1WY6A

Crystal structure of hypothetical protein [st1625p] from hyperthermophilic archaeon sulfolobus tokodaii
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
161
structure length
159
Chain Sequence
EIIRKLMDAKKFLLDGYIDEGVKIVLEITKSSTKSEYNWFICNLLESIDCRYMFQVLDKIGSYFDLDKCQNLKSVVECGVINNTLNEHVNKALDILVIQGKRDKLEEIGREILNEVSASILVAIANALRRVGDERDATTLLIEACKKGEKEACNAVNTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords hypothetical protein ST1625
publication title The first crystal structure of an archaeal helical repeat protein.
pubmed doi rcsb
source organism Sulfolobus tokodaii
molecule tags Structural genomics, unknown function
total genus 59
structure length 159
sequence length 161
ec nomenclature
pdb deposition date 2005-02-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09205 DUF1955 Domain of unknown function (DUF1955)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.350 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 1wy6A00
1WY6A
chains in the Genus database with same CATH superfamily
3UM0A 4BY6A 1JCSA 1SZ9A 2VSXE 3EU9A 4JA9A 3X2QE 2DZOA 1TJFA 2GRLA 1Y8MA 4DX2A 4CT0A 2V8SE 3ZXPA 1S63A 3ZXSA 3CHSA 4EQFA 3DRAA 3TWTA 3IHYA 3HDXA 4HLEA 3KAEA 2FBNA 3FUEA 2F8XK 1TNZA 3PNLB 3KEAA 1K1BA 3ML9A 3AG4E 2WMOA 5ANLA 3TWUA 3FTVA 3UQ3A 2PM7A 3EDTB 4ANVA 4U7EB 2MOWA 5EX0A 1FT2A 2WXPA 3S2AA 1FT1A 3IEGA 3C3QA 3OTNA 4GYWA 3BQOA 4JZYA 4FJYA 1X81A 4ILIA 3KD7A 3ABLE 3FTXA 3SF4A 4N39A 3LJ3A 3B7UX 4GPMA 4XI0A 3QWWA 4U8YD 3SZ7A 5FZRA 3ASFA 5ENRD 1UW4B 3AG3E 3ZVVA 3T5XA 5AIJA 2L6JA 4AVXA 5JA4D 3VLFA 3CV0A 3RK6A 4UWKA 3C72A 4QFVA 1WAO1 1JWGA 4WAFA 4DX6D 4YDWA 5BXOA 3T8KA 5CCLA 4AEZC 4HXIA 2V0PA 4N5QA 4J0UA 4GZ3A 2LAIA 4EHMA 2IOLA 3V2OA 3OXLA 1A17A 4BETA 2XENA 4AY5A 3DSXA 3NBNB 4C0EA 4PS8A 1BI7B 3PUKA 3ABKE 3FU0A 2FULA 5FTPA 4ANUA 1UJJA 4E85A 1N0RA 2EINE 1D8DA 4BFRA 2X6FA 4G26A 4GYYA 2ZGGA 5BPPA 2XGSA 4WWPA 4GCOA 1FPPA 4ZHBA 4LNBA 5BXUA 2GGFA 2P9SG 2XEHA 4DUIA 2X6JA 3NOCD 5KJLA 4HI9A 5EYPF 5FIOA 2FI7A 3U4TA 2CHXA 3LJNA 5E76A 3L54A 2OEWA 2GRNB 4UUCA 3D9HA 1H2VC 1SW6A 3ZYQA 1TNUA 2WXNA 1TR4A 1TNYA 4JVSA 5HQ8A 4I2ZA 4KBQA 4OVVA 4GU5A 5LFAA 3G2TA 4G24A 3ASDA 4GZ5A 4LCTA 2P9LG 4M7CA 3RO3A 3ESLA 4IN3B 3CHMA 4PS7A 2IJGX 2KM4A 2XGOA 3HXCA 3LPZA 4I6EA 4KYOB 3Q75A 2FO1E 1RZ4A 3EIQC 4CRWA 2J4BA 3L16A 1OUVA 1BI8B 2WXFA 3QOUA 2XCBA 1OY3D 4ZFHA 2UY1A 3DEOA 4IULA 5BNWA 4U07A 2NYJA 2Y4UA 5HS0A 4LNUD 1UOHA 2YNQA 2PM6A 4GA0A 3MYVA 4KVOA 4GCNA 2QY7A 2RFAA 3L22A 3QJZA 3B7BA 2H6HA 1MX2A 3R9AB 3DSUA 2AVPA 2XPIA 3QDNA 3QB2A 4MBGA 3AU4A 3R9MA 3AJIA 1FCHA 4LERA 2JEKA 3EHQA 4GMJA 1S70B 2DIWA 3UMVA 4Q96A 2XS8A 2J9QA 3CVQA 4N5CA 3TXNA 2VSOE 4BSXA 1TNOA 5CBNA 2VGEA 3UM1A 2IFUA 2OVBA 1OCOE 5JMND 1XNFA 4F53A 2WQ6A 3AG1E 4KT6B 4ME2A 2LUHA 2DYSE 2OCCE 5H7PA 1MJ0A 3ASNE 1UN9A 1NFIE 3HG0D 1INZA 1ELWA 4QQIA 3ULQA 4HRLA 4ANXA 4XKBA 3FTWA 5T4YA 3TJPA 4U63A 4BERA 3CGHA 4Y6WA 1H19A 4XZ4A 4I1AA 3DXMG 3CQCB 4G2VA 4GAAA 3LS8A 4MLPA 4GPKA 1HH8A 2J09A 2XGMA 2DCPA 1NI1A 5BV0A 4E6HA 2ONDA 2XPYA 5CMWA 1DNPA 4L1BA 3E37A 3KS2A 4A55A 3FH8A 3DPDA 3V31A 2B6CA 1QBQA 3PZ2A 5EYLA 1K8KG 3ZNGA 3QNKA 1MX4A 1RW2A 2AXVA 1A5EA 4U04A 5ARFA 2VGXA 4U0UA 4DX5D 3TGOA 3I4GA 2KZTB 2A4ZA 5FWQA 4J8EA 3FUDA 4Y6CA 2EIKE 3RRUA 4ANWA 3PH0C 4XEIG 5DBKA 1JCRA 1DCQA 4YVOA 3RAUA 4KXKB 5E75A 2PL2A 2FO7A 4UWGA 4ILHB 4F6RD 3ABME 4Q94A 4N3BA 1QYMA 2V4LA 2F8YA 4UQYA 4B94A 4EPZA 5AARA 3VTXA 5EN5D 3E34A 2C0MA 2P2CP 4OAVB 2ETBA 2RG8A 3ONLA 1E8XA 3HYMB 2EILE 3APCA 4GTOA 2QZAA 3MKQB 3ZYKA 2Y4TA 4CZ2D 5ENTD 3LDZA 3QKYA 3KEZA 3FWVA 3HVEA 5LCWC 3S7JA 1OWLA 1KT1A 2XPZA 3Q7AA 1BU9A 2CFZA 4L2YA 3DSVA 5A23A 3U9WA 5CRUA 3FUHA 2BKGA 4RVBA 1B89A 3KSQA 4MKTA 3IKOB 3CVLA 2HO1A 3B95A 1N52A 3ZEFA 2FF4A 3FFLA 3L82A 5CRVA 4HS2A 4GMLA 4HOQA 3BG1B 5FQ7A 3JUEA 3QWPA 3FH7A 4TV3A 3QK0A 2PNNA 5LOZA 1O1RA 3EHRA 4GYOA 2XQ0A 4CDNA 3UIPC 3ASHA 1MHQA 3JXIA 3ULEG 2J4DA 2LXMA 3FP3A 2M63A 3B13A 2CG2A 3G2SA 3JQ0A 4NRHB 2C0LA 2XEEA 1TYQG 2I1KA 3EHNA 4UWLA 4CCAA 2AXUA 3ESKA 1TEZA 4CGVA 3ZRHA 1UN8A 1SA5A 3UPVA 3C3RA 3E4BA 3E33A 3ZW3A 5AENA 2ZXWE 3SFZA 4A3VA 3LCAA 4RQIA 2WXHA 4BESA 4AOFA 1FVHA 1JPLA 2WXQA 2ZIRA 3JCKC 1KZPA 2IQCA 3E32A 3Q15A 4B89A 1Z5SC 2VSYA 3CSTA 4I43A 4FP7A 2F0YA 2P9IG 5G05C 4HB5A 2WXIA 2WXMA 1U2VG 3J5QB 3PE4A 2WB2A 3DSSA 2I6HA 4I2WA 1QQEA 1PAQA 2QC9A 5EILA 5A6CA 2DBAA 4L7TA 3FUFA 2X3MA 2IO3C 5CECB 3NOGD 3ZUVB 1L5JA 2GRPB 4JHJA 4YNDA 4TXQA 5EIDA 2H6GA 4I9EA 4DX1A 4GTMA 1OWNA 2MRIA 2I9CA 3AS8A 4MS6A 4CYMD 2L0TB 3LYAA 4DRXE 5CERB 3UT8A 1OXJA 3ZHEA 2CHZA 4B8CB 5FZQA 3NB2A 3PDNA 2CHWA 2VTBB 2IOSA 1WG0A 3DXKG 3O4ZA 2XS1A 4J8YA 2LSUA 1N11A 4FHJA 5DIZA 4O1PA 2R02A 3CHRA 5AAOA 4BTBA 4GZ6A 3FTSA 1VDYA 1UG3A 2Y69E 3CQGB 3RSEG 1N4PA 5LCWJ 3ASOE 4IYPA 3IBEA 5ITZF 3ASGA 3NQPA 2WQHA 3S7DA 4F7AA 4NQ0A 4G25A 4JXTA 3ZU7B 4HOUA 4KVMA 4UWHA 1QNFA 1V54E 3GW4A 4ILGA 3BUAA 3QC1A 5LP0A 3OXGA 3HXBA 2FEZA 2R05A 2XRZA 5G55A 1V55E 2F37A 1HF8A 3ML8A 3V2XA 2Y3AA 5D0QD 3FH5A 3Q78A 5KJMA 2UWJG 5FQ4A 2WXOA 3AAAC 1BLXB 1ZB1A 3UM2A 1O5MA 4HRNA 3FULA 4OVUA 3FEYA 3I4RB 3MX3A 5CMYA 3J5PA 2LNIA 2HE0A 3LXUX 4D10C 4V3IA 2V5FA 3FDHA 3CKBA 5JHBA 2IO2C 1JUQA 3FUMA 2WVIA 2ETCA 1IYGA 3RU0A 1G3NB 5KBAA 1K3ZD 1KLXA 4UI9J 4ACKA 2WMNA 1FVFA 3ZFWA 4A1GA 3R7QA 2OEVA 3CHPA 2ZU6B 4DJAA 5KNHD 4EBAA 2ZISA 4CGWA 5AYWD 1E7UA 3PEVB 3G2VA 3MCXA 2VQ2A 1EYHA 1OT8A 3CLJA 2BEDA 5C2YA 3TWVA 3ZIMA 4JL0A 1MZCA 2ZGDA 4N3AA 3R7RA 1HX8A 3Q4AB 3L17A 2LXLA 3JXJA 5G05J 2GROB 4LG6A 2PQNA 3QWVA 2J8SD 3PZDA 4JPSA 3VTYA 4GTTA 1AWCB 4RLYA 3CHQA 3SQVA 3BG0B 2NXPA 2V4HC 3SO8A 2PQRA 4JEHA 5T8IA 3I5PA 1S0PA 4CT4A 3LY7A 5KJKA 4PUCA 3DEPA 3D9PA 2R5SA 4ABNA 2L0IA 3N71A 3UKRG 3PVLA 5FZSA 1HO8A 3F6QA 3APFA 1E8YA 4O6FA 4URKA 3L08A 3OAWA 2QYJA 1IHBA 2WQ7A 4GMRA 1TNBA 2XEVA 2DYRE 3CSFA 4WUYA 3ULYA 3D9MA 3LEWA 1MQSA 5HI7A 3UKUG 1OWPA 4DX7D 4K5CA 4PS3A 4W9RA 3ZKJA 1PC2A 4F3VA 1JWFA 3LVRE 4YVQC 2P9KG 2LO6A 4XI9A 5BV1A 1OCCE 5ENQD 4L9PA 3ENEA 3PS6A 3PRZA 1YCSB 3Q9NC 4P29A 5BT1A 1LD8A 3UXGA 4BT9A 3SFYA 1N0QA 4APOA 3CK7A 2DWZA 3ZPJA 1NA0A 3HXFA 1LF8A 4GTRA 1E8WA 4WNEA 5BUZA 4G11A 5G2NA 3JQ1A 5AQAA 2LSVA 5JHAA 4EZJA 4Z68A 2KBXA 3AU5A 3MV3B 2EIJE 5T3RA 3DSWA 3BU8A 3SNXA 1WDYA 1OCZE 5D0OD 5HKPA 4AY6A 3NZSA 1K1AA 2P58C 5EX3A 3CK9A 1E8ZA 4FADA 1BD8A 3Q9UC 4U0ZA 3HIZA 4BX8A 2E2EA 2XHEA 1XGWA 5LX8A 4UQZA 3NAWA 2WXKA 3RO2A 4BSZB 3GZSA 4K0RA 3Q73A 2BKKB 3T8MA 4GA1A 2WXLA 2QFCA 4BEPA 1EPUA 5C1DA 2P9NG 4X8QA 4BX9A 1KT0A 3ONKA 2YHCA 2GW1A 3FTZA 3FUNA 3Q47B 4FU3A 1BPOA 2ETAA 4U8HA 4WWOA 2JABA 4U95D 4RG6A 1E96B 3TWXA 4DLQA 2R2LA 3CVNA 4WWNA 5IY5E 4I6JA 4AIFA 3PZ1A 1MX6A 4I6GA 3Q5MA 2E0IA 3NZUA 3AS5A 1WM5A 3EHMA 2YHEA 1P5QA 4YDEA 3SY2A 2HR2A 3G2UA 4UQXA 1NP7A 1U3DA 4I1MA 4KZCA 3RRNB 4GZDA 4HOSA 3S7BA 5KNGA 4GB9A 4GTVA 1D8EA 3WXXA 3L6AA 4AV7A 5AJLA 5CEDB 1U3CA 3G2WA 3UT7A 3E30A 3L9TA 4ATZD 2BF0X 3UUXA 5M72A 3GZ2A 3MA5A 5JJTA 2CFUA 2KZTA 2WM9A 4FC8A 1KPSB 3Q79A 4YDOA 5B1BE 4EECA 4G23A 5A7DB 4XKCA 3ZYLA 1DC2A 4UI9C 4DK5A 4K03A 3PZ3A 2PZIA 2EQXA 1Q2ZA 2CG3A 3HHMA 4HORA 1JCQA 3MZLB 3MKRA 3LY8A 3APDA 3W9GA 3CVXA 3EJNA 3Q49B 3I3NA 2IU1A 1HXIA 4J8SA 1QZ2A 3FUKA 5FQ6A 1N4QA 2P9UG 4DI4A 4FLHA 4AJWA 4H7XA 2IEJA 3TG4A 5AQ7A 4BT8A 4RSYA 4DLOA 2XCCA 3MKQA 3FTYA 4BTAA 3LY9A 3DWLG 4ATGA 1H2UA 2KCLA 2WXGA 4MRUA 4CDRA 3CEQA 3DBSA 3Q7FA 3JYSA 1SVXA 5EDSA 2XZTG 1LD7A 2L9BA 3HRAA 4NURA 3RIBA 3SD5A 2WXJA 4CDMA 2LAHA 3RKVA 2AJAA 3LKUA 4LNGA 1N95A 3TWSA 2MYOA 1N94A 4A63B 3TL5A 5AJDA 3D9IA 3FU6A 2J49A 2I2OA 1TN8A 3RRMB 3B7TA 3TXMA 4HFGA 4G8KA 4N2QA 5AQ9A 3V79K 3CVVA 2H6IA 2KXPC 4K5AB 2BTDA 3C3OA 5ARGA 2UY1B 3K9IA 4JA7A 1H6KA 1WY6A 2L6BA 3MGBA 1NA3A 4EZLA 2JLBA 4JW1A 4A3TA 2IONA 1IXVA 1HU3A 3B7SA 3P2BA 2AWIA 2RD0A 3JUIA 3P1UA 1NL4A 4G8LA 3D9NA 4HOTA 3SHFA 4N2SA 3PE3A 1LTXA 4Q69A 1PY1A 4WNDA 4PDXA 4XX5A 4TXRA 4AP2A 3D3MA 3URZA 4G1TA 3SBTB 2KATA 3CK8A 4OAUC 4DI3A 3O48A 3GZ1A 4FJZA 2OVFA 2H6FA 1H2TC 2WXRA 1ELRA 1SQMA 3PZ4A 4JD2G 4TXPA 1GW6A 2KC7A 3ZYMA 3FEXA 5FT9A 4C48B 2V5QC 3SI5A 2BUGA 2X38A 1TJCA 3TWRA 1DVPA 4HBDA 4LUNU 4YDYA 2NC9A 4KMOA 4K5BA 1ZU2A 2I1JA 4AM9A 2XRYA 3OXFA 4GTQA 2GRRB 1N4SA 1H0AA 3IXEA 1ELKA 3U66A 2Q7FA 3UM3A 3AG2E 3DPYA 2DVWA 3FU5A 4PH4B 3HXDA 2R03A 4I9CA 2X6HA 3U3WA 3WG7E 3ZN3A 4CEMA 5G04C 5CEAA 1SZAA 1DCEA 3D9JA 3MV2B 2VJ8A 4B8AA 5KJNA 2OOEA 1EDUA 4J7WA 4O1OA 3NF1A 5D66A 4APFA 1IQUA 3SBSA 2KCVA 1E90A 4UWFA 4I17A 1H6PA 5ENOD 2VTBA 1N54A 5FQ8A 2RFMA 4IRUA 2Y0BG 4GZCA 4UI9K 5ENNA 3PREA 3C98A 4NACA 3FY4A 3EU5A 3W9FA 4HI8A 2R17C 2VGXB 1HE8A 1HG2A 3D9OA 3TG5A 3U64A 1TN6A 2OV8A 3PEUB 5ENPD 3C5RA 3PNTB 2R59A 1S64A 2J07A 4U96D 3S7FA 2WPVA 3FU3A 4TRQA 2IF4A 5KCMA 2A5EA 1KZOA 3SFXA 1H6OA 2GRMA 3CVUA 2QYUA 2YINA 2YQ8A 3CR3A 2X6IA 4FULA 3TAXA 4GA2A 5KWDA 4B93B 1HZ4A 3EIJA 3LVQE 2B0OE 3TWWA 5ENSD 5CBOA 4AXHA 1IQRA 4GTSA 4EBAG 1MYOA 3HVEB 2Y1LE 5FINA 1IHGA 1AP7A 1OCRE 3QAQA 5D2MC 1N9AA 3UI2A 5B1AE 2A5UA 1X5BA 2ILRA 3RJVA 2P9PG 1ZBPA 3D9KA 2NSZA 4OYSA 3HXEA 3UINC 1IKND 4JHKA 4J6IA 2VGYA 3FUJA 1TN7A 3D9LA 1HFAA 2MHKA 4JEUA 4GTPA 5JJ6A 2C2LA 1SA4A 3CHOA 1YYHA 2DZNA 1E7VA 2KCKA 5AN8A 1HG5A 3UTMA 5FJYA 2XZDG 2AXZA 4B0ZA 3TWQA 4F1PA 3ISMC 4F1SA 3CIAA 1EF1C 1Z6TA 1UJKA 4HNAD 4O60A 3BEEA 1O1SA 3ZGQA 4DPRA 5HRYA 1OWMA 4C9BB 4U8VD 4FHKA 4U0SA 4RG9A 3GYZA 1O1TA 5EKQD 4HLLA 3T9KA 1YA0A 2EIME 4HVBA 5G04J 3VLDA 2AW6A 3CVWA 3IHVA 3EUVA 1HS6A 4HQDA 3T5VA 4FA6A 4XE0A 3SGHA 4FLBA 3UIOC 4J8DA 3CVYA 3CVPA 5B3SE 2HM8A 3UX4A 2X6KA 3PUJA 3V30A 3MJWA 4KZ0A 1N4RA 3UT4A 4J8FA 4JC8A 5EIBE 3KSLA 5ANRA 1D9SA 3B7RL 3FHEA 5AQBA 2J08A 4WNFA 4JB8P 4M3OA 4BWRA 4TUUA 4LSZE 4L23A 4L2LA 5J90A 1OWOA 4JHRA 4H7YA 4EZKA 4HRMB 5JJ7A 5J08A 4N3CA 4TUMA 5BW8C 2GRQB 2RKKA 2IY0C 3FUIA 4XIFA 3FTUA 3QARA 4ACLA 2VYIA 4A1SA 3L13A 1W3BA 4LRZA 4C0MA 5CCMA 3IV0A 3AS4A 1Y6IA 4R7LA 1Z3XA 1Z3YA 4LEUA 2VSNA 4WNGA 3DSTA 4I1OB 1YMPA 4NIKA 3MEKA 2HYZA 5CHEE 3ZHEB 1NZNA 3VLEA 3CKCA
chains in the Genus database with same CATH topology
4BY6A 3CLJA 1SZ9A 2VSXE 3DPDA 5C2YA 4JW1A 4A3TA 3ZIMA 4JL0A 2IONA 1HU3A 4JA9A 4N3AA 3B7SA 1HX8A 3R7RA 3P2BA 1TJFA 2AWIA 2RD0A 2GRLA 3JUIA 3Q4AB 1Y8MA 3L17A 3P1UA 5G05J 4CT0A 2V8SE 3D9NA 3ZXSA 2PQNA 3QNKA 3CHSA 4EQFA 3QWVA 4HOTA 2AXVA 3PZDA 4U04A 5ARFA 3SHFA 2VGXA 4JPSA 4U0UA 3VTYA 4N2SA 3PE3A 3TGOA 4Q69A 1PY1A 3I4GA 3IHYA 4WNDA 2KZTB 3HDXA 4HLEA 3CHQA 3KAEA 2A4ZA 2FBNA 5FWQA 4J8EA 3FUDA 3FUEA 4Y6CA 4PDXA 3RRUA 4ANWA 3BG0B 3PH0C 3PNLB 2NXPA 4XX5A 3ML9A 2PQRA 4JEHA 5DBKA 5T8IA 3I5PA 4AP2A 1S0PA 4CT4A 4YVOA 3LY7A 3D3MA 4KXKB 5E75A 3URZA 2WMOA 4G1TA 5KJKA 4PUCA 3SBTB 2PL2A 2FO7A 2KATA 3D9PA 4UWGA 3CK8A 4ILHB 5ANLA 2R5SA 4DI3A 3O48A 2L0IA 4Q94A 4ABNA 3GZ1A 4N3BA 3FTVA 2V4LA 3UQ3A 4FJZA 2PM7A 2OVFA 3N71A 3EDTB 4UQYA 1H2TC 4B94A 3PVLA 2WXRA 4EPZA 1ELRA 3VTXA 1SQMA 4ANVA 5FZSA 2MOWA 5EX0A 2C0MA 2WXPA 1GW6A 1HO8A 2KC7A 3ZYMA 3FEXA 5FT9A 3S2AA 2RG8A 3ONLA 3IEGA 3OTNA 3APFA 1E8XA 1E8YA 3HYMB 4GYWA 4O6FA 2BUGA 2X38A 3APCA 3SI5A 4JZYA 4URKA 1TJCA 4FJYA 3L08A 3MKQB 4ILIA 3KD7A 3OAWA 3ZYKA 1DVPA 2Y4TA 3FTXA 4LUNU 1EYHA 3SF4A 2WQ7A 4N39A 3LJ3A 2NC9A 2XEVA 3B7UX 3CSFA 4WUYA 4KMOA 3D9MA 3LEWA 1MQSA 3LDZA 5HI7A 1OWPA 3QKYA 1ZU2A 2I1JA 4AM9A 4XI0A 2XRYA 3OXFA 3QWWA 3SZ7A 3KEZA 5FZRA 3ASFA 4PS3A 3FWVA 3HVEA 5LCWC 3S7JA 1OWLA 1KT1A 1UW4B 1H0AA 3ZVVA 3T5XA 4W9RA 5AIJA 2L6JA 2XPZA 4AVXA 1PC2A 3VLFA 1ELKA 3U66A 4F3VA 1JWFA 2Q7FA 3CV0A 3LVRE 4UWKA 4YVQC 3RK6A 2CFZA 4L2YA 4QFVA 2LO6A 4XI9A 5BV1A 5A23A 3FU5A 3U9WA 1WAO1 1JWGA 4PH4B 4WAFA 3FUHA 4RVBA 4I9CA 1B89A 2X6HA 3U3WA 3ZN3A 4CEMA 4MKTA 5CCLA 3ENEA 3PS6A 3PRZA 5G04C 4AEZC 4HXIA 2V0PA 1SZAA 2HO1A 3CVLA 3IKOB 4P29A 1N52A 3D9JA 5BT1A 3ZEFA 2FF4A 3FFLA 3MV2B 4J0UA 4GZ3A 2LAIA 4BT9A 2IOLA 2VJ8A 4B8AA 5KJNA 2OOEA 1EDUA 4HS2A 4GMLA 4HOQA 4APOA 3CK7A 3OXLA 1A17A 3NF1A 3BG1B 5FQ7A 3ZPJA 4AY5A 1NA0A 4APFA 4C0EA 3QWPA 1IQUA 3FH7A 4PS8A 3SBSA 4TV3A 3PUKA 2KCVA 1E90A 4UWFA 4I17A 3FU0A 3QK0A 2FULA 5FTPA 2VTBA 5LOZA 1N54A 5FQ8A 4ANUA 1LF8A 4GYOA 2XQ0A 1UJJA 4IRUA 4CDNA 1E8WA 4GZCA 4E85A 4WNEA 5BUZA 4UI9K 3ASHA 4G11A 1MHQA 5ENNA 5G2NA 3JQ1A 3PREA 3C98A 4NACA 2J4DA 2LSVA 3FY4A 4BFRA 5JHAA 3FP3A 2X6FA 4G26A 4EZJA 2M63A 3B13A 2CG2A 3G2SA 4GYYA 3AU5A 5BPPA 2XGSA 3JQ0A 4NRHB 2C0LA 4WWPA 2R17C 3MV3B 4GCOA 2VGXB 5T3RA 1HE8A 3SNXA 1HG2A 2I1KA 3D9OA 3EHNA 4UWLA 3TG5A 4CCAA 3U64A 2AXUA 2GGFA 2OV8A 5D0OD 3ESKA 3PEUB 1TEZA 4CGVA 3ZRHA 1UN8A 4AY6A 3NZSA 2P58C 3PNTB 5EX3A 2X6JA 3CK9A 5KJLA 2R59A 3UPVA 2J07A 3S7FA 1E8ZA 2WPVA 4FADA 3FU3A 2FI7A 4U0ZA 2CHXA 3HIZA 3E4BA 4TRQA 2IF4A 5E76A 5KCMA 2E2EA 2XHEA 3U4TA 3L54A 4BX8A 1XGWA 3ZW3A 5AENA 5LX8A 4UQZA 3SFZA 4A3VA 2WXKA 2GRMA 3RO2A 3LCAA 3GZSA 3CVUA 1H2VC 4K0RA 2WXHA 2YINA 3ZYQA 4AOFA 1FVHA 2WXNA 1JPLA 2WXQA 3JCKC 2YQ8A 3T8MA 2IQCA 2WXLA 4GA1A 3CR3A 2QFCA 2X6IA 4FULA 3TAXA 3Q15A 4JVSA 4B89A 5HQ8A 4GA2A 2VSYA 1EPUA 4I2ZA 5C1DA 3CSTA 4I43A 4KBQA 1HZ4A 4OVVA 3EIJA 4BX9A 1KT0A 4FP7A 4GU5A 3ONKA 2YHCA 5LFAA 3LVQE 3G2TA 5G05C 2GW1A 3FTZA 3FUNA 4G24A 3Q47B 2WXIA 4FU3A 4AXHA 1BPOA 3ASDA 2WXMA 4GZ5A 4LCTA 4U8HA 1IQRA 3PE4A 4WWOA 3RO3A 4EBAG 3ESLA 4IN3B 3CHMA 3HVEB 2WB2A 2I6HA 1IHGA 4PS7A 4RG6A 1E96B 4I2WA 1QQEA 2IJGX 1PAQA 2KM4A 3QAQA 4DLQA 2XGOA 3CVNA 4WWNA 5A6CA 2DBAA 4L7TA 3LPZA 3FUFA 4I6EA 2A5UA 1X5BA 4I6JA 2ILRA 4KYOB 3RJVA 4AIFA 4I6GA 3Q5MA 2X3MA 2E0IA 1ZBPA 3D9KA 1L5JA 4JHJA 2NSZA 3NZUA 4OYSA 3EIQC 4CRWA 3AS5A 1WM5A 3EHMA 2J4BA 2YHEA 1P5QA 4YNDA 3L16A 1OUVA 2HR2A 3G2UA 4JHKA 4J6IA 2WXFA 1NP7A 1U3DA 2VGYA 3FUJA 4UQXA 3QOUA 2XCBA 4I9EA 4I1MA 3D9LA 4KZCA 1HFAA 2MHKA 2UY1A 3RRNB 4GZDA 4IULA 4JEUA 4HOSA 3S7BA 5BNWA 4U07A 5JJ6A 1OWNA 2C2LA 4GB9A 2MRIA 2I9CA 3AS8A 4MS6A 3CHOA 2L0TB 2Y4UA 3LYAA 3WXXA 3UT8A 3ZHEA 2CHZA 3L6AA 4B8CB 5FZQA 1E7VA 2YNQA 2PM6A 2KCKA 3PDNA 4GA0A 2CHWA 3MYVA 4KVOA 1HG5A 4AV7A 2VTBB 5AJLA 5FJYA 2IOSA 4GCNA 1U3CA 2AXZA 3G2WA 2QY7A 3L22A 3QJZA 3UT7A 4B0ZA 3O4ZA 2LSUA 4FHJA 4F1SA 2BF0X 5DIZA 3UUXA 5M72A 3GZ2A 3CHRA 3MA5A 5JJTA 4BTBA 2CFUA 3CIAA 4GZ6A 1EF1C 2KZTA 2WM9A 4FC8A 3FTSA 1VDYA 1UG3A 1Z6TA 3CQGB 3R9AB 2AVPA 1UJKA 2XPIA 5LCWJ 3QDNA 3QB2A 4EECA 3AU4A 4G23A 4IYPA 3BEEA 4XKCA 5A7DB 3IBEA 3ASGA 3ZYLA 1FCHA 3ZGQA 4UI9C 3NQPA 4DK5A 4K03A 4DPRA 1OWMA 2WQHA 3S7DA 4LERA 4NQ0A 4C9BB 4F7AA 2JEKA 2PZIA 2EQXA 4G25A 4GMJA 2DIWA 4FHKA 4JXTA 4U0SA 4RG9A 2CG3A 3GYZA 3HHMA 4HOUA 4KVMA 4Q96A 4UWHA 3UMVA 4HORA 2J9QA 3MZLB 3CVQA 3MKRA 1QNFA 5EKQD 3GW4A 3LY8A 4ILGA 4N5CA 1YA0A 3APDA 3QC1A 5LP0A 3CVXA 3TXNA 3OXGA 4HVBA 5G04J 3EJNA 3VLDA 2FEZA 3Q49B 3I3NA 2IU1A 2AW6A 1HXIA 2VSOE 4BSXA 4J8SA 3CVWA 1QZ2A 3IHVA 3FUKA 2IFUA 5FQ6A 2OVBA 1HS6A 3T5VA 2XRZA 4DI4A 4FLHA 4AJWA 4H7XA 5G55A 4XE0A 3TG4A 4FA6A 4BT8A 4RSYA 4DLOA 1HF8A 3ML8A 2Y3AA 3SGHA 4FLBA 5D0QD 1XNFA 2XCCA 3FH5A 3FTYA 3MKQA 4BTAA 4F53A 2WQ6A 4KT6B 4J8DA 4ME2A 3LY9A 3CVYA 3CVPA 5KJMA 2UWJG 5FQ4A 2HM8A 2WXOA 4ATGA 1H2UA 2X6KA 3PUJA 3UX4A 2KCLA 3MJWA 2WXGA 4KZ0A 4MRUA 3UT4A 4J8FA 4JC8A 4CDRA 1UN9A 3CEQA 3DBSA 3JYSA 5ANRA 3B7RL 5EDSA 3FULA 4OVUA 3FHEA 3FEYA 2J08A 2L9BA 3I4RB 4WNFA 3MX3A 4NURA 3RIBA 3SD5A 4M3OA 2WXJA 5CMYA 1ELWA 4CDMA 1INZA 2LAHA 4TUUA 2LNIA 4BWRA 3RKVA 4L23A 3LKUA 3LXUX 3ULQA 4D10C 4V3IA 4ANXA 4XKBA 3FTWA 2V5FA 3FDHA 4L2LA 3TL5A 3CKBA 5T4YA 5JHBA 5J90A 3TJPA 5AJDA 1JUQA 3D9IA 3FUMA 4U63A 1OWOA 2WVIA 3CGHA 3FU6A 2J49A 1H19A 4JHRA 4Y6WA 4H7YA 4XZ4A 4EZKA 4I1AA 2I2OA 1IYGA 3CQCB 4G2VA 3RRMB 3RU0A 5JJ7A 4GAAA 5J08A 4N3CA 3B7TA 3TXMA 4HFGA 5BW8C 3FUIA 1KLXA 3LS8A 4MLPA 4UI9J 4XIFA 4N2QA 4GPKA 1HH8A 3FTUA 3CVVA 3QARA 4ACKA 4ACLA 2WMNA 2J09A 1FVFA 2XGMA 2VYIA 3ZFWA 2DCPA 3L13A 4A1SA 1W3BA 2BTDA 4LRZA 4A1GA 3R7QA 4C0MA 5BV0A 5CCMA 3IV0A 4E6HA 3CHPA 2ZU6B 3AS4A 1Y6IA 4R7LA 4DJAA 5ARGA 2UY1B 1Z3XA 3K9IA 4JA7A 1Z3YA 4LEUA 2VSNA 2ONDA 2XPYA 5CMWA 4WNGA 1H6KA 1WY6A 1DNPA 4I1OB 4L1BA 4EBAA 3KS2A 4CGWA 5AYWD 3MEKA 3MGBA 2HYZA 1E7UA 3PEVB 3G2VA 1NA3A 3MCXA 5CHEE 3ZHEB 1NZNA 3FH8A 2VQ2A 4A55A 4EZLA 3VLEA 2JLBA 3CKCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WY6 A; 
#chains in the Genus database with same CATH topology
 3UM0 A;  4BY6 A;  1JCS A;  1SZ9 A;  2VSX E;  3EU9 A;  4JA9 A;  3X2Q E;  2DZO A;  1TJF A;  2GRL A;  1Y8M A;  4DX2 A;  4CT0 A;  2V8S E;  3ZXP A;  1S63 A;  3ZXS A;  3CHS A;  4EQF A;  3DRA A;  3TWT A;  3IHY A;  3HDX A;  4HLE A;  3KAE A;  2FBN A;  3FUE A;  2F8X K;  1TNZ A;  3PNL B;  3KEA A;  1K1B A;  3ML9 A;  3AG4 E;  2WMO A;  5ANL A;  3TWU A;  3FTV A;  3UQ3 A;  2PM7 A;  3EDT B;  4ANV A;  4U7E B;  2MOW A;  5EX0 A;  1FT2 A;  2WXP A;  3S2A A;  1FT1 A;  3IEG A;  3C3Q A;  3OTN A;  4GYW A;  3BQO A;  4JZY A;  4FJY A;  1X81 A;  4ILI A;  3KD7 A;  3ABL E;  3FTX A;  3SF4 A;  4N39 A;  3LJ3 A;  3B7U X;  4GPM A;  4XI0 A;  3QWW A;  4U8Y D;  3SZ7 A;  5FZR A;  3ASF A;  5ENR D;  1UW4 B;  3AG3 E;  3ZVV A;  3T5X A;  5AIJ A;  2L6J A;  4AVX A;  5JA4 D;  3VLF A;  3CV0 A;  3RK6 A;  4UWK A;  3C72 A;  4QFV A;  1WAO 1;  1JWG A;  4WAF A;  4DX6 D;  4YDW A;  5BXO A;  3T8K A;  5CCL A;  4AEZ C;  4HXI A;  2V0P A;  4N5Q A;  4J0U A;  4GZ3 A;  2LAI A;  4EHM A;  2IOL A;  3V2O A;  3OXL A;  1A17 A;  4BET A;  2XEN A;  4AY5 A;  3DSX A;  3NBN B;  4C0E A;  4PS8 A;  1BI7 B;  3PUK A;  3ABK E;  3FU0 A;  2FUL A;  5FTP A;  4ANU A;  1UJJ A;  4E85 A;  1N0R A;  2EIN E;  1D8D A;  4BFR A;  2X6F A;  4G26 A;  4GYY A;  2ZGG A;  5BPP A;  2XGS A;  4WWP A;  4GCO A;  1FPP A;  4ZHB A;  4LNB A;  5BXU A;  2GGF A;  2P9S G;  2XEH A;  4DUI A;  2X6J A;  3NOC D;  5KJL A;  4HI9 A;  5EYP F;  5FIO A;  2FI7 A;  3U4T A;  2CHX A;  3LJN A;  5E76 A;  3L54 A;  2OEW A;  2GRN B;  4UUC A;  3D9H A;  1H2V C;  1SW6 A;  3ZYQ A;  1TNU A;  2WXN A;  1TR4 A;  1TNY A;  4JVS A;  5HQ8 A;  4I2Z A;  4KBQ A;  4OVV A;  4GU5 A;  5LFA A;  3G2T A;  4G24 A;  3ASD A;  4GZ5 A;  4LCT A;  2P9L G;  4M7C A;  3RO3 A;  3ESL A;  4IN3 B;  3CHM A;  4PS7 A;  2IJG X;  2KM4 A;  2XGO A;  3HXC A;  3LPZ A;  4I6E A;  4KYO B;  3Q75 A;  2FO1 E;  1RZ4 A;  3EIQ C;  4CRW A;  2J4B A;  3L16 A;  1OUV A;  1BI8 B;  2WXF A;  3QOU A;  2XCB A;  1OY3 D;  4ZFH A;  2UY1 A;  3DEO A;  4IUL A;  5BNW A;  4U07 A;  2NYJ A;  2Y4U A;  5HS0 A;  4LNU D;  1UOH A;  2YNQ A;  2PM6 A;  4GA0 A;  3MYV A;  4KVO A;  4GCN A;  2QY7 A;  2RFA A;  3L22 A;  3QJZ A;  3B7B A;  2H6H A;  1MX2 A;  3R9A B;  3DSU A;  2AVP A;  2XPI A;  3QDN A;  3QB2 A;  4MBG A;  3AU4 A;  3R9M A;  3AJI A;  1FCH A;  4LER A;  2JEK A;  3EHQ A;  4GMJ A;  1S70 B;  2DIW A;  3UMV A;  4Q96 A;  2XS8 A;  2J9Q A;  3CVQ A;  4N5C A;  3TXN A;  2VSO E;  4BSX A;  1TNO A;  5CBN A;  2VGE A;  3UM1 A;  2IFU A;  2OVB A;  1OCO E;  5JMN D;  1XNF A;  4F53 A;  2WQ6 A;  3AG1 E;  4KT6 B;  4ME2 A;  2LUH A;  2DYS E;  2OCC E;  5H7P A;  1MJ0 A;  3ASN E;  1UN9 A;  1NFI E;  3HG0 D;  1INZ A;  1ELW A;  4QQI A;  3ULQ A;  4HRL A;  4ANX A;  4XKB A;  3FTW A;  5T4Y A;  3TJP A;  4U63 A;  4BER A;  3CGH A;  4Y6W A;  1H19 A;  4XZ4 A;  4I1A A;  3DXM G;  3CQC B;  4G2V A;  4GAA A;  3LS8 A;  4MLP A;  4GPK A;  1HH8 A;  2J09 A;  2XGM A;  2DCP A;  1NI1 A;  5BV0 A;  4E6H A;  2OND A;  2XPY A;  5CMW A;  1DNP A;  4L1B A;  3E37 A;  3KS2 A;  4A55 A;  3FH8 A;  3DPD A;  3V31 A;  2B6C A;  1QBQ A;  3PZ2 A;  5EYL A;  1K8K G;  3ZNG A;  3QNK A;  1MX4 A;  1RW2 A;  2AXV A;  1A5E A;  4U04 A;  5ARF A;  2VGX A;  4U0U A;  4DX5 D;  3TGO A;  3I4G A;  2KZT B;  2A4Z A;  5FWQ A;  4J8E A;  3FUD A;  4Y6C A;  2EIK E;  3RRU A;  4ANW A;  3PH0 C;  4XEI G;  5DBK A;  1JCR A;  1DCQ A;  4YVO A;  3RAU A;  4KXK B;  5E75 A;  2PL2 A;  2FO7 A;  4UWG A;  4ILH B;  4F6R D;  3ABM E;  4Q94 A;  4N3B A;  1QYM A;  2V4L A;  2F8Y A;  4UQY A;  4B94 A;  4EPZ A;  5AAR A;  3VTX A;  5EN5 D;  3E34 A;  2C0M A;  2P2C P;  4OAV B;  2ETB A;  2RG8 A;  3ONL A;  1E8X A;  3HYM B;  2EIL E;  3APC A;  4GTO A;  2QZA A;  3MKQ B;  3ZYK A;  2Y4T A;  4CZ2 D;  5ENT D;  3LDZ A;  3QKY A;  3KEZ A;  3FWV A;  3HVE A;  5LCW C;  3S7J A;  1OWL A;  1KT1 A;  2XPZ A;  3Q7A A;  1BU9 A;  2CFZ A;  4L2Y A;  3DSV A;  5A23 A;  3U9W A;  5CRU A;  3FUH A;  2BKG A;  4RVB A;  1B89 A;  3KSQ A;  4MKT A;  3IKO B;  3CVL A;  2HO1 A;  3B95 A;  1N52 A;  3ZEF A;  2FF4 A;  3FFL A;  3L82 A;  5CRV A;  4HS2 A;  4GML A;  4HOQ A;  3BG1 B;  5FQ7 A;  3JUE A;  3QWP A;  3FH7 A;  4TV3 A;  3QK0 A;  2PNN A;  5LOZ A;  1O1R A;  3EHR A;  4GYO A;  2XQ0 A;  4CDN A;  3UIP C;  3ASH A;  1MHQ A;  3JXI A;  3ULE G;  2J4D A;  2LXM A;  3FP3 A;  2M63 A;  3B13 A;  2CG2 A;  3G2S A;  3JQ0 A;  4NRH B;  2C0L A;  2XEE A;  1TYQ G;  2I1K A;  3EHN A;  4UWL A;  4CCA A;  2AXU A;  3ESK A;  1TEZ A;  4CGV A;  3ZRH A;  1UN8 A;  1SA5 A;  3UPV A;  3C3R A;  3E4B A;  3E33 A;  3ZW3 A;  5AEN A;  2ZXW E;  3SFZ A;  4A3V A;  3LCA A;  4RQI A;  2WXH A;  4BES A;  4AOF A;  1FVH A;  1JPL A;  2WXQ A;  2ZIR A;  3JCK C;  1KZP A;  2IQC A;  3E32 A;  3Q15 A;  4B89 A;  1Z5S C;  2VSY A;  3CST A;  4I43 A;  4FP7 A;  2F0Y A;  2P9I G;  5G05 C;  4HB5 A;  2WXI A;  2WXM A;  1U2V G;  3J5Q B;  3PE4 A;  2WB2 A;  3DSS A;  2I6H A;  4I2W A;  1QQE A;  1PAQ A;  2QC9 A;  5EIL A;  5A6C A;  2DBA A;  4L7T A;  3FUF A;  2X3M A;  2IO3 C;  5CEC B;  3NOG D;  3ZUV B;  1L5J A;  2GRP B;  4JHJ A;  4YND A;  4TXQ A;  5EID A;  2H6G A;  4I9E A;  4DX1 A;  4GTM A;  1OWN A;  2MRI A;  2I9C A;  3AS8 A;  4MS6 A;  4CYM D;  2L0T B;  3LYA A;  4DRX E;  5CER B;  3UT8 A;  1OXJ A;  3ZHE A;  2CHZ A;  4B8C B;  5FZQ A;  3NB2 A;  3PDN A;  2CHW A;  2VTB B;  2IOS A;  1WG0 A;  3DXK G;  3O4Z A;  2XS1 A;  4J8Y A;  2LSU A;  1N11 A;  4FHJ A;  5DIZ A;  4O1P A;  2R02 A;  3CHR A;  5AAO A;  4BTB A;  4GZ6 A;  3FTS A;  1VDY A;  1UG3 A;  2Y69 E;  3CQG B;  3RSE G;  1N4P A;  5LCW J;  3ASO E;  4IYP A;  3IBE A;  5ITZ F;  3ASG A;  3NQP A;  2WQH A;  3S7D A;  4F7A A;  4NQ0 A;  4G25 A;  4JXT A;  3ZU7 B;  4HOU A;  4KVM A;  4UWH A;  1QNF A;  1V54 E;  3GW4 A;  4ILG A;  3BUA A;  3QC1 A;  5LP0 A;  3OXG A;  3HXB A;  2FEZ A;  2R05 A;  2XRZ A;  5G55 A;  1V55 E;  2F37 A;  1HF8 A;  3ML8 A;  3V2X A;  2Y3A A;  5D0Q D;  3FH5 A;  3Q78 A;  5KJM A;  2UWJ G;  5FQ4 A;  2WXO A;  3AAA C;  1BLX B;  1ZB1 A;  3UM2 A;  1O5M A;  4HRN A;  3FUL A;  4OVU A;  3FEY A;  3I4R B;  3MX3 A;  5CMY A;  3J5P A;  2LNI A;  2HE0 A;  3LXU X;  4D10 C;  4V3I A;  2V5F A;  3FDH A;  3CKB A;  5JHB A;  2IO2 C;  1JUQ A;  3FUM A;  2WVI A;  2ETC A;  1IYG A;  3RU0 A;  1G3N B;  5KBA A;  1K3Z D;  1KLX A;  4UI9 J;  4ACK A;  2WMN A;  1FVF A;  3ZFW A;  4A1G A;  3R7Q A;  2OEV A;  3CHP A;  2ZU6 B;  4DJA A;  5KNH D;  4EBA A;  2ZIS A;  4CGW A;  5AYW D;  1E7U A;  3PEV B;  3G2V A;  3MCX A;  2VQ2 A;  1EYH A;  1OT8 A;  3CLJ A;  2BED A;  5C2Y A;  3TWV A;  3ZIM A;  4JL0 A;  1MZC A;  2ZGD A;  4N3A A;  3R7R A;  1HX8 A;  3Q4A B;  3L17 A;  2LXL A;  3JXJ A;  5G05 J;  2GRO B;  4LG6 A;  2PQN A;  3QWV A;  2J8S D;  3PZD A;  4JPS A;  3VTY A;  4GTT A;  1AWC B;  4RLY A;  3CHQ A;  3SQV A;  3BG0 B;  2NXP A;  2V4H C;  3SO8 A;  2PQR A;  4JEH A;  5T8I A;  3I5P A;  1S0P A;  4CT4 A;  3LY7 A;  5KJK A;  4PUC A;  3DEP A;  3D9P A;  2R5S A;  4ABN A;  2L0I A;  3N71 A;  3UKR G;  3PVL A;  5FZS A;  1HO8 A;  3F6Q A;  3APF A;  1E8Y A;  4O6F A;  4URK A;  3L08 A;  3OAW A;  2QYJ A;  1IHB A;  2WQ7 A;  4GMR A;  1TNB A;  2XEV A;  2DYR E;  3CSF A;  4WUY A;  3ULY A;  3D9M A;  3LEW A;  1MQS A;  5HI7 A;  3UKU G;  1OWP A;  4DX7 D;  4K5C A;  4PS3 A;  4W9R A;  3ZKJ A;  1PC2 A;  4F3V A;  1JWF A;  3LVR E;  4YVQ C;  2P9K G;  2LO6 A;  4XI9 A;  5BV1 A;  1OCC E;  5ENQ D;  4L9P A;  3ENE A;  3PS6 A;  3PRZ A;  1YCS B;  3Q9N C;  4P29 A;  5BT1 A;  1LD8 A;  3UXG A;  4BT9 A;  3SFY A;  1N0Q A;  4APO A;  3CK7 A;  2DWZ A;  3ZPJ A;  1NA0 A;  3HXF A;  1LF8 A;  4GTR A;  1E8W A;  4WNE A;  5BUZ A;  4G11 A;  5G2N A;  3JQ1 A;  5AQA A;  2LSV A;  5JHA A;  4EZJ A;  4Z68 A;  2KBX A;  3AU5 A;  3MV3 B;  2EIJ E;  5T3R A;  3DSW A;  3BU8 A;  3SNX A;  1WDY A;  1OCZ E;  5D0O D;  5HKP A;  4AY6 A;  3NZS A;  1K1A A;  2P58 C;  5EX3 A;  3CK9 A;  1E8Z A;  4FAD A;  1BD8 A;  3Q9U C;  4U0Z A;  3HIZ A;  4BX8 A;  2E2E A;  2XHE A;  1XGW A;  5LX8 A;  4UQZ A;  3NAW A;  2WXK A;  3RO2 A;  4BSZ B;  3GZS A;  4K0R A;  3Q73 A;  2BKK B;  3T8M A;  4GA1 A;  2WXL A;  2QFC A;  4BEP A;  1EPU A;  5C1D A;  2P9N G;  4X8Q A;  4BX9 A;  1KT0 A;  3ONK A;  2YHC A;  2GW1 A;  3FTZ A;  3FUN A;  3Q47 B;  4FU3 A;  1BPO A;  2ETA A;  4U8H A;  4WWO A;  2JAB A;  4U95 D;  4RG6 A;  1E96 B;  3TWX A;  4DLQ A;  2R2L A;  3CVN A;  4WWN A;  5IY5 E;  4I6J A;  4AIF A;  3PZ1 A;  1MX6 A;  4I6G A;  3Q5M A;  2E0I A;  3NZU A;  3AS5 A;  1WM5 A;  3EHM A;  2YHE A;  1P5Q A;  4YDE A;  3SY2 A;  2HR2 A;  3G2U A;  4UQX A;  1NP7 A;  1U3D A;  4I1M A;  4KZC A;  3RRN B;  4GZD A;  4HOS A;  3S7B A;  5KNG A;  4GB9 A;  4GTV A;  1D8E A;  3WXX A;  3L6A A;  4AV7 A;  5AJL A;  5CED B;  1U3C A;  3G2W A;  3UT7 A;  3E30 A;  3L9T A;  4ATZ D;  2BF0 X;  3UUX A;  5M72 A;  3GZ2 A;  3MA5 A;  5JJT A;  2CFU A;  2KZT A;  2WM9 A;  4FC8 A;  1KPS B;  3Q79 A;  4YDO A;  5B1B E;  4EEC A;  4G23 A;  5A7D B;  4XKC A;  3ZYL A;  1DC2 A;  4UI9 C;  4DK5 A;  4K03 A;  3PZ3 A;  2PZI A;  2EQX A;  1Q2Z A;  2CG3 A;  3HHM A;  4HOR A;  1JCQ A;  3MZL B;  3MKR A;  3LY8 A;  3APD A;  3W9G A;  3CVX A;  3EJN A;  3Q49 B;  3I3N A;  2IU1 A;  1HXI A;  4J8S A;  1QZ2 A;  3FUK A;  5FQ6 A;  1N4Q A;  2P9U G;  4DI4 A;  4FLH A;  4AJW A;  4H7X A;  2IEJ A;  3TG4 A;  5AQ7 A;  4BT8 A;  4RSY A;  4DLO A;  2XCC A;  3MKQ A;  3FTY A;  4BTA A;  3LY9 A;  3DWL G;  4ATG A;  1H2U A;  2KCL A;  2WXG A;  4MRU A;  4CDR A;  3CEQ A;  3DBS A;  3Q7F A;  3JYS A;  1SVX A;  5EDS A;  2XZT G;  1LD7 A;  2L9B A;  3HRA A;  4NUR A;  3RIB A;  3SD5 A;  2WXJ A;  4CDM A;  2LAH A;  3RKV A;  2AJA A;  3LKU A;  4LNG A;  1N95 A;  3TWS A;  2MYO A;  1N94 A;  4A63 B;  3TL5 A;  5AJD A;  3D9I A;  3FU6 A;  2J49 A;  2I2O A;  1TN8 A;  3RRM B;  3B7T A;  3TXM A;  4HFG A;  4G8K A;  4N2Q A;  5AQ9 A;  3V79 K;  3CVV A;  2H6I A;  2KXP C;  4K5A B;  2BTD A;  3C3O A;  5ARG A;  2UY1 B;  3K9I A;  4JA7 A;  1H6K A;  1WY6 A;  2L6B A;  3MGB A;  1NA3 A;  4EZL A;  2JLB A;  4JW1 A;  4A3T A;  2ION A;  1IXV A;  1HU3 A;  3B7S A;  3P2B A;  2AWI A;  2RD0 A;  3JUI A;  3P1U A;  1NL4 A;  4G8L A;  3D9N A;  4HOT A;  3SHF A;  4N2S A;  3PE3 A;  1LTX A;  4Q69 A;  1PY1 A;  4WND A;  4PDX A;  4XX5 A;  4TXR A;  4AP2 A;  3D3M A;  3URZ A;  4G1T A;  3SBT B;  2KAT A;  3CK8 A;  4OAU C;  4DI3 A;  3O48 A;  3GZ1 A;  4FJZ A;  2OVF A;  2H6F A;  1H2T C;  2WXR A;  1ELR A;  1SQM A;  3PZ4 A;  4JD2 G;  4TXP A;  1GW6 A;  2KC7 A;  3ZYM A;  3FEX A;  5FT9 A;  4C48 B;  2V5Q C;  3SI5 A;  2BUG A;  2X38 A;  1TJC A;  3TWR A;  1DVP A;  4HBD A;  4LUN U;  4YDY A;  2NC9 A;  4KMO A;  4K5B A;  1ZU2 A;  2I1J A;  4AM9 A;  2XRY A;  3OXF A;  4GTQ A;  2GRR B;  1N4S A;  1H0A A;  3IXE A;  1ELK A;  3U66 A;  2Q7F A;  3UM3 A;  3AG2 E;  3DPY A;  2DVW A;  3FU5 A;  4PH4 B;  3HXD A;  2R03 A;  4I9C A;  2X6H A;  3U3W A;  3WG7 E;  3ZN3 A;  4CEM A;  5G04 C;  5CEA A;  1SZA A;  1DCE A;  3D9J A;  3MV2 B;  2VJ8 A;  4B8A A;  5KJN A;  2OOE A;  1EDU A;  4J7W A;  4O1O A;  3NF1 A;  5D66 A;  4APF A;  1IQU A;  3SBS A;  2KCV A;  1E90 A;  4UWF A;  4I17 A;  1H6P A;  5ENO D;  2VTB A;  1N54 A;  5FQ8 A;  2RFM A;  4IRU A;  2Y0B G;  4GZC A;  4UI9 K;  5ENN A;  3PRE A;  3C98 A;  4NAC A;  3FY4 A;  3EU5 A;  3W9F A;  4HI8 A;  2R17 C;  2VGX B;  1HE8 A;  1HG2 A;  3D9O A;  3TG5 A;  3U64 A;  1TN6 A;  2OV8 A;  3PEU B;  5ENP D;  3C5R A;  3PNT B;  2R59 A;  1S64 A;  2J07 A;  4U96 D;  3S7F A;  2WPV A;  3FU3 A;  4TRQ A;  2IF4 A;  5KCM A;  2A5E A;  1KZO A;  3SFX A;  1H6O A;  2GRM A;  3CVU A;  2QYU A;  2YIN A;  2YQ8 A;  3CR3 A;  2X6I A;  4FUL A;  3TAX A;  4GA2 A;  5KWD A;  4B93 B;  1HZ4 A;  3EIJ A;  3LVQ E;  2B0O E;  3TWW A;  5ENS D;  5CBO A;  4AXH A;  1IQR A;  4GTS A;  4EBA G;  1MYO A;  3HVE B;  2Y1L E;  5FIN A;  1IHG A;  1AP7 A;  1OCR E;  3QAQ A;  5D2M C;  1N9A A;  3UI2 A;  5B1A E;  2A5U A;  1X5B A;  2ILR A;  3RJV A;  2P9P G;  1ZBP A;  3D9K A;  2NSZ A;  4OYS A;  3HXE A;  3UIN C;  1IKN D;  4JHK A;  4J6I A;  2VGY A;  3FUJ A;  1TN7 A;  3D9L A;  1HFA A;  2MHK A;  4JEU A;  4GTP A;  5JJ6 A;  2C2L A;  1SA4 A;  3CHO A;  1YYH A;  2DZN A;  1E7V A;  2KCK A;  5AN8 A;  1HG5 A;  3UTM A;  5FJY A;  2XZD G;  2AXZ A;  4B0Z A;  3TWQ A;  4F1P A;  3ISM C;  4F1S A;  3CIA A;  1EF1 C;  1Z6T A;  1UJK A;  4HNA D;  4O60 A;  3BEE A;  1O1S A;  3ZGQ A;  4DPR A;  5HRY A;  1OWM A;  4C9B B;  4U8V D;  4FHK A;  4U0S A;  4RG9 A;  3GYZ A;  1O1T A;  5EKQ D;  4HLL A;  3T9K A;  1YA0 A;  2EIM E;  4HVB A;  5G04 J;  3VLD A;  2AW6 A;  3CVW A;  3IHV A;  3EUV A;  1HS6 A;  4HQD A;  3T5V A;  4FA6 A;  4XE0 A;  3SGH A;  4FLB A;  3UIO C;  4J8D A;  3CVY A;  3CVP A;  5B3S E;  2HM8 A;  3UX4 A;  2X6K A;  3PUJ A;  3V30 A;  3MJW A;  4KZ0 A;  1N4R A;  3UT4 A;  4J8F A;  4JC8 A;  5EIB E;  3KSL A;  5ANR A;  1D9S A;  3B7R L;  3FHE A;  5AQB A;  2J08 A;  4WNF A;  4JB8 P;  4M3O A;  4BWR A;  4TUU A;  4LSZ E;  4L23 A;  4L2L A;  5J90 A;  1OWO A;  4JHR A;  4H7Y A;  4EZK A;  4HRM B;  5JJ7 A;  5J08 A;  4N3C A;  4TUM A;  5BW8 C;  2GRQ B;  2RKK A;  2IY0 C;  3FUI A;  4XIF A;  3FTU A;  3QAR A;  4ACL A;  2VYI A;  4A1S A;  3L13 A;  1W3B A;  4LRZ A;  4C0M A;  5CCM A;  3IV0 A;  3AS4 A;  1Y6I A;  4R7L A;  1Z3X A;  1Z3Y A;  4LEU A;  2VSN A;  4WNG A;  3DST A;  4I1O B;  1YMP A;  4NIK A;  3MEK A;  2HYZ A;  5CHE E;  3ZHE B;  1NZN A;  3VLE A;  3CKC A; 
#chains in the Genus database with same CATH homology
 4BY6 A;  3CLJ A;  1SZ9 A;  2VSX E;  3DPD A;  5C2Y A;  4JW1 A;  4A3T A;  3ZIM A;  4JL0 A;  2ION A;  1HU3 A;  4JA9 A;  4N3A A;  3B7S A;  1HX8 A;  3R7R A;  3P2B A;  1TJF A;  2AWI A;  2RD0 A;  2GRL A;  3JUI A;  3Q4A B;  1Y8M A;  3L17 A;  3P1U A;  5G05 J;  4CT0 A;  2V8S E;  3D9N A;  3ZXS A;  2PQN A;  3QNK A;  3CHS A;  4EQF A;  3QWV A;  4HOT A;  2AXV A;  3PZD A;  4U04 A;  5ARF A;  3SHF A;  2VGX A;  4JPS A;  4U0U A;  3VTY A;  4N2S A;  3PE3 A;  3TGO A;  4Q69 A;  1PY1 A;  3I4G A;  3IHY A;  4WND A;  2KZT B;  3HDX A;  4HLE A;  3CHQ A;  3KAE A;  2A4Z A;  2FBN A;  5FWQ A;  4J8E A;  3FUD A;  3FUE A;  4Y6C A;  4PDX A;  3RRU A;  4ANW A;  3BG0 B;  3PH0 C;  3PNL B;  2NXP A;  4XX5 A;  3ML9 A;  2PQR A;  4JEH A;  5DBK A;  5T8I A;  3I5P A;  4AP2 A;  1S0P A;  4CT4 A;  4YVO A;  3LY7 A;  3D3M A;  4KXK B;  5E75 A;  3URZ A;  2WMO A;  4G1T A;  5KJK A;  4PUC A;  3SBT B;  2PL2 A;  2FO7 A;  2KAT A;  3D9P A;  4UWG A;  3CK8 A;  4ILH B;  5ANL A;  2R5S A;  4DI3 A;  3O48 A;  2L0I A;  4Q94 A;  4ABN A;  3GZ1 A;  4N3B A;  3FTV A;  2V4L A;  3UQ3 A;  4FJZ A;  2PM7 A;  2OVF A;  3N71 A;  3EDT B;  4UQY A;  1H2T C;  4B94 A;  3PVL A;  2WXR A;  4EPZ A;  1ELR A;  3VTX A;  1SQM A;  4ANV A;  5FZS A;  2MOW A;  5EX0 A;  2C0M A;  2WXP A;  1GW6 A;  1HO8 A;  2KC7 A;  3ZYM A;  3FEX A;  5FT9 A;  3S2A A;  2RG8 A;  3ONL A;  3IEG A;  3OTN A;  3APF A;  1E8X A;  1E8Y A;  3HYM B;  4GYW A;  4O6F A;  2BUG A;  2X38 A;  3APC A;  3SI5 A;  4JZY A;  4URK A;  1TJC A;  4FJY A;  3L08 A;  3MKQ B;  4ILI A;  3KD7 A;  3OAW A;  3ZYK A;  1DVP A;  2Y4T A;  3FTX A;  4LUN U;  1EYH A;  3SF4 A;  2WQ7 A;  4N39 A;  3LJ3 A;  2NC9 A;  2XEV A;  3B7U X;  3CSF A;  4WUY A;  4KMO A;  3D9M A;  3LEW A;  1MQS A;  3LDZ A;  5HI7 A;  1OWP A;  3QKY A;  1ZU2 A;  2I1J A;  4AM9 A;  4XI0 A;  2XRY A;  3OXF A;  3QWW A;  3SZ7 A;  3KEZ A;  5FZR A;  3ASF A;  4PS3 A;  3FWV A;  3HVE A;  5LCW C;  3S7J A;  1OWL A;  1KT1 A;  1UW4 B;  1H0A A;  3ZVV A;  3T5X A;  4W9R A;  5AIJ A;  2L6J A;  2XPZ A;  4AVX A;  1PC2 A;  3VLF A;  1ELK A;  3U66 A;  4F3V A;  1JWF A;  2Q7F A;  3CV0 A;  3LVR E;  4UWK A;  4YVQ C;  3RK6 A;  2CFZ A;  4L2Y A;  4QFV A;  2LO6 A;  4XI9 A;  5BV1 A;  5A23 A;  3FU5 A;  3U9W A;  1WAO 1;  1JWG A;  4PH4 B;  4WAF A;  3FUH A;  4RVB A;  4I9C A;  1B89 A;  2X6H A;  3U3W A;  3ZN3 A;  4CEM A;  4MKT A;  5CCL A;  3ENE A;  3PS6 A;  3PRZ A;  5G04 C;  4AEZ C;  4HXI A;  2V0P A;  1SZA A;  2HO1 A;  3CVL A;  3IKO B;  4P29 A;  1N52 A;  3D9J A;  5BT1 A;  3ZEF A;  2FF4 A;  3FFL A;  3MV2 B;  4J0U A;  4GZ3 A;  2LAI A;  4BT9 A;  2IOL A;  2VJ8 A;  4B8A A;  5KJN A;  2OOE A;  1EDU A;  4HS2 A;  4GML A;  4HOQ A;  4APO A;  3CK7 A;  3OXL A;  1A17 A;  3NF1 A;  3BG1 B;  5FQ7 A;  3ZPJ A;  4AY5 A;  1NA0 A;  4APF A;  4C0E A;  3QWP A;  1IQU A;  3FH7 A;  4PS8 A;  3SBS A;  4TV3 A;  3PUK A;  2KCV A;  1E90 A;  4UWF A;  4I17 A;  3FU0 A;  3QK0 A;  2FUL A;  5FTP A;  2VTB A;  5LOZ A;  1N54 A;  5FQ8 A;  4ANU A;  1LF8 A;  4GYO A;  2XQ0 A;  1UJJ A;  4IRU A;  4CDN A;  1E8W A;  4GZC A;  4E85 A;  4WNE A;  5BUZ A;  4UI9 K;  3ASH A;  4G11 A;  1MHQ A;  5ENN A;  5G2N A;  3JQ1 A;  3PRE A;  3C98 A;  4NAC A;  2J4D A;  2LSV A;  3FY4 A;  4BFR A;  5JHA A;  3FP3 A;  2X6F A;  4G26 A;  4EZJ A;  2M63 A;  3B13 A;  2CG2 A;  3G2S A;  4GYY A;  3AU5 A;  5BPP A;  2XGS A;  3JQ0 A;  4NRH B;  2C0L A;  4WWP A;  2R17 C;  3MV3 B;  4GCO A;  2VGX B;  5T3R A;  1HE8 A;  3SNX A;  1HG2 A;  2I1K A;  3D9O A;  3EHN A;  4UWL A;  3TG5 A;  4CCA A;  3U64 A;  2AXU A;  2GGF A;  2OV8 A;  5D0O D;  3ESK A;  3PEU B;  1TEZ A;  4CGV A;  3ZRH A;  1UN8 A;  4AY6 A;  3NZS A;  2P58 C;  3PNT B;  5EX3 A;  2X6J A;  3CK9 A;  5KJL A;  2R59 A;  3UPV A;  2J07 A;  3S7F A;  1E8Z A;  2WPV A;  4FAD A;  3FU3 A;  2FI7 A;  4U0Z A;  2CHX A;  3HIZ A;  3E4B A;  4TRQ A;  2IF4 A;  5E76 A;  5KCM A;  2E2E A;  2XHE A;  3U4T A;  3L54 A;  4BX8 A;  1XGW A;  3ZW3 A;  5AEN A;  5LX8 A;  4UQZ A;  3SFZ A;  4A3V A;  2WXK A;  2GRM A;  3RO2 A;  3LCA A;  3GZS A;  3CVU A;  1H2V C;  4K0R A;  2WXH A;  2YIN A;  3ZYQ A;  4AOF A;  1FVH A;  2WXN A;  1JPL A;  2WXQ A;  3JCK C;  2YQ8 A;  3T8M A;  2IQC A;  2WXL A;  4GA1 A;  3CR3 A;  2QFC A;  2X6I A;  4FUL A;  3TAX A;  3Q15 A;  4JVS A;  4B89 A;  5HQ8 A;  4GA2 A;  2VSY A;  1EPU A;  4I2Z A;  5C1D A;  3CST A;  4I43 A;  4KBQ A;  1HZ4 A;  4OVV A;  3EIJ A;  4BX9 A;  1KT0 A;  4FP7 A;  4GU5 A;  3ONK A;  2YHC A;  5LFA A;  3LVQ E;  3G2T A;  5G05 C;  2GW1 A;  3FTZ A;  3FUN A;  4G24 A;  3Q47 B;  2WXI A;  4FU3 A;  4AXH A;  1BPO A;  3ASD A;  2WXM A;  4GZ5 A;  4LCT A;  4U8H A;  1IQR A;  3PE4 A;  4WWO A;  3RO3 A;  4EBA G;  3ESL A;  4IN3 B;  3CHM A;  3HVE B;  2WB2 A;  2I6H A;  1IHG A;  4PS7 A;  4RG6 A;  1E96 B;  4I2W A;  1QQE A;  2IJG X;  1PAQ A;  2KM4 A;  3QAQ A;  4DLQ A;  2XGO A;  3CVN A;  4WWN A;  5A6C A;  2DBA A;  4L7T A;  3LPZ A;  3FUF A;  4I6E A;  2A5U A;  1X5B A;  4I6J A;  2ILR A;  4KYO B;  3RJV A;  4AIF A;  4I6G A;  3Q5M A;  2X3M A;  2E0I A;  1ZBP A;  3D9K A;  1L5J A;  4JHJ A;  2NSZ A;  3NZU A;  4OYS A;  3EIQ C;  4CRW A;  3AS5 A;  1WM5 A;  3EHM A;  2J4B A;  2YHE A;  1P5Q A;  4YND A;  3L16 A;  1OUV A;  2HR2 A;  3G2U A;  4JHK A;  4J6I A;  2WXF A;  1NP7 A;  1U3D A;  2VGY A;  3FUJ A;  4UQX A;  3QOU A;  2XCB A;  4I9E A;  4I1M A;  3D9L A;  4KZC A;  1HFA A;  2MHK A;  2UY1 A;  3RRN B;  4GZD A;  4IUL A;  4JEU A;  4HOS A;  3S7B A;  5BNW A;  4U07 A;  5JJ6 A;  1OWN A;  2C2L A;  4GB9 A;  2MRI A;  2I9C A;  3AS8 A;  4MS6 A;  3CHO A;  2L0T B;  2Y4U A;  3LYA A;  3WXX A;  3UT8 A;  3ZHE A;  2CHZ A;  3L6A A;  4B8C B;  5FZQ A;  1E7V A;  2YNQ A;  2PM6 A;  2KCK A;  3PDN A;  4GA0 A;  2CHW A;  3MYV A;  4KVO A;  1HG5 A;  4AV7 A;  2VTB B;  5AJL A;  5FJY A;  2IOS A;  4GCN A;  1U3C A;  2AXZ A;  3G2W A;  2QY7 A;  3L22 A;  3QJZ A;  3UT7 A;  4B0Z A;  3O4Z A;  2LSU A;  4FHJ A;  4F1S A;  2BF0 X;  5DIZ A;  3UUX A;  5M72 A;  3GZ2 A;  3CHR A;  3MA5 A;  5JJT A;  4BTB A;  2CFU A;  3CIA A;  4GZ6 A;  1EF1 C;  2KZT A;  2WM9 A;  4FC8 A;  3FTS A;  1VDY A;  1UG3 A;  1Z6T A;  3CQG B;  3R9A B;  2AVP A;  1UJK A;  2XPI A;  5LCW J;  3QDN A;  3QB2 A;  4EEC A;  3AU4 A;  4G23 A;  4IYP A;  3BEE A;  4XKC A;  5A7D B;  3IBE A;  3ASG A;  3ZYL A;  1FCH A;  3ZGQ A;  4UI9 C;  3NQP A;  4DK5 A;  4K03 A;  4DPR A;  1OWM A;  2WQH A;  3S7D A;  4LER A;  4NQ0 A;  4C9B B;  4F7A A;  2JEK A;  2PZI A;  2EQX A;  4G25 A;  4GMJ A;  2DIW A;  4FHK A;  4JXT A;  4U0S A;  4RG9 A;  2CG3 A;  3GYZ A;  3HHM A;  4HOU A;  4KVM A;  4Q96 A;  4UWH A;  3UMV A;  4HOR A;  2J9Q A;  3MZL B;  3CVQ A;  3MKR A;  1QNF A;  5EKQ D;  3GW4 A;  3LY8 A;  4ILG A;  4N5C A;  1YA0 A;  3APD A;  3QC1 A;  5LP0 A;  3CVX A;  3TXN A;  3OXG A;  4HVB A;  5G04 J;  3EJN A;  3VLD A;  2FEZ A;  3Q49 B;  3I3N A;  2IU1 A;  2AW6 A;  1HXI A;  2VSO E;  4BSX A;  4J8S A;  3CVW A;  1QZ2 A;  3IHV A;  3FUK A;  2IFU A;  5FQ6 A;  2OVB A;  1HS6 A;  3T5V A;  2XRZ A;  4DI4 A;  4FLH A;  4AJW A;  4H7X A;  5G55 A;  4XE0 A;  3TG4 A;  4FA6 A;  4BT8 A;  4RSY A;  4DLO A;  1HF8 A;  3ML8 A;  2Y3A A;  3SGH A;  4FLB A;  5D0Q D;  1XNF A;  2XCC A;  3FH5 A;  3FTY A;  3MKQ A;  4BTA A;  4F53 A;  2WQ6 A;  4KT6 B;  4J8D A;  4ME2 A;  3LY9 A;  3CVY A;  3CVP A;  5KJM A;  2UWJ G;  5FQ4 A;  2HM8 A;  2WXO A;  4ATG A;  1H2U A;  2X6K A;  3PUJ A;  3UX4 A;  2KCL A;  3MJW A;  2WXG A;  4KZ0 A;  4MRU A;  3UT4 A;  4J8F A;  4JC8 A;  4CDR A;  1UN9 A;  3CEQ A;  3DBS A;  3JYS A;  5ANR A;  3B7R L;  5EDS A;  3FUL A;  4OVU A;  3FHE A;  3FEY A;  2J08 A;  2L9B A;  3I4R B;  4WNF A;  3MX3 A;  4NUR A;  3RIB A;  3SD5 A;  4M3O A;  2WXJ A;  5CMY A;  1ELW A;  4CDM A;  1INZ A;  2LAH A;  4TUU A;  2LNI A;  4BWR A;  3RKV A;  4L23 A;  3LKU A;  3LXU X;  3ULQ A;  4D10 C;  4V3I A;  4ANX A;  4XKB A;  3FTW A;  2V5F A;  3FDH A;  4L2L A;  3TL5 A;  3CKB A;  5T4Y A;  5JHB A;  5J90 A;  3TJP A;  5AJD A;  1JUQ A;  3D9I A;  3FUM A;  4U63 A;  1OWO A;  2WVI A;  3CGH A;  3FU6 A;  2J49 A;  1H19 A;  4JHR A;  4Y6W A;  4H7Y A;  4XZ4 A;  4EZK A;  4I1A A;  2I2O A;  1IYG A;  3CQC B;  4G2V A;  3RRM B;  3RU0 A;  5JJ7 A;  4GAA A;  5J08 A;  4N3C A;  3B7T A;  3TXM A;  4HFG A;  5BW8 C;  3FUI A;  1KLX A;  3LS8 A;  4MLP A;  4UI9 J;  4XIF A;  4N2Q A;  4GPK A;  1HH8 A;  3FTU A;  3CVV A;  3QAR A;  4ACK A;  4ACL A;  2WMN A;  2J09 A;  1FVF A;  2XGM A;  2VYI A;  3ZFW A;  2DCP A;  3L13 A;  4A1S A;  1W3B A;  2BTD A;  4LRZ A;  4A1G A;  3R7Q A;  4C0M A;  5BV0 A;  5CCM A;  3IV0 A;  4E6H A;  3CHP A;  2ZU6 B;  3AS4 A;  1Y6I A;  4R7L A;  4DJA A;  5ARG A;  2UY1 B;  1Z3X A;  3K9I A;  4JA7 A;  1Z3Y A;  4LEU A;  2VSN A;  2OND A;  2XPY A;  5CMW A;  4WNG A;  1H6K A;  1WY6 A;  1DNP A;  4I1O B;  4L1B A;  4EBA A;  3KS2 A;  4CGW A;  5AYW D;  3MEK A;  3MGB A;  2HYZ A;  1E7U A;  3PEV B;  3G2V A;  1NA3 A;  3MCX A;  5CHE E;  3ZHE B;  1NZN A;  3FH8 A;  2VQ2 A;  4A55 A;  4EZL A;  3VLE A;  2JLB A;  3CKC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...