1WY6A

Crystal structure of hypothetical protein [st1625p] from hyperthermophilic archaeon sulfolobus tokodaii
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
161
structure length
159
Chain Sequence
EIIRKLMDAKKFLLDGYIDEGVKIVLEITKSSTKSEYNWFICNLLESIDCRYMFQVLDKIGSYFDLDKCQNLKSVVECGVINNTLNEHVNKALDILVIQGKRDKLEEIGREILNEVSASILVAIANALRRVGDERDATTLLIEACKKGEKEACNAVNTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The first crystal structure of an archaeal helical repeat protein.
pubmed doi rcsb
source organism Sulfolobus tokodaii
molecule tags Structural genomics, unknown function
molecule keywords hypothetical protein ST1625
total genus 59
structure length 159
sequence length 161
ec nomenclature
pdb deposition date 2005-02-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09205 DUF1955 Domain of unknown function (DUF1955)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.350 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 1wy6A00
1WY6A
chains in the Genus database with same CATH superfamily
3CGHA 2EINE 1FT1A 3D9KA 3E33A 3ASDA 5G05C 4U0UA 4I43A 4APFA 4TXRA 2CFZA 5KCMA 1U3DA 1MX4A 3TWSA 1D8EA 4JC8A 4X8QA 4CGVA 4MRUA 2FULA 1RZ4A 5E75A 2H6IA 1DCQA 1PAQA 3O4ZA 3L13A 1H2TC 3GZ2A 3HG0D 1OY3D 4N5CA 1QQEA 3ASNE 4O60A 5BT1A 4PUCA 5FIOA 4JHJA 4U96D 4F1SA 3LY9A 4JB8P 1JWFA 4APOA 4BT9A 4DX6D 2OCCE 1FPPA 1D8DA 1OCZE 1Y6IA 2YNQA 5CMYA 4DI4A 4GZ6A 3IHVA 3PRZA 3UKUG 3U64A 4YDWA 3CVQA 1FT2A 3UT7A 2ZIRA 5LOZA 4GA1A 5JMND 4G1TA 5CECB 4I6EA 4HRLA 3FH5A 5E76A 5D0QD 3UI2A 3Q79A 2AXZA 5LCWJ 3JUIA 3UM1A 1O1RA 3FEYA 3PZ3A 4U0SA 5CEDB 2P9KG 5AJLA 2XRZA 2OVFA 3ABKE 3FUKA 3PNTB 3ZFWA 2PQNA 2VQ2A 3DEOA 3JQ0A 1IQUA 1UOHA 4G26A 2VJ8A 4HI8A 1N54A 1ELWA 4I1OB 5B1AE 2VGXA 3FU6A 3DPDA 1Q2ZA 1ZB1A 3ESKA 1O1SA 3Q49B 4EHMA 1BI7B 4EBAA 1TNZA 3E37A 3UT4A 3E32A 3PEVB 3IKOB 1K1BA 3CEQA 4U8YD 4O6FA 4WWOA 1DCEA 4K5BA 4U63A 2DYRE 3HXBA 4F6RD 4J7WA 2XEVA 2ETCA 4UUCA 3FUMA 2JABA 3BQOA 4BT8A 3RAUA 3ZKJA 3QNKA 4QFVA 5A23A 5KWDA 4Q69A 4A63B 4ILHB 3G2TA 4B8AA 2RKKA 4Q96A 1BPOA 3I5PA 3VLEA 4JL0A 2KM4A 3EJNA 3MGBA 3UMVA 4LERA 4GCOA 3E30A 2XQ0A 3ZPJA 2WXNA 3FH8A 1HO8A 2J49A 2XPYA 1NP7A 4MKTA 3TJPA 2PM6A 3UM3A 4L23A 4RG9A 4GA2A 3UUXA 4YDOA 1X81A 5KJKA 3TGOA 3D9MA 2J8SD 2RG8A 1TNUA 1TN7A 5DBKA 3SNXA 4M7CA 2WXFA 4GTRA 3CQGB 5FQ4A 1BD8A 2KBXA 4JW1A 3E34A 1LF8A 2J4BA 4AY5A 3DSUA 4JD2G 4RQIA 2M63A 1TNOA 2P9LG 3PS6A 4ZHBA 2J08A 3BEEA 1N4PA 3UIPC 5D2MC 4FADA 5T8IA 3FP3A 4TUMA 3EHQA 1TN6A 1KT0A 4CZ2D 2RD0A 3AU4A 5BUZA 4RVBA 1YA0A 1WDYA 4A55A 5C2YA 2WXLA 2VGEA 1UN9A 1MJ0A 4BEPA 2AXUA 3WG7E 3ABLE 4XI9A 4I17A 2MRIA 4AY6A 3T9KA 4OVVA 3QWWA 4J6IA 1XNFA 3Q7FA 2DZNA 3C72A 3TWUA 2J09A 3RO2A 3R7QA 3UIOC 4OYSA 4U7EB 3W9FA 4FLHA 4EBAG 2UY1B 3PE4A 2BKKB 2WXOA 1TR4A 2UWJG 2F8YA 1BU9A 3P2BA 3HYMB 3EU9A 3TG5A 2VSYA 3MKQA 3CQCB 2IOLA 4PDXA 1O1TA 1LD8A 2C0LA 3AG1E 2XPIA 2XEHA 5ITZF 4B8CB 2P9NG 2H6HA 5FZQA 3RK6A 4TUUA 5G05J 4U07A 2QYJA 1ELKA 2BUGA 2WXQA 3ZGQA 3SFYA 4ANWA 1H2VC 3RU0A 3ML9A 1E90A 4N3AA 1IQRA 2PL2A 1NI1A 1N4QA 5G55A 4HVBA 3U4TA 2HYZA 3PH0C 4UWGA 4R7LA 4HOUA 3IEGA 2L9BA 3Q75A 2YHEA 4HFGA 4BSXA 4LCTA 5CBNA 5EX0A 3TWTA 4KXKB 2P9PG 4JA7A 2X3MA 2GRNB 4XZ4A 1W3BA 1DVPA 4GA0A 2P9IG 3T8KA 4GU5A 3HVEB 1K8KG 3Q73A 1FVHA 2DVWA 4TV3A 2IY0C 2XRYA 3HXCA 2VTBA 4Z68A 1WAO1 3PDNA 3SZ7A 4G23A 2R17C 2DYSE 3QOUA 2KZTB 4C0MA 1BLXB 4CRWA 4J8YA 4UWFA 5KJLA 1QZ2A 4ANVA 1ZU2A 4KBQA 5KNHD 2HE0A 1HH8A 4B93B 2WXPA 3GW4A 4G24A 3CSFA 3DSVA 3LXUX 4EZKA 3EIJA 3AJIA 3C3QA 3L08A 1HG5A 3BG1B 4Y6CA 2Y4UA 2OEVA 4GYOA 3FTXA 3URZA 4LRZA 4F1PA 4GZ3A 4D10C 4HOTA 1L5JA 2LSUA 2FO7A 2XZDG 4AIFA 2LUHA 4FU3A 2IO3C 4XI0A 3RRNB 2XPZA 2QY7A 3FTZA 1H19A 4BTAA 4MBGA 4DUIA 3LYAA 2I6HA 3T8MA 5AENA 2WB2A 2GRPB 3ML8A 4GZ5A 2P58C 4F3VA 3AAAC 2AWIA 4N2SA 3MCXA 3R9AB 1H6KA 4DPRA 3PUKA 4J8SA 1NA3A 3CVWA 3F6QA 5JJTA 3IXEA 3LS8A 2ETBA 2V0PA 5EILA 2DCPA 3P1UA 4GMLA 4BETA 3C98A 3ZVVA 5KNGA 2BEDA 5EX3A 5JJ7A 4J8EA 3AG3E 3N71A 4PS3A 3MV3B 4U04A 2WMOA 3FUEA 5BNWA 2V5FA 3Q7AA 3Q4AB 2Q7FA 1EYHA 2HR2A 3VTYA 5CCMA 2MOWA 4H7XA 4L7TA 2H6GA 1U3CA 4BWRA 4KZCA 3L82A 4CT4A 4GTSA 3RRMB 3OTNA 5HI7A 5M72A 5FQ7A 3CSTA 4K0RA 4TXPA 3ULQA 3CIAA 4OVUA 1DC2A 2LO6A 4LEUA 1HU3A 2NC9A 3PVLA 2R03A 5EIBE 3MJWA 2JLBA 3PEUB 5B3SE 2ONDA 4C9BB 3QB2A 1JCRA 4HBDA 3ZYLA 3CKCA 1FVFA 5ENRD 4DI3A 2A5EA 3FWVA 1K1AA 1TYQG 1UJKA 3ZYMA 2DWZA 3ZIMA 2KATA 4A1GA 4WNFA 5A6CA 3TWQA 1JCSA 4WWNA 5FINA 3B13A 4HI9A 2KZTA 3Q9NC 4ANUA 4TXQA 4L1BA 3Q9UC 1P5QA 4OAUC 3KD7A 1E7VA 2UY1A 2OV8A 3CV0A 3CVLA 3CR3A 3I4GA 3ASFA 3LVQE 3CHOA 3FHEA 3D9OA 3LJNA 3KEZA 4UQZA 3EUVA 3DSWA 3HHMA 2VTBB 4IYPA 1K3ZD 3NZUA 2C2LA 3KSQA 4U8VD 3NF1A 5AJDA 1IYGA 2Y69E 3OAWA 4HB5A 3RRUA 2FI7A 4CGWA 4UWKA 2ETAA 4GTVA 4PS7A 4G2VA 1S64A 2F37A 3V30A 3G2VA 5ANLA 3S7FA 2R05A 4FJZA 3FH7A 4KYOB 3RIBA 1MZCA 3X2QE 4HLLA 4GTPA 4N5QA 2J07A 3FUJA 4DJAA 1OCRE 3TL5A 4FC8A 4W9RA 2R02A 2AW6A 4WNEA 4DX7D 4ZFHA 4JEUA 4URKA 2FBNA 4GB9A 4E6HA 3OXGA 2GRQB 3FY4A 3OXFA 3RSEG 4CDNA 3DPYA 2X6JA 4A3TA 4GPKA 2V4HC 3TWRA 3HRAA 1UJJA 2WXJA 1DNPA 1KLXA 2P2CP 1WY6A 2VSOE 1EPUA 4RSYA 4PH4B 4J8DA 3B95A 5JA4D 5HRYA 4XKCA 4EECA 2HO1A 1Z5SC 1MX6A 2L6BA 5CMWA 2VSNA 4I6GA 2X6IA 4ANXA 4A1SA 5BPPA 4BX9A 1N0RA 2L0IA 3W9GA 5T4YA 4E85A 1H2UA 2I2OA 2WXRA 3PE3A 2NSZA 4EZLA 3S7BA 4G8LA 4UWLA 4AV7A 3S7DA 4I9CA 1E8XA 3UX4A 2OOEA 2XZTG 1H6PA 4C48B 4HXIA 4XEIG 2YQ8A 1HX8A 2GRMA 3LJ3A 4FP7A 2GW1A 3CVXA 3ZNGA 2GRLA 3QKYA 4CEMA 4GZDA 2F8XK 1OCOE 1SQMA 4AP2A 3DSTA 4UQYA 3QWVA 5G04C 1FCHA 3E4BA 1AP7A 4YVOA 3DXMG 3TXNA 1LTXA 3KEAA 2KCKA 3AG2E 1YCSB 1OT8A 4M3OA 4N3BA 3EHMA 3ULEG 3T5VA 1S63A 2MHKA 3S2AA 3WXXA 3EDTB 2WXMA 1WM5A 2WQHA 1HG2A 3QJZA 1H6OA 1AWCB 1EF1C 2QC9A 3C3RA 3FEXA 3HXEA 3SO8A 2ZGGA 3V2OA 3MKQB 5EYLA 4CT0A 2R59A 2Y1LE 4ACLA 3CHPA 2XCBA 3ABME 3APCA 3D9LA 4ATZD 3ISMC 3TWVA 3CLJA 1JCQA 3V31A 3B7BA 2LXLA 3RKVA 3MX3A 3G2UA 3SI5A 3HVEA 3QAQA 4FJYA 3AS8A 3LCAA 2XGSA 5ENNA 1VDYA 2WXIA 1INZA 1U2VG 2I1JA 5CEAA 2P9SG 2DIWA 3ASHA 5D66A 3ULYA 5EIDA 3T5XA 3ZUVB 2XS1A 1SW6A 4ABNA 2XHEA 4JXTA 5CRVA 4MS6A 3VLFA 5BV1A 3L6AA 2L0TB 3MZLB 3LDZA 3NQPA 5FZRA 3TWXA 5A7DB 5KBAA 4RG6A 4I6JA 3CHQA 3D9PA 5JHAA 3PZ4A 1E7UA 3G2SA 4L9PA 1HE8A 2PQRA 3ZXSA 1SA5A 2V8SE 2EQXA 1TJCA 4UQXA 4EQFA 5EKQD 4FLBA 4L2LA 3UM0A 4GTTA 5ENOD 3HXDA 2AJAA 3TAXA 2ZU6B 2C0MA 2PZIA 3NOGD 3EU5A 3JXJA 3L9TA 3QC1A 4V3IA 4HRNA 4N39A 4N2QA 1OWLA 1EDUA 3G2WA 2CG2A 3QK0A 2I9CA 4A3VA 5CRUA 1BI8B 4PS8A 4AVXA 2IEJA 1OCCE 5HS0A 2ILRA 4FULA 3SF4A 3FFLA 3CVNA 3J5PA 4UI9K 1TNYA 3DRAA 4QQIA 3MEKA 3ZN3A 1Y8MA 2FO1E 4EZJA 2XGOA 4H7YA 3NBNB 1PC2A 3EHNA 3ESLA 3U9WA 3SBTB 4K5AB 3NOCD 5CCLA 1S0PA 5LFAA 2LNIA 4I2ZA 5AQBA 4DK5A 4KVMA 1LD7A 2IU1A 2J4DA 2NYJA 4BY6A 2F0YA 2IQCA 4WAFA 3LKUA 2KXPC 1E8YA 2IOSA 5CBOA 4AM9A 3APDA 3CK7A 4LNBA 3CKBA 3MA5A 4JHKA 1D9SA 1UG3A 2IONA 3FUHA 2Y3AA 4WNDA 3ZU7B 2I1KA 2B6CA 3B7SA 5AARA 3UQ3A 4I9EA 4YNDA 2VGYA 5JHBA 2R2LA 1N95A 3ZEFA 3PUJA 1MQSA 3GZSA 1ELRA 3U66A 1PY1A 2CFUA 5ARGA 2VSXE 2B0OE 4GYWA 4XE0A 4UWHA 1NA0A 4J0UA 2NXPA 4FHKA 4BTBA 2KC7A 4DLQA 2QFCA 1HFAA 3L22A 4NQ0A 4G11A 2BF0X 2BTDA 1N9AA 3UXGA 4F53A 3CVUA 4JEHA 2XGMA 2EIKE 4GTQA 4DX5D 2WXGA 3LY7A 3KSLA 5BV0A 4DX2A 2EILE 4B89A 3FU5A 3UINC 5BXOA 5G04J 5ENQD 3EHRA 5G2NA 3ONLA 2A4ZA 3HXFA 2CHZA 4GYYA 2P9UG 3TG4A 3C3OA 1JUQA 1G3NB 4GTMA 4LNGA 3FU0A 1E8WA 2GGFA 2OVBA 1SZAA 3JQ1A 4NACA 5FWQA 1N0QA 3JCKC 1RW2A 4HRMB 4NRHB 3DWLG 2XS8A 3FDHA 4BESA 1OWPA 3S7JA 1OWOA 4LG6A 4GPMA 1X5BA 1IHBA 4O1PA 4KT6B 5EN5D 2YHCA 2XCCA 4KVOA 3UKRG 3O48A 4WUYA 1S70B 5CHEE 4DRXE 3J5QB 4JHRA 3ZHEA 2XENA 2LSVA 5IY5E 1V55E 1KT1A 3PZ1A 4GZCA 4KZ0A 5LX8A 2A5UA 3QDNA 4B0ZA 3SFZA 3VLDA 3CVYA 4GMRA 1TEZA 1A17A 3HIZA 3IV0A 2VGXB 3L17A 3FTWA 3ZRHA 4BERA 3U3WA 4GAAA 3SD5A 3ZHEB 1UW4B 2X38A 3NAWA 3DBSA 1ZBPA 4WNGA 3GZ1A 1KPSB 5B1BE 3CHMA 3LY8A 2DZOA 1N52A 3V2XA 1N4RA 3DEPA 1KZOA 5ANRA 2DBAA 2E0IA 1SA4A 3CHRA 4IN3B 3CVPA 4KMOA 3FUDA 4K03A 2BKGA 3FUNA 3I4RB 3CK9A 3FTYA 1HF8A 4UI9C 5CERB 4ACKA 2LAHA 3PREA 3B7UX 3FTSA 3UM2A 2QYUA 3SBSA 3D9IA 3D9NA 4TRQA 1MYOA 2L6JA 3CHSA 2WMNA 2AVPA 3OXLA 5DIZA 1N94A 4GCNA 5AAOA 5EYPF 3ZYQA 4FHJA 1N11A 3QARA 3R7RA 3TWWA 3L16A 3RO3A 1V54E 5LP0A 3BUAA 3Q5MA 3PZ2A 5ARFA 1IHGA 4CDRA 5C1DA 2JEKA 2OEWA 1JWGA 4HLEA 2MYOA 5AQ7A 5AQ9A 5AYWD 3PNLB 4IRUA 1XGWA 3FTUA 3C5RA 4JA9A 2XEEA 4J8FA 3NB2A 3D9HA 3PZDA 2IFUA 3FTVA 3VTXA 2R5SA 2QZAA 2CHWA 1JPLA 4EPZA 1YYHA 2WQ7A 2WPVA 3MYVA 4C0EA 3LPZA 4BSZB 5ENSD 5ENPD 2V4LA 2X6KA 4HOSA 2IJGX 4GMJA 2E2EA 3ZXPA 1SVXA 5KJNA 1H0AA 3ZW3A 4BFRA 5AIJA 1QBQA 2Y0BG 2EIME 3SQVA 1TJFA 1OUVA 3D9JA 3ONKA 5FZSA 4K5CA 5HKPA 3L54A 1OXJA 5LCWC 4CDMA 4DLOA 3Q78A 3LVRE 2WXHA 4FA6A 3KAEA 4U8HA 3FUIA 3RJVA 3SGHA 3BU8A 4DX1A 4JPSA 4L2YA 2GRRB 1IXVA 5JJ6A 3I3NA 5D0OD 1OWNA 4RLYA 4YVQC 2WM9A 1E96B 5EDSA 4AEZC 4Q94A 5BW8C 3SHFA 5BXUA 3DSSA 3IBEA 4XX5A 3SY2A 4HOQA 3EIQC 2WVIA 1MHQA 1Z3YA 1IKND 2PM7A 1NL4A 2ZISA 2PNNA 2FF4A 2WQ6A 4I2WA 5AQAA 3D3MA 1MX2A 2V5QC 1HZ4A 1QYMA 2RFAA 5FQ8A 4YDYA 1YMPA 3SFXA 5T3RA 4YDEA 5J90A 1SZ9A 2J9QA 3K9IA 4ATGA 4UI9J 1TN8A 2WXKA 2Y4TA 4LUNU 1B89A 3ENEA 3KS2A 1WG0A 3JYSA 1OWMA 4NIKA 4CYMD 5FTPA 4ME2A 5FQ6A 3AU5A 3AS5A 1GW6A 2HM8A 4P29A 2RFMA 1Z3XA 1A5EA 3MV2B 4XIFA 5FJYA 2YINA 3UPVA 4AOFA 4HORA 3ZYKA 3CK8A 4O1OA 3JXIA 4AJWA 5AN8A 3BG0B 1HXIA 1E8ZA 3DXKG 2LXMA 4AXHA 2KCLA 2AXVA 4IULA 4I1MA 4HQDA 2GROB 2VYIA 1NZNA 3B7TA 4JZYA 1TNBA 1HS6A 5ENTD 4CCAA 2X6FA 5KJMA 4G25A 3HDXA 3DSXA 3Q15A 3IHYA 3FU3A 3JUEA 4NURA 2ZGDA 4HNAD 2FEZA 4HS2A 4U95D 2ZXWE 3NZSA 1NFIE 1KZPA 3B7RL 4I1AA 4WWPA 2CHXA 3ASOE 3ASGA 1Z6TA 3FUFA 3UT8A 2LAIA 3FULA 4ILIA 4Y6WA 3Q47B 2EIJE 4GTOA 4BX8A 3V79K 2IF4A 1O5MA 2IO2C 3LEWA 3QWPA 5J08A 4MLPA 4G8KA 5H7PA 4XKBA 4JVSA 4LSZE 4U0ZA 3TXMA 3APFA 2H6FA 3GYZA 3AS4A 3AG4E 1UN8A 2CG3A 2X6HA 3CVVA 4F7AA 3MKRA 1N4SA 4ILGA 4LNUD 4B94A 1QNFA 3R9MA 5HQ8A 3UTMA 5FT9A 2KCVA 4OAVB 4N3CA
chains in the Genus database with same CATH topology
2YHEA 3S7BA 4HFGA 3CGHA 4BSXA 4LCTA 3D9KA 5EX0A 4UWLA 4KXKB 1A17A 3ASDA 4AV7A 5G05C 1TEZA 3HIZA 3S7DA 3IV0A 4I9CA 2VGXB 1E8XA 4U0UA 3UX4A 2OOEA 3L17A 3FTWA 4I43A 2X3MA 4JA7A 4APFA 3ZRHA 4XZ4A 2CFZA 1W3BA 5KCMA 3U3WA 1DVPA 4GAAA 3SD5A 4GA0A 4HXIA 1U3DA 3ZHEB 2YQ8A 1HX8A 2GRMA 1UW4B 2X38A 3LJ3A 4JC8A 4FP7A 2GW1A 4GU5A 3CVXA 3DBSA 3HVEB 2GRLA 1ZBPA 3QKYA 4WNGA 4CEMA 3GZ1A 4GZDA 4CGVA 3CHMA 3LY8A 4MRUA 1FVHA 1SQMA 2FULA 1N52A 4AP2A 4TV3A 5E75A 4UQYA 1PAQA 3O4ZA 2DBAA 3L13A 1FCHA 3QWVA 5ANRA 5G04C 2XRYA 1H2TC 3GZ2A 2E0IA 3E4BA 4N5CA 4YVOA 3CHRA 1QQEA 2VTBA 4IN3B 3CVPA 4KMOA 5BT1A 1WAO1 3FUDA 4K03A 4PUCA 3TXNA 3FUNA 3I4RB 3CK9A 3FTYA 1HF8A 4JHJA 2KCKA 4UI9C 4M3OA 4N3BA 4ACKA 3EHMA 2LAHA 4F1SA 3LY9A 3PREA 3T5VA 3PDNA 3SZ7A 2MHKA 3S2AA 3WXXA 4G23A 1JWFA 4APOA 4BT9A 2R17C 3B7UX 3EDTB 2WXMA 1WM5A 2WQHA 1HG2A 3FTSA 3QJZA 3QOUA 1Y6IA 2KZTB 4C0MA 2YNQA 1EF1C 4CRWA 5CMYA 4UWFA 3FEXA 3SBSA 5KJLA 4DI4A 1QZ2A 4GZ6A 3IHVA 3D9IA 3D9NA 4TRQA 3PRZA 2L6JA 3MKQB 3CHSA 4CT0A 4ANVA 1ZU2A 4KBQA 3U64A 2WMNA 2NSZA 2R59A 1HH8A 2AVPA 3OXLA 4ACLA 3CHPA 5DIZA 3CVQA 2XCBA 2WXPA 4GCNA 3UT7A 3GW4A 3ZYQA 4FHJA 4G24A 3APCA 4GA1A 3D9LA 5LOZA 4G1TA 3CSFA 4I6EA 3CLJA 3LXUX 3QARA 3FH5A 3R7RA 5E76A 3RKVA 5D0QD 3L16A 3RO3A 3MX3A 4EZKA 3G2UA 3EIJA 3SI5A 2AXZA 5LP0A 3L08A 3HVEA 3QAQA 1HG5A 4FJYA 3AS8A 3BG1B 3JUIA 3LCAA 2Y4UA 4Y6CA 5LCWJ 3FEYA 2XGSA 3Q5MA 5ENNA 4U0SA 1VDYA 5AJLA 2XRZA 5ARFA 2WXIA 4GYOA 1INZA 2OVFA 1IHGA 4CDRA 5C1DA 2JEKA 2I1JA 1JWGA 3FTXA 3FUKA 3PNTB 3URZA 2DIWA 3ASHA 4LRZA 5AYWD 3ZFWA 4HLEA 2PQNA 2VQ2A 4GZ3A 3PNLB 4D10C 4IRUA 1L5JA 1XGWA 2LSUA 3JQ0A 2FO7A 3T5XA 4HOTA 1IQUA 4AIFA 3FTUA 4FU3A 4G26A 4JA9A 4XI0A 2VJ8A 2XPZA 3RRNB 2QY7A 4ABNA 2XHEA 3FTZA 4J8FA 4JXTA 1H19A 3PZDA 1N54A 4MS6A 1ELWA 4I1OB 3VLFA 2VGXA 5BV1A 4BTAA 2IFUA 3FU6A 3L6AA 2L0TB 3MZLB 3DPDA 3FTVA 3LDZA 3NQPA 3LYAA 2I6HA 3VTXA 3T8MA 3ESKA 5FZRA 3Q49B 5AENA 2R5SA 2WB2A 5A7DB 4EBAA 2CHWA 1JPLA 3ML8A 4EPZA 4GZ5A 4PDXA 4RG6A 2WQ7A 2WPVA 3UT4A 2P58C 4I6JA 3MYVA 3PEVB 3CHQA 3D9PA 4C0EA 4F3VA 4N2SA 2AWIA 3IKOB 3LPZA 3MCXA 3CEQA 3R9AB 4O6FA 1H6KA 4DPRA 5JHAA 3PUKA 4J8SA 1NA3A 4WWOA 3CVWA 1E7UA 3G2SA 2V4LA 2X6KA 4U63A 1HE8A 2PQRA 4HOSA 5JJTA 3ZXSA 2IJGX 4GMJA 2E2EA 5KJNA 5EKQD 2V8SE 2EQXA 1TJCA 1H0AA 3LS8A 4UQXA 2XEVA 2V0PA 3ZW3A 4EQFA 5BPPA 4BFRA 5AIJA 2DCPA 4FLBA 4L2LA 3P1UA 4GMLA 3FUMA 3C98A 4BT8A 3ZVVA 1TJFA 1OUVA 3D9JA 5EX3A 5JJ7A 3QNKA 3ONKA 4J8EA 4QFVA 5FZSA 3TAXA 5A23A 2ZU6B 2C0MA 4Q69A 2PZIA 3L54A 3N71A 4ILHB 3QC1A 3G2TA 4PS3A 4V3IA 4N39A 4B8AA 3MV3B 4N2QA 5LCWC 4U04A 2WMOA 3FUEA 4CDMA 4DLOA 5BNWA 4Q96A 3LVRE 2V5FA 1BPOA 2WXHA 4FA6A 3Q4AB 3KAEA 1OWLA 3I5PA 4U8HA 3FUIA 3VLEA 4JL0A 1EDUA 2Q7FA 3RJVA 1EYHA 2KM4A 3G2WA 3SGHA 2CG2A 2HR2A 4JPSA 3EJNA 2I9CA 3MGBA 3QK0A 4L2YA 3VTYA 4A3VA 5CCMA 3UMVA 2MOWA 4H7XA 4PS8A 4AVXA 4LERA 4GCOA 4L7TA 5JJ6A 2ILRA 4FULA 3SF4A 3FFLA 1U3CA 3I3NA 5D0OD 3CVNA 4BWRA 4KZCA 1OWNA 2XQ0A 4UI9K 4CT4A 4YVQC 2WM9A 3RRMB 1E96B 3ZPJA 4AEZC 2WXNA 3OTNA 5EDSA 3MEKA 4Q94A 5BW8C 3SHFA 3FH8A 5HI7A 1HO8A 1Y8MA 3ZN3A 5M72A 3IBEA 4EZJA 2XGOA 5FQ7A 4H7YA 2J49A 1PC2A 3CSTA 3EHNA 2XPYA 4XX5A 4K0RA 1NP7A 3ESLA 3U9WA 4MKTA 4HOQA 3EIQC 3SBTB 3TJPA 2WVIA 5CCLA 1MHQA 2PM6A 3ULQA 1S0PA 5LFAA 2LNIA 3CIAA 4L23A 1Z3YA 4GA2A 4RG9A 3UUXA 4I2ZA 4OVUA 2PM7A 2LO6A 4DK5A 2FF4A 4KVMA 2WQ6A 4LEUA 1HU3A 5KJKA 2NC9A 3PVLA 3TGOA 3D9MA 2IU1A 2J4DA 4I2WA 3MJWA 2JLBA 2RG8A 3D3MA 3PEUB 4BY6A 2IQCA 5DBKA 1HZ4A 4WAFA 3SNXA 3LKUA 1E8YA 2IOSA 2WXFA 2ONDA 5FQ8A 4AM9A 3CQGB 3APDA 3QB2A 4C9BB 5FQ4A 5T3RA 3CK7A 3ZYLA 3CKCA 1FVFA 3CKBA 5J90A 3MA5A 4JHKA 1SZ9A 2J9QA 3K9IA 4ATGA 1UG3A 4JW1A 2IONA 4UI9J 4DI3A 2WXKA 3FUHA 3FWVA 1LF8A 2J4BA 2Y4TA 4AY5A 2Y3AA 4LUNU 4WNDA 1UJKA 1B89A 3ZYMA 3ZIMA 3ENEA 2KATA 2I1KA 4A1GA 2M63A 3KS2A 3B7SA 4WNFA 5A6CA 3UQ3A 3JYSA 4I9EA 3PS6A 2J08A 4YNDA 1OWMA 3BEEA 2VGYA 4WWNA 5JHBA 5FTPA 3B13A 4ME2A 3PE3A 5FQ6A 3ZEFA 4FADA 3PUJA 1MQSA 2KZTA 3FP3A 5T8IA 4ANUA 4L1BA 3GZSA 3AU5A 3AS5A 1ELRA 1GW6A 1P5QA 2HM8A 3KD7A 1KT0A 4P29A 3U66A 1PY1A 1E7VA 2UY1A 2OV8A 1Z3XA 3CV0A 3CVLA 2CFUA 3CR3A 3I4GA 3ASFA 3MV2B 5ARGA 2RD0A 3AU4A 3LVQE 2VSXE 4XIFA 5BUZA 4RVBA 3CHOA 3FHEA 5FJYA 1YA0A 2YINA 3D9OA 3UPVA 4A55A 4GYWA 4XE0A 4AOFA 4UWHA 3KEZA 4UQZA 5C2YA 2WXLA 4HORA 3ZYKA 1UN9A 1NA0A 3HHMA 2VTBB 3CK8A 4J0UA 4IYPA 4AJWA 3NZUA 2C2LA 2NXPA 3BG0B 4FHKA 2AXUA 4BTBA 1HXIA 1E8ZA 2KC7A 4DLQA 3NF1A 5AJDA 1IYGA 4XI9A 2QFCA 4I17A 4AXHA 2MRIA 3OAWA 4AY6A 2KCLA 1HFAA 2AXVA 3RRUA 3L22A 2FI7A 4NQ0A 4G11A 4CGWA 4IULA 2BF0X 4UWKA 4I1MA 4OVVA 3QWWA 2BTDA 4J6IA 4PS7A 2VYIA 4G2VA 1XNFA 4F53A 3CVUA 4JEHA 2XGMA 2J09A 2WXGA 1NZNA 3LY7A 3B7TA 3RO2A 3G2VA 5ANLA 3S7FA 5BV0A 4JZYA 4CCAA 1HS6A 3R7QA 2X6FA 5KJMA 4G25A 3HDXA 4OYSA 3Q15A 4FJZA 3IHYA 4B89A 3FU5A 3FH7A 3FU3A 4KYOB 3RIBA 4NURA 4FLHA 5G04J 4EBAG 2UY1B 3PE4A 5G2NA 2FEZA 3ONLA 2WXOA 4HS2A 2A4ZA 2CHZA 2UWJG 3NZSA 4GYYA 2J07A 3FUJA 4DJAA 3TG4A 3B7RL 3P2BA 3TL5A 3HYMB 4I1AA 4WWPA 2CHXA 4FC8A 4W9RA 2VSYA 2AW6A 4WNEA 3TG5A 1JUQA 3MKQA 3CQCB 2IOLA 3ASGA 1Z6TA 2OVBA 1E8WA 2GGFA 3FU0A 2C0LA 2LAIA 3FUFA 1SZAA 2XPIA 3FULA 4JEUA 3JQ1A 3UT8A 4URKA 4ILIA 4NACA 5FWQA 4B8CB 3JCKC 4Y6WA 2FBNA 3Q47B 5FZQA 4GB9A 4NRHB 4BX8A 3RK6A 4E6HA 3OXGA 4TUUA 5G05J 4U07A 3FDHA 3FY4A 3OXFA 2IF4A 4CDNA 1ELKA 2BUGA 2WXQA 2X6JA 3LEWA 1OWPA 4A3TA 4GPKA 3QWPA 3ZGQA 5J08A 4MLPA 3S7JA 4XKBA 1OWOA 1UJJA 2WXJA 1DNPA 4JVSA 4ANWA 1X5BA 1KLXA 1H2VC 1WY6A 4KT6B 4U0ZA 2VSOE 3TXMA 2YHCA 1EPUA 2XCCA 3APFA 4KVOA 3O48A 3ML9A 3RU0A 4RSYA 1E90A 3GYZA 3AS4A 4PH4B 4N3AA 4WUYA 5CHEE 4J8DA 1UN8A 4JHRA 2CG3A 2X6HA 1IQRA 2PL2A 3CVVA 4F7AA 3MKRA 4ILGA 4XKCA 3ZHEA 4EECA 2HO1A 5G55A 2LSVA 4HVBA 2VSNA 2HYZA 3U4TA 5CMWA 4I6GA 1KT1A 2X6IA 1QNFA 3PH0C 4UWGA 4B94A 4ANXA 4GZCA 4KZ0A 4R7LA 4HOUA 5HQ8A 5LX8A 2A5UA 3QDNA 3SFZA 5FT9A 4A1SA 2L0IA 3VLDA 3IEGA 2KCVA 5T4YA 4B0ZA 4BX9A 4E85A 3CVYA 1H2UA 2L9BA 2I2OA 2WXRA 4EZLA 4N3CA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WY6 A; 
#chains in the Genus database with same CATH topology
 3CGH A;  2EIN E;  1FT1 A;  3D9K A;  3E33 A;  3ASD A;  5G05 C;  4U0U A;  4I43 A;  4APF A;  4TXR A;  2CFZ A;  5KCM A;  1U3D A;  1MX4 A;  3TWS A;  1D8E A;  4JC8 A;  4X8Q A;  4CGV A;  4MRU A;  2FUL A;  1RZ4 A;  5E75 A;  2H6I A;  1DCQ A;  1PAQ A;  3O4Z A;  3L13 A;  1H2T C;  3GZ2 A;  3HG0 D;  1OY3 D;  4N5C A;  1QQE A;  3ASN E;  4O60 A;  5BT1 A;  4PUC A;  5FIO A;  4JHJ A;  4U96 D;  4F1S A;  3LY9 A;  4JB8 P;  1JWF A;  4APO A;  4BT9 A;  4DX6 D;  2OCC E;  1FPP A;  1D8D A;  1OCZ E;  1Y6I A;  2YNQ A;  5CMY A;  4DI4 A;  4GZ6 A;  3IHV A;  3PRZ A;  3UKU G;  3U64 A;  4YDW A;  3CVQ A;  1FT2 A;  3UT7 A;  2ZIR A;  5LOZ A;  4GA1 A;  5JMN D;  4G1T A;  5CEC B;  4I6E A;  4HRL A;  3FH5 A;  5E76 A;  5D0Q D;  3UI2 A;  3Q79 A;  2AXZ A;  5LCW J;  3JUI A;  3UM1 A;  1O1R A;  3FEY A;  3PZ3 A;  4U0S A;  5CED B;  2P9K G;  5AJL A;  2XRZ A;  2OVF A;  3ABK E;  3FUK A;  3PNT B;  3ZFW A;  2PQN A;  2VQ2 A;  3DEO A;  3JQ0 A;  1IQU A;  1UOH A;  4G26 A;  2VJ8 A;  4HI8 A;  1N54 A;  1ELW A;  4I1O B;  5B1A E;  2VGX A;  3FU6 A;  3DPD A;  1Q2Z A;  1ZB1 A;  3ESK A;  1O1S A;  3Q49 B;  4EHM A;  1BI7 B;  4EBA A;  1TNZ A;  3E37 A;  3UT4 A;  3E32 A;  3PEV B;  3IKO B;  1K1B A;  3CEQ A;  4U8Y D;  4O6F A;  4WWO A;  1DCE A;  4K5B A;  4U63 A;  2DYR E;  3HXB A;  4F6R D;  4J7W A;  2XEV A;  2ETC A;  4UUC A;  3FUM A;  2JAB A;  3BQO A;  4BT8 A;  3RAU A;  3ZKJ A;  3QNK A;  4QFV A;  5A23 A;  5KWD A;  4Q69 A;  4A63 B;  4ILH B;  3G2T A;  4B8A A;  2RKK A;  4Q96 A;  1BPO A;  3I5P A;  3VLE A;  4JL0 A;  2KM4 A;  3EJN A;  3MGB A;  3UMV A;  4LER A;  4GCO A;  3E30 A;  2XQ0 A;  3ZPJ A;  2WXN A;  3FH8 A;  1HO8 A;  2J49 A;  2XPY A;  1NP7 A;  4MKT A;  3TJP A;  2PM6 A;  3UM3 A;  4L23 A;  4RG9 A;  4GA2 A;  3UUX A;  4YDO A;  1X81 A;  5KJK A;  3TGO A;  3D9M A;  2J8S D;  2RG8 A;  1TNU A;  1TN7 A;  5DBK A;  3SNX A;  4M7C A;  2WXF A;  4GTR A;  3CQG B;  5FQ4 A;  1BD8 A;  2KBX A;  4JW1 A;  3E34 A;  1LF8 A;  2J4B A;  4AY5 A;  3DSU A;  4JD2 G;  4RQI A;  2M63 A;  1TNO A;  2P9L G;  3PS6 A;  4ZHB A;  2J08 A;  3BEE A;  1N4P A;  3UIP C;  5D2M C;  4FAD A;  5T8I A;  3FP3 A;  4TUM A;  3EHQ A;  1TN6 A;  1KT0 A;  4CZ2 D;  2RD0 A;  3AU4 A;  5BUZ A;  4RVB A;  1YA0 A;  1WDY A;  4A55 A;  5C2Y A;  2WXL A;  2VGE A;  1UN9 A;  1MJ0 A;  4BEP A;  2AXU A;  3WG7 E;  3ABL E;  4XI9 A;  4I17 A;  2MRI A;  4AY6 A;  3T9K A;  4OVV A;  3QWW A;  4J6I A;  1XNF A;  3Q7F A;  2DZN A;  3C72 A;  3TWU A;  2J09 A;  3RO2 A;  3R7Q A;  3UIO C;  4OYS A;  4U7E B;  3W9F A;  4FLH A;  4EBA G;  2UY1 B;  3PE4 A;  2BKK B;  2WXO A;  1TR4 A;  2UWJ G;  2F8Y A;  1BU9 A;  3P2B A;  3HYM B;  3EU9 A;  3TG5 A;  2VSY A;  3MKQ A;  3CQC B;  2IOL A;  4PDX A;  1O1T A;  1LD8 A;  2C0L A;  3AG1 E;  2XPI A;  2XEH A;  5ITZ F;  4B8C B;  2P9N G;  2H6H A;  5FZQ A;  3RK6 A;  4TUU A;  5G05 J;  4U07 A;  2QYJ A;  1ELK A;  2BUG A;  2WXQ A;  3ZGQ A;  3SFY A;  4ANW A;  1H2V C;  3RU0 A;  3ML9 A;  1E90 A;  4N3A A;  1IQR A;  2PL2 A;  1NI1 A;  1N4Q A;  5G55 A;  4HVB A;  3U4T A;  2HYZ A;  3PH0 C;  4UWG A;  4R7L A;  4HOU A;  3IEG A;  2L9B A;  3Q75 A;  2YHE A;  4HFG A;  4BSX A;  4LCT A;  5CBN A;  5EX0 A;  3TWT A;  4KXK B;  2P9P G;  4JA7 A;  2X3M A;  2GRN B;  4XZ4 A;  1W3B A;  1DVP A;  4GA0 A;  2P9I G;  3T8K A;  4GU5 A;  3HVE B;  1K8K G;  3Q73 A;  1FVH A;  2DVW A;  4TV3 A;  2IY0 C;  2XRY A;  3HXC A;  2VTB A;  4Z68 A;  1WAO 1;  3PDN A;  3SZ7 A;  4G23 A;  2R17 C;  2DYS E;  3QOU A;  2KZT B;  4C0M A;  1BLX B;  4CRW A;  4J8Y A;  4UWF A;  5KJL A;  1QZ2 A;  4ANV A;  1ZU2 A;  4KBQ A;  5KNH D;  2HE0 A;  1HH8 A;  4B93 B;  2WXP A;  3GW4 A;  4G24 A;  3CSF A;  3DSV A;  3LXU X;  4EZK A;  3EIJ A;  3AJI A;  3C3Q A;  3L08 A;  1HG5 A;  3BG1 B;  4Y6C A;  2Y4U A;  2OEV A;  4GYO A;  3FTX A;  3URZ A;  4LRZ A;  4F1P A;  4GZ3 A;  4D10 C;  4HOT A;  1L5J A;  2LSU A;  2FO7 A;  2XZD G;  4AIF A;  2LUH A;  4FU3 A;  2IO3 C;  4XI0 A;  3RRN B;  2XPZ A;  2QY7 A;  3FTZ A;  1H19 A;  4BTA A;  4MBG A;  4DUI A;  3LYA A;  2I6H A;  3T8M A;  5AEN A;  2WB2 A;  2GRP B;  3ML8 A;  4GZ5 A;  2P58 C;  4F3V A;  3AAA C;  2AWI A;  4N2S A;  3MCX A;  3R9A B;  1H6K A;  4DPR A;  3PUK A;  4J8S A;  1NA3 A;  3CVW A;  3F6Q A;  5JJT A;  3IXE A;  3LS8 A;  2ETB A;  2V0P A;  5EIL A;  2DCP A;  3P1U A;  4GML A;  4BET A;  3C98 A;  3ZVV A;  5KNG A;  2BED A;  5EX3 A;  5JJ7 A;  4J8E A;  3AG3 E;  3N71 A;  4PS3 A;  3MV3 B;  4U04 A;  2WMO A;  3FUE A;  5BNW A;  2V5F A;  3Q7A A;  3Q4A B;  2Q7F A;  1EYH A;  2HR2 A;  3VTY A;  5CCM A;  2MOW A;  4H7X A;  4L7T A;  2H6G A;  1U3C A;  4BWR A;  4KZC A;  3L82 A;  4CT4 A;  4GTS A;  3RRM B;  3OTN A;  5HI7 A;  5M72 A;  5FQ7 A;  3CST A;  4K0R A;  4TXP A;  3ULQ A;  3CIA A;  4OVU A;  1DC2 A;  2LO6 A;  4LEU A;  1HU3 A;  2NC9 A;  3PVL A;  2R03 A;  5EIB E;  3MJW A;  2JLB A;  3PEU B;  5B3S E;  2OND A;  4C9B B;  3QB2 A;  1JCR A;  4HBD A;  3ZYL A;  3CKC A;  1FVF A;  5ENR D;  4DI3 A;  2A5E A;  3FWV A;  1K1A A;  1TYQ G;  1UJK A;  3ZYM A;  2DWZ A;  3ZIM A;  2KAT A;  4A1G A;  4WNF A;  5A6C A;  3TWQ A;  1JCS A;  4WWN A;  5FIN A;  3B13 A;  4HI9 A;  2KZT A;  3Q9N C;  4ANU A;  4TXQ A;  4L1B A;  3Q9U C;  1P5Q A;  4OAU C;  3KD7 A;  1E7V A;  2UY1 A;  2OV8 A;  3CV0 A;  3CVL A;  3CR3 A;  3I4G A;  3ASF A;  3LVQ E;  3CHO A;  3FHE A;  3D9O A;  3LJN A;  3KEZ A;  4UQZ A;  3EUV A;  3DSW A;  3HHM A;  2VTB B;  4IYP A;  1K3Z D;  3NZU A;  2C2L A;  3KSQ A;  4U8V D;  3NF1 A;  5AJD A;  1IYG A;  2Y69 E;  3OAW A;  4HB5 A;  3RRU A;  2FI7 A;  4CGW A;  4UWK A;  2ETA A;  4GTV A;  4PS7 A;  4G2V A;  1S64 A;  2F37 A;  3V30 A;  3G2V A;  5ANL A;  3S7F A;  2R05 A;  4FJZ A;  3FH7 A;  4KYO B;  3RIB A;  1MZC A;  3X2Q E;  4HLL A;  4GTP A;  4N5Q A;  2J07 A;  3FUJ A;  4DJA A;  1OCR E;  3TL5 A;  4FC8 A;  4W9R A;  2R02 A;  2AW6 A;  4WNE A;  4DX7 D;  4ZFH A;  4JEU A;  4URK A;  2FBN A;  4GB9 A;  4E6H A;  3OXG A;  2GRQ B;  3FY4 A;  3OXF A;  3RSE G;  4CDN A;  3DPY A;  2X6J A;  4A3T A;  4GPK A;  2V4H C;  3TWR A;  3HRA A;  1UJJ A;  2WXJ A;  1DNP A;  1KLX A;  2P2C P;  1WY6 A;  2VSO E;  1EPU A;  4RSY A;  4PH4 B;  4J8D A;  3B95 A;  5JA4 D;  5HRY A;  4XKC A;  4EEC A;  2HO1 A;  1Z5S C;  1MX6 A;  2L6B A;  5CMW A;  2VSN A;  4I6G A;  2X6I A;  4ANX A;  4A1S A;  5BPP A;  4BX9 A;  1N0R A;  2L0I A;  3W9G A;  5T4Y A;  4E85 A;  1H2U A;  2I2O A;  2WXR A;  3PE3 A;  2NSZ A;  4EZL A;  3S7B A;  4G8L A;  4UWL A;  4AV7 A;  3S7D A;  4I9C A;  1E8X A;  3UX4 A;  2OOE A;  2XZT G;  1H6P A;  4C48 B;  4HXI A;  4XEI G;  2YQ8 A;  1HX8 A;  2GRM A;  3LJ3 A;  4FP7 A;  2GW1 A;  3CVX A;  3ZNG A;  2GRL A;  3QKY A;  4CEM A;  4GZD A;  2F8X K;  1OCO E;  1SQM A;  4AP2 A;  3DST A;  4UQY A;  3QWV A;  5G04 C;  1FCH A;  3E4B A;  1AP7 A;  4YVO A;  3DXM G;  3TXN A;  1LTX A;  3KEA A;  2KCK A;  3AG2 E;  1YCS B;  1OT8 A;  4M3O A;  4N3B A;  3EHM A;  3ULE G;  3T5V A;  1S63 A;  2MHK A;  3S2A A;  3WXX A;  3EDT B;  2WXM A;  1WM5 A;  2WQH A;  1HG2 A;  3QJZ A;  1H6O A;  1AWC B;  1EF1 C;  2QC9 A;  3C3R A;  3FEX A;  3HXE A;  3SO8 A;  2ZGG A;  3V2O A;  3MKQ B;  5EYL A;  4CT0 A;  2R59 A;  2Y1L E;  4ACL A;  3CHP A;  2XCB A;  3ABM E;  3APC A;  3D9L A;  4ATZ D;  3ISM C;  3TWV A;  3CLJ A;  1JCQ A;  3V31 A;  3B7B A;  2LXL A;  3RKV A;  3MX3 A;  3G2U A;  3SI5 A;  3HVE A;  3QAQ A;  4FJY A;  3AS8 A;  3LCA A;  2XGS A;  5ENN A;  1VDY A;  2WXI A;  1INZ A;  1U2V G;  2I1J A;  5CEA A;  2P9S G;  2DIW A;  3ASH A;  5D66 A;  3ULY A;  5EID A;  3T5X A;  3ZUV B;  2XS1 A;  1SW6 A;  4ABN A;  2XHE A;  4JXT A;  5CRV A;  4MS6 A;  3VLF A;  5BV1 A;  3L6A A;  2L0T B;  3MZL B;  3LDZ A;  3NQP A;  5FZR A;  3TWX A;  5A7D B;  5KBA A;  4RG6 A;  4I6J A;  3CHQ A;  3D9P A;  5JHA A;  3PZ4 A;  1E7U A;  3G2S A;  4L9P A;  1HE8 A;  2PQR A;  3ZXS A;  1SA5 A;  2V8S E;  2EQX A;  1TJC A;  4UQX A;  4EQF A;  5EKQ D;  4FLB A;  4L2L A;  3UM0 A;  4GTT A;  5ENO D;  3HXD A;  2AJA A;  3TAX A;  2ZU6 B;  2C0M A;  2PZI A;  3NOG D;  3EU5 A;  3JXJ A;  3L9T A;  3QC1 A;  4V3I A;  4HRN A;  4N39 A;  4N2Q A;  1OWL A;  1EDU A;  3G2W A;  2CG2 A;  3QK0 A;  2I9C A;  4A3V A;  5CRU A;  1BI8 B;  4PS8 A;  4AVX A;  2IEJ A;  1OCC E;  5HS0 A;  2ILR A;  4FUL A;  3SF4 A;  3FFL A;  3CVN A;  3J5P A;  4UI9 K;  1TNY A;  3DRA A;  4QQI A;  3MEK A;  3ZN3 A;  1Y8M A;  2FO1 E;  4EZJ A;  2XGO A;  4H7Y A;  3NBN B;  1PC2 A;  3EHN A;  3ESL A;  3U9W A;  3SBT B;  4K5A B;  3NOC D;  5CCL A;  1S0P A;  5LFA A;  2LNI A;  4I2Z A;  5AQB A;  4DK5 A;  4KVM A;  1LD7 A;  2IU1 A;  2J4D A;  2NYJ A;  4BY6 A;  2F0Y A;  2IQC A;  4WAF A;  3LKU A;  2KXP C;  1E8Y A;  2IOS A;  5CBO A;  4AM9 A;  3APD A;  3CK7 A;  4LNB A;  3CKB A;  3MA5 A;  4JHK A;  1D9S A;  1UG3 A;  2ION A;  3FUH A;  2Y3A A;  4WND A;  3ZU7 B;  2I1K A;  2B6C A;  3B7S A;  5AAR A;  3UQ3 A;  4I9E A;  4YND A;  2VGY A;  5JHB A;  2R2L A;  1N95 A;  3ZEF A;  3PUJ A;  1MQS A;  3GZS A;  1ELR A;  3U66 A;  1PY1 A;  2CFU A;  5ARG A;  2VSX E;  2B0O E;  4GYW A;  4XE0 A;  4UWH A;  1NA0 A;  4J0U A;  2NXP A;  4FHK A;  4BTB A;  2KC7 A;  4DLQ A;  2QFC A;  1HFA A;  3L22 A;  4NQ0 A;  4G11 A;  2BF0 X;  2BTD A;  1N9A A;  3UXG A;  4F53 A;  3CVU A;  4JEH A;  2XGM A;  2EIK E;  4GTQ A;  4DX5 D;  2WXG A;  3LY7 A;  3KSL A;  5BV0 A;  4DX2 A;  2EIL E;  4B89 A;  3FU5 A;  3UIN C;  5BXO A;  5G04 J;  5ENQ D;  3EHR A;  5G2N A;  3ONL A;  2A4Z A;  3HXF A;  2CHZ A;  4GYY A;  2P9U G;  3TG4 A;  3C3O A;  1JUQ A;  1G3N B;  4GTM A;  4LNG A;  3FU0 A;  1E8W A;  2GGF A;  2OVB A;  1SZA A;  3JQ1 A;  4NAC A;  5FWQ A;  1N0Q A;  3JCK C;  1RW2 A;  4HRM B;  4NRH B;  3DWL G;  2XS8 A;  3FDH A;  4BES A;  1OWP A;  3S7J A;  1OWO A;  4LG6 A;  4GPM A;  1X5B A;  1IHB A;  4O1P A;  4KT6 B;  5EN5 D;  2YHC A;  2XCC A;  4KVO A;  3UKR G;  3O48 A;  4WUY A;  1S70 B;  5CHE E;  4DRX E;  3J5Q B;  4JHR A;  3ZHE A;  2XEN A;  2LSV A;  5IY5 E;  1V55 E;  1KT1 A;  3PZ1 A;  4GZC A;  4KZ0 A;  5LX8 A;  2A5U A;  3QDN A;  4B0Z A;  3SFZ A;  3VLD A;  3CVY A;  4GMR A;  1TEZ A;  1A17 A;  3HIZ A;  3IV0 A;  2VGX B;  3L17 A;  3FTW A;  3ZRH A;  4BER A;  3U3W A;  4GAA A;  3SD5 A;  3ZHE B;  1UW4 B;  2X38 A;  3NAW A;  3DBS A;  1ZBP A;  4WNG A;  3GZ1 A;  1KPS B;  5B1B E;  3CHM A;  3LY8 A;  2DZO A;  1N52 A;  3V2X A;  1N4R A;  3DEP A;  1KZO A;  5ANR A;  2DBA A;  2E0I A;  1SA4 A;  3CHR A;  4IN3 B;  3CVP A;  4KMO A;  3FUD A;  4K03 A;  2BKG A;  3FUN A;  3I4R B;  3CK9 A;  3FTY A;  1HF8 A;  4UI9 C;  5CER B;  4ACK A;  2LAH A;  3PRE A;  3B7U X;  3FTS A;  3UM2 A;  2QYU A;  3SBS A;  3D9I A;  3D9N A;  4TRQ A;  1MYO A;  2L6J A;  3CHS A;  2WMN A;  2AVP A;  3OXL A;  5DIZ A;  1N94 A;  4GCN A;  5AAO A;  5EYP F;  3ZYQ A;  4FHJ A;  1N11 A;  3QAR A;  3R7R A;  3TWW A;  3L16 A;  3RO3 A;  1V54 E;  5LP0 A;  3BUA A;  3Q5M A;  3PZ2 A;  5ARF A;  1IHG A;  4CDR A;  5C1D A;  2JEK A;  2OEW A;  1JWG A;  4HLE A;  2MYO A;  5AQ7 A;  5AQ9 A;  5AYW D;  3PNL B;  4IRU A;  1XGW A;  3FTU A;  3C5R A;  4JA9 A;  2XEE A;  4J8F A;  3NB2 A;  3D9H A;  3PZD A;  2IFU A;  3FTV A;  3VTX A;  2R5S A;  2QZA A;  2CHW A;  1JPL A;  4EPZ A;  1YYH A;  2WQ7 A;  2WPV A;  3MYV A;  4C0E A;  3LPZ A;  4BSZ B;  5ENS D;  5ENP D;  2V4L A;  2X6K A;  4HOS A;  2IJG X;  4GMJ A;  2E2E A;  3ZXP A;  1SVX A;  5KJN A;  1H0A A;  3ZW3 A;  4BFR A;  5AIJ A;  1QBQ A;  2Y0B G;  2EIM E;  3SQV A;  1TJF A;  1OUV A;  3D9J A;  3ONK A;  5FZS A;  4K5C A;  5HKP A;  3L54 A;  1OXJ A;  5LCW C;  4CDM A;  4DLO A;  3Q78 A;  3LVR E;  2WXH A;  4FA6 A;  3KAE A;  4U8H A;  3FUI A;  3RJV A;  3SGH A;  3BU8 A;  4DX1 A;  4JPS A;  4L2Y A;  2GRR B;  1IXV A;  5JJ6 A;  3I3N A;  5D0O D;  1OWN A;  4RLY A;  4YVQ C;  2WM9 A;  1E96 B;  5EDS A;  4AEZ C;  4Q94 A;  5BW8 C;  3SHF A;  5BXU A;  3DSS A;  3IBE A;  4XX5 A;  3SY2 A;  4HOQ A;  3EIQ C;  2WVI A;  1MHQ A;  1Z3Y A;  1IKN D;  2PM7 A;  1NL4 A;  2ZIS A;  2PNN A;  2FF4 A;  2WQ6 A;  4I2W A;  5AQA A;  3D3M A;  1MX2 A;  2V5Q C;  1HZ4 A;  1QYM A;  2RFA A;  5FQ8 A;  4YDY A;  1YMP A;  3SFX A;  5T3R A;  4YDE A;  5J90 A;  1SZ9 A;  2J9Q A;  3K9I A;  4ATG A;  4UI9 J;  1TN8 A;  2WXK A;  2Y4T A;  4LUN U;  1B89 A;  3ENE A;  3KS2 A;  1WG0 A;  3JYS A;  1OWM A;  4NIK A;  4CYM D;  5FTP A;  4ME2 A;  5FQ6 A;  3AU5 A;  3AS5 A;  1GW6 A;  2HM8 A;  4P29 A;  2RFM A;  1Z3X A;  1A5E A;  3MV2 B;  4XIF A;  5FJY A;  2YIN A;  3UPV A;  4AOF A;  4HOR A;  3ZYK A;  3CK8 A;  4O1O A;  3JXI A;  4AJW A;  5AN8 A;  3BG0 B;  1HXI A;  1E8Z A;  3DXK G;  2LXM A;  4AXH A;  2KCL A;  2AXV A;  4IUL A;  4I1M A;  4HQD A;  2GRO B;  2VYI A;  1NZN A;  3B7T A;  4JZY A;  1TNB A;  1HS6 A;  5ENT D;  4CCA A;  2X6F A;  5KJM A;  4G25 A;  3HDX A;  3DSX A;  3Q15 A;  3IHY A;  3FU3 A;  3JUE A;  4NUR A;  2ZGD A;  4HNA D;  2FEZ A;  4HS2 A;  4U95 D;  2ZXW E;  3NZS A;  1NFI E;  1KZP A;  3B7R L;  4I1A A;  4WWP A;  2CHX A;  3ASO E;  3ASG A;  1Z6T A;  3FUF A;  3UT8 A;  2LAI A;  3FUL A;  4ILI A;  4Y6W A;  3Q47 B;  2EIJ E;  4GTO A;  4BX8 A;  3V79 K;  2IF4 A;  1O5M A;  2IO2 C;  3LEW A;  3QWP A;  5J08 A;  4MLP A;  4G8K A;  5H7P A;  4XKB A;  4JVS A;  4LSZ E;  4U0Z A;  3TXM A;  3APF A;  2H6F A;  3GYZ A;  3AS4 A;  3AG4 E;  1UN8 A;  2CG3 A;  2X6H A;  3CVV A;  4F7A A;  3MKR A;  1N4S A;  4ILG A;  4LNU D;  4B94 A;  1QNF A;  3R9M A;  5HQ8 A;  3UTM A;  5FT9 A;  2KCV A;  4OAV B;  4N3C A; 
#chains in the Genus database with same CATH homology
 2YHE A;  3S7B A;  4HFG A;  3CGH A;  4BSX A;  4LCT A;  3D9K A;  5EX0 A;  4UWL A;  4KXK B;  1A17 A;  3ASD A;  4AV7 A;  5G05 C;  1TEZ A;  3HIZ A;  3S7D A;  3IV0 A;  4I9C A;  2VGX B;  1E8X A;  4U0U A;  3UX4 A;  2OOE A;  3L17 A;  3FTW A;  4I43 A;  2X3M A;  4JA7 A;  4APF A;  3ZRH A;  4XZ4 A;  2CFZ A;  1W3B A;  5KCM A;  3U3W A;  1DVP A;  4GAA A;  3SD5 A;  4GA0 A;  4HXI A;  1U3D A;  3ZHE B;  2YQ8 A;  1HX8 A;  2GRM A;  1UW4 B;  2X38 A;  3LJ3 A;  4JC8 A;  4FP7 A;  2GW1 A;  4GU5 A;  3CVX A;  3DBS A;  3HVE B;  2GRL A;  1ZBP A;  3QKY A;  4WNG A;  4CEM A;  3GZ1 A;  4GZD A;  4CGV A;  3CHM A;  3LY8 A;  4MRU A;  1FVH A;  1SQM A;  2FUL A;  1N52 A;  4AP2 A;  4TV3 A;  5E75 A;  4UQY A;  1PAQ A;  3O4Z A;  2DBA A;  3L13 A;  1FCH A;  3QWV A;  5ANR A;  5G04 C;  2XRY A;  1H2T C;  3GZ2 A;  2E0I A;  3E4B A;  4N5C A;  4YVO A;  3CHR A;  1QQE A;  2VTB A;  4IN3 B;  3CVP A;  4KMO A;  5BT1 A;  1WAO 1;  3FUD A;  4K03 A;  4PUC A;  3TXN A;  3FUN A;  3I4R B;  3CK9 A;  3FTY A;  1HF8 A;  4JHJ A;  2KCK A;  4UI9 C;  4M3O A;  4N3B A;  4ACK A;  3EHM A;  2LAH A;  4F1S A;  3LY9 A;  3PRE A;  3T5V A;  3PDN A;  3SZ7 A;  2MHK A;  3S2A A;  3WXX A;  4G23 A;  1JWF A;  4APO A;  4BT9 A;  2R17 C;  3B7U X;  3EDT B;  2WXM A;  1WM5 A;  2WQH A;  1HG2 A;  3FTS A;  3QJZ A;  3QOU A;  1Y6I A;  2KZT B;  4C0M A;  2YNQ A;  1EF1 C;  4CRW A;  5CMY A;  4UWF A;  3FEX A;  3SBS A;  5KJL A;  4DI4 A;  1QZ2 A;  4GZ6 A;  3IHV A;  3D9I A;  3D9N A;  4TRQ A;  3PRZ A;  2L6J A;  3MKQ B;  3CHS A;  4CT0 A;  4ANV A;  1ZU2 A;  4KBQ A;  3U64 A;  2WMN A;  2NSZ A;  2R59 A;  1HH8 A;  2AVP A;  3OXL A;  4ACL A;  3CHP A;  5DIZ A;  3CVQ A;  2XCB A;  2WXP A;  4GCN A;  3UT7 A;  3GW4 A;  3ZYQ A;  4FHJ A;  4G24 A;  3APC A;  4GA1 A;  3D9L A;  5LOZ A;  4G1T A;  3CSF A;  4I6E A;  3CLJ A;  3LXU X;  3QAR A;  3FH5 A;  3R7R A;  5E76 A;  3RKV A;  5D0Q D;  3L16 A;  3RO3 A;  3MX3 A;  4EZK A;  3G2U A;  3EIJ A;  3SI5 A;  2AXZ A;  5LP0 A;  3L08 A;  3HVE A;  3QAQ A;  1HG5 A;  4FJY A;  3AS8 A;  3BG1 B;  3JUI A;  3LCA A;  2Y4U A;  4Y6C A;  5LCW J;  3FEY A;  2XGS A;  3Q5M A;  5ENN A;  4U0S A;  1VDY A;  5AJL A;  2XRZ A;  5ARF A;  2WXI A;  4GYO A;  1INZ A;  2OVF A;  1IHG A;  4CDR A;  5C1D A;  2JEK A;  2I1J A;  1JWG A;  3FTX A;  3FUK A;  3PNT B;  3URZ A;  2DIW A;  3ASH A;  4LRZ A;  5AYW D;  3ZFW A;  4HLE A;  2PQN A;  2VQ2 A;  4GZ3 A;  3PNL B;  4D10 C;  4IRU A;  1L5J A;  1XGW A;  2LSU A;  3JQ0 A;  2FO7 A;  3T5X A;  4HOT A;  1IQU A;  4AIF A;  3FTU A;  4FU3 A;  4G26 A;  4JA9 A;  4XI0 A;  2VJ8 A;  2XPZ A;  3RRN B;  2QY7 A;  4ABN A;  2XHE A;  3FTZ A;  4J8F A;  4JXT A;  1H19 A;  3PZD A;  1N54 A;  4MS6 A;  1ELW A;  4I1O B;  3VLF A;  2VGX A;  5BV1 A;  4BTA A;  2IFU A;  3FU6 A;  3L6A A;  2L0T B;  3MZL B;  3DPD A;  3FTV A;  3LDZ A;  3NQP A;  3LYA A;  2I6H A;  3VTX A;  3T8M A;  3ESK A;  5FZR A;  3Q49 B;  5AEN A;  2R5S A;  2WB2 A;  5A7D B;  4EBA A;  2CHW A;  1JPL A;  3ML8 A;  4EPZ A;  4GZ5 A;  4PDX A;  4RG6 A;  2WQ7 A;  2WPV A;  3UT4 A;  2P58 C;  4I6J A;  3MYV A;  3PEV B;  3CHQ A;  3D9P A;  4C0E A;  4F3V A;  4N2S A;  2AWI A;  3IKO B;  3LPZ A;  3MCX A;  3CEQ A;  3R9A B;  4O6F A;  1H6K A;  4DPR A;  5JHA A;  3PUK A;  4J8S A;  1NA3 A;  4WWO A;  3CVW A;  1E7U A;  3G2S A;  2V4L A;  2X6K A;  4U63 A;  1HE8 A;  2PQR A;  4HOS A;  5JJT A;  3ZXS A;  2IJG X;  4GMJ A;  2E2E A;  5KJN A;  5EKQ D;  2V8S E;  2EQX A;  1TJC A;  1H0A A;  3LS8 A;  4UQX A;  2XEV A;  2V0P A;  3ZW3 A;  4EQF A;  5BPP A;  4BFR A;  5AIJ A;  2DCP A;  4FLB A;  4L2L A;  3P1U A;  4GML A;  3FUM A;  3C98 A;  4BT8 A;  3ZVV A;  1TJF A;  1OUV A;  3D9J A;  5EX3 A;  5JJ7 A;  3QNK A;  3ONK A;  4J8E A;  4QFV A;  5FZS A;  3TAX A;  5A23 A;  2ZU6 B;  2C0M A;  4Q69 A;  2PZI A;  3L54 A;  3N71 A;  4ILH B;  3QC1 A;  3G2T A;  4PS3 A;  4V3I A;  4N39 A;  4B8A A;  3MV3 B;  4N2Q A;  5LCW C;  4U04 A;  2WMO A;  3FUE A;  4CDM A;  4DLO A;  5BNW A;  4Q96 A;  3LVR E;  2V5F A;  1BPO A;  2WXH A;  4FA6 A;  3Q4A B;  3KAE A;  1OWL A;  3I5P A;  4U8H A;  3FUI A;  3VLE A;  4JL0 A;  1EDU A;  2Q7F A;  3RJV A;  1EYH A;  2KM4 A;  3G2W A;  3SGH A;  2CG2 A;  2HR2 A;  4JPS A;  3EJN A;  2I9C A;  3MGB A;  3QK0 A;  4L2Y A;  3VTY A;  4A3V A;  5CCM A;  3UMV A;  2MOW A;  4H7X A;  4PS8 A;  4AVX A;  4LER A;  4GCO A;  4L7T A;  5JJ6 A;  2ILR A;  4FUL A;  3SF4 A;  3FFL A;  1U3C A;  3I3N A;  5D0O D;  3CVN A;  4BWR A;  4KZC A;  1OWN A;  2XQ0 A;  4UI9 K;  4CT4 A;  4YVQ C;  2WM9 A;  3RRM B;  1E96 B;  3ZPJ A;  4AEZ C;  2WXN A;  3OTN A;  5EDS A;  3MEK A;  4Q94 A;  5BW8 C;  3SHF A;  3FH8 A;  5HI7 A;  1HO8 A;  1Y8M A;  3ZN3 A;  5M72 A;  3IBE A;  4EZJ A;  2XGO A;  5FQ7 A;  4H7Y A;  2J49 A;  1PC2 A;  3CST A;  3EHN A;  2XPY A;  4XX5 A;  4K0R A;  1NP7 A;  3ESL A;  3U9W A;  4MKT A;  4HOQ A;  3EIQ C;  3SBT B;  3TJP A;  2WVI A;  5CCL A;  1MHQ A;  2PM6 A;  3ULQ A;  1S0P A;  5LFA A;  2LNI A;  3CIA A;  4L23 A;  1Z3Y A;  4GA2 A;  4RG9 A;  3UUX A;  4I2Z A;  4OVU A;  2PM7 A;  2LO6 A;  4DK5 A;  2FF4 A;  4KVM A;  2WQ6 A;  4LEU A;  1HU3 A;  5KJK A;  2NC9 A;  3PVL A;  3TGO A;  3D9M A;  2IU1 A;  2J4D A;  4I2W A;  3MJW A;  2JLB A;  2RG8 A;  3D3M A;  3PEU B;  4BY6 A;  2IQC A;  5DBK A;  1HZ4 A;  4WAF A;  3SNX A;  3LKU A;  1E8Y A;  2IOS A;  2WXF A;  2OND A;  5FQ8 A;  4AM9 A;  3CQG B;  3APD A;  3QB2 A;  4C9B B;  5FQ4 A;  5T3R A;  3CK7 A;  3ZYL A;  3CKC A;  1FVF A;  3CKB A;  5J90 A;  3MA5 A;  4JHK A;  1SZ9 A;  2J9Q A;  3K9I A;  4ATG A;  1UG3 A;  4JW1 A;  2ION A;  4UI9 J;  4DI3 A;  2WXK A;  3FUH A;  3FWV A;  1LF8 A;  2J4B A;  2Y4T A;  4AY5 A;  2Y3A A;  4LUN U;  4WND A;  1UJK A;  1B89 A;  3ZYM A;  3ZIM A;  3ENE A;  2KAT A;  2I1K A;  4A1G A;  2M63 A;  3KS2 A;  3B7S A;  4WNF A;  5A6C A;  3UQ3 A;  3JYS A;  4I9E A;  3PS6 A;  2J08 A;  4YND A;  1OWM A;  3BEE A;  2VGY A;  4WWN A;  5JHB A;  5FTP A;  3B13 A;  4ME2 A;  3PE3 A;  5FQ6 A;  3ZEF A;  4FAD A;  3PUJ A;  1MQS A;  2KZT A;  3FP3 A;  5T8I A;  4ANU A;  4L1B A;  3GZS A;  3AU5 A;  3AS5 A;  1ELR A;  1GW6 A;  1P5Q A;  2HM8 A;  3KD7 A;  1KT0 A;  4P29 A;  3U66 A;  1PY1 A;  1E7V A;  2UY1 A;  2OV8 A;  1Z3X A;  3CV0 A;  3CVL A;  2CFU A;  3CR3 A;  3I4G A;  3ASF A;  3MV2 B;  5ARG A;  2RD0 A;  3AU4 A;  3LVQ E;  2VSX E;  4XIF A;  5BUZ A;  4RVB A;  3CHO A;  3FHE A;  5FJY A;  1YA0 A;  2YIN A;  3D9O A;  3UPV A;  4A55 A;  4GYW A;  4XE0 A;  4AOF A;  4UWH A;  3KEZ A;  4UQZ A;  5C2Y A;  2WXL A;  4HOR A;  3ZYK A;  1UN9 A;  1NA0 A;  3HHM A;  2VTB B;  3CK8 A;  4J0U A;  4IYP A;  4AJW A;  3NZU A;  2C2L A;  2NXP A;  3BG0 B;  4FHK A;  2AXU A;  4BTB A;  1HXI A;  1E8Z A;  2KC7 A;  4DLQ A;  3NF1 A;  5AJD A;  1IYG A;  4XI9 A;  2QFC A;  4I17 A;  4AXH A;  2MRI A;  3OAW A;  4AY6 A;  2KCL A;  1HFA A;  2AXV A;  3RRU A;  3L22 A;  2FI7 A;  4NQ0 A;  4G11 A;  4CGW A;  4IUL A;  2BF0 X;  4UWK A;  4I1M A;  4OVV A;  3QWW A;  2BTD A;  4J6I A;  4PS7 A;  2VYI A;  4G2V A;  1XNF A;  4F53 A;  3CVU A;  4JEH A;  2XGM A;  2J09 A;  2WXG A;  1NZN A;  3LY7 A;  3B7T A;  3RO2 A;  3G2V A;  5ANL A;  3S7F A;  5BV0 A;  4JZY A;  4CCA A;  1HS6 A;  3R7Q A;  2X6F A;  5KJM A;  4G25 A;  3HDX A;  4OYS A;  3Q15 A;  4FJZ A;  3IHY A;  4B89 A;  3FU5 A;  3FH7 A;  3FU3 A;  4KYO B;  3RIB A;  4NUR A;  4FLH A;  5G04 J;  4EBA G;  2UY1 B;  3PE4 A;  5G2N A;  2FEZ A;  3ONL A;  2WXO A;  4HS2 A;  2A4Z A;  2CHZ A;  2UWJ G;  3NZS A;  4GYY A;  2J07 A;  3FUJ A;  4DJA A;  3TG4 A;  3B7R L;  3P2B A;  3TL5 A;  3HYM B;  4I1A A;  4WWP A;  2CHX A;  4FC8 A;  4W9R A;  2VSY A;  2AW6 A;  4WNE A;  3TG5 A;  1JUQ A;  3MKQ A;  3CQC B;  2IOL A;  3ASG A;  1Z6T A;  2OVB A;  1E8W A;  2GGF A;  3FU0 A;  2C0L A;  2LAI A;  3FUF A;  1SZA A;  2XPI A;  3FUL A;  4JEU A;  3JQ1 A;  3UT8 A;  4URK A;  4ILI A;  4NAC A;  5FWQ A;  4B8C B;  3JCK C;  4Y6W A;  2FBN A;  3Q47 B;  5FZQ A;  4GB9 A;  4NRH B;  4BX8 A;  3RK6 A;  4E6H A;  3OXG A;  4TUU A;  5G05 J;  4U07 A;  3FDH A;  3FY4 A;  3OXF A;  2IF4 A;  4CDN A;  1ELK A;  2BUG A;  2WXQ A;  2X6J A;  3LEW A;  1OWP A;  4A3T A;  4GPK A;  3QWP A;  3ZGQ A;  5J08 A;  4MLP A;  3S7J A;  4XKB A;  1OWO A;  1UJJ A;  2WXJ A;  1DNP A;  4JVS A;  4ANW A;  1X5B A;  1KLX A;  1H2V C;  1WY6 A;  4KT6 B;  4U0Z A;  2VSO E;  3TXM A;  2YHC A;  1EPU A;  2XCC A;  3APF A;  4KVO A;  3O48 A;  3ML9 A;  3RU0 A;  4RSY A;  1E90 A;  3GYZ A;  3AS4 A;  4PH4 B;  4N3A A;  4WUY A;  5CHE E;  4J8D A;  1UN8 A;  4JHR A;  2CG3 A;  2X6H A;  1IQR A;  2PL2 A;  3CVV A;  4F7A A;  3MKR A;  4ILG A;  4XKC A;  3ZHE A;  4EEC A;  2HO1 A;  5G55 A;  2LSV A;  4HVB A;  2VSN A;  2HYZ A;  3U4T A;  5CMW A;  4I6G A;  1KT1 A;  2X6I A;  1QNF A;  3PH0 C;  4UWG A;  4B94 A;  4ANX A;  4GZC A;  4KZ0 A;  4R7L A;  4HOU A;  5HQ8 A;  5LX8 A;  2A5U A;  3QDN A;  3SFZ A;  5FT9 A;  4A1S A;  2L0I A;  3VLD A;  3IEG A;  2KCV A;  5T4Y A;  4B0Z A;  4BX9 A;  4E85 A;  3CVY A;  1H2U A;  2L9B A;  2I2O A;  2WXR A;  4EZL A;  4N3C A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...