1WXUA

Solution structure of the sh3 domain of mouse peroxisomal biogenesis factor 13
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
93
structure length
93
Chain Sequence
GSSGSSGTNWASGEDDHVVARAEYDFVAVSDEEISFRAGDMLNLALKEQQPKVRGWLLASLDGQTTGLIPANYVKILGKRRGRKTIESGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of the SH3 domain of mouse peroxisomal biogenesis factor 13
rcsb
source organism Mus musculus
molecule tags Protein transport
molecule keywords peroxisomal biogenesis factor 13
total genus 7
structure length 93
sequence length 93
ec nomenclature
pdb deposition date 2005-02-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14604 SH3_9 Variant SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 1wxuA01
2EYYA 1K4US 4CC7A 1WIEA 2K7AA 3NHNA 3EGUA 2J6OA 1WX6A 1LCKA 3R6NA 1QWFA 4IIOA 4RTXA 1X6BA 1OPLA 3M0PA 1ZUUA 1X2QA 2YSQA 4F14A 1X69A 4AFUC 1CKBA 4LUDA 2DL7A 1BB9A 3NGPA 4OMOA 1H92A 1G2BA 4JPBW 2EGEA 4RTZA 1YN8A 4QT7A 1NG2A 5FWCA 1QWEA 4HXJA 4WCIA 1UHFA 3GBQA 1GBRA 3EG1A 2M0YA 2GGRA 4FSSA 4Z88A 3THKA 4KRTA 2KRNA 2DBKA 2KROA 1UTIA 4GLMA 2JM8A 2FRWA 1V1CA 3VS2A 1YWPA 2FEIA 3H41A 4ZNXA 2HEQA 4D8KA 1W70A 1Y57A 2K79A 1WLPB 2GTOA 2J6KA 1H8KA 2JTEA 1NEGA 1UE9A 2CSQA 2DRMA 4JZ3A 4E6RA 1K0XA 2DBMA 1SEMA 1WFWA 1WYXA 1G83A 1N5ZA 2PTKA 1WXTA 3CQTA 2O31A 2OAWA 1NEBA 2DILA 4JJDA 2RQUA 2FO0A 1WDXA 2LJ1A 1OV3A 1OPKA 2ENMA 4HVVA 1UECA 2DX1A 1FMKA 2YUQA 2DLPA 4J9HA 1ABOA 4M4ZA 4CC4B 2O9SA 3KFVA 1E6GA 2W10A 3M0UA 1QKWA 1M8MA 1WXBA 1ZLMA 2W0ZA 5ECAA 1RLPC 2ROTA 1AZGB 2ROLA 1UGVA 5EC7A 1XOVA 1AWXA 2EGAA 2V1QA 2BZXA 1M3BA 2KEAA 2A08A 1K0SA 2VVKA 1SRMA 1J3TA 2B86A 1ABQA 1JO8A 1HJDA 5IH2A 2ED0A 3UA7A 1BK2A 1H3HA 1PKSA 3UF4A 2D8JA 1AZEA 2AK5A 1K9AA 1UJYA 3M0SA 2L2PA 1WI7A 2CH4A 2FPDA 2G6FX 3M0QA 4RTYA 1YNZA 1Y0MA 2O9VA 2K9GA 1T3SA 2A28A 1T0JA 2IIMA 4F16A 2RQTA 5IHNA 1OOTA 1AOJA 1QLYA 1AWOA 2RQRA 1SHFA 4HCKA 1VA7A 2HDAA 3EG0A 1QKXA 1ZBJA 2NUZA 3VS1A 5IHIA 2MIOA 2DM1A 2EYWA 3SEMA 1BBZA 4JJBA 3QWXX 1UJ0A 3QWYA 1MUZA 4J9IA 1E7OA 5FW9A 1B07A 2SRCA 1RLQC 2JM9A 1M3CA 3I9QA 1U3OA 2QDLA 2K2MA 2DL3A 2OJ2A 4GBQA 4OMPA 2X3WD 2KT8A 4AFQC 1JEGA 2JS2A 2AZSA 2V1RA 2KYBA 2DL8A 2DE0X 3PE0A 3TVTA 2FPFA 2A36A 3JV3A 2HSPA 3ULRB 4OMQA 1X43A 2C0IA 2EYXA 1B3QA 1GCQC 2FG0A 2LMJA 1GFCA 1KIKA 3IQLA 4R0KA 2GBQA 3REAB 1GRIA 4RTWA 2DF6A 1K1ZA 4Y92A 3REBB 1ZUKA 2K6DA 2J7IA 2ECZA 2KRMA 2KGTA 5HCKA 2CREA 3I5RA 3VS5A 2DL4A 2JXBA 1IO6A 4LN2A 1JU5C 2CT4A 5IXBA 2M51A 5IXFA 2GQIA 2YUPA 3EHRA 2L3PA 3PVLA 4OMNA 2C0OA 2LCSA 5IHKA 1AVZC 3LH5A 2CUDA 1NM7A 1PRMC 1A0NB 2LQNA 1AWJA 3I35A 3VS0A 4OMMA 2DVJA 2EGCA 3UATA 1AWWA 2VKNA 4CC2A 5I11A 1YWOA 4EIKA 2F2WA 1RI9A 2EQIA 4DEYA 3H0HA 2RQVA 2DMOA 2L3SA 4CC3A 1W6XA 2KXCA 2KT1A 1S1NA 2F2VA 2EW3A 4HVUA 1Z9ZA 4J9EA 1UDLA 2A37A 2AKKA 4DEXA 1YP5A 3ZL7C 1GFDA 2DA9A 4LUEA 1OEBA 2NWMA 2RF0A 1UFFA 1NYFA 5I22A 4K11A 1MV0B 4Z89A 2GNCA 1MV3A 1Z9QA 4IIMA 3VS4A 2DL5A 1FYNA 2BZYA 1ZSGA 2AKLA 1SPKA 2KRSA 2DJQA 2I0NA 1PKTA 1HSQA 1VYUA 2LJ0A 1KFZA 2KE9A 3I5SA 1X2KA 4J9CA 2L3QA 2KXDA 3H0IA 3EHQA 3SHWA 5FWBA 1PHTA 2D0NA 2J05A 4LE9A 2D1XA 2LX7A 2EBPA 2JT4A 1U06A 1CKAA 4RTUA 1T0HA 3NMZC 5GJVB 4AFSC 1ZX6A 2JMAA 4J9FA 1SSHA 2PNIA 2EPDA 2H8HA 1GCQA 5GJWB 4RUGA 3EG3A 2JW4A 1K76A 2KBTA 4OMLA 3TSZA 3VRZA 1JXMA 1UUEA 1U5SA 2ED1A 1VYVA 2YT6A 3VS7A 1SRLA 2CSIA 3H0FA 3M0RA 2RNAA 2J06A 2DNUA 2EYZA 1NLOC 4RTVA 1WA7A 2PZ1A 2J6FA 4ESRA 2SEMA 1W1FA 3VRYA 4X1VA 4A63B 3EG2A 2LP5A 2XMFA 2MCNA 2D8HA 4F17A 1E6HA 4J9GA 4JZ4A 3RNJA 2EKHA 4RTTA 1WXUA 2X3XD 4JJCA 4D8DA 2ESWA 2RPNA 1M3AA 3M0TA 2FRYA 1GBQA 1I07A 2LQWA 2L0AA 1JXOA 1I1JA 2YDLA 1PNJA 4LNPA 3UA6A 1ARKA 2CH4W 2AZVA 2CUBA 2P4RA 4AG2C 2YUOA 1KSWA 4AG1C 1KJWA 2KYMA 2DRKA 1TUCA 2BZ8A 1CSKA 2MOXA 2EVRA 2DYBA 1ZUYA 2FPEA 2JMCA 2RN8A 2OI3A 2KNBB 1NYGA 1UHCA 1AEYA 3VS3A 2ABLA 2HCKA 3FJ5A 2CDTA 2HBWA 2YUNA 2KR3A 1SHGA 4HVWA 1NLPC 1YCSB 4J9BA 1BU1A 1EFNA 1TUDA 1VYTA 2LJ3A 2CT3A 1M27C 2O88A 2RQWA 1TG0A 3C0CA 1GL5A 1HD3A 1T3LA 2BTTA 1AD5A 4Z8AA 1GCPA 1PRLC 2E5KA 2JS0A 5L23A 2K3BA 3U23A 2O2OA 2RMOA 1X27A 2GTJA 3O5ZA 1M30A 1X6GA 3PVQA 2VWFA 3NPFA 1JQQA 4AFZC 2C0TA 2LNHB 4ORZA 1UG1A 1PWTA 3RBBB 2LZ6B 3TSWA 1QCFA 3VS6A 4J9DA 1RUWA 2F2XA 1I0CA 3A98A
chains in the Genus database with same CATH superfamily
4C5GA 4KH0B 3C4SA 1Q82U 4HT9A 3FC3A 2COZA 4CC7A 3CCET 1W2BP 1O75A 5HK3A 1YJNA 5LJ3d 4C0FA 4C8QE 1LCKA 1QWFA 4IIOA 3RKXA 3A1PA 1ZUUA 4XU1A 4R55A 4F7UF 1ZA2B 1M2OA 2DD5A 3ER0A 4J7IA 1OX9A 1IRXA 3X26B 1G3WA 4JRKA 5I2MA 1K9MR 2DL7A 3X20B 3UWNA 3SWNB 5CIUA 5FWCA 1VQ9T 2I2LA 4WCIA 3GIBA 2WSEE 5GAN2 3CCQA 1M1KC 1WHMA 4FSSA 3ZBDA 2KROA 1WNLA 1V1CA 5M9OA 1LJOA 3VU3C 2LCCA 2HEQA 4N4GA 1Y57A 4XAXB 3MO8A 4EMGA 1OI1A 3OYKA 3LGFA 4ATOA 1BIAA 4IUUA 4E6RA 2DBMA 4L5GA 5GMKe 1YIJQ 1WXTA 2OAWA 1RAIB 2HZYA 1U8RA 1JJ2S 2DILA 3GF5A 5LL6S 2RQUA 1TTHB 1WDXA 5A2QE 2LJ1A 3QG1A 1OV3A 5HK0A 1UECA 1AHJB 1PD0A 3L42A 3T9NA 5GAN3 4CC4B 2O9SA 1IZ6A 1KHCA 4C0DB 2YRCA 2PUOB 4Q5WA 1RLPC 2ROTA 1OYXA 2ROLA 1UGVA 3V8JA 4PFZA 3OMGA 1QVGA 4OB3B 2EGAA 3CC2A 2A08A 2ZPBB 1K0SA 5IAYA 2V26A 1N8RU 4M75D 3HSBA 1G3SA 3LWIA 4Z02A 3DLLA 4FCYA 2B86A 1ABQA 3DB4A 2AT1B 4JDSA 3V7SA 3UA7A 1BK2A 4OF1A 2AK5A 1K9AA 1WHLA 1UJYA 3JB9J 3FLGA 2CH4A 2YLCA 4FYYB 1T3SA 2A28A 4JLIA 4F16A 1YBYA 5IHNA 1OOTA 4OGEA 1Y96B 1K73R 1Y07A 3URGA 5KCHA 1Q95G 1KC8R 1VA7A 4BD3A 3EG0A 5GANe 2NUZA 5IHIA 1IGUA 2DM1A 3QWXX 1UJ0A 2M02A 3JSCA 4J6WA 4ZTJA 3CXCS 3RERA 1E7OA 1Q81U 1NJIR 5GAOq 3MP1A 1K73U 4PK4A 2K2MA 5GAOp 4PJOD 4JRQA 1KC8U 1BCMA 4C5EA 2AZSA 2KYBA 3M9QA 4EPCA 2DE0X 1EIFA 2QI2A 3JCMJ 3QYGB 4F04B 1WJRA 2FZGB 3X28B 4C8QF 4CI0C 5LJ5e 5HKCA 3ULRB 4OMQA 1N27A 1OU9A 3RMQA 2EYXA 1GCQC 2FG0A 1WHHA 4E7SA 3IQLA 2PQWA 5KYUB 1D0YA 4R0KA 3OYYA 3JCMc 1M1GA 4RTWA 5LJ3h 3C94A 2DD4A 2DF6A 2O4XA 1D09B 3REBB 2K6DA 3JCMV 2RHZA 2QASA 1QCOA 3JCMf 2CP7A 2L8DA 3VS5A 2JXBA 3BY7A 2F5TX 2DZCA 2CT4A 2RO0A 2V8JA 3LLRA 2GQIA 1YJ9A 3L2UA 2LCSA 2PUKB 4DOWA 4N0AC 3LH5A 3E2UA 3M58A 2D9TA 1SKUB 2YHTA 3QKJA 4PJOE 3I35A 3VS0A 1R77A 3UATA 1AWWA 2VKNA 2QQSA 4CC2A 1R0BG 1VUBA 4DEYA 3H0HA 4QVCA 2L3SA 2DERA 2Z0WA 1W6XA 2JJ9A 3RDVA 4XU3A 1QW1A 2EW3A 5J26A 2HNIA 3HRTA 4BI4A 4N0AA 1Z9ZA 3OBWA 2LNVA 2AKKA 1YJ9Q 5GAN8 2EYQA 4LUEA 1PM3A 2NWMA 5I22A 4Z89A 1MV3A 1YHQA 1MMDA 2P0QA 1SPKA 1YI2Q 2KRSA 3VJPA 1QMCA 1K8AC 2NLUA 4JRIA 2QEXQ 3KUFA 4NS5A 1PKTA 3I56Q 4BACA 2E5QA 2COWA 1JJ2P 1TH7A 3VUZA 2PVGB 4FYWB 4C0GA 1PHTA 4LE9A 3HFOA 1MMAA 3L2WA 1VQ9Q 5GANj 1CKAA 1MMGA 5DLOA 4LXCA 4M7DA 2RHIA 1VQPQ 3M5AA 2PNIA 2EPDA 4NOYA 4EMKB 1Q86C 2DK3A 1OZ3A 3G71A 2DPPB 1K76A 3VRZA 1UUEA 4A54A 5KYYA 2BUDA 4BE2A 3CC4T 1GXIE 3VS7A 1SRLA 2CSIA 3M0RA 2RNAA 1TU0B 2DNUA 4PNOA 1WA7A 3CCLA 2R5AA 5KH6A 4OVAA 1X6OA 4RKUE 1W1FA 1H641 3EGDB 4J9GA 4C8QD 2F5KA 1VQ4Q 1RADB 3RESA 5D6WA 1M2VB 4MZTA 5KYXA 2XU8A 2X51A 2DXBA 2P4TA 2RHXA 2FRYA 2E1HA 3OW2P 4PLLA 4QVZA 1JXOA 4GY5A 4X9DA 1D0ZA 1XNIA 4LNPA 3MJXA 4XTYA 5LJ3f 4FSXA 2P4RA 4AG2C 2B8AA 4GLKA 1KSWA 3M56A 2EJ9A 1CSKA 2MOXA 1ZUYA 3S6WA 3MHXA 3OSSC 1QCNA 2VUBA 1NYGA 1UHCA 1W2BS 3VS3A 2HCKA 1WQ7A 2CDTA 3DKMA 4KBMB 2O4XB 4FIBA 4L6V5 1VQ6A 3L1AA 5KYUA 2VB6A 3ASKA 4KUDK 4C92A 3LW5E 1TUDA 2LJ3A 1VQMA 2RQWA 3SDZA 4BE1A 2NUPA 3V7CA 1T3LA 4QKUA 2BTTA 3L2QA 1KQ2A 2COYA 4M7DD 2GQVA 1M90U 2O2OA 2RMOA 3VV0A 1X27A 3O5ZA 3CCVT 1EZZB 1NE8A 2RI3A 1WHKA 4M7DB 3INZA 2CYZB 2VWFA 1JQQA 2Y4XA 1UG1A 2E65A 4EMKC 2QK0A 3CC2Q 3TSWA 2X9HA 4C92C 1FMVA 2XD0A 1N6AA 1WQWA 1VQ6Q 4LDVA 5D6YA 1D1AA 3CCVA 2FHDA 1WPYA 1WIEA 2YXYA 3NHNA 1C1AA 3EGUA 5LJ5h 4J6YA 2FB7A 3QO3A 4M77E 4RTXA 4M7AF 4C92D 1X6BA 1X2QA 2DAQA 3EGXA 5GANg 3M57A 1X69A 3X25B 3CCJA 4HKEA 5CKEA 1H92A 2E4HA 4A4EA 2XI9A 4XTWA 4HXJA 3H9NA 3HHTB 1SG5A 1UHFA 4YTLA 2RI2A 2VXEA 3HP9A 2D6FA 2KRNA 2DBKA 1UTIA 2WSFE 3OS5A 4GLMA 2JM8A 3VS2A 1H3ZA 2FEIA 4Y28E 2ZPGB 4MDWA 5CKFA 4Y91A 3CCUA 1K0XA 2X4XA 8AT1B 1MMNA 2ZAEA 1N5ZA 4BY6B 1IXDA 3OYDA 2QEXT 2O31A 3GP8A 1D0XA 5CKDA 3I56T 2XDPA 2C06A 1VQPA 3DLMA 3QDFA 2FO0A 4M7DC 3CCQQ 4E2FB 4HVVA 3A8MB 3JB9I 3OS1A 3SD4A 1TSFA 3Q1JA 2YUQA 1M5Q1 2CZ6B 5FROA 2HQHA 1UGRB 4FU6A 1E6GA 5EG2A 1QKWA 1ZLMA 3I56A 4LDXA 1VQ5Q 1AZGB 3MEUA 3H8ZA 1MGQA 1X01A 5GAOl 1XOVA 2V1QA 1OQKA 4LD9K 5GMKh 4C92E 1KD1C 5J39A 3CMAQ 2QGFB 2RA2A 3UF4A 1P92A 2KK4A 3UDCA 2G6FX 2VV5A 4RCBA 2OTJQ 4RTYA 2HAXA 1YCYA 1YNZA 3L2RA 1Y0MA 2O9VA 1LPLA 1V76A 1M1KU 2ZGWA 3OMCA 4RG2A 4M7AD 4C92F 2H3EB 1YJWQ 3LGLA 1AOJA 2BE7D 1AWOA 2E10A 3PT9A 4HCCA 2HDAA 4DBHA 3QSUA 1QKXA 3UT1A 2CP5A 4PJLA 3VS1A 1VQ4A 5KYYB 2EYWA 1Q82R 4JJBA 2ATCB 3QWYA 5FU7B 4HA8A 1PSEA 1MUZA 3CCRA 4J9IA 3JCMd 5FW9A 2P0KA 1RLQC 4M7DE 1M3CA 5KCOA 1U3OA 3OYFA 2QXFA 1JEGA 3CC4Q 2K57A 3LYIA 1VQ8A 1BI2A 2ZCFB 3TVTA 5I21A 2DIGA 4PKCC 4QQGA 5GMKi 1Q81R 4M7AA 1XTDA 2HSPA 3JCMW 4P5NA 1RAGB 2BE9B 2QDYB 4QVDA 5LJ5f 2FZKB 4KH1B 2E3HA 1MNDA 2JZ2A 2GBQA 5GANh 4WTOB 1BI3A 1ZUKA 1EX4A 2KRMA 3LH0A 1PD1A 1C0MA 1IO6A 2CS7A 1JU5C 3QHSA 3TCJA 2X4JA 1VQ7T 2M51A 3CPWS 5GAOn 4OMNA 4KGVB 5IHKA 1PRMC 3CCRT 2HKNA 1AWJA 2DVJA 2EGCA 3S3MA 2MK5A 2CGHA 3G4SA 2QEXA 4OB0B 1N9SA 1G8XA 3M55A 4IUVA 3I55Q 1YJWA 2KXCA 3TEEA 2E41A 5I2SA 5FU7C 4A4FA 3TREA 1Y7XA 1QVFP 4ZGEB 5FRMA 4ZN1A 1NZ9A 1YFNA 3V8LA 5GAMf 1UDLA 2VC8A 2A37A 4HCBA 2DA9A 5GAN4 1W2BA 2GFUA 1NYFA 4PFPA 3CCJT 4TVRA 2GNCA 1FWZA 2BZYA 1YI2A 2L5QA 4FW1A 3V7RA 2LX9A 2AKLA 3OYNA 2DJQA 4FYVB 4C92G 3KXTA 4M75C 2XK0A 4ELYC 2R58A 4ZN3A 1YIJA 2KE9A 3I5SA 4PJOA 1ZQ1A 1VQOQ 2D0NA 2J05A 2LX7A 1VQLQ 1M9SA 1U06A 2QG9B 1S72A 1ACMB 3E9FA 4RTUA 3OYEA 1Q86U 1ZX6A 2HL3A 1SSHA 2KMTA 5CQXA 3CC7Q 4B6MA 4EMHA 3OY9A 3A8OB 3JB9F 3RKWA 3N5BB 3EG3A 4VUBA 5GAMd 1VQPT 3HTRA 3EG9A 3BDUA 3CMEQ 1JXMA 1M1KR 4KGZB 1Q7YU 1U5SA 4PJOC 1KD1R 4QW2A 4IUQA 4ESRA 1RAAB 2SEMA 4BDYA 5A0GA 4A63B 3EG2A 2LP5A 2XMFA 2MCNA 2D8HA 1E6HA 3RKYA 4JZ4A 3RNJA 4M77G 4M7DF 4XTZA 2X3XD 4A4GA 2HL5C 3VKIA 4MDXA 2ESWA 1M3AA 1GBQA 1I07A 1WJQA 2F69A 4A53A 1ARKA 4QQ6A 3MEAA 2HMAA 1BKBA 2DYBA 2JMCA 2RN8A 2OI3A 2K4YA 3EH2A 1AEYA 1RAEB 1K8AU 3FJ5A 1KK7A 3CPWA 2HBWA 2K3XA 4O5VA 1KQSA 1NLPC 3OYHA 3OYJA 2HSEB 3QBYA 4WF2A 4J9BA 5GAOr 1VYTA 3EG9B 1M27C 1TG0A 1HD3A 3G6EQ 4E7JA 2BKDN 4FT4A 2E5KA 2JS0A 2XIDA 5L23A 1TWBA 3U23A 4BI3A 1VQOT 3CCLT 4AT1B 3E9GA 3SFMA 3PVQA 4M78B 1VQ5A 1K8AR 4M77A 4AFZC 2LNHB 1NBEB 4ELZC 3MP8A 4JLGA 1PWTA 2LZ6B 2RHYA 2YRDA 1VQLT 1RL2A 1K73C 2E70A 4J9DA 3CPFA 4PJOB 2DKGA 2M0OA 1MNEA 4XTUA 4C5IA 1K4US 4M78G 5KYNA 1VQ6T 1WX6A 4J6XA 3R6NA 4MZPA 3NTKA 2LQ8A 2YSQA 2HQXA 5LJ3j 4AFUC 8ATCB 1CKBA 2YRVA 4LUDA 3HPWA 1BB9A 2K5IA 4OMOA 3CCSQ 1G2BA 4XQ3A 2EGEA 2PVOB 2ZPIB 1YN8A 4OMFB 3GPLA 3RR6A 4QT7A 1NG2A 3CCSA 3C95A 5GAMj 4C8QA 3G7ZA 3I55T 3GBQA 2E6ZA 4Z88A 2GGRA 3THKA 3ZFJA 4KRTA 1K9MC 2XICA 3P8HA 3MPUB 4ZNXA 1RABB 4CRIA 2K79A 1WLPB 1QVFS 2J6KA 1H8KA 1MHNA 1YJ9T 4KT0E 2JTEA 2BIVA 2QQRA 2DZ9A 4JZ3A 2CSQA 3CXCP 4DBRA 5IN1A 1WYXA 1WFWA 1M90R 4ZTFA 2PTKA 1YJNT 4ZGDB 1NEBA 4M77B 2QA4A 4LDYA 4M78A 1ZSZC 3JCMQ 4M77D 1QQJA 3QUIA 1OPKA 1VQMQ 2X4YA 2DX1A 3J80E 3HL8A 3G6EA 1ZBXA 1N8RR 2DLPA 5GAMh 1KG1A 3CPWP 4M4ZA 2RH2A 2E12A 5GMKm 2GCXA 2W10A 3M0UA 3LWHA 1WXBA 1VIFA 2QA4T 4D6WA 3JCMP 1KQSS 3A8HB 1YITA 1AWXA 2BZXA 1M3BA 2EJGA 2KEAA 2VVKA 1SRMA 1J3TA 3OS2A 2LQKA 3CMAA 3OW2A 1JO8A 1HJDA 3JCMe 2WSCE 4J8OA 1I5LA 5DY9A 2ED0A 1ZHIA 2JOYA 1YHQQ 1PKSA 2D8JA 1IB8A 3VYGA 2L2PA 2FYKA 2OTJA 2FPDA 3M0QA 1HYOA 3M53A 3JAME 2LDMA 3L2VA 4E7IA 4PL6A 1T0JA 3CMEA 3SB2A 2IIMA 2A7YA 2OTLQ 5GANd 2EQUA 1JJ2A 1QLYA 2MPXC 1BI1A 2DJZA 2RK1A 1SHFA 1NJIC 1NPRA 4HCKA 2H3JA 3OBYA 1ZBJA 3CC7T 3CBMA 3SEMA 5LJ5g 1BBZA 5D7UA 2Y90A 4FYXB 2NUTA 3CCMT 3EFRA 4V2SA 1B07A 2JM9A 2MWOA 2A3LA 4M78E 3JCMb 3I9QA 2QDLA 2DL3A 5LJ5d 4OMPA 1NPPA 2E3IA 4AFQC 4OGCA 2E64A 4IUTA 1VQKA 1YITQ 2JTMA 1QP2A 5A0LA 4JJNK 3FJPA 2F1LA 3EGDA 2FPFA 3RMSA 3JB9H 1X43A 2OX7A 2JUFA 3OS0A 5GAN5 1JB0E 2LMJA 4E7LA 1KIKA 2CP6A 4PJOG 1VQKT 2QGGA 1GRIA 2M1HA 1X75C 4EMKA 4Y92A 1D3BB 3QYHB 4IKFA 2MYSA 2ECZA 3P8BB 2KGTA 5HCKA 4B9XA 3I5RA 1VOMA 3ZEHA 1WHJA 4DA4A 5IXBA 4DQ2A 5IXFA 2PU9B 2RHUA 3EHRA 1VQ4T 3GOXA 2IVWA 4M7AB 4M75A 2DTIA 2RM4A 2CUDA 2RD1A 1NM7A 4J83A 2FVUA 3JB9G 3WXMB 4OMMA 1XQHA 1TUGB 2P0PA 1TS9A 4XK8E 4J7FA 1BCOA 2EJFA 2F2WA 4NL3A 4M75G 1OZ2A 2RQVA 4UC4A 4LDUA 2XKOC 4CC3A 4ANJA 4PFOA 2KT1A 5GANf 1DJ7B 1VQ5T 4BB7A 3QJYA 5LJ3e 2ZPHB 2KAFA 3CD6T 4MZMA 4J9EA 3OYLA 2E6NA 3A8LB 1YP5A 1GFDA 1IHWA 2DTHA 1OEBA 5GAMe 2RF0A 1HXDA 4K11A 3CMAT 4RCCA 1Z9QA 1RI0A 3VS4A 3G71Q 2DL5A 3NTIA 1I81A 4IUPA 1ZSGA 2X4WA 2QQAA 1C6VX 5C0MA 1OX8A 1PCXA 3A5ZB 4M75F 1VYUA 3CBPA 3PGGA 4DBQA 2LJ0A 2LTOA 2LC4A 1KFZA 2L3QA 1F1BB 3EHQA 5FWBA 4FW2A 2RJCA 2D1XA 1K9MU 2EBPA 4OB2B 5KYWB 1T0HA 3NMZC 5GJVB 1IREB 5GAOm 3CCST 4AFSC 5L8RE 4J9FA 3RIRA 3CMET 3L2ZA 2MMPA 2H8HA 2ZZDA 5GJWB 3CC7A 4RUGA 2WACA 4OMLA 3TSZA 2NUPB 1YJNQ 3UPUA 4BE0A 2D0QB 4M7AC 1KHIA 2LVMA 1B34B 4PJNA 2VYTA 3QZ5B 4J5YA 5J3BA 3H0FA 4X9CA 2J06A 4RTVA 2PZ1A 2J6FA 3CD6A 5GAN7 1VQMT 4X1VA 4NL2A 3BW1A 2JN0A 1Q82C 1Q81C 3EFOB 5FRNA 4RTTA 1WXUA 4JJCA 2PVDB 1OULA 4A4KA 4D8DA 2MI6A 4PJOF 2QYZA 2LQWA 1U1TA 2YDLA 1PNJA 3UA6A 2DO3A 2JTFA 1RAFB 4O6JA 2CKKA 1HK9A 2YUOA 2HQEA 3AT1B 1PG5B 4XU2A 2NYSA 4AG1C 3GLXA 3OA6A 1KD1U 3CC2T 1M2VA 2KYMA 2DRKA 5FU6C 1IHVA 1TUCA 2EVRA 2FPEA 3NFCA 2KNBB 2ABLA 2HD0A 4QQDA 4C8QG 2A0FB 1BI0A 3CCEA 4HCZA 1SHGA 2MAMA 4HVWA 2O01E 4BUGA 3VYHB 5LJ3g 1N9RA 1TOVA 2EFIA 1BU1A 2KQWA 2DIQA 1B34A 1LOJA 2O88A 1VQ7Q 4BY6C 3C0CA 1GL5A 4KUIA 3JB9D 1AT1B 4MMKA 5GAMg 3HKSA 1AD5A 4Z8AA 1GCPA 1PRLC 3OB9A 1M1FA 1G5VA 2G3RA 2K3BA 1M30A 1G3TA 1X6GA 2KY9A 1I8FA 1FMWA 3NPFA 4ME7A 3HFNA 4ORZA 1Q7YR 1TXQA 3M4YA 3PIPA 3G1JA 1ZSZA 4BI8B 3RBBB 3OYBA 1QCFA 5FLXE 4PJJA 1RUWA 5KE3A 3FRNA 2XHCA 3CCUT 2HBPA 2EYYA 3QPHA 2JNGA 2K7AA 1QVGP 4M7DG 2J6OA 4M75E 2KDSA 2FL7A 3J7AF 1OPLA 3M0PA 2R57A 2MWPA 3EH1A 3OYGA 1Q86R 4F14A 2JVVA 1YITT 1RAHB 4E7ZA 3NGPA 4AMCA 3BFMA 4JPBW 4RTZA 1LVKA 2RK2A 1QWEA 1D1CA 4JS4A 5FU6B 1GBRA 4M7AE 2HKQB 1M8VA 5A0DA 1QVFA 3EG1A 2M0YA 4XTXA 4FT2A 2CZ7B 2FRWA 1YWPA 3G4SQ 3H41A 2DYIA 1PC0A 4D8KA 1W70A 2XDDA 2YLBA 2GTOA 3CCUQ 1NEGA 4IURA 1UE9A 2DRMA 3OYMA 1SEMA 4R56A 3G71T 3CCJQ 1G83A 2RJDA 5CK9A 3HRUA 5KE2A 7AT1B 1WJSA 5CR2A 3CQTA 4F7UE 5KYXB 4F7UG 1QVGS 5HY6A 4JJDA 4JS5A 2ENMA 1YJWT 1FMKA 4J9HA 1ABOA 2K5LA 3R6OA 4KGXB 2M9UA 3KFVA 4C92B 1XJWB 1QVPA 3AHUA 2VXFA 5ECAA 1M8MA 2W0ZA 3JRZA 2DXTA 5EC7A 3CD6Q 1YHQT 3S3NA 2QA4Q 1YI2T 2CZ1B 1O9SA 5IH2A 3QIIA 1H3HA 1AZEA 2QAZA 4PJMA 3OYAA 2YWWA 3M0SA 3O8VA 5CCAA 3PFSA 1WI7A 5CKBA 2VASA 5D6XA 2NUTB 1UGPB 4JRPA 3TU4K 3PMIA 2K9GA 1S72T 1NJIU 2RQTA 1VQ8Q 3EFOA 1VQOA 2K3YA 3G6ET 3CEYA 2DTOA 3TQ7P 3WVEB 2XG8D 2RQRA 5IT9E 2LT1A 3PTAA 4N4HA 3KBGA 5CAIA 3CCMQ 1IGQA 3QXEB 1Q7YC 2EQMA 3PIOA 2KI7A 2MF2A 2MIOA 3VUBA 4M77F 2EAYA 1QP3A 2RI5A 2QTXA 1D1BA 3EGXB 3JCMh 2SRCA 1OU8A 5GMKj 2DXCA 5GMKl 2CP0A 4RG8A 3E19A 2OJ2A 2QQ9A 4MMLA 4GBQA 5DLQE 1Y71A 2X3WD 2KT8A 2JS2A 2OTJT 3CBOA 1W4SA 3M4GA 2V1RA 2DL8A 1WGSA 3PE0A 2EQKA 3C12A 3CCMA 1VQ9A 3EAEA 2A36A 1S72Q 3JV3A 2XDBA 2DVEA 4FL6A 1KQSP 3HRSA 2C0IA 3D7SB 5GAN6 1B3QA 2GF7A 1GFCA 2ZPFB 2EKOA 4EDUA 2EWNA 1BIBA 3REAB 3S3OA 1JBMA 1V29B 1K1ZA 1YIJT 2EQJA 2P84A 3ME9A 2J7IA 2OTLA 1UB4A 2CREA 1PSFA 2DL4A 4LN2A 2DEQA 1SSFA 3A8GB 2YUPA 5CKHA 4HT8A 2L3PA 2QQBA 3PVLA 2C0OA 1AVZC 3GNFB 4M78D 3CCVQ 1G3YA 1A0NB 2LQNA 3BDLA 3FB9A 3OYIA 2M16A 3QDRB 3WVDB 2CP3A 3PNWC 5I11A 3CXCA 4OP0A 1YWOA 4EIKA 1UEBA 1RI9A 2EQIA 4M78F 4C0ZA 1R0CB 2FZCB 1FXXA 4C8QB 2DMOA 3DB3A 3MEWA 3OSVA 1WZOA 3CC4A 1S1NA 2F2VA 1VQNT 3QZ9B 3SWNA 4HVUA 2VGNA 3MCAB 4DBFA 4DEXA 3ZL7C 2RB6A 1D3BA 5CVIA 1UFFA 1MV0B 2K2VA 2QTVA 3OYCA 2X35A 3EFSA 4IIMA 2VGMA 1FYNA 1VQ7A 1Y96A 4JUVA 1N8RC 3QJ6A 4PLIA 2KVQG 2RJEA 2I0NA 2IPOB 2DFUA 2OTLT 5LJ5j 1HSQA 3X24B 6AT1B 3CCQT 3PMTA 3F70A 4LD6A 3OW2S 3V8KA 1X2KA 4J9CA 1LNXA 2LCLA 2DXUA 4XU0A 2KXDA 3H0IA 3I55A 4II1A 3SHWA 3CCLQ 1I5OB 2GFAA 3H6ZA 2JT4A 2LT4A 5KYWA 3META 4F7UB 1RACB 2R5MA 4LDWA 4DOVA 2JMAA 1M90C 4M78C 2K5FA 4XTVA 2L89A 3JCMg 3M59A 1GCQA 3FDRA 2JW4A 2KBTA 3MKDA 4C5HA 2AIRB 4BDZA 2ZPEB 3OQ5A 3P8DA 3JCMX 3G4ST 2ED1A 1VYVA 2YT6A 4N4IA 4A4HA 1B7TA 4KULA 2EYZA 1NLOC 1VQLA 3VRYA 5CO7A 4E7KA 2IG0A 4F17A 3MEVA 1I4K1 2EKHA 3NTHA 2OAUA 4C8QC 1VQ8T 1SF9A 4L59A 1KC8C 2RPNA 3M0TA 5DM7R 3CCRQ 3LX7A 2L0AA 5AYFA 2L3RA 1I1JA 9ATCB 2V8IA 2RJFA 3GNGA 2CH4W 2AZVA 3SWNC 2CUBA 2CP2A 3FEOA 1R8OB 1WHGA 3FIFA 1KJWA 2LRQA 2Y4YA 2BZ8A 3MP6A 3BE3A 1M4ZA 4E7HA 3E1SA 1VQNQ 3J81E 1VQKQ 2V8KA 2DETA 3M54A 2YUNA 2KR3A 1KQ1A 3CCEQ 4M75B 4X34A 2AHJB 1ZA1B 1YCSB 1EFNA 2CT3A 4B9WA 4FM4B 5CQYA 1UGQB 2EIFA 2KSSA 4M77C 4M7AG 5C6SA 2GTJA 1ZSZB 4F7UA 2CZ0B 1U1SA 4RMOA 2C0TA 1BYMA 5AT1B 1FX7A 2DEUA 1VIEA 4E47A 1VQNA 3VS6A 1JRIA 4C0DC 2F2XA 3RUXA 1UGSB 4OB1B 4ZGJB 1I0CA 3A98A
chains in the Genus database with same CATH topology
2EYYA 1K4US 4CC7A 1WIEA 2K7AA 3NHNA 3EGUA 2J6OA 1WX6A 1LCKA 3R6NA 1QWFA 4IIOA 4RTXA 1X6BA 1OPLA 3M0PA 1ZUUA 1X2QA 2YSQA 4F14A 1X69A 4AFUC 1CKBA 4LUDA 2DL7A 1BB9A 3NGPA 4OMOA 1H92A 1G2BA 4JPBW 2EGEA 4RTZA 1YN8A 4QT7A 1NG2A 5FWCA 1QWEA 4HXJA 4WCIA 1UHFA 3GBQA 1GBRA 3EG1A 2M0YA 2GGRA 4FSSA 4Z88A 3THKA 4KRTA 2KRNA 2DBKA 2KROA 1UTIA 4GLMA 2JM8A 2FRWA 1V1CA 3VS2A 1YWPA 2FEIA 3H41A 4ZNXA 2HEQA 4D8KA 1W70A 1Y57A 2K79A 1WLPB 2GTOA 2J6KA 1H8KA 2JTEA 1NEGA 1UE9A 2CSQA 2DRMA 4JZ3A 4E6RA 1K0XA 2DBMA 1SEMA 1WFWA 1WYXA 1G83A 1N5ZA 2PTKA 1WXTA 3CQTA 2O31A 2OAWA 1NEBA 2DILA 4JJDA 2RQUA 2FO0A 1WDXA 2LJ1A 1OV3A 1OPKA 2ENMA 4HVVA 1UECA 2DX1A 1FMKA 2YUQA 2DLPA 4J9HA 1ABOA 4M4ZA 4CC4B 2O9SA 3KFVA 1E6GA 2W10A 3M0UA 1QKWA 1M8MA 1WXBA 1ZLMA 2W0ZA 5ECAA 1RLPC 2ROTA 1AZGB 2ROLA 1UGVA 5EC7A 1XOVA 1AWXA 2EGAA 2V1QA 2BZXA 1M3BA 2KEAA 2A08A 1K0SA 2VVKA 1SRMA 1J3TA 2B86A 1ABQA 1JO8A 1HJDA 5IH2A 2ED0A 3UA7A 1BK2A 1H3HA 1PKSA 3UF4A 2D8JA 1AZEA 2AK5A 1K9AA 1UJYA 3M0SA 2L2PA 1WI7A 2CH4A 2FPDA 2G6FX 3M0QA 4RTYA 1YNZA 1Y0MA 2O9VA 2K9GA 1T3SA 2A28A 1T0JA 2IIMA 4F16A 2RQTA 5IHNA 1OOTA 1AOJA 1QLYA 1AWOA 2RQRA 1SHFA 4HCKA 1VA7A 2HDAA 3EG0A 1QKXA 1ZBJA 2NUZA 3VS1A 5IHIA 2MIOA 2DM1A 2EYWA 3SEMA 1BBZA 4JJBA 3QWXX 1UJ0A 3QWYA 1MUZA 4J9IA 1E7OA 5FW9A 1B07A 2SRCA 1RLQC 2JM9A 1M3CA 3I9QA 1U3OA 2QDLA 2K2MA 2DL3A 2OJ2A 4GBQA 4OMPA 2X3WD 2KT8A 4AFQC 1JEGA 2JS2A 2AZSA 2V1RA 2KYBA 2DL8A 2DE0X 3PE0A 3TVTA 2FPFA 2A36A 3JV3A 2HSPA 3ULRB 4OMQA 1X43A 2C0IA 2EYXA 1B3QA 1GCQC 2FG0A 2LMJA 1GFCA 1KIKA 3IQLA 4R0KA 2GBQA 3REAB 1GRIA 4RTWA 2DF6A 1K1ZA 4Y92A 3REBB 1ZUKA 2K6DA 2J7IA 2ECZA 2KRMA 2KGTA 5HCKA 2CREA 3I5RA 3VS5A 2DL4A 2JXBA 1IO6A 4LN2A 1JU5C 2CT4A 5IXBA 2M51A 5IXFA 2GQIA 2YUPA 3EHRA 2L3PA 3PVLA 4OMNA 2C0OA 2LCSA 5IHKA 1AVZC 3LH5A 2CUDA 1NM7A 1PRMC 1A0NB 2LQNA 1AWJA 3I35A 3VS0A 4OMMA 2DVJA 2EGCA 3UATA 1AWWA 2VKNA 4CC2A 5I11A 1YWOA 4EIKA 2F2WA 1RI9A 2EQIA 4DEYA 3H0HA 2RQVA 2DMOA 2L3SA 4CC3A 1W6XA 2KXCA 2KT1A 1S1NA 2F2VA 2EW3A 4HVUA 1Z9ZA 4J9EA 1UDLA 2A37A 2AKKA 4DEXA 1YP5A 3ZL7C 1GFDA 2DA9A 4LUEA 1OEBA 2NWMA 2RF0A 1UFFA 1NYFA 5I22A 4K11A 1MV0B 4Z89A 2GNCA 1MV3A 1Z9QA 4IIMA 3VS4A 2DL5A 1FYNA 2BZYA 1ZSGA 2AKLA 1SPKA 2KRSA 2DJQA 2I0NA 1PKTA 1HSQA 1VYUA 2LJ0A 1KFZA 2KE9A 3I5SA 1X2KA 4J9CA 2L3QA 2KXDA 3H0IA 3EHQA 3SHWA 5FWBA 1PHTA 2D0NA 2J05A 4LE9A 2D1XA 2LX7A 2EBPA 2JT4A 1U06A 1CKAA 4RTUA 1T0HA 3NMZC 5GJVB 4AFSC 1ZX6A 2JMAA 4J9FA 1SSHA 2PNIA 2EPDA 2H8HA 1GCQA 5GJWB 4RUGA 3EG3A 2JW4A 1K76A 2KBTA 4OMLA 3TSZA 3VRZA 1JXMA 1UUEA 1U5SA 2ED1A 1VYVA 2YT6A 3VS7A 1SRLA 2CSIA 3H0FA 3M0RA 2RNAA 2J06A 2DNUA 2EYZA 1NLOC 4RTVA 1WA7A 2PZ1A 2J6FA 4ESRA 2SEMA 1W1FA 3VRYA 4X1VA 4A63B 3EG2A 2LP5A 2XMFA 2MCNA 2D8HA 4F17A 1E6HA 4J9GA 4JZ4A 3RNJA 2EKHA 4RTTA 1WXUA 2X3XD 4JJCA 4D8DA 2ESWA 2RPNA 1M3AA 3M0TA 2FRYA 1GBQA 1I07A 2LQWA 2L0AA 1JXOA 1I1JA 2YDLA 1PNJA 4LNPA 3UA6A 1ARKA 2CH4W 2AZVA 2CUBA 2P4RA 4AG2C 2YUOA 1KSWA 4AG1C 1KJWA 2KYMA 2DRKA 1TUCA 2BZ8A 1CSKA 2MOXA 2EVRA 2DYBA 1ZUYA 2FPEA 2JMCA 2RN8A 2OI3A 2KNBB 1NYGA 1UHCA 1AEYA 3VS3A 2ABLA 2HCKA 3FJ5A 2CDTA 2HBWA 2YUNA 2KR3A 1SHGA 4HVWA 1NLPC 1YCSB 4J9BA 1BU1A 1EFNA 1TUDA 1VYTA 2LJ3A 2CT3A 1M27C 2O88A 2RQWA 1TG0A 3C0CA 1GL5A 1HD3A 1T3LA 2BTTA 1AD5A 4Z8AA 1GCPA 1PRLC 2E5KA 2JS0A 5L23A 2K3BA 3U23A 2O2OA 2RMOA 1X27A 2GTJA 3O5ZA 1M30A 1X6GA 3PVQA 2VWFA 3NPFA 1JQQA 4AFZC 2C0TA 2LNHB 4ORZA 1UG1A 1PWTA 3RBBB 2LZ6B 3TSWA 1QCFA 3VS6A 4J9DA 1RUWA 2F2XA 1I0CA 3A98A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EYY A;  1K4U S;  4CC7 A;  1WIE A;  2K7A A;  3NHN A;  3EGU A;  2J6O A;  1WX6 A;  1LCK A;  3R6N A;  1QWF A;  4IIO A;  4RTX A;  1X6B A;  1OPL A;  3M0P A;  1ZUU A;  1X2Q A;  2YSQ A;  4F14 A;  1X69 A;  4AFU C;  1CKB A;  4LUD A;  2DL7 A;  1BB9 A;  3NGP A;  4OMO A;  1H92 A;  1G2B A;  4JPB W;  2EGE A;  4RTZ A;  1YN8 A;  4QT7 A;  1NG2 A;  5FWC A;  1QWE A;  4HXJ A;  4WCI A;  1UHF A;  3GBQ A;  1GBR A;  3EG1 A;  2M0Y A;  2GGR A;  4FSS A;  4Z88 A;  3THK A;  4KRT A;  2KRN A;  2DBK A;  2KRO A;  1UTI A;  4GLM A;  2JM8 A;  2FRW A;  1V1C A;  3VS2 A;  1YWP A;  2FEI A;  3H41 A;  4ZNX A;  2HEQ A;  4D8K A;  1W70 A;  1Y57 A;  2K79 A;  1WLP B;  2GTO A;  2J6K A;  1H8K A;  2JTE A;  1NEG A;  1UE9 A;  2CSQ A;  2DRM A;  4JZ3 A;  4E6R A;  1K0X A;  2DBM A;  1SEM A;  1WFW A;  1WYX A;  1G83 A;  1N5Z A;  2PTK A;  1WXT A;  3CQT A;  2O31 A;  2OAW A;  1NEB A;  2DIL A;  4JJD A;  2RQU A;  2FO0 A;  1WDX A;  2LJ1 A;  1OV3 A;  1OPK A;  2ENM A;  4HVV A;  1UEC A;  2DX1 A;  1FMK A;  2YUQ A;  2DLP A;  4J9H A;  1ABO A;  4M4Z A;  4CC4 B;  2O9S A;  3KFV A;  1E6G A;  2W10 A;  3M0U A;  1QKW A;  1M8M A;  1WXB A;  1ZLM A;  2W0Z A;  5ECA A;  1RLP C;  2ROT A;  1AZG B;  2ROL A;  1UGV A;  5EC7 A;  1XOV A;  1AWX A;  2EGA A;  2V1Q A;  2BZX A;  1M3B A;  2KEA A;  2A08 A;  1K0S A;  2VVK A;  1SRM A;  1J3T A;  2B86 A;  1ABQ A;  1JO8 A;  1HJD A;  5IH2 A;  2ED0 A;  3UA7 A;  1BK2 A;  1H3H A;  1PKS A;  3UF4 A;  2D8J A;  1AZE A;  2AK5 A;  1K9A A;  1UJY A;  3M0S A;  2L2P A;  1WI7 A;  2CH4 A;  2FPD A;  2G6F X;  3M0Q A;  4RTY A;  1YNZ A;  1Y0M A;  2O9V A;  2K9G A;  1T3S A;  2A28 A;  1T0J A;  2IIM A;  4F16 A;  2RQT A;  5IHN A;  1OOT A;  1AOJ A;  1QLY A;  1AWO A;  2RQR A;  1SHF A;  4HCK A;  1VA7 A;  2HDA A;  3EG0 A;  1QKX A;  1ZBJ A;  2NUZ A;  3VS1 A;  5IHI A;  2MIO A;  2DM1 A;  2EYW A;  3SEM A;  1BBZ A;  4JJB A;  3QWX X;  1UJ0 A;  3QWY A;  1MUZ A;  4J9I A;  1E7O A;  5FW9 A;  1B07 A;  2SRC A;  1RLQ C;  2JM9 A;  1M3C A;  3I9Q A;  1U3O A;  2QDL A;  2K2M A;  2DL3 A;  2OJ2 A;  4GBQ A;  4OMP A;  2X3W D;  2KT8 A;  4AFQ C;  1JEG A;  2JS2 A;  2AZS A;  2V1R A;  2KYB A;  2DL8 A;  2DE0 X;  3PE0 A;  3TVT A;  2FPF A;  2A36 A;  3JV3 A;  2HSP A;  3ULR B;  4OMQ A;  1X43 A;  2C0I A;  2EYX A;  1B3Q A;  1GCQ C;  2FG0 A;  2LMJ A;  1GFC A;  1KIK A;  3IQL A;  4R0K A;  2GBQ A;  3REA B;  1GRI A;  4RTW A;  2DF6 A;  1K1Z A;  4Y92 A;  3REB B;  1ZUK A;  2K6D A;  2J7I A;  2ECZ A;  2KRM A;  2KGT A;  5HCK A;  2CRE A;  3I5R A;  3VS5 A;  2DL4 A;  2JXB A;  1IO6 A;  4LN2 A;  1JU5 C;  2CT4 A;  5IXB A;  2M51 A;  5IXF A;  2GQI A;  2YUP A;  3EHR A;  2L3P A;  3PVL A;  4OMN A;  2C0O A;  2LCS A;  5IHK A;  1AVZ C;  3LH5 A;  2CUD A;  1NM7 A;  1PRM C;  1A0N B;  2LQN A;  1AWJ A;  3I35 A;  3VS0 A;  4OMM A;  2DVJ A;  2EGC A;  3UAT A;  1AWW A;  2VKN A;  4CC2 A;  5I11 A;  1YWO A;  4EIK A;  2F2W A;  1RI9 A;  2EQI A;  4DEY A;  3H0H A;  2RQV A;  2DMO A;  2L3S A;  4CC3 A;  1W6X A;  2KXC A;  2KT1 A;  1S1N A;  2F2V A;  2EW3 A;  4HVU A;  1Z9Z A;  4J9E A;  1UDL A;  2A37 A;  2AKK A;  4DEX A;  1YP5 A;  3ZL7 C;  1GFD A;  2DA9 A;  4LUE A;  1OEB A;  2NWM A;  2RF0 A;  1UFF A;  1NYF A;  5I22 A;  4K11 A;  1MV0 B;  4Z89 A;  2GNC A;  1MV3 A;  1Z9Q A;  4IIM A;  3VS4 A;  2DL5 A;  1FYN A;  2BZY A;  1ZSG A;  2AKL A;  1SPK A;  2KRS A;  2DJQ A;  2I0N A;  1PKT A;  1HSQ A;  1VYU A;  2LJ0 A;  1KFZ A;  2KE9 A;  3I5S A;  1X2K A;  4J9C A;  2L3Q A;  2KXD A;  3H0I A;  3EHQ A;  3SHW A;  5FWB A;  1PHT A;  2D0N A;  2J05 A;  4LE9 A;  2D1X A;  2LX7 A;  2EBP A;  2JT4 A;  1U06 A;  1CKA A;  4RTU A;  1T0H A;  3NMZ C;  5GJV B;  4AFS C;  1ZX6 A;  2JMA A;  4J9F A;  1SSH A;  2PNI A;  2EPD A;  2H8H A;  1GCQ A;  5GJW B;  4RUG A;  3EG3 A;  2JW4 A;  1K76 A;  2KBT A;  4OML A;  3TSZ A;  3VRZ A;  1JXM A;  1UUE A;  1U5S A;  2ED1 A;  1VYV A;  2YT6 A;  3VS7 A;  1SRL A;  2CSI A;  3H0F A;  3M0R A;  2RNA A;  2J06 A;  2DNU A;  2EYZ A;  1NLO C;  4RTV A;  1WA7 A;  2PZ1 A;  2J6F A;  4ESR A;  2SEM A;  1W1F A;  3VRY A;  4X1V A;  4A63 B;  3EG2 A;  2LP5 A;  2XMF A;  2MCN A;  2D8H A;  4F17 A;  1E6H A;  4J9G A;  4JZ4 A;  3RNJ A;  2EKH A;  4RTT A;  1WXU A;  2X3X D;  4JJC A;  4D8D A;  2ESW A;  2RPN A;  1M3A A;  3M0T A;  2FRY A;  1GBQ A;  1I07 A;  2LQW A;  2L0A A;  1JXO A;  1I1J A;  2YDL A;  1PNJ A;  4LNP A;  3UA6 A;  1ARK A;  2CH4 W;  2AZV A;  2CUB A;  2P4R A;  4AG2 C;  2YUO A;  1KSW A;  4AG1 C;  1KJW A;  2KYM A;  2DRK A;  1TUC A;  2BZ8 A;  1CSK A;  2MOX A;  2EVR A;  2DYB A;  1ZUY A;  2FPE A;  2JMC A;  2RN8 A;  2OI3 A;  2KNB B;  1NYG A;  1UHC A;  1AEY A;  3VS3 A;  2ABL A;  2HCK A;  3FJ5 A;  2CDT A;  2HBW A;  2YUN A;  2KR3 A;  1SHG A;  4HVW A;  1NLP C;  1YCS B;  4J9B A;  1BU1 A;  1EFN A;  1TUD A;  1VYT A;  2LJ3 A;  2CT3 A;  1M27 C;  2O88 A;  2RQW A;  1TG0 A;  3C0C A;  1GL5 A;  1HD3 A;  1T3L A;  2BTT A;  1AD5 A;  4Z8A A;  1GCP A;  1PRL C;  2E5K A;  2JS0 A;  5L23 A;  2K3B A;  3U23 A;  2O2O A;  2RMO A;  1X27 A;  2GTJ A;  3O5Z A;  1M30 A;  1X6G A;  3PVQ A;  2VWF A;  3NPF A;  1JQQ A;  4AFZ C;  2C0T A;  2LNH B;  4ORZ A;  1UG1 A;  1PWT A;  3RBB B;  2LZ6 B;  3TSW A;  1QCF A;  3VS6 A;  4J9D A;  1RUW A;  2F2X A;  1I0C A;  3A98 A; 
#chains in the Genus database with same CATH topology
 4C5G A;  4KH0 B;  3C4S A;  1Q82 U;  4HT9 A;  3FC3 A;  2COZ A;  4CC7 A;  3CCE T;  1W2B P;  1O75 A;  5HK3 A;  1YJN A;  5LJ3 d;  4C0F A;  4C8Q E;  1LCK A;  1QWF A;  4IIO A;  3RKX A;  3A1P A;  1ZUU A;  4XU1 A;  4R55 A;  4F7U F;  1ZA2 B;  1M2O A;  2DD5 A;  3ER0 A;  4J7I A;  1OX9 A;  1IRX A;  3X26 B;  1G3W A;  4JRK A;  5I2M A;  1K9M R;  2DL7 A;  3X20 B;  3UWN A;  3SWN B;  5CIU A;  5FWC A;  1VQ9 T;  2I2L A;  4WCI A;  3GIB A;  2WSE E;  5GAN 2;  3CCQ A;  1M1K C;  1WHM A;  4FSS A;  3ZBD A;  2KRO A;  1WNL A;  1V1C A;  5M9O A;  1LJO A;  3VU3 C;  2LCC A;  2HEQ A;  4N4G A;  1Y57 A;  4XAX B;  3MO8 A;  4EMG A;  1OI1 A;  3OYK A;  3LGF A;  4ATO A;  1BIA A;  4IUU A;  4E6R A;  2DBM A;  4L5G A;  5GMK e;  1YIJ Q;  1WXT A;  2OAW A;  1RAI B;  2HZY A;  1U8R A;  1JJ2 S;  2DIL A;  3GF5 A;  5LL6 S;  2RQU A;  1TTH B;  1WDX A;  5A2Q E;  2LJ1 A;  3QG1 A;  1OV3 A;  5HK0 A;  1UEC A;  1AHJ B;  1PD0 A;  3L42 A;  3T9N A;  5GAN 3;  4CC4 B;  2O9S A;  1IZ6 A;  1KHC A;  4C0D B;  2YRC A;  2PUO B;  4Q5W A;  1RLP C;  2ROT A;  1OYX A;  2ROL A;  1UGV A;  3V8J A;  4PFZ A;  3OMG A;  1QVG A;  4OB3 B;  2EGA A;  3CC2 A;  2A08 A;  2ZPB B;  1K0S A;  5IAY A;  2V26 A;  1N8R U;  4M75 D;  3HSB A;  1G3S A;  3LWI A;  4Z02 A;  3DLL A;  4FCY A;  2B86 A;  1ABQ A;  3DB4 A;  2AT1 B;  4JDS A;  3V7S A;  3UA7 A;  1BK2 A;  4OF1 A;  2AK5 A;  1K9A A;  1WHL A;  1UJY A;  3JB9 J;  3FLG A;  2CH4 A;  2YLC A;  4FYY B;  1T3S A;  2A28 A;  4JLI A;  4F16 A;  1YBY A;  5IHN A;  1OOT A;  4OGE A;  1Y96 B;  1K73 R;  1Y07 A;  3URG A;  5KCH A;  1Q95 G;  1KC8 R;  1VA7 A;  4BD3 A;  3EG0 A;  5GAN e;  2NUZ A;  5IHI A;  1IGU A;  2DM1 A;  3QWX X;  1UJ0 A;  2M02 A;  3JSC A;  4J6W A;  4ZTJ A;  3CXC S;  3RER A;  1E7O A;  1Q81 U;  1NJI R;  5GAO q;  3MP1 A;  1K73 U;  4PK4 A;  2K2M A;  5GAO p;  4PJO D;  4JRQ A;  1KC8 U;  1BCM A;  4C5E A;  2AZS A;  2KYB A;  3M9Q A;  4EPC A;  2DE0 X;  1EIF A;  2QI2 A;  3JCM J;  3QYG B;  4F04 B;  1WJR A;  2FZG B;  3X28 B;  4C8Q F;  4CI0 C;  5LJ5 e;  5HKC A;  3ULR B;  4OMQ A;  1N27 A;  1OU9 A;  3RMQ A;  2EYX A;  1GCQ C;  2FG0 A;  1WHH A;  4E7S A;  3IQL A;  2PQW A;  5KYU B;  1D0Y A;  4R0K A;  3OYY A;  3JCM c;  1M1G A;  4RTW A;  5LJ3 h;  3C94 A;  2DD4 A;  2DF6 A;  2O4X A;  1D09 B;  3REB B;  2K6D A;  3JCM V;  2RHZ A;  2QAS A;  1QCO A;  3JCM f;  2CP7 A;  2L8D A;  3VS5 A;  2JXB A;  3BY7 A;  2F5T X;  2DZC A;  2CT4 A;  2RO0 A;  2V8J A;  3LLR A;  2GQI A;  1YJ9 A;  3L2U A;  2LCS A;  2PUK B;  4DOW A;  4N0A C;  3LH5 A;  3E2U A;  3M58 A;  2D9T A;  1SKU B;  2YHT A;  3QKJ A;  4PJO E;  3I35 A;  3VS0 A;  1R77 A;  3UAT A;  1AWW A;  2VKN A;  2QQS A;  4CC2 A;  1R0B G;  1VUB A;  4DEY A;  3H0H A;  4QVC A;  2L3S A;  2DER A;  2Z0W A;  1W6X A;  2JJ9 A;  3RDV A;  4XU3 A;  1QW1 A;  2EW3 A;  5J26 A;  2HNI A;  3HRT A;  4BI4 A;  4N0A A;  1Z9Z A;  3OBW A;  2LNV A;  2AKK A;  1YJ9 Q;  5GAN 8;  2EYQ A;  4LUE A;  1PM3 A;  2NWM A;  5I22 A;  4Z89 A;  1MV3 A;  1YHQ A;  1MMD A;  2P0Q A;  1SPK A;  1YI2 Q;  2KRS A;  3VJP A;  1QMC A;  1K8A C;  2NLU A;  4JRI A;  2QEX Q;  3KUF A;  4NS5 A;  1PKT A;  3I56 Q;  4BAC A;  2E5Q A;  2COW A;  1JJ2 P;  1TH7 A;  3VUZ A;  2PVG B;  4FYW B;  4C0G A;  1PHT A;  4LE9 A;  3HFO A;  1MMA A;  3L2W A;  1VQ9 Q;  5GAN j;  1CKA A;  1MMG A;  5DLO A;  4LXC A;  4M7D A;  2RHI A;  1VQP Q;  3M5A A;  2PNI A;  2EPD A;  4NOY A;  4EMK B;  1Q86 C;  2DK3 A;  1OZ3 A;  3G71 A;  2DPP B;  1K76 A;  3VRZ A;  1UUE A;  4A54 A;  5KYY A;  2BUD A;  4BE2 A;  3CC4 T;  1GXI E;  3VS7 A;  1SRL A;  2CSI A;  3M0R A;  2RNA A;  1TU0 B;  2DNU A;  4PNO A;  1WA7 A;  3CCL A;  2R5A A;  5KH6 A;  4OVA A;  1X6O A;  4RKU E;  1W1F A;  1H64 1;  3EGD B;  4J9G A;  4C8Q D;  2F5K A;  1VQ4 Q;  1RAD B;  3RES A;  5D6W A;  1M2V B;  4MZT A;  5KYX A;  2XU8 A;  2X51 A;  2DXB A;  2P4T A;  2RHX A;  2FRY A;  2E1H A;  3OW2 P;  4PLL A;  4QVZ A;  1JXO A;  4GY5 A;  4X9D A;  1D0Z A;  1XNI A;  4LNP A;  3MJX A;  4XTY A;  5LJ3 f;  4FSX A;  2P4R A;  4AG2 C;  2B8A A;  4GLK A;  1KSW A;  3M56 A;  2EJ9 A;  1CSK A;  2MOX A;  1ZUY A;  3S6W A;  3MHX A;  3OSS C;  1QCN A;  2VUB A;  1NYG A;  1UHC A;  1W2B S;  3VS3 A;  2HCK A;  1WQ7 A;  2CDT A;  3DKM A;  4KBM B;  2O4X B;  4FIB A;  4L6V 5;  1VQ6 A;  3L1A A;  5KYU A;  2VB6 A;  3ASK A;  4KUD K;  4C92 A;  3LW5 E;  1TUD A;  2LJ3 A;  1VQM A;  2RQW A;  3SDZ A;  4BE1 A;  2NUP A;  3V7C A;  1T3L A;  4QKU A;  2BTT A;  3L2Q A;  1KQ2 A;  2COY A;  4M7D D;  2GQV A;  1M90 U;  2O2O A;  2RMO A;  3VV0 A;  1X27 A;  3O5Z A;  3CCV T;  1EZZ B;  1NE8 A;  2RI3 A;  1WHK A;  4M7D B;  3INZ A;  2CYZ B;  2VWF A;  1JQQ A;  2Y4X A;  1UG1 A;  2E65 A;  4EMK C;  2QK0 A;  3CC2 Q;  3TSW A;  2X9H A;  4C92 C;  1FMV A;  2XD0 A;  1N6A A;  1WQW A;  1VQ6 Q;  4LDV A;  5D6Y A;  1D1A A;  3CCV A;  2FHD A;  1WPY A;  1WIE A;  2YXY A;  3NHN A;  1C1A A;  3EGU A;  5LJ5 h;  4J6Y A;  2FB7 A;  3QO3 A;  4M77 E;  4RTX A;  4M7A F;  4C92 D;  1X6B A;  1X2Q A;  2DAQ A;  3EGX A;  5GAN g;  3M57 A;  1X69 A;  3X25 B;  3CCJ A;  4HKE A;  5CKE A;  1H92 A;  2E4H A;  4A4E A;  2XI9 A;  4XTW A;  4HXJ A;  3H9N A;  3HHT B;  1SG5 A;  1UHF A;  4YTL A;  2RI2 A;  2VXE A;  3HP9 A;  2D6F A;  2KRN A;  2DBK A;  1UTI A;  2WSF E;  3OS5 A;  4GLM A;  2JM8 A;  3VS2 A;  1H3Z A;  2FEI A;  4Y28 E;  2ZPG B;  4MDW A;  5CKF A;  4Y91 A;  3CCU A;  1K0X A;  2X4X A;  8AT1 B;  1MMN A;  2ZAE A;  1N5Z A;  4BY6 B;  1IXD A;  3OYD A;  2QEX T;  2O31 A;  3GP8 A;  1D0X A;  5CKD A;  3I56 T;  2XDP A;  2C06 A;  1VQP A;  3DLM A;  3QDF A;  2FO0 A;  4M7D C;  3CCQ Q;  4E2F B;  4HVV A;  3A8M B;  3JB9 I;  3OS1 A;  3SD4 A;  1TSF A;  3Q1J A;  2YUQ A;  1M5Q 1;  2CZ6 B;  5FRO A;  2HQH A;  1UGR B;  4FU6 A;  1E6G A;  5EG2 A;  1QKW A;  1ZLM A;  3I56 A;  4LDX A;  1VQ5 Q;  1AZG B;  3MEU A;  3H8Z A;  1MGQ A;  1X01 A;  5GAO l;  1XOV A;  2V1Q A;  1OQK A;  4LD9 K;  5GMK h;  4C92 E;  1KD1 C;  5J39 A;  3CMA Q;  2QGF B;  2RA2 A;  3UF4 A;  1P92 A;  2KK4 A;  3UDC A;  2G6F X;  2VV5 A;  4RCB A;  2OTJ Q;  4RTY A;  2HAX A;  1YCY A;  1YNZ A;  3L2R A;  1Y0M A;  2O9V A;  1LPL A;  1V76 A;  1M1K U;  2ZGW A;  3OMC A;  4RG2 A;  4M7A D;  4C92 F;  2H3E B;  1YJW Q;  3LGL A;  1AOJ A;  2BE7 D;  1AWO A;  2E10 A;  3PT9 A;  4HCC A;  2HDA A;  4DBH A;  3QSU A;  1QKX A;  3UT1 A;  2CP5 A;  4PJL A;  3VS1 A;  1VQ4 A;  5KYY B;  2EYW A;  1Q82 R;  4JJB A;  2ATC B;  3QWY A;  5FU7 B;  4HA8 A;  1PSE A;  1MUZ A;  3CCR A;  4J9I A;  3JCM d;  5FW9 A;  2P0K A;  1RLQ C;  4M7D E;  1M3C A;  5KCO A;  1U3O A;  3OYF A;  2QXF A;  1JEG A;  3CC4 Q;  2K57 A;  3LYI A;  1VQ8 A;  1BI2 A;  2ZCF B;  3TVT A;  5I21 A;  2DIG A;  4PKC C;  4QQG A;  5GMK i;  1Q81 R;  4M7A A;  1XTD A;  2HSP A;  3JCM W;  4P5N A;  1RAG B;  2BE9 B;  2QDY B;  4QVD A;  5LJ5 f;  2FZK B;  4KH1 B;  2E3H A;  1MND A;  2JZ2 A;  2GBQ A;  5GAN h;  4WTO B;  1BI3 A;  1ZUK A;  1EX4 A;  2KRM A;  3LH0 A;  1PD1 A;  1C0M A;  1IO6 A;  2CS7 A;  1JU5 C;  3QHS A;  3TCJ A;  2X4J A;  1VQ7 T;  2M51 A;  3CPW S;  5GAO n;  4OMN A;  4KGV B;  5IHK A;  1PRM C;  3CCR T;  2HKN A;  1AWJ A;  2DVJ A;  2EGC A;  3S3M A;  2MK5 A;  2CGH A;  3G4S A;  2QEX A;  4OB0 B;  1N9S A;  1G8X A;  3M55 A;  4IUV A;  3I55 Q;  1YJW A;  2KXC A;  3TEE A;  2E41 A;  5I2S A;  5FU7 C;  4A4F A;  3TRE A;  1Y7X A;  1QVF P;  4ZGE B;  5FRM A;  4ZN1 A;  1NZ9 A;  1YFN A;  3V8L A;  5GAM f;  1UDL A;  2VC8 A;  2A37 A;  4HCB A;  2DA9 A;  5GAN 4;  1W2B A;  2GFU A;  1NYF A;  4PFP A;  3CCJ T;  4TVR A;  2GNC A;  1FWZ A;  2BZY A;  1YI2 A;  2L5Q A;  4FW1 A;  3V7R A;  2LX9 A;  2AKL A;  3OYN A;  2DJQ A;  4FYV B;  4C92 G;  3KXT A;  4M75 C;  2XK0 A;  4ELY C;  2R58 A;  4ZN3 A;  1YIJ A;  2KE9 A;  3I5S A;  4PJO A;  1ZQ1 A;  1VQO Q;  2D0N A;  2J05 A;  2LX7 A;  1VQL Q;  1M9S A;  1U06 A;  2QG9 B;  1S72 A;  1ACM B;  3E9F A;  4RTU A;  3OYE A;  1Q86 U;  1ZX6 A;  2HL3 A;  1SSH A;  2KMT A;  5CQX A;  3CC7 Q;  4B6M A;  4EMH A;  3OY9 A;  3A8O B;  3JB9 F;  3RKW A;  3N5B B;  3EG3 A;  4VUB A;  5GAM d;  1VQP T;  3HTR A;  3EG9 A;  3BDU A;  3CME Q;  1JXM A;  1M1K R;  4KGZ B;  1Q7Y U;  1U5S A;  4PJO C;  1KD1 R;  4QW2 A;  4IUQ A;  4ESR A;  1RAA B;  2SEM A;  4BDY A;  5A0G A;  4A63 B;  3EG2 A;  2LP5 A;  2XMF A;  2MCN A;  2D8H A;  1E6H A;  3RKY A;  4JZ4 A;  3RNJ A;  4M77 G;  4M7D F;  4XTZ A;  2X3X D;  4A4G A;  2HL5 C;  3VKI A;  4MDX A;  2ESW A;  1M3A A;  1GBQ A;  1I07 A;  1WJQ A;  2F69 A;  4A53 A;  1ARK A;  4QQ6 A;  3MEA A;  2HMA A;  1BKB A;  2DYB A;  2JMC A;  2RN8 A;  2OI3 A;  2K4Y A;  3EH2 A;  1AEY A;  1RAE B;  1K8A U;  3FJ5 A;  1KK7 A;  3CPW A;  2HBW A;  2K3X A;  4O5V A;  1KQS A;  1NLP C;  3OYH A;  3OYJ A;  2HSE B;  3QBY A;  4WF2 A;  4J9B A;  5GAO r;  1VYT A;  3EG9 B;  1M27 C;  1TG0 A;  1HD3 A;  3G6E Q;  4E7J A;  2BKD N;  4FT4 A;  2E5K A;  2JS0 A;  2XID A;  5L23 A;  1TWB A;  3U23 A;  4BI3 A;  1VQO T;  3CCL T;  4AT1 B;  3E9G A;  3SFM A;  3PVQ A;  4M78 B;  1VQ5 A;  1K8A R;  4M77 A;  4AFZ C;  2LNH B;  1NBE B;  4ELZ C;  3MP8 A;  4JLG A;  1PWT A;  2LZ6 B;  2RHY A;  2YRD A;  1VQL T;  1RL2 A;  1K73 C;  2E70 A;  4J9D A;  3CPF A;  4PJO B;  2DKG A;  2M0O A;  1MNE A;  4XTU A;  4C5I A;  1K4U S;  4M78 G;  5KYN A;  1VQ6 T;  1WX6 A;  4J6X A;  3R6N A;  4MZP A;  3NTK A;  2LQ8 A;  2YSQ A;  2HQX A;  5LJ3 j;  4AFU C;  8ATC B;  1CKB A;  2YRV A;  4LUD A;  3HPW A;  1BB9 A;  2K5I A;  4OMO A;  3CCS Q;  1G2B A;  4XQ3 A;  2EGE A;  2PVO B;  2ZPI B;  1YN8 A;  4OMF B;  3GPL A;  3RR6 A;  4QT7 A;  1NG2 A;  3CCS A;  3C95 A;  5GAM j;  4C8Q A;  3G7Z A;  3I55 T;  3GBQ A;  2E6Z A;  4Z88 A;  2GGR A;  3THK A;  3ZFJ A;  4KRT A;  1K9M C;  2XIC A;  3P8H A;  3MPU B;  4ZNX A;  1RAB B;  4CRI A;  2K79 A;  1WLP B;  1QVF S;  2J6K A;  1H8K A;  1MHN A;  1YJ9 T;  4KT0 E;  2JTE A;  2BIV A;  2QQR A;  2DZ9 A;  4JZ3 A;  2CSQ A;  3CXC P;  4DBR A;  5IN1 A;  1WYX A;  1WFW A;  1M90 R;  4ZTF A;  2PTK A;  1YJN T;  4ZGD B;  1NEB A;  4M77 B;  2QA4 A;  4LDY A;  4M78 A;  1ZSZ C;  3JCM Q;  4M77 D;  1QQJ A;  3QUI A;  1OPK A;  1VQM Q;  2X4Y A;  2DX1 A;  3J80 E;  3HL8 A;  3G6E A;  1ZBX A;  1N8R R;  2DLP A;  5GAM h;  1KG1 A;  3CPW P;  4M4Z A;  2RH2 A;  2E12 A;  5GMK m;  2GCX A;  2W10 A;  3M0U A;  3LWH A;  1WXB A;  1VIF A;  2QA4 T;  4D6W A;  3JCM P;  1KQS S;  3A8H B;  1YIT A;  1AWX A;  2BZX A;  1M3B A;  2EJG A;  2KEA A;  2VVK A;  1SRM A;  1J3T A;  3OS2 A;  2LQK A;  3CMA A;  3OW2 A;  1JO8 A;  1HJD A;  3JCM e;  2WSC E;  4J8O A;  1I5L A;  5DY9 A;  2ED0 A;  1ZHI A;  2JOY A;  1YHQ Q;  1PKS A;  2D8J A;  1IB8 A;  3VYG A;  2L2P A;  2FYK A;  2OTJ A;  2FPD A;  3M0Q A;  1HYO A;  3M53 A;  3JAM E;  2LDM A;  3L2V A;  4E7I A;  4PL6 A;  1T0J A;  3CME A;  3SB2 A;  2IIM A;  2A7Y A;  2OTL Q;  5GAN d;  2EQU A;  1JJ2 A;  1QLY A;  2MPX C;  1BI1 A;  2DJZ A;  2RK1 A;  1SHF A;  1NJI C;  1NPR A;  4HCK A;  2H3J A;  3OBY A;  1ZBJ A;  3CC7 T;  3CBM A;  3SEM A;  5LJ5 g;  1BBZ A;  5D7U A;  2Y90 A;  4FYX B;  2NUT A;  3CCM T;  3EFR A;  4V2S A;  1B07 A;  2JM9 A;  2MWO A;  2A3L A;  4M78 E;  3JCM b;  3I9Q A;  2QDL A;  2DL3 A;  5LJ5 d;  4OMP A;  1NPP A;  2E3I A;  4AFQ C;  4OGC A;  2E64 A;  4IUT A;  1VQK A;  1YIT Q;  2JTM A;  1QP2 A;  5A0L A;  4JJN K;  3FJP A;  2F1L A;  3EGD A;  2FPF A;  3RMS A;  3JB9 H;  1X43 A;  2OX7 A;  2JUF A;  3OS0 A;  5GAN 5;  1JB0 E;  2LMJ A;  4E7L A;  1KIK A;  2CP6 A;  4PJO G;  1VQK T;  2QGG A;  1GRI A;  2M1H A;  1X75 C;  4EMK A;  4Y92 A;  1D3B B;  3QYH B;  4IKF A;  2MYS A;  2ECZ A;  3P8B B;  2KGT A;  5HCK A;  4B9X A;  3I5R A;  1VOM A;  3ZEH A;  1WHJ A;  4DA4 A;  5IXB A;  4DQ2 A;  5IXF A;  2PU9 B;  2RHU A;  3EHR A;  1VQ4 T;  3GOX A;  2IVW A;  4M7A B;  4M75 A;  2DTI A;  2RM4 A;  2CUD A;  2RD1 A;  1NM7 A;  4J83 A;  2FVU A;  3JB9 G;  3WXM B;  4OMM A;  1XQH A;  1TUG B;  2P0P A;  1TS9 A;  4XK8 E;  4J7F A;  1BCO A;  2EJF A;  2F2W A;  4NL3 A;  4M75 G;  1OZ2 A;  2RQV A;  4UC4 A;  4LDU A;  2XKO C;  4CC3 A;  4ANJ A;  4PFO A;  2KT1 A;  5GAN f;  1DJ7 B;  1VQ5 T;  4BB7 A;  3QJY A;  5LJ3 e;  2ZPH B;  2KAF A;  3CD6 T;  4MZM A;  4J9E A;  3OYL A;  2E6N A;  3A8L B;  1YP5 A;  1GFD A;  1IHW A;  2DTH A;  1OEB A;  5GAM e;  2RF0 A;  1HXD A;  4K11 A;  3CMA T;  4RCC A;  1Z9Q A;  1RI0 A;  3VS4 A;  3G71 Q;  2DL5 A;  3NTI A;  1I81 A;  4IUP A;  1ZSG A;  2X4W A;  2QQA A;  1C6V X;  5C0M A;  1OX8 A;  1PCX A;  3A5Z B;  4M75 F;  1VYU A;  3CBP A;  3PGG A;  4DBQ A;  2LJ0 A;  2LTO A;  2LC4 A;  1KFZ A;  2L3Q A;  1F1B B;  3EHQ A;  5FWB A;  4FW2 A;  2RJC A;  2D1X A;  1K9M U;  2EBP A;  4OB2 B;  5KYW B;  1T0H A;  3NMZ C;  5GJV B;  1IRE B;  5GAO m;  3CCS T;  4AFS C;  5L8R E;  4J9F A;  3RIR A;  3CME T;  3L2Z A;  2MMP A;  2H8H A;  2ZZD A;  5GJW B;  3CC7 A;  4RUG A;  2WAC A;  4OML A;  3TSZ A;  2NUP B;  1YJN Q;  3UPU A;  4BE0 A;  2D0Q B;  4M7A C;  1KHI A;  2LVM A;  1B34 B;  4PJN A;  2VYT A;  3QZ5 B;  4J5Y A;  5J3B A;  3H0F A;  4X9C A;  2J06 A;  4RTV A;  2PZ1 A;  2J6F A;  3CD6 A;  5GAN 7;  1VQM T;  4X1V A;  4NL2 A;  3BW1 A;  2JN0 A;  1Q82 C;  1Q81 C;  3EFO B;  5FRN A;  4RTT A;  1WXU A;  4JJC A;  2PVD B;  1OUL A;  4A4K A;  4D8D A;  2MI6 A;  4PJO F;  2QYZ A;  2LQW A;  1U1T A;  2YDL A;  1PNJ A;  3UA6 A;  2DO3 A;  2JTF A;  1RAF B;  4O6J A;  2CKK A;  1HK9 A;  2YUO A;  2HQE A;  3AT1 B;  1PG5 B;  4XU2 A;  2NYS A;  4AG1 C;  3GLX A;  3OA6 A;  1KD1 U;  3CC2 T;  1M2V A;  2KYM A;  2DRK A;  5FU6 C;  1IHV A;  1TUC A;  2EVR A;  2FPE A;  3NFC A;  2KNB B;  2ABL A;  2HD0 A;  4QQD A;  4C8Q G;  2A0F B;  1BI0 A;  3CCE A;  4HCZ A;  1SHG A;  2MAM A;  4HVW A;  2O01 E;  4BUG A;  3VYH B;  5LJ3 g;  1N9R A;  1TOV A;  2EFI A;  1BU1 A;  2KQW A;  2DIQ A;  1B34 A;  1LOJ A;  2O88 A;  1VQ7 Q;  4BY6 C;  3C0C A;  1GL5 A;  4KUI A;  3JB9 D;  1AT1 B;  4MMK A;  5GAM g;  3HKS A;  1AD5 A;  4Z8A A;  1GCP A;  1PRL C;  3OB9 A;  1M1F A;  1G5V A;  2G3R A;  2K3B A;  1M30 A;  1G3T A;  1X6G A;  2KY9 A;  1I8F A;  1FMW A;  3NPF A;  4ME7 A;  3HFN A;  4ORZ A;  1Q7Y R;  1TXQ A;  3M4Y A;  3PIP A;  3G1J A;  1ZSZ A;  4BI8 B;  3RBB B;  3OYB A;  1QCF A;  5FLX E;  4PJJ A;  1RUW A;  5KE3 A;  3FRN A;  2XHC A;  3CCU T;  2HBP A;  2EYY A;  3QPH A;  2JNG A;  2K7A A;  1QVG P;  4M7D G;  2J6O A;  4M75 E;  2KDS A;  2FL7 A;  3J7A F;  1OPL A;  3M0P A;  2R57 A;  2MWP A;  3EH1 A;  3OYG A;  1Q86 R;  4F14 A;  2JVV A;  1YIT T;  1RAH B;  4E7Z A;  3NGP A;  4AMC A;  3BFM A;  4JPB W;  4RTZ A;  1LVK A;  2RK2 A;  1QWE A;  1D1C A;  4JS4 A;  5FU6 B;  1GBR A;  4M7A E;  2HKQ B;  1M8V A;  5A0D A;  1QVF A;  3EG1 A;  2M0Y A;  4XTX A;  4FT2 A;  2CZ7 B;  2FRW A;  1YWP A;  3G4S Q;  3H41 A;  2DYI A;  1PC0 A;  4D8K A;  1W70 A;  2XDD A;  2YLB A;  2GTO A;  3CCU Q;  1NEG A;  4IUR A;  1UE9 A;  2DRM A;  3OYM A;  1SEM A;  4R56 A;  3G71 T;  3CCJ Q;  1G83 A;  2RJD A;  5CK9 A;  3HRU A;  5KE2 A;  7AT1 B;  1WJS A;  5CR2 A;  3CQT A;  4F7U E;  5KYX B;  4F7U G;  1QVG S;  5HY6 A;  4JJD A;  4JS5 A;  2ENM A;  1YJW T;  1FMK A;  4J9H A;  1ABO A;  2K5L A;  3R6O A;  4KGX B;  2M9U A;  3KFV A;  4C92 B;  1XJW B;  1QVP A;  3AHU A;  2VXF A;  5ECA A;  1M8M A;  2W0Z A;  3JRZ A;  2DXT A;  5EC7 A;  3CD6 Q;  1YHQ T;  3S3N A;  2QA4 Q;  1YI2 T;  2CZ1 B;  1O9S A;  5IH2 A;  3QII A;  1H3H A;  1AZE A;  2QAZ A;  4PJM A;  3OYA A;  2YWW A;  3M0S A;  3O8V A;  5CCA A;  3PFS A;  1WI7 A;  5CKB A;  2VAS A;  5D6X A;  2NUT B;  1UGP B;  4JRP A;  3TU4 K;  3PMI A;  2K9G A;  1S72 T;  1NJI U;  2RQT A;  1VQ8 Q;  3EFO A;  1VQO A;  2K3Y A;  3G6E T;  3CEY A;  2DTO A;  3TQ7 P;  3WVE B;  2XG8 D;  2RQR A;  5IT9 E;  2LT1 A;  3PTA A;  4N4H A;  3KBG A;  5CAI A;  3CCM Q;  1IGQ A;  3QXE B;  1Q7Y C;  2EQM A;  3PIO A;  2KI7 A;  2MF2 A;  2MIO A;  3VUB A;  4M77 F;  2EAY A;  1QP3 A;  2RI5 A;  2QTX A;  1D1B A;  3EGX B;  3JCM h;  2SRC A;  1OU8 A;  5GMK j;  2DXC A;  5GMK l;  2CP0 A;  4RG8 A;  3E19 A;  2OJ2 A;  2QQ9 A;  4MML A;  4GBQ A;  5DLQ E;  1Y71 A;  2X3W D;  2KT8 A;  2JS2 A;  2OTJ T;  3CBO A;  1W4S A;  3M4G A;  2V1R A;  2DL8 A;  1WGS A;  3PE0 A;  2EQK A;  3C12 A;  3CCM A;  1VQ9 A;  3EAE A;  2A36 A;  1S72 Q;  3JV3 A;  2XDB A;  2DVE A;  4FL6 A;  1KQS P;  3HRS A;  2C0I A;  3D7S B;  5GAN 6;  1B3Q A;  2GF7 A;  1GFC A;  2ZPF B;  2EKO A;  4EDU A;  2EWN A;  1BIB A;  3REA B;  3S3O A;  1JBM A;  1V29 B;  1K1Z A;  1YIJ T;  2EQJ A;  2P84 A;  3ME9 A;  2J7I A;  2OTL A;  1UB4 A;  2CRE A;  1PSF A;  2DL4 A;  4LN2 A;  2DEQ A;  1SSF A;  3A8G B;  2YUP A;  5CKH A;  4HT8 A;  2L3P A;  2QQB A;  3PVL A;  2C0O A;  1AVZ C;  3GNF B;  4M78 D;  3CCV Q;  1G3Y A;  1A0N B;  2LQN A;  3BDL A;  3FB9 A;  3OYI A;  2M16 A;  3QDR B;  3WVD B;  2CP3 A;  3PNW C;  5I11 A;  3CXC A;  4OP0 A;  1YWO A;  4EIK A;  1UEB A;  1RI9 A;  2EQI A;  4M78 F;  4C0Z A;  1R0C B;  2FZC B;  1FXX A;  4C8Q B;  2DMO A;  3DB3 A;  3MEW A;  3OSV A;  1WZO A;  3CC4 A;  1S1N A;  2F2V A;  1VQN T;  3QZ9 B;  3SWN A;  4HVU A;  2VGN A;  3MCA B;  4DBF A;  4DEX A;  3ZL7 C;  2RB6 A;  1D3B A;  5CVI A;  1UFF A;  1MV0 B;  2K2V A;  2QTV A;  3OYC A;  2X35 A;  3EFS A;  4IIM A;  2VGM A;  1FYN A;  1VQ7 A;  1Y96 A;  4JUV A;  1N8R C;  3QJ6 A;  4PLI A;  2KVQ G;  2RJE A;  2I0N A;  2IPO B;  2DFU A;  2OTL T;  5LJ5 j;  1HSQ A;  3X24 B;  6AT1 B;  3CCQ T;  3PMT A;  3F70 A;  4LD6 A;  3OW2 S;  3V8K A;  1X2K A;  4J9C A;  1LNX A;  2LCL A;  2DXU A;  4XU0 A;  2KXD A;  3H0I A;  3I55 A;  4II1 A;  3SHW A;  3CCL Q;  1I5O B;  2GFA A;  3H6Z A;  2JT4 A;  2LT4 A;  5KYW A;  3MET A;  4F7U B;  1RAC B;  2R5M A;  4LDW A;  4DOV A;  2JMA A;  1M90 C;  4M78 C;  2K5F A;  4XTV A;  2L89 A;  3JCM g;  3M59 A;  1GCQ A;  3FDR A;  2JW4 A;  2KBT A;  3MKD A;  4C5H A;  2AIR B;  4BDZ A;  2ZPE B;  3OQ5 A;  3P8D A;  3JCM X;  3G4S T;  2ED1 A;  1VYV A;  2YT6 A;  4N4I A;  4A4H A;  1B7T A;  4KUL A;  2EYZ A;  1NLO C;  1VQL A;  3VRY A;  5CO7 A;  4E7K A;  2IG0 A;  4F17 A;  3MEV A;  1I4K 1;  2EKH A;  3NTH A;  2OAU A;  4C8Q C;  1VQ8 T;  1SF9 A;  4L59 A;  1KC8 C;  2RPN A;  3M0T A;  5DM7 R;  3CCR Q;  3LX7 A;  2L0A A;  5AYF A;  2L3R A;  1I1J A;  9ATC B;  2V8I A;  2RJF A;  3GNG A;  2CH4 W;  2AZV A;  3SWN C;  2CUB A;  2CP2 A;  3FEO A;  1R8O B;  1WHG A;  3FIF A;  1KJW A;  2LRQ A;  2Y4Y A;  2BZ8 A;  3MP6 A;  3BE3 A;  1M4Z A;  4E7H A;  3E1S A;  1VQN Q;  3J81 E;  1VQK Q;  2V8K A;  2DET A;  3M54 A;  2YUN A;  2KR3 A;  1KQ1 A;  3CCE Q;  4M75 B;  4X34 A;  2AHJ B;  1ZA1 B;  1YCS B;  1EFN A;  2CT3 A;  4B9W A;  4FM4 B;  5CQY A;  1UGQ B;  2EIF A;  2KSS A;  4M77 C;  4M7A G;  5C6S A;  2GTJ A;  1ZSZ B;  4F7U A;  2CZ0 B;  1U1S A;  4RMO A;  2C0T A;  1BYM A;  5AT1 B;  1FX7 A;  2DEU A;  1VIE A;  4E47 A;  1VQN A;  3VS6 A;  1JRI A;  4C0D C;  2F2X A;  3RUX A;  1UGS B;  4OB1 B;  4ZGJ B;  1I0C A;  3A98 A; 
#chains in the Genus database with same CATH homology
 2EYY A;  1K4U S;  4CC7 A;  1WIE A;  2K7A A;  3NHN A;  3EGU A;  2J6O A;  1WX6 A;  1LCK A;  3R6N A;  1QWF A;  4IIO A;  4RTX A;  1X6B A;  1OPL A;  3M0P A;  1ZUU A;  1X2Q A;  2YSQ A;  4F14 A;  1X69 A;  4AFU C;  1CKB A;  4LUD A;  2DL7 A;  1BB9 A;  3NGP A;  4OMO A;  1H92 A;  1G2B A;  4JPB W;  2EGE A;  4RTZ A;  1YN8 A;  4QT7 A;  1NG2 A;  5FWC A;  1QWE A;  4HXJ A;  4WCI A;  1UHF A;  3GBQ A;  1GBR A;  3EG1 A;  2M0Y A;  2GGR A;  4FSS A;  4Z88 A;  3THK A;  4KRT A;  2KRN A;  2DBK A;  2KRO A;  1UTI A;  4GLM A;  2JM8 A;  2FRW A;  1V1C A;  3VS2 A;  1YWP A;  2FEI A;  3H41 A;  4ZNX A;  2HEQ A;  4D8K A;  1W70 A;  1Y57 A;  2K79 A;  1WLP B;  2GTO A;  2J6K A;  1H8K A;  2JTE A;  1NEG A;  1UE9 A;  2CSQ A;  2DRM A;  4JZ3 A;  4E6R A;  1K0X A;  2DBM A;  1SEM A;  1WFW A;  1WYX A;  1G83 A;  1N5Z A;  2PTK A;  1WXT A;  3CQT A;  2O31 A;  2OAW A;  1NEB A;  2DIL A;  4JJD A;  2RQU A;  2FO0 A;  1WDX A;  2LJ1 A;  1OV3 A;  1OPK A;  2ENM A;  4HVV A;  1UEC A;  2DX1 A;  1FMK A;  2YUQ A;  2DLP A;  4J9H A;  1ABO A;  4M4Z A;  4CC4 B;  2O9S A;  3KFV A;  1E6G A;  2W10 A;  3M0U A;  1QKW A;  1M8M A;  1WXB A;  1ZLM A;  2W0Z A;  5ECA A;  1RLP C;  2ROT A;  1AZG B;  2ROL A;  1UGV A;  5EC7 A;  1XOV A;  1AWX A;  2EGA A;  2V1Q A;  2BZX A;  1M3B A;  2KEA A;  2A08 A;  1K0S A;  2VVK A;  1SRM A;  1J3T A;  2B86 A;  1ABQ A;  1JO8 A;  1HJD A;  5IH2 A;  2ED0 A;  3UA7 A;  1BK2 A;  1H3H A;  1PKS A;  3UF4 A;  2D8J A;  1AZE A;  2AK5 A;  1K9A A;  1UJY A;  3M0S A;  2L2P A;  1WI7 A;  2CH4 A;  2FPD A;  2G6F X;  3M0Q A;  4RTY A;  1YNZ A;  1Y0M A;  2O9V A;  2K9G A;  1T3S A;  2A28 A;  1T0J A;  2IIM A;  4F16 A;  2RQT A;  5IHN A;  1OOT A;  1AOJ A;  1QLY A;  1AWO A;  2RQR A;  1SHF A;  4HCK A;  1VA7 A;  2HDA A;  3EG0 A;  1QKX A;  1ZBJ A;  2NUZ A;  3VS1 A;  5IHI A;  2MIO A;  2DM1 A;  2EYW A;  3SEM A;  1BBZ A;  4JJB A;  3QWX X;  1UJ0 A;  3QWY A;  1MUZ A;  4J9I A;  1E7O A;  5FW9 A;  1B07 A;  2SRC A;  1RLQ C;  2JM9 A;  1M3C A;  3I9Q A;  1U3O A;  2QDL A;  2K2M A;  2DL3 A;  2OJ2 A;  4GBQ A;  4OMP A;  2X3W D;  2KT8 A;  4AFQ C;  1JEG A;  2JS2 A;  2AZS A;  2V1R A;  2KYB A;  2DL8 A;  2DE0 X;  3PE0 A;  3TVT A;  2FPF A;  2A36 A;  3JV3 A;  2HSP A;  3ULR B;  4OMQ A;  1X43 A;  2C0I A;  2EYX A;  1B3Q A;  1GCQ C;  2FG0 A;  2LMJ A;  1GFC A;  1KIK A;  3IQL A;  4R0K A;  2GBQ A;  3REA B;  1GRI A;  4RTW A;  2DF6 A;  1K1Z A;  4Y92 A;  3REB B;  1ZUK A;  2K6D A;  2J7I A;  2ECZ A;  2KRM A;  2KGT A;  5HCK A;  2CRE A;  3I5R A;  3VS5 A;  2DL4 A;  2JXB A;  1IO6 A;  4LN2 A;  1JU5 C;  2CT4 A;  5IXB A;  2M51 A;  5IXF A;  2GQI A;  2YUP A;  3EHR A;  2L3P A;  3PVL A;  4OMN A;  2C0O A;  2LCS A;  5IHK A;  1AVZ C;  3LH5 A;  2CUD A;  1NM7 A;  1PRM C;  1A0N B;  2LQN A;  1AWJ A;  3I35 A;  3VS0 A;  4OMM A;  2DVJ A;  2EGC A;  3UAT A;  1AWW A;  2VKN A;  4CC2 A;  5I11 A;  1YWO A;  4EIK A;  2F2W A;  1RI9 A;  2EQI A;  4DEY A;  3H0H A;  2RQV A;  2DMO A;  2L3S A;  4CC3 A;  1W6X A;  2KXC A;  2KT1 A;  1S1N A;  2F2V A;  2EW3 A;  4HVU A;  1Z9Z A;  4J9E A;  1UDL A;  2A37 A;  2AKK A;  4DEX A;  1YP5 A;  3ZL7 C;  1GFD A;  2DA9 A;  4LUE A;  1OEB A;  2NWM A;  2RF0 A;  1UFF A;  1NYF A;  5I22 A;  4K11 A;  1MV0 B;  4Z89 A;  2GNC A;  1MV3 A;  1Z9Q A;  4IIM A;  3VS4 A;  2DL5 A;  1FYN A;  2BZY A;  1ZSG A;  2AKL A;  1SPK A;  2KRS A;  2DJQ A;  2I0N A;  1PKT A;  1HSQ A;  1VYU A;  2LJ0 A;  1KFZ A;  2KE9 A;  3I5S A;  1X2K A;  4J9C A;  2L3Q A;  2KXD A;  3H0I A;  3EHQ A;  3SHW A;  5FWB A;  1PHT A;  2D0N A;  2J05 A;  4LE9 A;  2D1X A;  2LX7 A;  2EBP A;  2JT4 A;  1U06 A;  1CKA A;  4RTU A;  1T0H A;  3NMZ C;  5GJV B;  4AFS C;  1ZX6 A;  2JMA A;  4J9F A;  1SSH A;  2PNI A;  2EPD A;  2H8H A;  1GCQ A;  5GJW B;  4RUG A;  3EG3 A;  2JW4 A;  1K76 A;  2KBT A;  4OML A;  3TSZ A;  3VRZ A;  1JXM A;  1UUE A;  1U5S A;  2ED1 A;  1VYV A;  2YT6 A;  3VS7 A;  1SRL A;  2CSI A;  3H0F A;  3M0R A;  2RNA A;  2J06 A;  2DNU A;  2EYZ A;  1NLO C;  4RTV A;  1WA7 A;  2PZ1 A;  2J6F A;  4ESR A;  2SEM A;  1W1F A;  3VRY A;  4X1V A;  4A63 B;  3EG2 A;  2LP5 A;  2XMF A;  2MCN A;  2D8H A;  4F17 A;  1E6H A;  4J9G A;  4JZ4 A;  3RNJ A;  2EKH A;  4RTT A;  1WXU A;  2X3X D;  4JJC A;  4D8D A;  2ESW A;  2RPN A;  1M3A A;  3M0T A;  2FRY A;  1GBQ A;  1I07 A;  2LQW A;  2L0A A;  1JXO A;  1I1J A;  2YDL A;  1PNJ A;  4LNP A;  3UA6 A;  1ARK A;  2CH4 W;  2AZV A;  2CUB A;  2P4R A;  4AG2 C;  2YUO A;  1KSW A;  4AG1 C;  1KJW A;  2KYM A;  2DRK A;  1TUC A;  2BZ8 A;  1CSK A;  2MOX A;  2EVR A;  2DYB A;  1ZUY A;  2FPE A;  2JMC A;  2RN8 A;  2OI3 A;  2KNB B;  1NYG A;  1UHC A;  1AEY A;  3VS3 A;  2ABL A;  2HCK A;  3FJ5 A;  2CDT A;  2HBW A;  2YUN A;  2KR3 A;  1SHG A;  4HVW A;  1NLP C;  1YCS B;  4J9B A;  1BU1 A;  1EFN A;  1TUD A;  1VYT A;  2LJ3 A;  2CT3 A;  1M27 C;  2O88 A;  2RQW A;  1TG0 A;  3C0C A;  1GL5 A;  1HD3 A;  1T3L A;  2BTT A;  1AD5 A;  4Z8A A;  1GCP A;  1PRL C;  2E5K A;  2JS0 A;  5L23 A;  2K3B A;  3U23 A;  2O2O A;  2RMO A;  1X27 A;  2GTJ A;  3O5Z A;  1M30 A;  1X6G A;  3PVQ A;  2VWF A;  3NPF A;  1JQQ A;  4AFZ C;  2C0T A;  2LNH B;  4ORZ A;  1UG1 A;  1PWT A;  3RBB B;  2LZ6 B;  3TSW A;  1QCF A;  3VS6 A;  4J9D A;  1RUW A;  2F2X A;  1I0C A;  3A98 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...