENMA 1Z9QA 4IIOA 2A36A 1M30A 2DL7A 2LJ1A 4J9IA 2KYBA 1K76A 5IXFA 2GQIA 3ZL7C 1PNJA 2JM8A 1ZX6A 4JZ3A 3I35A 2MCNA 1I1JA 3M0QA 2RQRA 2ROLA 2ABLA 4X1VA 2F2XA 3PVQA 3I5SA 3U23A 1WLPB 2DRKA 3JV3A 2JM9A 2RN8A 1VYTA 2EGCA 2EYZA 1YWOA 2JTEA 2KR3A 4WCIA 4AG1C 4R0KA 1AZEA 2EYWA 4HVVA 4OMQA 2BZXA 1WXUA 3SEMA 2ECZA 1ZBJA 3VS6A 1UE9A 2ROTA 3A98A 2CUBA 4IIMA 3M0PA 3H41A 2EQIA 4JJBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1T3L A;  2D8H A;  4ORZ A;  2JW4 A;  1W1F A;  2P4R A;  3REA B;  2LX7 A;  2J6K A;  1ZLM A;  1UG1 A;  2YUO A;  1ABO A;  4F14 A;  1QKW A;  2DBM A;  4ESR A;  4J9H A;  1SPK A;  4CC4 B;  2YUP A;  1GFD A;  1QLY A;  2SRC A;  1QWF A;  2HCK A;  2KGT A;  4RTU A;  2JS2 A;  2G6F X;  2EGA A;  2GGR A;  2M0Y A;  4J9G A;  1S1N A;  2LQN A;  3UF4 A;  4AFU C;  2XMF A;  1ZUK A;  4RUG A;  3KFV A;  2C0T A;  3R6N A;  1GL5 A;  2KRS A;  4AFS C;  4HCK A;  2HBW A;  1UHC A;  5FWC A;  2DIL A;  1YNZ A;  1UEC A;  3VS7 A;  2AK5 A;  1WDX A;  3QWY A;  2YDL A;  1GCQ A;  5HCK A;  2DJQ A;  1YWP A;  2H8H A;  1BBZ A;  1WFW A;  1AD5 A;  4RTX A;  2A28 A;  1OPL A;  3EHQ A;  1CKB A;  3UA6 A;  1WIE A;  2KEA A;  1UUE A;  2LQW A;  3VS4 A;  4JPB W;  4RTV A;  2VKN A;  2DLP A;  2JT4 A;  1B07 A;  1Z9Z A;  1UGV A;  2KRO A;  2GTO A;  3NMZ C;  2OJ2 A;  4DEY A;  1GBR A;  2CUD A;  2DF6 A;  3NHN A;  4J9D A;  5L23 A;  2VVK A;  2DX1 A;  5IHK A;  3I5R A;  1AWJ A;  4Y92 A;  5IHI A;  2EYX A;  2PNI A;  1U3O A;  2DVJ A;  2JMC A;  2HEQ A;  1OEB A;  2LNH B;  1BK2 A;  2YUQ A;  1UJY A;  1XOV A;  2AKL A;  2AZV A;  2W10 A;  4Z88 A;  4F16 A;  3C0C A;  4A63 B;  1NM7 A;  1AWO A;  1QKX A;  2DRM A;  2B86 A;  3ULR B;  2KT8 A;  2KXC A;  3EG0 A;  4CC3 A;  1K4U S;  1M3B A;  1M27 C;  1AWW A;  2EW3 A;  3CQT A;  1U06 A;  1OOT A;  2CRE A;  5GJV B;  1ARK A;  2ESW A;  2F2V A;  2LJ0 A;  3VS1 A;  1EFN A;  2L2P A;  2YSQ A;  2DA9 A;  4RTT A;  1UTI A;  1WX6 A;  4OMM A;  1FYN A;  1BB9 A;  1JXM A;  2O9S A;  2YUN A;  2I0N A;  2FPF A;  3QWX X;  1JEG A;  5GJW B;  4CC2 A;  5EC7 A;  1GBQ A;  1JO8 A;  2J6O A;  1K1Z A;  2KYM A;  2RF0 A;  2GBQ A;  4CC7 A;  2K7A A;  1M8M A;  4FSS A;  2KNB B;  2BZY A;  1SRM A;  1YP5 A;  4OMO A;  2JXB A;  2J6F A;  1QWE A;  2KRM A;  1ZSG A;  1UJ0 A;  4JJC A;  1JQQ A;  1GFC A;  2J05 A;  2EPD A;  3VRZ A;  2VWF A;  3FJ5 A;  1X2K A;  4KRT A;  2FO0 A;  2FPD A;  2X3X D;  2O31 A;  2RNA A;  3RNJ A;  1WYX A;  2L3P A;  2LMJ A;  2D1X A;  2LZ6 B;  1V1C A;  1X6B A;  2ED0 A;  2E5K A;  1AEY A;  1UDL A;  4LUD A;  4J9F A;  3NPF A;  4GLM A;  1ZUU A;  1AWX A;  2FEI A;  4M4Z A;  4E6R A;  1MUZ A;  1AZG B;  3TSW A;  2FRW A;  1PHT A;  1M3A A;  1OV3 A;  2CH4 A;  2KT1 A;  1I07 A;  1MV0 B;  2CH4 W;  2C0I A;  2EYY A;  1HJD A;  1W70 A;  5FW9 A;  2K3B A;  1PKT A;  1NG2 A;  5IXB A;  5FWB A;  1UFF A;  1K9A A;  1GCP A;  3EG2 A;  1T0H A;  2RQU A;  2IIM A;  4J9E A;  2KXD A;  3M0T A;  1W6X A;  2LCS A;  1G83 A;  2O88 A;  2KE9 A;  1JXO A;  3M0U A;  2YT6 A;  3VS3 A;  1Y57 A;  2O9V A;  3EG1 A;  4JJD A;  1AOJ A;  4D8K A;  4HVU A;  5I11 A;  2NUZ A;  2LJ3 A;  1H8K A;  2DL8 A;  3EGU A;  4HVW A;  1KIK A;  1TUD A;  2CSI A;  2OI3 A;  2V1Q A;  2A37 A;  2RQW A;  1I0C A;  2JMA A;  1GCQ C;  2K6D A;  4OML A;  1CSK A;  4LNP A;  2W0Z A;  3TVT A;  1AVZ C;  2K2M A;  4HXJ A;  2LP5 A;  3I9Q A;  4OMN A;  2K9G A;  1HD3 A;  2L3S A;  4Z8A A;  4K11 A;  4J9C A;  1J3T A;  3THK A;  2QDL A;  1X43 A;  2CSQ A;  2A08 A;  4J9B A;  1GRI A;  4QT7 A;  3H0H A;  1IO6 A;  3H0I A;  3GBQ A;  1WI7 A;  2AKK A;  2DMO A;  2RQV A;  1X27 A;  1RUW A;  1SHF A;  1VYV A;  2M51 A;  2EBP A;  1K0X A;  1PRL C;  1WXB A;  1YCS B;  3VS0 A;  1FMK A;  2OAW A;  1KJW A;  2GNC A;  1HSQ A;  3LH5 A;  2RPN A;  4JZ4 A;  2X3W D;  2DNU A;  2GTJ A;  4DEX A;  1NYG A;  3IQL A;  1VYU A;  3NGP A;  2CT3 A;  1PRM C;  2MOX A;  1CKA A;  3VS2 A;  2O2O A;  1QCF A;  2D0N A;  1TG0 A;  2J06 A;  1WXT A;  2EGE A;  2FRY A;  5IHN A;  1E6H A;  1H92 A;  1NLO C;  1ZUY A;  2DBK A;  2RQT A;  3M0S A;  2ED1 A;  3REB B;  2RMO A;  3SHW A;  1H3H A;  1NLP C;  2SEM A;  1X2Q A;  4RTY A;  1PWT A;  3EHR A;  2J7I A;  4ZNX A;  4LE9 A;  2DL3 A;  5IH2 A;  1OPK A;  2V1R A;  1WA7 A;  1BU1 A;  1LCK A;  2EKH A;  2C0O A;  3PE0 A;  2JS0 A;  2BZ8 A;  2KRN A;  1MV3 A;  2HDA A;  2L0A A;  1NEG A;  4EIK A;  2K79 A;  1U5S A;  4Z89 A;  1VA7 A;  2AZS A;  1NYF A;  2HSP A;  1B3Q A;  4RTZ A;  4F17 A;  2PTK A;  5ECA A;  1K0S A;  2F2W A;  4AFQ C;  2CDT A;  1RLQ C;  1SEM A;  1KSW A;  1JU5 C;  1SHG A;  1UHF A;  4LN2 A;  1ABQ A;  4OMP A;  2D8J A;  2DE0 X;  2NWM A;  3M0R A;  4AG2 C;  2FPE A;  1RI9 A;  3TSZ A;  1E7O A;  5I22 A;  2DYB A;  1SSH A;  1T0J A;  1G2B A;  1T3S A;  2L3Q A;  3UA7 A;  1N5Z A;  1YN8 A;  1M3C A;  1X69 A;  1E6G A;  1PKS A;  2DL4 A;  1SRL A;  2EVR A;  1NEB A;  1KFZ A;  3VRY A;  3EG3 A;  2KBT A;  4D8D A;  1Y0M A;  2MIO A;  2DL5 A;  3RBB B;  2PZ1 A;  4LUE A;  1RLP C;  1A0N B;  4RTW A;  3UAT A;  2BTT A;  4AFZ C;  3PVL A;  1X6G A;  4GBQ A;  2FG0 A;  2DM1 A;  2CT4 A;  3O5Z A;  1TUC A;  3H0F A;  3VS5 A;  2ENM A;  1Z9Q A;  4IIO A;  2A36 A;  1M30 A;  2DL7 A;  2LJ1 A;  4J9I A;  2KYB A;  1K76 A;  5IXF A;  2GQI A;  3ZL7 C;  1PNJ A;  2JM8 A;  1ZX6 A;  4JZ3 A;  3I35 A;  2MCN A;  1I1J A;  3M0Q A;  2RQR A;  2ROL A;  2ABL A;  4X1V A;  2F2X A;  3PVQ A;  3I5S A;  3U23 A;  1WLP B;  2DRK A;  3JV3 A;  2JM9 A;  2RN8 A;  1VYT A;  2EGC A;  2EYZ A;  1YWO A;  2JTE A;  2KR3 A;  4WCI A;  4AG1 C;  4R0K A;  1AZE A;  2EYW A;  4HVV A;  4OMQ A;  2BZX A;  1WXU A;  3SEM A;  2ECZ A;  1ZBJ A;  3VS6 A;  1UE9 A;  2ROT A;  3A98 A;  2CUB A;  4IIM A;  3M0P A;  3H41 A;  2EQI A;  4JJB A; 
#chains in the Genus database with same CATH topology
 2CYZ B;  2JW4 A;  4BD3 A;  1QVG A;  3OYK A;  3ZEH A;  1ABO A;  4OB2 B;  3CCR A;  5KYN A;  1MGQ A;  3M9Q A;  4J9H A;  2DTI A;  3CC4 T;  4C8Q B;  2PUO B;  3S3N A;  1JRI A;  1QLY A;  2L3R A;  2SRC A;  2XID A;  1FXX A;  2KGT A;  3EAE A;  4M78 B;  4NS5 A;  4QQG A;  1S1N A;  4PJO C;  5GAO q;  1BKB A;  2X4J A;  3CME A;  3JB9 G;  4XTX A;  1NE8 A;  2DIL A;  3VS7 A;  2AK5 A;  1TWB A;  1WDX A;  3PT9 A;  2YDL A;  3OQ5 A;  2DJQ A;  1YWP A;  2DFU A;  3M4Y A;  3CC7 A;  4B9X A;  4RTX A;  2A28 A;  3CXC P;  2P84 A;  3EHQ A;  3UA6 A;  3CCJ Q;  2MMP A;  3JB9 I;  2VAS A;  3CCU Q;  2LQW A;  3VS4 A;  1GXI E;  4RTV A;  1D0X A;  3OYF A;  4LD9 K;  1YIJ T;  3QJ6 A;  1RL2 A;  1Z9Z A;  2DAQ A;  2GTO A;  2CUD A;  2DF6 A;  1VQ5 A;  4OP0 A;  1KD1 U;  3OA6 A;  2DXB A;  4C92 B;  8AT1 B;  4Y92 A;  1Q86 U;  4M7A F;  3LWI A;  1SSF A;  3A5Z B;  1XJW B;  3E9F A;  3NTK A;  3C0C A;  1VQ9 A;  5D6Y A;  1QKX A;  2DRM A;  3URG A;  1X75 C;  3QSU A;  3CCE A;  3CXC S;  2MI6 A;  4MMK A;  3ULR B;  3MEW A;  4QQD A;  5KYX B;  5LJ5 e;  1NJI R;  3LH0 A;  2EKO A;  2HSE B;  3CCS A;  3L2Z A;  1M27 C;  2RJD A;  3S3M A;  1B7T A;  3CQT A;  4C8Q A;  1YI2 Q;  2CRE A;  2RH2 A;  5GJV B;  3OW2 S;  1HK9 A;  2QQA A;  4M78 A;  3VS1 A;  4KT0 E;  4A4K A;  4BE1 A;  1EFN A;  2L2P A;  1FYN A;  1ZA2 B;  1YJW A;  4DBF A;  2O9S A;  5I21 A;  1BIB A;  3CPW A;  1VUB A;  1RAA B;  4CC2 A;  5EC7 A;  1JO8 A;  3L2W A;  1M5Q 1;  1K1Z A;  2RF0 A;  4C92 D;  2OTJ Q;  2KAF A;  1XTD A;  2K7A A;  2BUD A;  4B9W A;  2BZY A;  2QQB A;  1VQ8 T;  1SRM A;  4UC4 A;  5LJ5 f;  2E3H A;  4FYY B;  5LJ3 e;  2DEU A;  2J6F A;  3UT1 A;  1NJI C;  4RKU E;  2K5I A;  4M7D F;  1H3Z A;  2HL3 A;  1M1K R;  3OYI A;  2KY9 A;  1IGQ A;  1JQQ A;  1ACM B;  5AYF A;  5CQX A;  2EPD A;  3GIB A;  2VWF A;  3TRE A;  3FC3 A;  2QA4 A;  2LX9 A;  4P5N A;  1U1T A;  2OX7 A;  1VQL T;  2L3P A;  4C92 A;  1X6O A;  1X6B A;  1UGQ B;  4KH0 B;  3M59 A;  2ED0 A;  4C0D C;  5IN1 A;  2CKK A;  3EH1 A;  5GAN 6;  2H3E B;  3DLM A;  1N9S A;  3NPF A;  5FU7 B;  3MEA A;  5LJ3 h;  1ZBX A;  3EFR A;  4BI3 A;  5KYX A;  3OSS C;  1PHT A;  1FWZ A;  2JVV A;  4DA4 A;  4IUT A;  2CH4 A;  2KT1 A;  4LXC A;  1MV0 B;  4RCB A;  1M1K C;  4PJO B;  3OYH A;  1PSF A;  1C1A A;  1PKT A;  5FWB A;  1UFF A;  1K9A A;  5IT9 E;  2XI9 A;  3EG2 A;  2IIM A;  2WAC A;  1IXD A;  4JS5 A;  3JB9 H;  4FYX B;  1W6X A;  1G83 A;  3M5A A;  3CCM A;  3EG1 A;  3BY7 A;  2M1H A;  3OS5 A;  3CC4 Q;  4QVD A;  5I11 A;  2LJ3 A;  1H8K A;  2DL8 A;  4HVW A;  2DEQ A;  3I55 T;  3JCM e;  1VQ6 A;  4YTL A;  3VUB A;  1Q81 U;  4E7L A;  3VU3 C;  3CC2 Q;  1GCQ C;  3MET A;  4L59 A;  2RJE A;  1WHJ A;  2W0Z A;  4LNP A;  5GAO n;  3TVT A;  4HXJ A;  2LP5 A;  5LJ5 d;  3EFS A;  4PFO A;  5KYW B;  3FRN A;  4K11 A;  1MND A;  1J3T A;  1YBY A;  3KUF A;  1GRI A;  1WI7 A;  2AKK A;  2DMO A;  4L6V 5;  1K0X A;  2DET A;  1WXB A;  4RCC A;  4O5V A;  4KUI A;  3EG9 B;  4M75 D;  1OUL A;  2OAW A;  2WSF E;  1HSQ A;  3JCM h;  4JRI A;  1JJ2 P;  2CP5 A;  2GTJ A;  3QPH A;  4DEX A;  1VYU A;  3QDR B;  1CKA A;  3MKD A;  1IHV A;  3Q1J A;  4FIB A;  4HCB A;  3R6O A;  4F04 B;  1K9M U;  1YIT Q;  2FRY A;  5DLQ E;  2F1L A;  1Q82 R;  3ZBD A;  1E6H A;  4PJO A;  2QEX T;  2DBK A;  4FW2 A;  2R5A A;  3SHW A;  4IUU A;  2X51 A;  1K73 U;  1NLP C;  2FZK B;  2SEM A;  2HQE A;  2J7I A;  4LE9 A;  2DL3 A;  2V1R A;  4OVA A;  1KC8 R;  2EKH A;  3PE0 A;  1D0Z A;  1JJ2 S;  1YHQ A;  1K8A U;  1BI1 A;  5A0L A;  4EIK A;  5KYU B;  1UB4 A;  3QII A;  1Y7X A;  2CP2 A;  1KD1 R;  5KYW A;  2HSP A;  4RTZ A;  3CD6 T;  2X4X A;  3TEE A;  4F17 A;  1Q86 R;  4AFQ C;  4BI4 A;  2RHI A;  1Q7Y R;  4C0D B;  1YJN A;  1QQJ A;  3MPU B;  1KSW A;  1JU5 C;  1SHG A;  2QYZ A;  2EYQ A;  2MF2 A;  1UHF A;  3KXT A;  3QJY A;  1VQ8 Q;  1RAH B;  2ZPE B;  3V8J A;  3JB9 J;  1WZO A;  4O6J A;  2NWM A;  3CCL T;  3EG9 A;  4MZM A;  1KC8 C;  2CGH A;  1T0J A;  4IUV A;  4LD6 A;  1PKS A;  4M7A D;  2DL4 A;  3FB9 A;  1VQL Q;  4DOW A;  3G6E A;  3VRY A;  4QKU A;  1Y0M A;  4XU2 A;  5CKF A;  4A4H A;  4PLI A;  2DL5 A;  2P0P A;  3RBB B;  2YWW A;  4E7H A;  1I5L A;  4LDW A;  3T9N A;  4KGX B;  4RTW A;  3UAT A;  2EQJ A;  3JCM P;  4QVC A;  3PVL A;  3VS5 A;  1NBE B;  3A1P A;  2D9T A;  3BDU A;  3OS2 A;  1O9S A;  2LJ1 A;  4J9I A;  4FYV B;  2KYB A;  3X20 B;  2GQI A;  4Z02 A;  2COY A;  2YXY A;  2PVD B;  1OX9 A;  5GMK l;  5HY6 A;  3QO3 A;  1TUG B;  5KYU A;  2DK3 A;  3FIF A;  5FU6 C;  3LGL A;  3CME T;  3PVQ A;  5GAN 3;  4LDX A;  2JM9 A;  2ATC B;  2CZ0 B;  2WSC E;  3NTH A;  5EG2 A;  4EPC A;  1KQS P;  1OU8 A;  2KR3 A;  4WCI A;  4AG1 C;  4R0K A;  5I2M A;  4HVV A;  2HQH A;  4OMQ A;  1YFN A;  3D7S B;  4OGC A;  3OYA A;  3CMA A;  3FDR A;  4KBM B;  2E12 A;  1QMC A;  3M0P A;  3JRZ A;  4LDU A;  2QDY B;  2YHT A;  1MMA A;  3RMQ A;  3QZ9 B;  2D8H A;  1BI3 A;  2P4R A;  1ZLM A;  5D6X A;  1UG1 A;  2MWP A;  1VQ5 T;  4F14 A;  1QKW A;  2DBM A;  2GQV A;  4JS4 A;  2E5Q A;  2YUP A;  3BFM A;  4ATO A;  1RAF B;  3MJX A;  5CKB A;  3MEU A;  1KQS S;  3EH2 A;  1QVG P;  3G4S A;  4J9G A;  3LLR A;  3CCE T;  2DTO A;  2XMF A;  1G8X A;  1NPR A;  2E6N A;  4PJL A;  2ZPH B;  1Q81 R;  2C0T A;  1GL5 A;  4HCK A;  1UHC A;  5FWC A;  1YNZ A;  3CCS T;  5D7U A;  5CAI A;  1GCQ A;  2QI2 A;  2LQK A;  4MZP A;  2RHY A;  2QEX Q;  1AT1 B;  4WF2 A;  1VQ4 Q;  5GAN f;  4LDV A;  1WIE A;  2KEA A;  4FU6 A;  2E3I A;  3JCM Q;  1YJW T;  4Q5W A;  3G7Z A;  1B34 A;  1UGV A;  2LVM A;  3FJP A;  4DBQ A;  1QVG S;  4PJN A;  5LJ5 j;  3OYE A;  5GAN 4;  3NHN A;  4KUD K;  2RA2 A;  2BKD N;  2O01 E;  2DX1 A;  2ZPB B;  3I5R A;  2K5F A;  3NTI A;  2PNI A;  2DVJ A;  2HEQ A;  2R5M A;  3X24 B;  2YUQ A;  3WVE B;  2AKL A;  3CCV A;  5HKC A;  1BYM A;  2DXC A;  3CD6 Q;  1K9M R;  1OZ3 A;  2B86 A;  2RO0 A;  4A53 A;  2ZCF B;  2KQW A;  2CZ6 B;  3F70 A;  2EQK A;  3EG0 A;  1K4U S;  1RAD B;  3VJP A;  3RR6 A;  2M02 A;  4ELZ C;  1ZHI A;  1U06 A;  4M75 G;  1OOT A;  1QVP A;  2L5Q A;  4J6W A;  2A0F B;  2NYS A;  2FZG B;  2D6F A;  4JDS A;  2DA9 A;  4RTT A;  4CI0 C;  5GAN g;  4OMM A;  3C4S A;  3E2U A;  4FL6 A;  1BB9 A;  3VKI A;  2YUN A;  2FPF A;  4M78 E;  4C0G A;  3QWX X;  1K8A R;  1BCM A;  2QTV A;  5GAM f;  5FU6 B;  2C06 A;  3AT1 B;  3QYG B;  3ZFJ A;  2KRM A;  4PKC C;  3QKJ A;  1UJ0 A;  4XU3 A;  5FU7 C;  4JJC A;  3CCM T;  3CCR Q;  1BI2 A;  1GFC A;  5FRN A;  3VRZ A;  2FL7 A;  2E70 A;  2FPD A;  1S72 A;  5AT1 B;  4ZTJ A;  1WYX A;  1VQ6 T;  4ZGE B;  3CC2 T;  2LMJ A;  2LZ6 B;  4OB0 B;  1V1C A;  2E5K A;  3CME Q;  1AEY A;  4M75 C;  1UDL A;  4C92 E;  1KK7 A;  4GLM A;  1ZUU A;  4XU0 A;  1AWX A;  2FEI A;  1Y71 A;  2DYI A;  1UGP B;  2FRW A;  3WVD B;  3CPW S;  2YRV A;  4EMK A;  5J26 A;  2EYY A;  1W70 A;  1SF9 A;  1NG2 A;  5GAM g;  3H9N A;  3OYJ A;  4XU1 A;  3OW2 P;  2RQU A;  3E1S A;  1G5V A;  4J9E A;  3JB9 F;  4M7A G;  2O88 A;  1VQ5 Q;  3M0U A;  3VS3 A;  1Y57 A;  2O9V A;  1AOJ A;  3P8D A;  4E7K A;  4X34 A;  3OS0 A;  1YIT T;  2E6Z A;  3EGU A;  1KIK A;  3CBO A;  4FYW B;  1TUD A;  2CSI A;  2R57 A;  3SDZ A;  4HCZ A;  2JZ2 A;  1MMG A;  2RI3 A;  1VQ9 Q;  4QW2 A;  1VQM A;  1CSK A;  3CCE Q;  2K9G A;  2L3S A;  4J9C A;  1X43 A;  5KH6 A;  3CCS Q;  2CSQ A;  2K57 A;  4XQ3 A;  1YJ9 A;  2X35 A;  1IO6 A;  3UPU A;  3MCA B;  3GBQ A;  1YHQ T;  2HNI A;  3RKY A;  4BB7 A;  2RK1 A;  3CBP A;  1RUW A;  3V7C A;  2M51 A;  1PRL C;  3SWN A;  2HL5 C;  3VS0 A;  3FLG A;  4J6Y A;  1YJW Q;  3E9G A;  1NYG A;  4FM4 B;  1PRM C;  1VIF A;  4PK4 A;  3M53 A;  2MOX A;  4PNO A;  1YJN T;  2EJ9 A;  2ZGW A;  4M77 D;  1QCF A;  4M7A C;  5LJ5 h;  3LW5 E;  1RAG B;  1NLO C;  1ZUY A;  3M0S A;  3BE3 A;  2RMO A;  2CP7 A;  1PD1 A;  2K3X A;  4PJO E;  1XQH A;  1H3H A;  3OSV A;  3LX7 A;  4JLG A;  1TS9 A;  1X2Q A;  3EGX A;  1OI1 A;  2QA4 Q;  1BIA A;  1RAC B;  4M75 E;  1OPK A;  2E65 A;  1LCK A;  4F7U F;  4X9D A;  2XG8 D;  2C0O A;  5GAN 8;  2H3J A;  3G6E T;  4CRI A;  2ZPI B;  3OYL A;  2JS0 A;  2HQX A;  4M77 A;  2BZ8 A;  2KRN A;  2VC8 A;  3RDV A;  5GMK m;  2DPP B;  4IUQ A;  2DD5 A;  5KCH A;  2KVQ G;  2IPO B;  2Y4X A;  1D1C A;  3PMT A;  1NYF A;  3L1A A;  3MP1 A;  1B3Q A;  4JRQ A;  3A8O B;  2PTK A;  1K0S A;  4J5Y A;  1PSE A;  2E10 A;  4ANJ A;  1N8R R;  2E1H A;  4XK8 E;  5GMK e;  1SEM A;  4NL2 A;  4LN2 A;  4M75 B;  2FHD A;  1ABQ A;  4OMP A;  2D8J A;  2DE0 X;  2EIF A;  1R0C B;  1M1F A;  2X9H A;  2FPE A;  3GNG A;  3TSZ A;  4C0Z A;  1G3Y A;  5I22 A;  3OMG A;  3GF5 A;  3CCM Q;  3V8K A;  1G2B A;  3OMC A;  1FMV A;  2QAS A;  3QYH B;  1E6G A;  5GAO l;  1QVF P;  1VQ6 Q;  1BI0 A;  1NPP A;  1KFZ A;  3V7S A;  4KH1 B;  3JCM X;  3CMA T;  2M9U A;  2JTM A;  2Y90 A;  2ZPG B;  2BE9 B;  3P8H A;  4D8D A;  4RMO A;  2MIO A;  3OYC A;  1FX7 A;  1WJQ A;  4LUE A;  4OF1 A;  1A0N B;  1N8R C;  2BTT A;  2HZY A;  3O5Z A;  3H0F A;  2MK5 A;  2ENM A;  4IIO A;  2LCL A;  3HFO A;  4Y28 E;  2QTX A;  3INZ A;  4FW1 A;  2A36 A;  4JLI A;  1G3T A;  2EJG A;  4M7A E;  3BDL A;  2DD4 A;  2RB6 A;  2MCN A;  1TU0 B;  1QVF S;  2ZZD A;  3G4S T;  2IG0 A;  3M56 A;  3HPW A;  2ABL A;  4X1V A;  3SFM A;  1OU9 A;  5LJ3 g;  3A8H B;  5DLO A;  9ATC B;  1VYT A;  3G71 A;  2EGC A;  1C6V X;  1M90 U;  1P92 A;  4AT1 B;  3CCQ A;  1C0M A;  2JTE A;  3MEV A;  4NOY A;  2BZX A;  1YIJ A;  1VQ4 T;  4M75 A;  3SEM A;  1TSF A;  3MP8 A;  4BDY A;  1M1G A;  4BUG A;  2KMT A;  4IIM A;  1AHJ B;  1T3L A;  2MPX C;  4M7A B;  1PG5 B;  2D0Q B;  2LX7 A;  5CO7 A;  4BI8 B;  1YHQ Q;  4ESR A;  3EGD B;  1TOV A;  5KCO A;  1VQP A;  3VUZ A;  4CC4 B;  1I5O B;  2JN0 A;  1QWF A;  3DB3 A;  4C5I A;  2HCK A;  3CCV T;  4RTU A;  2GGR A;  1Q82 C;  3RES A;  4IUR A;  2CP3 A;  1EIF A;  2A3L A;  1VQO A;  1YJN Q;  2KRS A;  2HBW A;  1N27 A;  2LNV A;  1UEC A;  1MMD A;  1QP2 A;  3X25 B;  5HCK A;  1WFW A;  1AD5 A;  2LT1 A;  4XTZ A;  3GOX A;  1OPL A;  5HK0 A;  3QZ5 B;  3DLL A;  2O4X B;  5GAN 2;  4XTY A;  3JCM g;  2JTF A;  2PVO B;  1PCX A;  1D3B B;  2DTH A;  1WQ7 A;  4PLL A;  3LWH A;  3G6E Q;  1ZA1 B;  3NMZ C;  2YRC A;  4TVR A;  4DEY A;  4ME7 A;  4ELY C;  2GFA A;  1KD1 C;  3I56 A;  5L23 A;  3QBY A;  2WSE E;  4MML A;  1Q86 C;  2VGM A;  4RG2 A;  4EMK C;  5IHK A;  1Q7Y C;  1OEB A;  1G3W A;  1UJY A;  1XOV A;  2W10 A;  4A63 B;  1NM7 A;  3CCR T;  2A7Y A;  1AWO A;  2HAX A;  2CZ7 B;  1D1B A;  4AMC A;  4DBR A;  4M7A A;  4C8Q F;  4II1 A;  1VOM A;  1S72 T;  2KXC A;  4V2S A;  2XKO C;  1M9S A;  4OGE A;  4CC3 A;  3EGD A;  3V8L A;  4M78 F;  1AWW A;  2EW3 A;  1M8V A;  1PD0 A;  1QCN A;  2V8I A;  1B34 B;  1ARK A;  2QQ9 A;  1OX8 A;  2GF7 A;  5DM7 R;  1UTI A;  1VQN A;  1JXM A;  3CC7 T;  4M77 G;  2XDD A;  5GJW B;  4ZN1 A;  4M7D D;  2J6O A;  3CMA Q;  2VV5 A;  2KSS A;  1JBM A;  2KYM A;  2EJF A;  1RAI B;  2FVU A;  1N6A A;  4BY6 C;  1VQK A;  2GBQ A;  4D6W A;  3PTA A;  2VB6 A;  4XAX B;  4FSS A;  3SWN C;  2COZ A;  2KNB B;  2O4X A;  4J7I A;  1YP5 A;  2B8A A;  3QHS A;  3I55 A;  1NJI U;  5GAN e;  1ZSG A;  1D3B A;  2J05 A;  4KGV B;  5C6S A;  3QG1 A;  4C92 F;  4KRT A;  2O31 A;  2VYT A;  3RNJ A;  4M7D A;  3KBG A;  1VQ9 T;  1RAB B;  2D1X A;  3G4S Q;  4XTV A;  4N4G A;  1EX4 A;  1ZSZ A;  2EWN A;  1WNL A;  4OB1 B;  3UWN A;  3OB9 A;  2K3Y A;  3H8Z A;  3A8G B;  3HRU A;  4E47 A;  1YJ9 T;  1D0Y A;  1WHM A;  1MUZ A;  1AZG B;  3TSW A;  5GAO r;  4GY5 A;  3HL8 A;  1DJ7 B;  5GAN h;  4MZT A;  1M3A A;  4JJN K;  4M77 C;  3RIR A;  1HJD A;  3OY9 A;  1YCY A;  2DVE A;  1M1K U;  2K3B A;  5IXB A;  4PFZ A;  2I2L A;  1GCP A;  2QQR A;  2X4W A;  1T0H A;  2QGF B;  4PL6 A;  5DY9 A;  2KE9 A;  1JXO A;  2K5L A;  4JJD A;  4D8K A;  4L5G A;  4WTO B;  4HVU A;  2NUZ A;  3M58 A;  3OYN A;  1Q81 C;  2V1Q A;  3CCV Q;  2EFI A;  1I0C A;  2JMA A;  2VUB A;  3OS1 A;  4OML A;  5GAM e;  1AVZ C;  2K2M A;  2QA4 T;  4OMN A;  1W4S A;  3JCM c;  5CQY A;  2QDL A;  5A2Q E;  4EMK B;  2A08 A;  4J9B A;  3H0H A;  1RAE B;  1K73 R;  3CBM A;  4A54 A;  3QXE B;  5IAY A;  1WJS A;  1LJO A;  1VQ7 A;  3HHT B;  4LDY A;  2EBP A;  2LQ8 A;  1YCS B;  2QGG A;  3L2R A;  3PNW C;  1KQS A;  4QVZ A;  2OTL A;  4J6X A;  1W2B A;  2X3W D;  2NUP B;  3AHU A;  3CCL A;  3NGP A;  4PJO F;  3MO8 A;  3E19 A;  3VS2 A;  2FYK A;  2O2O A;  3O8V A;  1K9M C;  5FRM A;  1LNX A;  4KUL A;  1TG0 A;  2J06 A;  2XDB A;  2EGE A;  4EMG A;  1KQ2 A;  3RUX A;  5GAN d;  1H92 A;  3CPW P;  2KK4 A;  3PMI A;  1F1B B;  2ZAE A;  2ED1 A;  2DJZ A;  4OMF B;  2P0Q A;  3REB B;  1OZ2 A;  4QQ6 A;  1K73 C;  2HD0 A;  4RTY A;  1PWT A;  1S72 Q;  2YRD A;  4BY6 B;  4N4I A;  5IH2 A;  1WA7 A;  3SWN B;  4BE0 A;  1IB8 A;  6AT1 B;  5GMK j;  1K8A C;  1WJR A;  2BIV A;  3JCM b;  1PC0 A;  1MV3 A;  1I4K 1;  2LCC A;  2KDS A;  2RHU A;  3A8M B;  1NEG A;  2ZPF B;  4M77 E;  2AHJ B;  2K79 A;  2XD0 A;  1U5S A;  3L2Q A;  4Z89 A;  2PUK B;  1VA7 A;  3CC7 Q;  4E7I A;  4NL3 A;  5ECA A;  2F2W A;  1Q82 U;  1RLQ C;  4DBH A;  3M54 A;  3L2U A;  4PJM A;  4AG2 C;  4N0A C;  4HT9 A;  3EGX B;  1RI9 A;  3L2V A;  1E7O A;  4J8O A;  3M4G A;  1KC8 U;  1IRX A;  1SSH A;  3CCJ A;  2R58 A;  3EFO A;  1XNI A;  2NUP A;  5D6W A;  1T3S A;  3CCU A;  3G71 T;  1N5Z A;  1YN8 A;  1M3C A;  4M77 B;  1X69 A;  4OB3 B;  3CCQ T;  2NUT B;  3JCM W;  3V7R A;  4R55 A;  5CKE A;  5GAM d;  4C5G A;  2YLC A;  1VQM Q;  1I81 A;  2CP6 A;  2PVG B;  2EQU A;  4C8Q D;  2PZ1 A;  2RM4 A;  1IRE B;  1RLP C;  1ZQ1 A;  5GAN 7;  4DOV A;  4AFZ C;  4ZN3 A;  1YJ9 Q;  1Q7Y U;  3RER A;  4M78 D;  1V76 A;  2M0O A;  4JRK A;  1TUC A;  1Z9Q A;  1VQP T;  4XTU A;  5KE3 A;  4RG8 A;  2QG9 B;  2DL7 A;  3HKS A;  3VYG A;  2MYS A;  1M4Z A;  1WPY A;  1HYO A;  2OAU A;  2CS7 A;  3NFC A;  3GPL A;  1PNJ A;  2JM8 A;  1ZX6 A;  3I35 A;  3M0Q A;  2VXF A;  2ROL A;  2L89 A;  1YI2 A;  5J3B A;  2F2X A;  5KYY B;  3SB2 A;  3U23 A;  1WLP B;  2DRK A;  3JV3 A;  3HTR A;  4Y91 A;  5CR2 A;  2CP0 A;  3J80 E;  1VQO T;  4M7D G;  2DKG A;  2RN8 A;  1QP3 A;  2MAM A;  1MNE A;  2EYZ A;  2COW A;  2EYW A;  2XIC A;  1KHI A;  2DXT A;  3HP9 A;  5A0D A;  2LTO A;  1WXU A;  2ECZ A;  4ZGJ B;  3VS6 A;  4F7U G;  1WHG A;  1UE9 A;  3A98 A;  2CUB A;  4HA8 A;  2OTJ A;  2M16 A;  1R8O B;  3UDC A;  2NLU A;  5CCA A;  1M2O A;  1Y96 B;  4ORZ A;  1W1F A;  3REA B;  2MWO A;  2QQS A;  3OYB A;  2J6K A;  5J39 A;  2YUO A;  1SKU B;  2NUT A;  3I56 T;  2EAY A;  2HBP A;  4XTW A;  1SPK A;  2RI5 A;  1GFD A;  3HRS A;  2V26 A;  3M57 A;  2P0K A;  3HFN A;  2X4Y A;  2JS2 A;  2G6F X;  2EGA A;  2K4Y A;  2M0Y A;  3CXC A;  5FLX E;  2LQN A;  3UF4 A;  4AFU C;  3QUI A;  2E41 A;  1ZUK A;  4RUG A;  3KFV A;  3R6N A;  2PU9 B;  4AFS C;  2BE7 D;  3QWY A;  4E7J A;  1OYX A;  2H8H A;  4M7D C;  1BBZ A;  3OW2 A;  2F5K A;  2JOY A;  5LJ3 f;  1QCO A;  1CKB A;  2DO3 A;  2KI7 A;  2DER A;  3C94 A;  2JJ9 A;  2HKN A;  1ZSZ C;  1UUE A;  4IUP A;  4A4E A;  3PIP A;  4JPB W;  1VQN T;  2VKN A;  2DXU A;  5KYY A;  2JUF A;  2DLP A;  2JT4 A;  1B07 A;  1KG1 A;  2KRO A;  2F69 A;  2OJ2 A;  4E2F B;  1GBR A;  5CK9 A;  7AT1 B;  5LJ5 g;  3DKM A;  4J9D A;  4E7Z A;  1VQK T;  2VVK A;  3P8B B;  5GMK h;  3CC4 A;  1AWJ A;  4C5H A;  5IHI A;  4J83 A;  2EYX A;  1U3O A;  2JMC A;  2LNH B;  1BK2 A;  5GAO p;  4Z88 A;  2AZV A;  2HMA A;  4F16 A;  3CC2 A;  4EMH A;  3QDF A;  1Y96 A;  1LVK A;  2KT8 A;  4GLK A;  1Q95 G;  1FMW A;  1M3B A;  3ME9 A;  2QAZ A;  3OYY A;  4PJO D;  1UEB A;  2ESW A;  2F2V A;  2LJ0 A;  2YSQ A;  2RHZ A;  3RKX A;  3G71 Q;  2QXF A;  1D1A A;  1WX6 A;  5GAN j;  1U1S A;  3CCQ Q;  3HSB A;  4BDZ A;  2I0N A;  1YIJ Q;  3JCM f;  1JEG A;  1GBQ A;  5A0G A;  1RI0 A;  2F5T X;  3GP8 A;  4CC7 A;  1M8M A;  5CKD A;  5CKH A;  4JUV A;  4OMO A;  5LJ3 d;  1YIT A;  2JXB A;  4EDU A;  3H6Z A;  1QWE A;  1TXQ A;  1WQW A;  1JB0 E;  4JRP A;  3N5B B;  2XU8 A;  1VQP Q;  3JAM E;  3GLX A;  3FJ5 A;  1X2K A;  2FO0 A;  1QW1 A;  2X3X D;  2RNA A;  4N0A A;  2DIQ A;  2RI2 A;  2VXE A;  4M7D E;  1EZZ B;  4MDX A;  3OBW A;  1VQO Q;  4LUD A;  4J9F A;  4E7S A;  4C0F A;  5CVI A;  2V8K A;  4IKF A;  2XDP A;  4M4Z A;  4E6R A;  2GFU A;  4F7U E;  3PFS A;  1KHC A;  3JB9 D;  1G3S A;  1VQ7 T;  3JCM V;  1OV3 A;  4FCY A;  1I07 A;  2CH4 W;  2C0I A;  8ATC B;  2FZC B;  5FW9 A;  2P4T A;  1QVF A;  4A4G A;  5GAM j;  1VQ8 A;  3VYH B;  2OTL T;  1WHK A;  2QK0 A;  4N4H A;  3DB4 A;  5HK3 A;  2KXD A;  2GCX A;  3M0T A;  2LCS A;  4M7D B;  3I56 Q;  1IGU A;  2YT6 A;  3BW1 A;  4MDW A;  1IHW A;  3LGF A;  3SD4 A;  4BE2 A;  4KGZ B;  3JCM d;  4C8Q G;  3C95 A;  1HXD A;  1ZSZ B;  1WGS A;  2OI3 A;  3OBY A;  2A37 A;  2RQW A;  2AIR B;  1VQL A;  4A4F A;  4F7U B;  3HRT A;  2Z0W A;  3S3O A;  2K6D A;  1N9R A;  4M78 G;  2IVW A;  3I9Q A;  4PFP A;  1HD3 A;  4Z8A A;  3ASK A;  3THK A;  1JJ2 A;  4QT7 A;  3H0I A;  1OQK A;  5FRO A;  4FT4 A;  4VUB A;  3MP6 A;  1U8R A;  2DZC A;  2RQV A;  1X27 A;  1SHF A;  1VYV A;  2RHX A;  2HKQ B;  5GMK i;  1FMK A;  2RJF A;  3RMS A;  1VQN Q;  1KJW A;  2GNC A;  3LH5 A;  2RPN A;  4B6M A;  4JZ4 A;  2DNU A;  2CZ1 B;  5LL6 S;  3IQL A;  4BAC A;  1D09 B;  2CT3 A;  3M55 A;  1VQK Q;  1IZ6 A;  2D0N A;  1WXT A;  2V8J A;  4X9C A;  1WHH A;  1MMN A;  5IHN A;  1BCO A;  4C92 G;  3PGG A;  3I55 Q;  2PQW A;  3A8L B;  1LPL A;  4J7F A;  1W2B P;  2RQT A;  3VV0 A;  4C8Q C;  2Y4Y A;  3CCJ T;  1NZ9 A;  4FT2 A;  3CCU T;  3OYM A;  4M77 F;  2VGN A;  1VIE A;  2FB7 A;  1KQ1 A;  3EHR A;  1R0B G;  3PIO A;  4ZNX A;  4M78 C;  1M2V B;  2G3R A;  1TTH B;  1WHL A;  1BU1 A;  1TH7 A;  3JSC A;  3TCJ A;  1VQM T;  2LDM A;  1PM3 A;  3ER0 A;  2HDA A;  1Y07 A;  3X28 B;  2L0A A;  4F7U A;  5CIU A;  2AZS A;  2XK0 A;  1UGR B;  4R56 A;  2RJC A;  1W2B S;  2CDT A;  3FEO A;  2DIG A;  2L8D A;  4DQ2 A;  3WXM B;  3JCM J;  3X26 B;  3M0R A;  1SG5 A;  1YI2 T;  4PJJ A;  2QEX A;  1I8F A;  4ZTF A;  2AT1 B;  1VQ4 A;  4C92 C;  1O75 A;  2DYB A;  2RK2 A;  2L3Q A;  3UA7 A;  3TU4 K;  2E4H A;  1SRL A;  2EVR A;  4ZGD B;  3J81 E;  1NEB A;  4HT8 A;  3S6W A;  3J7A F;  3EG3 A;  2KBT A;  1M90 R;  2LT4 A;  3MHX A;  2OTJ T;  3LYI A;  5M9O A;  4C5E A;  3CPF A;  3G1J A;  1X6G A;  4FSX A;  4GBQ A;  2FG0 A;  1N8R U;  2DM1 A;  2CT4 A;  4HCC A;  2YLB A;  2E64 A;  2RD1 A;  1LOJ A;  2K2V A;  1V29 B;  1M2V A;  1VQ7 Q;  3CD6 A;  3GNF B;  5GAN 5;  2LRQ A;  2DZ9 A;  1M30 A;  3TQ7 P;  3RKW A;  3OYD A;  1X01 A;  1K76 A;  5IXF A;  1UGS B;  1R77 A;  3ZL7 C;  4PJO G;  5L8R E;  4JZ3 A;  2OTL Q;  3EFO B;  1I1J A;  1MHN A;  2RQR A;  3CCL Q;  5GAO m;  5GAM h;  3I5S A;  4C8Q E;  5LJ3 j;  2JNG A;  1M90 C;  4M75 F;  3L42 A;  1YWO A;  1AZE A;  5I2S A;  3OYG A;  2XHC A;  1H64 1;  5KE2 A;  1ZBJ A;  3CEY A;  2LC4 A;  2ROT A;  3H41 A;  4HKE A;  2EQI A;  5C0M A;  4JJB A;  2EQM A;  3C12 A; 
#chains in the Genus database with same CATH homology
 1T3L A;  2D8H A;  4ORZ A;  2JW4 A;  1W1F A;  2P4R A;  3REA B;  2LX7 A;  2J6K A;  1ZLM A;  1UG1 A;  2YUO A;  1ABO A;  4F14 A;  1QKW A;  2DBM A;  4ESR A;  4J9H A;  1SPK A;  4CC4 B;  2YUP A;  1GFD A;  1QLY A;  2SRC A;  1QWF A;  2HCK A;  2KGT A;  4RTU A;  2JS2 A;  2G6F X;  2EGA A;  2GGR A;  2M0Y A;  4J9G A;  1S1N A;  2LQN A;  3UF4 A;  4AFU C;  2XMF A;  1ZUK A;  4RUG A;  3KFV A;  2C0T A;  3R6N A;  1GL5 A;  2KRS A;  4AFS C;  4HCK A;  2HBW A;  1UHC A;  5FWC A;  2DIL A;  1YNZ A;  1UEC A;  3VS7 A;  2AK5 A;  1WDX A;  3QWY A;  2YDL A;  1GCQ A;  5HCK A;  2DJQ A;  1YWP A;  2H8H A;  1BBZ A;  1WFW A;  1AD5 A;  4RTX A;  2A28 A;  1OPL A;  3EHQ A;  1CKB A;  3UA6 A;  1WIE A;  2KEA A;  1UUE A;  2LQW A;  3VS4 A;  4JPB W;  4RTV A;  2VKN A;  2DLP A;  2JT4 A;  1B07 A;  1Z9Z A;  1UGV A;  2KRO A;  2GTO A;  3NMZ C;  2OJ2 A;  4DEY A;  1GBR A;  2CUD A;  2DF6 A;  3NHN A;  4J9D A;  5L23 A;  2VVK A;  2DX1 A;  5IHK A;  3I5R A;  1AWJ A;  4Y92 A;  5IHI A;  2EYX A;  2PNI A;  1U3O A;  2DVJ A;  2JMC A;  2HEQ A;  1OEB A;  2LNH B;  1BK2 A;  2YUQ A;  1UJY A;  1XOV A;  2AKL A;  2AZV A;  2W10 A;  4Z88 A;  4F16 A;  3C0C A;  4A63 B;  1NM7 A;  1AWO A;  1QKX A;  2DRM A;  2B86 A;  3ULR B;  2KT8 A;  2KXC A;  3EG0 A;  4CC3 A;  1K4U S;  1M3B A;  1M27 C;  1AWW A;  2EW3 A;  3CQT A;  1U06 A;  1OOT A;  2CRE A;  5GJV B;  1ARK A;  2ESW A;  2F2V A;  2LJ0 A;  3VS1 A;  1EFN A;  2L2P A;  2YSQ A;  2DA9 A;  4RTT A;  1UTI A;  1WX6 A;  4OMM A;  1FYN A;  1BB9 A;  1JXM A;  2O9S A;  2YUN A;  2I0N A;  2FPF A;  3QWX X;  1JEG A;  5GJW B;  4CC2 A;  5EC7 A;  1GBQ A;  1JO8 A;  2J6O A;  1K1Z A;  2KYM A;  2RF0 A;  2GBQ A;  4CC7 A;  2K7A A;  1M8M A;  4FSS A;  2KNB B;  2BZY A;  1SRM A;  1YP5 A;  4OMO A;  2JXB A;  2J6F A;  1QWE A;  2KRM A;  1ZSG A;  1UJ0 A;  4JJC A;  1JQQ A;  1GFC A;  2J05 A;  2EPD A;  3VRZ A;  2VWF A;  3FJ5 A;  1X2K A;  4KRT A;  2FO0 A;  2FPD A;  2X3X D;  2O31 A;  2RNA A;  3RNJ A;  1WYX A;  2L3P A;  2LMJ A;  2D1X A;  2LZ6 B;  1V1C A;  1X6B A;  2ED0 A;  2E5K A;  1AEY A;  1UDL A;  4LUD A;  4J9F A;  3NPF A;  4GLM A;  1ZUU A;  1AWX A;  2FEI A;  4M4Z A;  4E6R A;  1MUZ A;  1AZG B;  3TSW A;  2FRW A;  1PHT A;  1M3A A;  1OV3 A;  2CH4 A;  2KT1 A;  1I07 A;  1MV0 B;  2CH4 W;  2C0I A;  2EYY A;  1HJD A;  1W70 A;  5FW9 A;  2K3B A;  1PKT A;  1NG2 A;  5IXB A;  5FWB A;  1UFF A;  1K9A A;  1GCP A;  3EG2 A;  1T0H A;  2RQU A;  2IIM A;  4J9E A;  2KXD A;  3M0T A;  1W6X A;  2LCS A;  1G83 A;  2O88 A;  2KE9 A;  1JXO A;  3M0U A;  2YT6 A;  3VS3 A;  1Y57 A;  2O9V A;  3EG1 A;  4JJD A;  1AOJ A;  4D8K A;  4HVU A;  5I11 A;  2NUZ A;  2LJ3 A;  1H8K A;  2DL8 A;  3EGU A;  4HVW A;  1KIK A;  1TUD A;  2CSI A;  2OI3 A;  2V1Q A;  2A37 A;  2RQW A;  1I0C A;  2JMA A;  1GCQ C;  2K6D A;  4OML A;  1CSK A;  4LNP A;  2W0Z A;  3TVT A;  1AVZ C;  2K2M A;  4HXJ A;  2LP5 A;  3I9Q A;  4OMN A;  2K9G A;  1HD3 A;  2L3S A;  4Z8A A;  4K11 A;  4J9C A;  1J3T A;  3THK A;  2QDL A;  1X43 A;  2CSQ A;  2A08 A;  4J9B A;  1GRI A;  4QT7 A;  3H0H A;  1IO6 A;  3H0I A;  3GBQ A;  1WI7 A;  2AKK A;  2DMO A;  2RQV A;  1X27 A;  1RUW A;  1SHF A;  1VYV A;  2M51 A;  2EBP A;  1K0X A;  1PRL C;  1WXB A;  1YCS B;  3VS0 A;  1FMK A;  2OAW A;  1KJW A;  2GNC A;  1HSQ A;  3LH5 A;  2RPN A;  4JZ4 A;  2X3W D;  2DNU A;  2GTJ A;  4DEX A;  1NYG A;  3IQL A;  1VYU A;  3NGP A;  2CT3 A;  1PRM C;  2MOX A;  1CKA A;  3VS2 A;  2O2O A;  1QCF A;  2D0N A;  1TG0 A;  2J06 A;  1WXT A;  2EGE A;  2FRY A;  5IHN A;  1E6H A;  1H92 A;  1NLO C;  1ZUY A;  2DBK A;  2RQT A;  3M0S A;  2ED1 A;  3REB B;  2RMO A;  3SHW A;  1H3H A;  1NLP C;  2SEM A;  1X2Q A;  4RTY A;  1PWT A;  3EHR A;  2J7I A;  4ZNX A;  4LE9 A;  2DL3 A;  5IH2 A;  1OPK A;  2V1R A;  1WA7 A;  1BU1 A;  1LCK A;  2EKH A;  2C0O A;  3PE0 A;  2JS0 A;  2BZ8 A;  2KRN A;  1MV3 A;  2HDA A;  2L0A A;  1NEG A;  4EIK A;  2K79 A;  1U5S A;  4Z89 A;  1VA7 A;  2AZS A;  1NYF A;  2HSP A;  1B3Q A;  4RTZ A;  4F17 A;  2PTK A;  5ECA A;  1K0S A;  2F2W A;  4AFQ C;  2CDT A;  1RLQ C;  1SEM A;  1KSW A;  1JU5 C;  1SHG A;  1UHF A;  4LN2 A;  1ABQ A;  4OMP A;  2D8J A;  2DE0 X;  2NWM A;  3M0R A;  4AG2 C;  2FPE A;  1RI9 A;  3TSZ A;  1E7O A;  5I22 A;  2DYB A;  1SSH A;  1T0J A;  1G2B A;  1T3S A;  2L3Q A;  3UA7 A;  1N5Z A;  1YN8 A;  1M3C A;  1X69 A;  1E6G A;  1PKS A;  2DL4 A;  1SRL A;  2EVR A;  1NEB A;  1KFZ A;  3VRY A;  3EG3 A;  2KBT A;  4D8D A;  1Y0M A;  2MIO A;  2DL5 A;  3RBB B;  2PZ1 A;  4LUE A;  1RLP C;  1A0N B;  4RTW A;  3UAT A;  2BTT A;  4AFZ C;  3PVL A;  1X6G A;  4GBQ A;  2FG0 A;  2DM1 A;  2CT4 A;  3O5Z A;  1TUC A;  3H0F A;  3VS5 A;  2ENM A;  1Z9Q A;  4IIO A;  2A36 A;  1M30 A;  2DL7 A;  2LJ1 A;  4J9I A;  2KYB A;  1K76 A;  5IXF A;  2GQI A;  3ZL7 C;  1PNJ A;  2JM8 A;  1ZX6 A;  4JZ3 A;  3I35 A;  2MCN A;  1I1J A;  3M0Q A;  2RQR A;  2ROL A;  2ABL A;  4X1V A;  2F2X A;  3PVQ A;  3I5S A;  3U23 A;  1WLP B;  2DRK A;  3JV3 A;  2JM9 A;  2RN8 A;  1VYT A;  2EGC A;  2EYZ A;  1YWO A;  2JTE A;  2KR3 A;  4WCI A;  4AG1 C;  4R0K A;  1AZE A;  2EYW A;  4HVV A;  4OMQ A;  2BZX A;  1WXU A;  3SEM A;  2ECZ A;  1ZBJ A;  3VS6 A;  1UE9 A;  2ROT A;  3A98 A;  2CUB A;  4IIM A;  3M0P A;  3H41 A;  2EQI A;  4JJB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...