1WY6A

Crystal structure of hypothetical protein [st1625p] from hyperthermophilic archaeon sulfolobus tokodaii
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
161
structure length
159
Chain Sequence
b'EIIRKLMDAKKFLLDGYIDEGVKIVLEITKSSTKSEYNWFICNLLESIDCRYMFQVLDKIGSYFDLDKCQNLKSVVECGVINNTLNEHVNKALDILVIQGKRDKLEEIGREILNEVSASILVAIANALRRVGDERDATTLLIEACKKGEKEACNAVNTL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords hypothetical protein ST1625
publication title The first crystal structure of an archaeal helical repeat protein.
pubmed doi rcsb
source organism Sulfolobus tokodaii
molecule tags Structural genomics, unknown function
total genus 59
structure length 159
sequence length 161
ec nomenclature
pdb deposition date 2005-02-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09205 DUF1955 Domain of unknown function (DUF1955)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.350 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 1wy6A00
1WY6A
chains in the Genus database with same CATH superfamily
4I17A 1HX8A 1OCZE 4U8HA 5AQ9A 2ETAA 3TG5A 5T8IA 5ANRA 3ZYKA 4W9RA 4XZ4A 3UT7A 4EBAG 2PQRA 3ESLA 1TN8A 1JCQA 2P9LG 5CHEE 4GTVA 4HLEA 2ONDA 5AAOA 2P9NG 1ZU2A 4Q96A 2WQ7A 2P58C 3ZRHA 3MV2B 4B94A 3UMVA 1XNFA 5KCMA 3LY8A 2LXLA 3E32A 1BLXB 3L16A 3QKYA 3UKRG 3D9MA 1JWGA 2V5FA 4MKTA 4E85A 3ASOE 3UM3A 4HRMB 4UWLA 4GPKA 3L08A 3CKBA 4UWHA 4WNDA 2X6FA 1N94A 4GTRA 2WMNA 1NL4A 2XEEA 3N71A 4PH4B 4N2QA 3R9AB 4N39A 2QYJA 3O48A 2IJGX 1EDUA 3Q47B 3HIZA 3SFXA 3NZUA 1X81A 4CGWA 2EILE 4B8CB 3NOCD 5JJ6A 3P2BA 4LRZA 5D66A 1TEZA 3B7RL 2AW6A 2BKKB 2P9KG 2WVIA 4JL0A 2KZTB 3ZYLA 4J8EA 4RG9A 4KMOA 4GA1A 4I2ZA 2MYOA 2XGSA 4CT4A 3UIPC 1SZAA 4HLLA 2L0IA 3GZ2A 1E7VA 3E33A 1KPSB 3SFZA 2FEZA 4AVXA 1N4PA 3SZ7A 3JCKC 3FTXA 2QC9A 4N3CA 4QQIA 3AAAC 2C0LA 3TWUA 3E4BA 2X6IA 2LO6A 4OAUC 4N5QA 3CHPA 2V5QC 3VLFA 3HDXA 5KNHD 1UJKA 3EDTB 3KAEA 3CK9A 3BUAA 3CQCB 4C9BB 4CEMA 1YCSB 4G11A 1BD8A 1HE8A 3ZUVB 3ULYA 1K3ZD 3ASGA 1OWPA 1K8KG 2A5UA 2DVWA 2NXPA 2KCKA 5ANLA 1N52A 3PZDA 3SNXA 4DX1A 4U8VD 4FADA 4KYOB 1TNOA 1S64A 4A63B 4YDOA 5DBKA 3CVYA 5JJ7A 1JWFA 5BPPA 4JD2G 1IXVA 4A3VA 3T9KA 3L17A 2ILRA 3LYAA 3QWWA 4HVBA 4L9PA 3QC1A 1HG2A 2LUHA 2J8SD 3UTMA 2XRZA 1Y8MA 4JC8A 1AWCB 3VTYA 3HXDA 1HG5A 3QOUA 4UQZA 3ISMC 3LXUX 4GZDA 1KLXA 2BTDA 2XS8A 1H2VC 2V4HC 5D0OD 4J0UA 4BT8A 3EIQC 4O1OA 2B0OE 4GYYA 2HYZA 2WXNA 2NSZA 4LNGA 3DSTA 1KZPA 4GYWA 3APCA 3ZKJA 4ACKA 2RFMA 2ZXWE 3LVQE 2GRLA 3LKUA 4XE0A 4A3TA 4YDEA 1KZOA 1VDYA 1SQMA 4CT0A 3GZSA 1TJCA 3DPYA 4APOA 5B1AE 2PM7A 4TXRA 3RSEG 1MX6A 3FUNA 2LSUA 1DC2A 2WB2A 1INZA 3ASNE 1TJFA 4HB5A 1MJ0A 1NZNA 5EDSA 3L9TA 2QYUA 4DK5A 2WXHA 4CRWA 2A5EA 4FHJA 5CEDB 3FUEA 3BG1B 1LTXA 3LCAA 2YHCA 4AEZC 3TWQA 3HRAA 4ATZD 1SA4A 4F6RD 3G2VA 3MA5A 3TL5A 4PS7A 5A6CA 5ENOD 4YDYA 4GCOA 1OWNA 3MEKA 4YVQC 3ZXPA 4ILIA 3D9JA 4K5CA 3HHMA 3LPZA 2JEKA 1JCRA 3IBEA 1EPUA 4J8DA 3U66A 4F1PA 1MQSA 3RJVA 2AXVA 1P5QA 3E34A 4RLYA 4OVUA 3B7TA 2VTBB 2J49A 3J5PA 1UN9A 2YHEA 1IYGA 1LD8A 5DIZA 3DEPA 4HI9A 2I1KA 4DI3A 5A23A 2KBXA 1TNUA 2V8SE 3R7QA 2UWJG 5CRVA 3PZ4A 3FUJA 3V2XA 4CDNA 5J08A 5BV0A 3BEEA 3FTUA 5G2NA 2M63A 1PAQA 4U0SA 2DZNA 5LP0A 4ANWA 1N11A 1FCHA 3EHQA 4BESA 3BQOA 5CMYA 3T5XA 3Q7FA 3HXCA 3UINC 5AENA 2GRMA 3EUVA 3JXIA 3TAXA 3V79K 1OUVA 3S7DA 3FU6A 4HRLA 1OY3D 5ENSD 2X6HA 5EIBE 5FTPA 3Q49B 4U8YD 1KT0A 1N4SA 3I4GA 2FULA 3R9MA 4F3VA 1WDYA 3CVNA 2YQ8A 3JXJA 3BG0B 2R03A 3C3OA 3MKQA 1ELKA 4NACA 4J8SA 1QBQA 3AG2E 4LG6A 3CVVA 3APFA 3UIOC 3CVLA 5KBAA 3L6AA 3G2SA 4C48B 2DWZA 2RG8A 4GTSA 4K5AB 4XIFA 3SBTB 3F6QA 2BF0X 2WPVA 4I1MA 3ABME 3DEOA 3MCXA 5ENRD 1W3BA 1LF8A 3BU8A 1XGWA 3KEZA 3FTWA 4YVOA 2VYIA 1YMPA 5D0QD 4F1SA 2XCCA 2E0IA 1JCSA 5KJNA 4GMRA 4IYPA 3CSFA 4ME2A 2BUGA 3EU9A 4LNUD 1EF1C 4LUNU 3DBSA 4G8LA 3ZFWA 4V3IA 3Q75A 3IEGA 3CVWA 2F0YA 2LAIA 4G2VA 2DYSE 4ILGA 3DWLG 4BETA 2AXUA 2XCBA 2LNIA 5J90A 2MOWA 4TXPA 1JPLA 2VGXB 4BT9A 4CYMD 2WXKA 2XPIA 2WXRA 3FUIA 4FP7A 2PL2A 5H7PA 2OVBA 4I1AA 2Y1LE 4RG6A 4EECA 3TWXA 3CHMA 4B89A 3CKCA 3UM1A 2IU1A 3TGOA 3X2QE 3FP3A 3HG0D 4AY5A 4L2LA 3ZHEB 1O1RA 5AQ7A 1SVXA 4AV7A 3QWPA 5KJKA 4EBAA 2BEDA 1TNZA 4K0RA 2UY1A 4JHKA 5CBNA 5AQBA 2WXGA 5KJLA 3CVXA 1IQUA 3SGHA 3FHEA 3GZ1A 3UI2A 4HI8A 3ZU7B 1D8DA 3L22A 3MJWA 2L0TB 4FJYA 4L7TA 4RQIA 1OCOE 3PDNA 3FU3A 2CFUA 1N9AA 5HKPA 2XEVA 2IO3C 3QAQA 2GRNB 3FU5A 3ZYQA 2IONA 5LCWC 4UI9C 3GYZA 3DXMG 3ZGQA 5AQAA 2H6FA 4A55A 2FF4A 4DLOA 5G05J 3CVPA 4GCNA 3CSTA 4L23A 1NFIE 4IRUA 4KZCA 4K03A 2HE0A 3NF1A 4U0UA 3FTVA 3C5RA 2OVFA 4HOTA 4DLQA 3EIJA 2FBNA 4EHMA 3V2OA 4JHJA 2XZTG 4CDRA 3HVEA 4L1BA 1E8ZA 4G26A 1LD7A 5FZQA 1G3NB 3UT8A 2ETCA 4GZCA 2WXPA 1HO8A 3RKVA 3MV3B 3ENEA 4WNEA 2FO7A 4LERA 3B7BA 4I43A 3KSLA 5IY5E 5KNGA 4JPSA 3PUJA 3AS5A 4NIKA 3DPDA 4ACLA 3EHRA 4Q94A 3CHOA 5FIOA 2EIKE 4GPMA 3PEUB 3QWVA 3JQ0A 5G04C 2V4LA 4XI9A 4JHRA 2XS1A 1Q2ZA 3NAWA 1H6OA 2Y69E 4DUIA 3PEVB 1N4RA 2KM4A 1H6PA 4BERA 5BUZA 4GMLA 5AJLA 3PE4A 2P9IG 3TXNA 2XPZA 5E76A 4OAVB 2IOLA 1QQEA 4XEIG 2WXMA 1FVFA 4CCAA 2JABA 5FZRA 1DNPA 3UM0A 5LCWJ 2F8YA 4UI9J 4JZYA 5EN5D 5ARGA 2C0MA 5D2MC 5CRUA 5CERB 1SA5A 1NA0A 2XHEA 2E2EA 2H6HA 3SHFA 3U9WA 2OEVA 3LS8A 5EYPF 3D9PA 2GW1A 1DCQA 5ENTD 2WM9A 2H6GA 4EZKA 4Y6WA 2R59A 2X6JA 4XI0A 4CDMA 4U04A 4UUCA 1OCCE 4FU3A 2CFZA 4TUMA 3FH7A 2HR2A 2WMOA 4DJAA 4I9CA 3NZSA 1SZ9A 2WXLA 3D9KA 3EHNA 2ZISA 1UN8A 1H2TC 4J8YA 2DYRE 2IFUA 3U4TA 4GAAA 4UI9K 4E6HA 2GRQB 3PH0C 1H19A 3HVEB 1OT8A 1V54E 2DIWA 3J5QB 3ZN3A 4MBGA 2R05A 1H6KA 2WQHA 3WXXA 5CEAA 4DPRA 4U96D 1TNBA 5G04J 3FUHA 4RVBA 4I2WA 5B1BE 3PZ2A 3APDA 2Q7FA 1A17A 5KWDA 3FFLA 4JW1A 4AOFA 4ANVA 2ETBA 1S63A 4UQXA 3EHMA 3UQ3A 4BY6A 2MRIA 4BSZB 4YDWA 2I1JA 3RAUA 4X8QA 2YNQA 3B7SA 3FTYA 4DX5D 4GTQA 2X3MA 2L6JA 1N95A 4O1PA 5BNWA 2BKGA 5G55A 4KXKB 2H6IA 2JLBA 1K1AA 4D10C 3QK0A 2EQXA 1E7UA 3AG1E 4N3BA 3RRNB 5CECB 2XENA 3CHRA 4U07A 2Y3AA 3MKRA 2X6KA 4N5CA 5JHAA 2V0PA 4K5BA 3IV0A 3LJNA 5T4YA 1BU9A 4ABNA 4EZLA 3TWSA 4GTTA 2WXIA 3ZXSA 4ZFHA 5FT9A 3SBSA 3FUDA 2F37A 5AYWD 3C3RA 3UUXA 2VGEA 1FPPA 2WXOA 1YA0A 3DSSA 4GA0A 4L2YA 4KBQA 3TJPA 4BSXA 4U95D 2NYJA 2LAHA 3ASFA 4WWOA 4JA7A 3R7RA 2J4BA 1EYHA 2VGYA 3D9OA 4HOUA 3SO8A 1OWLA 4F7AA 1IQRA 4I6EA 2CHZA 1WAO1 4HBDA 3D9NA 4HQDA 2EIME 3UT4A 3D9LA 5CMWA 2XPYA 2LXMA 3EJNA 3PVLA 5EYLA 4DX6D 5AN8A 3QDNA 2IOSA 4EZJA 3SY2A 1Z5SC 3ONLA 2OEWA 5EILA 4AIFA 5FQ7A 3UKUG 3DSWA 5EX3A 4AY6A 5CCMA 2FI7A 4G24A 2XQ0A 5C2YA 4TXQA 4MLPA 3VLDA 1U2VG 1ELRA 3KS2A 3FEYA 4KVOA 3CHSA 3ZEFA 2C2LA 2GGFA 3AS8A 3Q9UC 2PM6A 1BI8B 2B6CA 3C3QA 4Z68A 1IKND 3QJZA 3RIBA 3SF4A 4Q69A 1KT1A 1MX2A 1TYQG 2L9BA 2VJ8A 3O4ZA 3MGBA 4DX2A 3NBNB 4P29A 4PDXA 5BV1A 1HF8A 1N54A 1WM5A 4Y6CA 4B0ZA 1NI1A 4BTBA 3QARA 4J8FA 3FDHA 1MYOA 2IQCA 3NB2A 2IF4A 2J07A 3FWVA 4G1TA 5G05C 4WAFA 4FJZA 3PZ1A 3RRMB 2KZTA 4KZ0A 3FULA 3RRUA 4GU5A 3SI5A 3KSQA 4UWFA 2PZIA 3JUEA 4ANXA 3CGHA 2HO1A 3FEXA 3Q5MA 4NURA 2KC7A 4OVVA 4WWNA 3TWRA 4AXHA 3QNKA 1YYHA 2J09A 5HS0A 2GROB 4DX7D 4DRXE 3W9FA 1Z3YA 4FLHA 2R5SA 3K9IA 4BEPA 3ZVVA 5JHBA 4KT6B 3TWWA 4A1SA 1FT1A 4UWKA 1NA3A 3ZPJA 2Y4TA 5AIJA 3S7JA 4UWGA 1GW6A 3ULQA 1QZ2A 4HFGA 4B8AA 3HXFA 3ZIMA 2IEJA 3KEAA 3VTXA 2CHWA 2R02A 3ML9A 1FT2A 4M7CA 3DRAA 2J4DA 5HRYA 3CQGB 1MHQA 1OXJA 2Y0BG 3V30A 1L5JA 2F8XK 1A5EA 3CK7A 2L6BA 3I5PA 5FINA 4NQ0A 1D8EA 3CVQA 2WXFA 2PQNA 5HQ8A 2QFCA 4HOSA 4H7XA 4WUYA 3AU5A 4LNBA 3MKQB 4ZHBA 4LCTA 1H2UA 3AG3E 1OWOA 2HM8A 2J08A 4J6IA 2XZDG 2NC9A 4AJWA 2AWIA 4FC8A 3CV0A 5JA4D 5HI7A 3FU0A 4FULA 4XKBA 3TXMA 1WY6A 2GRPB 3D9HA 3HXEA 2DBAA 5JJTA 2AVPA 4GTMA 4PS8A 5FZSA 3TWVA 1O5MA 4R7LA 1MX4A 3G2WA 3ASDA 3ESKA 2IO2C 2VSOE 1BPOA 3NOGD 4LEUA 4BWRA 3AG4E 4OYSA 2R17C 3RO2A 3S2AA 2I6HA 1ELWA 3S7BA 3U3WA 1QNFA 3PNTB 1S0PA 1WG0A 3CLJA 4JA9A 4B93B 2Y4UA 5BW8C 3MX3A 5ENQD 5AARA 2YINA 3LEWA 4G23A 3MYVA 4JXTA 3UPVA 1HH8A 3UXGA 3VLEA 2RKKA 4HS2A 5FQ4A 5BXUA 4GZ3A 3IHYA 1IHGA 1SW6A 4J7WA 3LJ3A 4GB9A 1FVHA 2EIJE 4WNFA 3TG4A 1HXIA 1IHBA 2AJAA 1E90A 5A7DB 4F53A 3HYMB 4GA2A 5BXOA 3ASHA 2P9PG 4CGVA 1ZB1A 2UY1B 2VSXE 3S7FA 3FH5A 4N3AA 3C72A 3C98A 3PS6A 3LY7A 4XX5A 2VTBA 1HFAA 1HU3A 5EIDA 3HXBA 2KCLA 5ARFA 3W9GA 1N4QA 5E75A 1UG3A 1UW4B 2ZIRA 4ANUA 2DZOA 3ML8A 2VSYA 1Z6TA 3Q73A 1DVPA 4O60A 1X5BA 5EX0A 3LVRE 4YNDA 2ZGDA 4C0MA 3FUMA 4IULA 2CG3A 3DSVA 2WXQA 3E30A 4ATGA 3I4RB 4TRQA 5JMND 1O1SA 3ZYMA 2CHXA 3FY4A 4APFA 3OTNA 3FH8A 3RK6A 1TR4A 1TN6A 2WQ6A 4JVSA 1E8XA 3PUKA 4I9EA 4M3OA 4WWPA 4MS6A 2ZGGA 3B95A 4I6JA 1HZ4A 4HXIA 3PE3A 2VQ2A 3PZ3A 3IXEA 1K1BA 3CK8A 5AJDA 3AU4A 3CIAA 1JUQA 1S70B 4MRUA 3FUKA 3DSXA 1N0QA 3G2TA 4KVMA 4N2SA 5C1DA 4H7YA 4U63A 4BX9A 2FO1E 4ILHB 2WXJA 5FWQA 3Q9NC 5FJYA 4HRNA 1U3DA 4U0ZA 4G8KA 3I3NA 4WNGA 4DI4A 3T5VA 1E96B 2GRRB 5B3SE 4O6FA 2EINE 1TNYA 2ZU6B 4EPZA 4BX8A 1UJJA 2CG2A 3PRZA 3PNLB 5CCLA 3TWTA 1HS6A 3UM2A 1OCRE 3FTSA 3B13A 1D9SA 3ABLE 3QB2A 3KD7A 1Y6IA 4FLBA 3DXKG 4BTAA 2RFAA 3T8KA 4GZ6A 3JQ1A 3ONKA 3Q79A 2IY0C 2XGMA 3LDZA 4HOQA 5FQ8A 1B89A 4I1OB 1OWMA 3LY9A 2A4ZA 2P2CP 2P9SG 3Q4AB 2RD0A 4G25A 5LFAA 4PS3A 5KJMA 3OXLA 1ZBPA 2J9QA 3D3MA 2VGXA 3WG7E 3AJIA 5BT1A 3E37A 4GZ5A 3NQPA 5M72A 3MZLB 5T3RA 3IHVA 4TV3A 2KXPC 2OV8A 3CEQA 3L13A 3CVUA 4IN3B 3AS4A 4I6GA 4GTPA 4HNAD 4UQYA 1AP7A 5LOZA 4URKA 5EKQD 2AXZA 2R2LA 2X38A 2LSVA 4EQFA 3URZA 1N0RA 3ZHEA 1NP7A 4RSYA 4BFRA 5LX8A 5FQ6A 1PC2A 3Q7AA 2P9UG 1MZCA 4AP2A 4QFVA 4U7EB 4NRHB 3PREA 4A1GA 5CBOA 1QYMA 1H0AA 1Z3XA 3GW4A 3SQVA 2XRYA 2VSNA 3L54A 3P1UA 5ENPD 3ULEG 2QZAA 4TUUA 2XEHA 2I9CA 1RZ4A 4LSZE 3FTZA 3ABKE 4AM9A 4GMJA 3JYSA 3RU0A 4JEUA 2OOEA 5ENNA 3Q78A 2MHKA 3U64A 3OAWA 2XGOA 4JEHA 1UOHA 3ZNGA 3OXFA 3ZW3A 2I2OA 4HORA 3CR3A 1V55E 4JB8P 2OCCE 3T8MA 3UX4A 1RW2A 3G2UA 3SD5A 3FUFA 3CHQA 4FA6A 3B7UX 2KCVA 3Q15A 1DCEA 4FHKA 2QY7A 3JUIA 1PY1A 1TN7A 3EU5A 2PNNA 2KATA 1E8WA 3DSUA 4GTOA 3SFYA 4C0EA 5ITZF 2DCPA 4PUCA 4CZ2D 3L82A 3V31A 3IKOB 3D9IA 1BI7B 3OXGA 1E8YA 1U3CA 1O1TA 4GYOA 4XKCA 3RO3A
chains in the Genus database with same CATH topology
4I17A 1HX8A 1H6KA 4U8HA 2WQHA 3WXXA 2YINA 3LEWA 4G23A 3MYVA 4JXTA 3TG5A 3UPVA 5T8IA 4DPRA 5AENA 5ANRA 1HH8A 3ZYKA 4W9RA 4XZ4A 3UT7A 3VLEA 2PQRA 4EBAG 3ESLA 5G04J 2GRMA 3FUHA 4RVBA 4I2WA 4HS2A 5FQ4A 3APDA 3TAXA 2Q7FA 1A17A 4GZ3A 5CHEE 1OUVA 3S7DA 3FFLA 3IHYA 4JW1A 4AOFA 4HLEA 2ONDA 3FU6A 4ANVA 1IHGA 1ZU2A 4UQXA 3EHMA 4Q96A 3UQ3A 2WQ7A 2X6HA 4BY6A 2MRIA 2P58C 5FTPA 3Q49B 3ZRHA 3MV2B 1KT0A 3LJ3A 4B94A 2I1JA 1FVHA 4GB9A 3UMVA 3I4GA 2FULA 1XNFA 4WNFA 2YNQA 3B7SA 3TG4A 4F3VA 5KCMA 3CVNA 3FTYA 1HXIA 3LY8A 2X3MA 2YQ8A 2L6JA 1E90A 5A7DB 3BG0B 3L16A 3QKYA 4F53A 5BNWA 3HYMB 3D9MA 4GA2A 3MKQA 4KXKB 5G55A 1JWGA 1ELKA 2V5FA 4NACA 3ASHA 4J8SA 2JLBA 4MKTA 4E85A 4D10C 4CGVA 3QK0A 2EQXA 1E7UA 2UY1B 2VSXE 3S7FA 4N3BA 3RRNB 3FH5A 4N3AA 3CVVA 3CHRA 3APFA 3CVLA 3C98A 3PS6A 3LY7A 4UWLA 4U07A 4GPKA 2Y3AA 3MKRA 1HFAA 2X6KA 3L6AA 4XX5A 1HU3A 4N5CA 2VTBA 3G2SA 5JHAA 2RG8A 3L08A 2KCLA 3CKBA 4XIFA 2V0PA 5T4YA 3IV0A 5ARFA 4UWHA 4ABNA 3SBTB 4EZLA 4WNDA 2X6FA 2WXIA 5E75A 3ZXSA 1UG3A 1UW4B 2BF0X 5FT9A 3SBSA 3ML8A 3FUDA 2WMNA 4ANUA 2WPVA 2VSYA 4I1MA 1Z6TA 1DVPA 3N71A 5AYWD 1X5BA 5EX0A 4PH4B 3LVRE 4N2QA 3UUXA 4YNDA 3MCXA 3R9AB 1W3BA 4N39A 1LF8A 2WXOA 3FUMA 1XGWA 3O48A 4C0MA 2IJGX 1YA0A 4IULA 1EDUA 3Q47B 3KEZA 4GA0A 3HIZA 3NZUA 3FTWA 4KBQA 4L2YA 3TJPA 4CGWA 4YVOA 2CG3A 4B8CB 4BSXA 2VYIA 5D0QD 2WXQA 5JJ6A 4ATGA 2XCCA 4F1SA 2E0IA 3P2BA 4LRZA 3I4RB 5KJNA 4TRQA 2LAHA 1TEZA 4IYPA 3CSFA 4ME2A 2BUGA 3ZYMA 3ASFA 2CHXA 3B7RL 4WWOA 1EF1C 3FY4A 4LUNU 3DBSA 2AW6A 4JA7A 2WVIA 4JL0A 3R7RA 2KZTB 3ZYLA 4J8EA 3ZFWA 4RG9A 4APFA 4KMOA 2J4BA 4GA1A 1EYHA 4I2ZA 4V3IA 2VGYA 3OTNA 3D9OA 3IEGA 3FH8A 4HOUA 2XGSA 4CT4A 3CVWA 1SZAA 1OWLA 3RK6A 4F7AA 1IQRA 2L0IA 2CHZA 1WAO1 3GZ2A 4I6EA 1E7VA 3D9NA 2WQ6A 4JVSA 2LAIA 1E8XA 4G2VA 3PUKA 4ILGA 4I9EA 3SFZA 3UT4A 2FEZA 4M3OA 3D9LA 4AVXA 4WWPA 2AXUA 4MS6A 2XCBA 2LNIA 3SZ7A 5CMWA 4I6JA 3JCKC 3FTXA 2XPYA 5J90A 3EJNA 1HZ4A 3PVLA 4N3CA 2MOWA 2C0LA 4HXIA 3QDNA 2IOSA 3E4BA 4EZJA 3PE3A 2VQ2A 1JPLA 2X6IA 2LO6A 2VGXB 4BT9A 2WXKA 3CK8A 2XPIA 2WXRA 3CHPA 3FUIA 4FP7A 5AJDA 3AU4A 2PL2A 3ONLA 4AIFA 5FQ7A 3CIAA 5EX3A 4AY6A 1JUQA 4MRUA 3VLFA 2OVBA 4I1AA 3FUKA 3HDXA 4EECA 3G2TA 4KVMA 4RG6A 5CCMA 1UJKA 2FI7A 3EDTB 3KAEA 4G24A 2XQ0A 3CHMA 5C2YA 3CK9A 5C1DA 4N2SA 4MLPA 3VLDA 4H7YA 1ELRA 4B89A 3CQCB 3CKCA 4U63A 3KS2A 4C9BB 2IU1A 4BX9A 4ILHB 4CEMA 3TGOA 2WXJA 5FWQA 3FEYA 4KVOA 3CHSA 4G11A 3FP3A 5FJYA 1HE8A 3ZEFA 4L2LA 4AY5A 2C2LA 3ZHEB 3ASGA 1U3DA 1OWPA 2GGFA 2A5UA 4AV7A 2NXPA 3QWPA 3AS8A 4U0ZA 2KCKA 4EBAA 5KJKA 5ANLA 2PM6A 1N52A 3T5VA 3I3NA 3PZDA 4K0RA 4WNGA 3SNXA 2UY1A 4JHKA 4DI4A 2WXGA 5KJLA 3QJZA 4FADA 3CVXA 1E96B 4KYOB 3RIBA 1IQUA 3SF4A 3SGHA 3FHEA 4Q69A 3GZ1A 5DBKA 3CVYA 1KT1A 4O6FA 5JJ7A 1JWFA 2ZU6B 5BPPA 3L22A 3MJWA 2L0TB 2L9BA 2VJ8A 3O4ZA 4EPZA 4FJYA 3MGBA 4A3VA 1UJJA 2CG2A 4L7TA 4BX8A 3PRZA 3PDNA 3PNLB 5CCLA 4P29A 3FU3A 4PDXA 2CFUA 5BV1A 3L17A 1HF8A 2ILRA 3LYAA 1N54A 1WM5A 3QWWA 1HS6A 4Y6CA 4B0ZA 4HVBA 4BTBA 3QARA 3QC1A 1HG2A 2XRZA 1Y8MA 4J8FA 2XEVA 4JC8A 3FTSA 3B13A 3FDHA 3QAQA 2IQCA 3VTYA 3QB2A 3KD7A 3FU5A 1HG5A 3T5XA 3QOUA 4UQZA 3ZYQA 2IONA 5LCWC 2IF4A 2J07A 3FWVA 4UI9C 3GYZA 3ZGQA 1Y6IA 3LXUX 4FLBA 4A55A 4G1TA 4BTAA 4GZDA 2FF4A 5G05C 1KLXA 4DLOA 4GZ6A 5G05J 3CVPA 2BTDA 3JQ1A 4WAFA 3ONKA 4FJZA 1H2VC 4GCNA 3RRMB 3CSTA 2KZTA 4L23A 2XGMA 4KZ0A 4IRUA 5D0OD 4KZCA 4J0UA 3LDZA 4BT8A 4HOQA 3FULA 4K03A 3RRUA 3NF1A 4GU5A 4U0UA 3FTVA 1B89A 5FQ8A 3SI5A 4I1OB 3EIQC 4UWFA 1OWMA 3LY9A 2OVFA 4HOTA 2PZIA 4DLQA 4ANXA 3EIJA 2A4ZA 3CGHA 2HO1A 2FBNA 3FEXA 4GYYA 2HYZA 2WXNA 3Q5MA 4JHJA 2NSZA 4NURA 3Q4AB 2KC7A 2RD0A 4G25A 5LFAA 4PS3A 4OVVA 4WWNA 4CDRA 4AXHA 3HVEA 3QNKA 1E8ZA 4GYWA 4L1BA 4G26A 2J09A 3APCA 5FZQA 5KJMA 3OXLA 4ACKA 3UT8A 4CDMA 1Z3YA 4FLHA 1ZBPA 2R5SA 2J9QA 3LVQE 3K9IA 2GRLA 3LKUA 3D3MA 4GZCA 2WXPA 2VGXA 1HO8A 4XE0A 4A3TA 3ZVVA 5JHBA 4KT6B 3RKVA 3MV3B 5BT1A 3ENEA 1VDYA 4GZ5A 3NQPA 4A1SA 4WNEA 5M72A 2FO7A 1SQMA 3MZLB 4LERA 4UWKA 3IHVA 4I43A 1NA3A 4TV3A 5T3RA 2OV8A 3ZPJA 4CT0A 2Y4TA 3CEQA 4JPSA 3GZSA 1TJCA 3L13A 3CVUA 4APOA 4IN3B 5AIJA 2PM7A 3AS4A 4UWGA 3PUJA 3AS5A 4I6GA 3S7JA 1GW6A 3ULQA 3DPDA 1QZ2A 4UQYA 3FUNA 4HFGA 2LSUA 4ACLA 5LOZA 4B8AA 2WB2A 4Q94A 4URKA 5EKQD 3CHOA 3ZIMA 2AXZA 1INZA 2X38A 2LSVA 3PEUB 3QWVA 4EQFA 1TJFA 3JQ0A 3URZA 5G04C 2V4LA 1NZNA 3ZHEA 1NP7A 4XI9A 4RSYA 3VTXA 5EDSA 4JHRA 4BFRA 5LX8A 2CHWA 4DK5A 5FQ6A 1PC2A 2WXHA 3ML9A 4CRWA 4FHJA 4AP2A 2J4DA 3FUEA 3BG1B 4QFVA 4NRHB 3PEVB 3CQGB 3PREA 4A1GA 3LCAA 2YHCA 4AEZC 1H0AA 1MHQA 1Z3XA 3GW4A 2XRYA 2KM4A 1L5JA 5BUZA 4GMLA 3CK7A 2VSNA 3G2VA 3MA5A 3I5PA 5AJLA 4NQ0A 3TL5A 3L54A 3P1UA 4PS7A 5A6CA 3PE4A 3TXNA 2XPZA 4TUUA 5E76A 3CVQA 2WXFA 2PQNA 4GCOA 5HQ8A 2QFCA 1OWNA 4HOSA 2I9CA 3MEKA 4H7XA 4YVQC 3FTZA 4WUYA 4AM9A 3AU5A 4ILIA 2IOLA 3JYSA 4GMJA 3RU0A 3MKQB 3D9JA 1QQEA 4JEUA 4LCTA 3HHMA 3LPZA 2JEKA 2OOEA 2WXMA 3IBEA 1EPUA 1H2UA 1FVFA 4J8DA 5ENNA 3U66A 2MHKA 3U64A 1OWOA 2HM8A 4CCAA 1MQSA 3RJVA 2J08A 2AXVA 4J6IA 3OAWA 2XGOA 1P5QA 4JEHA 5FZRA 2NC9A 4AJWA 1DNPA 4OVUA 3B7TA 5LCWJ 2AWIA 2VTBB 4UI9J 4JZYA 4FC8A 5ARGA 2J49A 1UN9A 2C0MA 2YHEA 3CV0A 1IYGA 5HI7A 3FU0A 1NA0A 2XHEA 2E2EA 4FULA 4XKBA 3OXFA 3TXMA 5DIZA 3SHFA 3ZW3A 3U9WA 1WY6A 2I1KA 2I2OA 4HORA 3CR3A 3LS8A 3D9PA 2DBAA 4DI3A 5JJTA 2GW1A 5A23A 3T8MA 3UX4A 2AVPA 2WM9A 3G2UA 2V8SE 4PS8A 3SD5A 5FZSA 3FUFA 3R7QA 4EZKA 3CHQA 4R7LA 2UWJG 4FA6A 3G2WA 3B7UX 2KCVA 4Y6WA 2R59A 2X6JA 3Q15A 3FUJA 4XI0A 3ASDA 4FHKA 2QY7A 4U04A 3JUIA 3ESKA 4CDNA 5J08A 5BV0A 1PY1A 3BEEA 2VSOE 4FU3A 1BPOA 3FTUA 2CFZA 5G2NA 2KATA 4LEUA 1E8WA 4BWRA 2M63A 3FH7A 2HR2A 4OYSA 2WMOA 4DJAA 4I9CA 1PAQA 3NZSA 1SZ9A 4C0EA 2WXLA 4U0SA 3D9KA 3EHNA 1UN8A 2DCPA 5LP0A 2R17C 1H2TC 3RO2A 3S2AA 2I6HA 4ANWA 1ELWA 2IFUA 4PUCA 3U4TA 3S7BA 3U3WA 4GAAA 4UI9K 1FCHA 1QNFA 3PNTB 3IKOB 4E6HA 3PH0C 1S0PA 3CLJA 4JA9A 3D9IA 1H19A 3OXGA 1E8YA 1U3CA 5CMYA 4GYOA 2Y4UA 3HVEB 5BW8C 2DIWA 4XKCA 3ZN3A 3MX3A 3RO3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WY6 A; 
#chains in the Genus database with same CATH topology
 4I17 A;  1HX8 A;  1OCZ E;  4U8H A;  5AQ9 A;  2ETA A;  3TG5 A;  5T8I A;  5ANR A;  3ZYK A;  4W9R A;  4XZ4 A;  3UT7 A;  4EBA G;  2PQR A;  3ESL A;  1TN8 A;  1JCQ A;  2P9L G;  5CHE E;  4GTV A;  4HLE A;  2OND A;  5AAO A;  2P9N G;  1ZU2 A;  4Q96 A;  2WQ7 A;  2P58 C;  3ZRH A;  3MV2 B;  4B94 A;  3UMV A;  1XNF A;  5KCM A;  3LY8 A;  2LXL A;  3E32 A;  1BLX B;  3L16 A;  3QKY A;  3UKR G;  3D9M A;  1JWG A;  2V5F A;  4MKT A;  4E85 A;  3ASO E;  3UM3 A;  4HRM B;  4UWL A;  4GPK A;  3L08 A;  3CKB A;  4UWH A;  4WND A;  2X6F A;  1N94 A;  4GTR A;  2WMN A;  1NL4 A;  2XEE A;  3N71 A;  4PH4 B;  4N2Q A;  3R9A B;  4N39 A;  2QYJ A;  3O48 A;  2IJG X;  1EDU A;  3Q47 B;  3HIZ A;  3SFX A;  3NZU A;  1X81 A;  4CGW A;  2EIL E;  4B8C B;  3NOC D;  5JJ6 A;  3P2B A;  4LRZ A;  5D66 A;  1TEZ A;  3B7R L;  2AW6 A;  2BKK B;  2P9K G;  2WVI A;  4JL0 A;  2KZT B;  3ZYL A;  4J8E A;  4RG9 A;  4KMO A;  4GA1 A;  4I2Z A;  2MYO A;  2XGS A;  4CT4 A;  3UIP C;  1SZA A;  4HLL A;  2L0I A;  3GZ2 A;  1E7V A;  3E33 A;  1KPS B;  3SFZ A;  2FEZ A;  4AVX A;  1N4P A;  3SZ7 A;  3JCK C;  3FTX A;  2QC9 A;  4N3C A;  4QQI A;  3AAA C;  2C0L A;  3TWU A;  3E4B A;  2X6I A;  2LO6 A;  4OAU C;  4N5Q A;  3CHP A;  2V5Q C;  3VLF A;  3HDX A;  5KNH D;  1UJK A;  3EDT B;  3KAE A;  3CK9 A;  3BUA A;  3CQC B;  4C9B B;  4CEM A;  1YCS B;  4G11 A;  1BD8 A;  1HE8 A;  3ZUV B;  3ULY A;  1K3Z D;  3ASG A;  1OWP A;  1K8K G;  2A5U A;  2DVW A;  2NXP A;  2KCK A;  5ANL A;  1N52 A;  3PZD A;  3SNX A;  4DX1 A;  4U8V D;  4FAD A;  4KYO B;  1TNO A;  1S64 A;  4A63 B;  4YDO A;  5DBK A;  3CVY A;  5JJ7 A;  1JWF A;  5BPP A;  4JD2 G;  1IXV A;  4A3V A;  3T9K A;  3L17 A;  2ILR A;  3LYA A;  3QWW A;  4HVB A;  4L9P A;  3QC1 A;  1HG2 A;  2LUH A;  2J8S D;  3UTM A;  2XRZ A;  1Y8M A;  4JC8 A;  1AWC B;  3VTY A;  3HXD A;  1HG5 A;  3QOU A;  4UQZ A;  3ISM C;  3LXU X;  4GZD A;  1KLX A;  2BTD A;  2XS8 A;  1H2V C;  2V4H C;  5D0O D;  4J0U A;  4BT8 A;  3EIQ C;  4O1O A;  2B0O E;  4GYY A;  2HYZ A;  2WXN A;  2NSZ A;  4LNG A;  3DST A;  1KZP A;  4GYW A;  3APC A;  3ZKJ A;  4ACK A;  2RFM A;  2ZXW E;  3LVQ E;  2GRL A;  3LKU A;  4XE0 A;  4A3T A;  4YDE A;  1KZO A;  1VDY A;  1SQM A;  4CT0 A;  3GZS A;  1TJC A;  3DPY A;  4APO A;  5B1A E;  2PM7 A;  4TXR A;  3RSE G;  1MX6 A;  3FUN A;  2LSU A;  1DC2 A;  2WB2 A;  1INZ A;  3ASN E;  1TJF A;  4HB5 A;  1MJ0 A;  1NZN A;  5EDS A;  3L9T A;  2QYU A;  4DK5 A;  2WXH A;  4CRW A;  2A5E A;  4FHJ A;  5CED B;  3FUE A;  3BG1 B;  1LTX A;  3LCA A;  2YHC A;  4AEZ C;  3TWQ A;  3HRA A;  4ATZ D;  1SA4 A;  4F6R D;  3G2V A;  3MA5 A;  3TL5 A;  4PS7 A;  5A6C A;  5ENO D;  4YDY A;  4GCO A;  1OWN A;  3MEK A;  4YVQ C;  3ZXP A;  4ILI A;  3D9J A;  4K5C A;  3HHM A;  3LPZ A;  2JEK A;  1JCR A;  3IBE A;  1EPU A;  4J8D A;  3U66 A;  4F1P A;  1MQS A;  3RJV A;  2AXV A;  1P5Q A;  3E34 A;  4RLY A;  4OVU A;  3B7T A;  2VTB B;  2J49 A;  3J5P A;  1UN9 A;  2YHE A;  1IYG A;  1LD8 A;  5DIZ A;  3DEP A;  4HI9 A;  2I1K A;  4DI3 A;  5A23 A;  2KBX A;  1TNU A;  2V8S E;  3R7Q A;  2UWJ G;  5CRV A;  3PZ4 A;  3FUJ A;  3V2X A;  4CDN A;  5J08 A;  5BV0 A;  3BEE A;  3FTU A;  5G2N A;  2M63 A;  1PAQ A;  4U0S A;  2DZN A;  5LP0 A;  4ANW A;  1N11 A;  1FCH A;  3EHQ A;  4BES A;  3BQO A;  5CMY A;  3T5X A;  3Q7F A;  3HXC A;  3UIN C;  5AEN A;  2GRM A;  3EUV A;  3JXI A;  3TAX A;  3V79 K;  1OUV A;  3S7D A;  3FU6 A;  4HRL A;  1OY3 D;  5ENS D;  2X6H A;  5EIB E;  5FTP A;  3Q49 B;  4U8Y D;  1KT0 A;  1N4S A;  3I4G A;  2FUL A;  3R9M A;  4F3V A;  1WDY A;  3CVN A;  2YQ8 A;  3JXJ A;  3BG0 B;  2R03 A;  3C3O A;  3MKQ A;  1ELK A;  4NAC A;  4J8S A;  1QBQ A;  3AG2 E;  4LG6 A;  3CVV A;  3APF A;  3UIO C;  3CVL A;  5KBA A;  3L6A A;  3G2S A;  4C48 B;  2DWZ A;  2RG8 A;  4GTS A;  4K5A B;  4XIF A;  3SBT B;  3F6Q A;  2BF0 X;  2WPV A;  4I1M A;  3ABM E;  3DEO A;  3MCX A;  5ENR D;  1W3B A;  1LF8 A;  3BU8 A;  1XGW A;  3KEZ A;  3FTW A;  4YVO A;  2VYI A;  1YMP A;  5D0Q D;  4F1S A;  2XCC A;  2E0I A;  1JCS A;  5KJN A;  4GMR A;  4IYP A;  3CSF A;  4ME2 A;  2BUG A;  3EU9 A;  4LNU D;  1EF1 C;  4LUN U;  3DBS A;  4G8L A;  3ZFW A;  4V3I A;  3Q75 A;  3IEG A;  3CVW A;  2F0Y A;  2LAI A;  4G2V A;  2DYS E;  4ILG A;  3DWL G;  4BET A;  2AXU A;  2XCB A;  2LNI A;  5J90 A;  2MOW A;  4TXP A;  1JPL A;  2VGX B;  4BT9 A;  4CYM D;  2WXK A;  2XPI A;  2WXR A;  3FUI A;  4FP7 A;  2PL2 A;  5H7P A;  2OVB A;  4I1A A;  2Y1L E;  4RG6 A;  4EEC A;  3TWX A;  3CHM A;  4B89 A;  3CKC A;  3UM1 A;  2IU1 A;  3TGO A;  3X2Q E;  3FP3 A;  3HG0 D;  4AY5 A;  4L2L A;  3ZHE B;  1O1R A;  5AQ7 A;  1SVX A;  4AV7 A;  3QWP A;  5KJK A;  4EBA A;  2BED A;  1TNZ A;  4K0R A;  2UY1 A;  4JHK A;  5CBN A;  5AQB A;  2WXG A;  5KJL A;  3CVX A;  1IQU A;  3SGH A;  3FHE A;  3GZ1 A;  3UI2 A;  4HI8 A;  3ZU7 B;  1D8D A;  3L22 A;  3MJW A;  2L0T B;  4FJY A;  4L7T A;  4RQI A;  1OCO E;  3PDN A;  3FU3 A;  2CFU A;  1N9A A;  5HKP A;  2XEV A;  2IO3 C;  3QAQ A;  2GRN B;  3FU5 A;  3ZYQ A;  2ION A;  5LCW C;  4UI9 C;  3GYZ A;  3DXM G;  3ZGQ A;  5AQA A;  2H6F A;  4A55 A;  2FF4 A;  4DLO A;  5G05 J;  3CVP A;  4GCN A;  3CST A;  4L23 A;  1NFI E;  4IRU A;  4KZC A;  4K03 A;  2HE0 A;  3NF1 A;  4U0U A;  3FTV A;  3C5R A;  2OVF A;  4HOT A;  4DLQ A;  3EIJ A;  2FBN A;  4EHM A;  3V2O A;  4JHJ A;  2XZT G;  4CDR A;  3HVE A;  4L1B A;  1E8Z A;  4G26 A;  1LD7 A;  5FZQ A;  1G3N B;  3UT8 A;  2ETC A;  4GZC A;  2WXP A;  1HO8 A;  3RKV A;  3MV3 B;  3ENE A;  4WNE A;  2FO7 A;  4LER A;  3B7B A;  4I43 A;  3KSL A;  5IY5 E;  5KNG A;  4JPS A;  3PUJ A;  3AS5 A;  4NIK A;  3DPD A;  4ACL A;  3EHR A;  4Q94 A;  3CHO A;  5FIO A;  2EIK E;  4GPM A;  3PEU B;  3QWV A;  3JQ0 A;  5G04 C;  2V4L A;  4XI9 A;  4JHR A;  2XS1 A;  1Q2Z A;  3NAW A;  1H6O A;  2Y69 E;  4DUI A;  3PEV B;  1N4R A;  2KM4 A;  1H6P A;  4BER A;  5BUZ A;  4GML A;  5AJL A;  3PE4 A;  2P9I G;  3TXN A;  2XPZ A;  5E76 A;  4OAV B;  2IOL A;  1QQE A;  4XEI G;  2WXM A;  1FVF A;  4CCA A;  2JAB A;  5FZR A;  1DNP A;  3UM0 A;  5LCW J;  2F8Y A;  4UI9 J;  4JZY A;  5EN5 D;  5ARG A;  2C0M A;  5D2M C;  5CRU A;  5CER B;  1SA5 A;  1NA0 A;  2XHE A;  2E2E A;  2H6H A;  3SHF A;  3U9W A;  2OEV A;  3LS8 A;  5EYP F;  3D9P A;  2GW1 A;  1DCQ A;  5ENT D;  2WM9 A;  2H6G A;  4EZK A;  4Y6W A;  2R59 A;  2X6J A;  4XI0 A;  4CDM A;  4U04 A;  4UUC A;  1OCC E;  4FU3 A;  2CFZ A;  4TUM A;  3FH7 A;  2HR2 A;  2WMO A;  4DJA A;  4I9C A;  3NZS A;  1SZ9 A;  2WXL A;  3D9K A;  3EHN A;  2ZIS A;  1UN8 A;  1H2T C;  4J8Y A;  2DYR E;  2IFU A;  3U4T A;  4GAA A;  4UI9 K;  4E6H A;  2GRQ B;  3PH0 C;  1H19 A;  3HVE B;  1OT8 A;  1V54 E;  2DIW A;  3J5Q B;  3ZN3 A;  4MBG A;  2R05 A;  1H6K A;  2WQH A;  3WXX A;  5CEA A;  4DPR A;  4U96 D;  1TNB A;  5G04 J;  3FUH A;  4RVB A;  4I2W A;  5B1B E;  3PZ2 A;  3APD A;  2Q7F A;  1A17 A;  5KWD A;  3FFL A;  4JW1 A;  4AOF A;  4ANV A;  2ETB A;  1S63 A;  4UQX A;  3EHM A;  3UQ3 A;  4BY6 A;  2MRI A;  4BSZ B;  4YDW A;  2I1J A;  3RAU A;  4X8Q A;  2YNQ A;  3B7S A;  3FTY A;  4DX5 D;  4GTQ A;  2X3M A;  2L6J A;  1N95 A;  4O1P A;  5BNW A;  2BKG A;  5G55 A;  4KXK B;  2H6I A;  2JLB A;  1K1A A;  4D10 C;  3QK0 A;  2EQX A;  1E7U A;  3AG1 E;  4N3B A;  3RRN B;  5CEC B;  2XEN A;  3CHR A;  4U07 A;  2Y3A A;  3MKR A;  2X6K A;  4N5C A;  5JHA A;  2V0P A;  4K5B A;  3IV0 A;  3LJN A;  5T4Y A;  1BU9 A;  4ABN A;  4EZL A;  3TWS A;  4GTT A;  2WXI A;  3ZXS A;  4ZFH A;  5FT9 A;  3SBS A;  3FUD A;  2F37 A;  5AYW D;  3C3R A;  3UUX A;  2VGE A;  1FPP A;  2WXO A;  1YA0 A;  3DSS A;  4GA0 A;  4L2Y A;  4KBQ A;  3TJP A;  4BSX A;  4U95 D;  2NYJ A;  2LAH A;  3ASF A;  4WWO A;  4JA7 A;  3R7R A;  2J4B A;  1EYH A;  2VGY A;  3D9O A;  4HOU A;  3SO8 A;  1OWL A;  4F7A A;  1IQR A;  4I6E A;  2CHZ A;  1WAO 1;  4HBD A;  3D9N A;  4HQD A;  2EIM E;  3UT4 A;  3D9L A;  5CMW A;  2XPY A;  2LXM A;  3EJN A;  3PVL A;  5EYL A;  4DX6 D;  5AN8 A;  3QDN A;  2IOS A;  4EZJ A;  3SY2 A;  1Z5S C;  3ONL A;  2OEW A;  5EIL A;  4AIF A;  5FQ7 A;  3UKU G;  3DSW A;  5EX3 A;  4AY6 A;  5CCM A;  2FI7 A;  4G24 A;  2XQ0 A;  5C2Y A;  4TXQ A;  4MLP A;  3VLD A;  1U2V G;  1ELR A;  3KS2 A;  3FEY A;  4KVO A;  3CHS A;  3ZEF A;  2C2L A;  2GGF A;  3AS8 A;  3Q9U C;  2PM6 A;  1BI8 B;  2B6C A;  3C3Q A;  4Z68 A;  1IKN D;  3QJZ A;  3RIB A;  3SF4 A;  4Q69 A;  1KT1 A;  1MX2 A;  1TYQ G;  2L9B A;  2VJ8 A;  3O4Z A;  3MGB A;  4DX2 A;  3NBN B;  4P29 A;  4PDX A;  5BV1 A;  1HF8 A;  1N54 A;  1WM5 A;  4Y6C A;  4B0Z A;  1NI1 A;  4BTB A;  3QAR A;  4J8F A;  3FDH A;  1MYO A;  2IQC A;  3NB2 A;  2IF4 A;  2J07 A;  3FWV A;  4G1T A;  5G05 C;  4WAF A;  4FJZ A;  3PZ1 A;  3RRM B;  2KZT A;  4KZ0 A;  3FUL A;  3RRU A;  4GU5 A;  3SI5 A;  3KSQ A;  4UWF A;  2PZI A;  3JUE A;  4ANX A;  3CGH A;  2HO1 A;  3FEX A;  3Q5M A;  4NUR A;  2KC7 A;  4OVV A;  4WWN A;  3TWR A;  4AXH A;  3QNK A;  1YYH A;  2J09 A;  5HS0 A;  2GRO B;  4DX7 D;  4DRX E;  3W9F A;  1Z3Y A;  4FLH A;  2R5S A;  3K9I A;  4BEP A;  3ZVV A;  5JHB A;  4KT6 B;  3TWW A;  4A1S A;  1FT1 A;  4UWK A;  1NA3 A;  3ZPJ A;  2Y4T A;  5AIJ A;  3S7J A;  4UWG A;  1GW6 A;  3ULQ A;  1QZ2 A;  4HFG A;  4B8A A;  3HXF A;  3ZIM A;  2IEJ A;  3KEA A;  3VTX A;  2CHW A;  2R02 A;  3ML9 A;  1FT2 A;  4M7C A;  3DRA A;  2J4D A;  5HRY A;  3CQG B;  1MHQ A;  1OXJ A;  2Y0B G;  3V30 A;  1L5J A;  2F8X K;  1A5E A;  3CK7 A;  2L6B A;  3I5P A;  5FIN A;  4NQ0 A;  1D8E A;  3CVQ A;  2WXF A;  2PQN A;  5HQ8 A;  2QFC A;  4HOS A;  4H7X A;  4WUY A;  3AU5 A;  4LNB A;  3MKQ B;  4ZHB A;  4LCT A;  1H2U A;  3AG3 E;  1OWO A;  2HM8 A;  2J08 A;  4J6I A;  2XZD G;  2NC9 A;  4AJW A;  2AWI A;  4FC8 A;  3CV0 A;  5JA4 D;  5HI7 A;  3FU0 A;  4FUL A;  4XKB A;  3TXM A;  1WY6 A;  2GRP B;  3D9H A;  3HXE A;  2DBA A;  5JJT A;  2AVP A;  4GTM A;  4PS8 A;  5FZS A;  3TWV A;  1O5M A;  4R7L A;  1MX4 A;  3G2W A;  3ASD A;  3ESK A;  2IO2 C;  2VSO E;  1BPO A;  3NOG D;  4LEU A;  4BWR A;  3AG4 E;  4OYS A;  2R17 C;  3RO2 A;  3S2A A;  2I6H A;  1ELW A;  3S7B A;  3U3W A;  1QNF A;  3PNT B;  1S0P A;  1WG0 A;  3CLJ A;  4JA9 A;  4B93 B;  2Y4U A;  5BW8 C;  3MX3 A;  5ENQ D;  5AAR A;  2YIN A;  3LEW A;  4G23 A;  3MYV A;  4JXT A;  3UPV A;  1HH8 A;  3UXG A;  3VLE A;  2RKK A;  4HS2 A;  5FQ4 A;  5BXU A;  4GZ3 A;  3IHY A;  1IHG A;  1SW6 A;  4J7W A;  3LJ3 A;  4GB9 A;  1FVH A;  2EIJ E;  4WNF A;  3TG4 A;  1HXI A;  1IHB A;  2AJA A;  1E90 A;  5A7D B;  4F53 A;  3HYM B;  4GA2 A;  5BXO A;  3ASH A;  2P9P G;  4CGV A;  1ZB1 A;  2UY1 B;  2VSX E;  3S7F A;  3FH5 A;  4N3A A;  3C72 A;  3C98 A;  3PS6 A;  3LY7 A;  4XX5 A;  2VTB A;  1HFA A;  1HU3 A;  5EID A;  3HXB A;  2KCL A;  5ARF A;  3W9G A;  1N4Q A;  5E75 A;  1UG3 A;  1UW4 B;  2ZIR A;  4ANU A;  2DZO A;  3ML8 A;  2VSY A;  1Z6T A;  3Q73 A;  1DVP A;  4O60 A;  1X5B A;  5EX0 A;  3LVR E;  4YND A;  2ZGD A;  4C0M A;  3FUM A;  4IUL A;  2CG3 A;  3DSV A;  2WXQ A;  3E30 A;  4ATG A;  3I4R B;  4TRQ A;  5JMN D;  1O1S A;  3ZYM A;  2CHX A;  3FY4 A;  4APF A;  3OTN A;  3FH8 A;  3RK6 A;  1TR4 A;  1TN6 A;  2WQ6 A;  4JVS A;  1E8X A;  3PUK A;  4I9E A;  4M3O A;  4WWP A;  4MS6 A;  2ZGG A;  3B95 A;  4I6J A;  1HZ4 A;  4HXI A;  3PE3 A;  2VQ2 A;  3PZ3 A;  3IXE A;  1K1B A;  3CK8 A;  5AJD A;  3AU4 A;  3CIA A;  1JUQ A;  1S70 B;  4MRU A;  3FUK A;  3DSX A;  1N0Q A;  3G2T A;  4KVM A;  4N2S A;  5C1D A;  4H7Y A;  4U63 A;  4BX9 A;  2FO1 E;  4ILH B;  2WXJ A;  5FWQ A;  3Q9N C;  5FJY A;  4HRN A;  1U3D A;  4U0Z A;  4G8K A;  3I3N A;  4WNG A;  4DI4 A;  3T5V A;  1E96 B;  2GRR B;  5B3S E;  4O6F A;  2EIN E;  1TNY A;  2ZU6 B;  4EPZ A;  4BX8 A;  1UJJ A;  2CG2 A;  3PRZ A;  3PNL B;  5CCL A;  3TWT A;  1HS6 A;  3UM2 A;  1OCR E;  3FTS A;  3B13 A;  1D9S A;  3ABL E;  3QB2 A;  3KD7 A;  1Y6I A;  4FLB A;  3DXK G;  4BTA A;  2RFA A;  3T8K A;  4GZ6 A;  3JQ1 A;  3ONK A;  3Q79 A;  2IY0 C;  2XGM A;  3LDZ A;  4HOQ A;  5FQ8 A;  1B89 A;  4I1O B;  1OWM A;  3LY9 A;  2A4Z A;  2P2C P;  2P9S G;  3Q4A B;  2RD0 A;  4G25 A;  5LFA A;  4PS3 A;  5KJM A;  3OXL A;  1ZBP A;  2J9Q A;  3D3M A;  2VGX A;  3WG7 E;  3AJI A;  5BT1 A;  3E37 A;  4GZ5 A;  3NQP A;  5M72 A;  3MZL B;  5T3R A;  3IHV A;  4TV3 A;  2KXP C;  2OV8 A;  3CEQ A;  3L13 A;  3CVU A;  4IN3 B;  3AS4 A;  4I6G A;  4GTP A;  4HNA D;  4UQY A;  1AP7 A;  5LOZ A;  4URK A;  5EKQ D;  2AXZ A;  2R2L A;  2X38 A;  2LSV A;  4EQF A;  3URZ A;  1N0R A;  3ZHE A;  1NP7 A;  4RSY A;  4BFR A;  5LX8 A;  5FQ6 A;  1PC2 A;  3Q7A A;  2P9U G;  1MZC A;  4AP2 A;  4QFV A;  4U7E B;  4NRH B;  3PRE A;  4A1G A;  5CBO A;  1QYM A;  1H0A A;  1Z3X A;  3GW4 A;  3SQV A;  2XRY A;  2VSN A;  3L54 A;  3P1U A;  5ENP D;  3ULE G;  2QZA A;  4TUU A;  2XEH A;  2I9C A;  1RZ4 A;  4LSZ E;  3FTZ A;  3ABK E;  4AM9 A;  4GMJ A;  3JYS A;  3RU0 A;  4JEU A;  2OOE A;  5ENN A;  3Q78 A;  2MHK A;  3U64 A;  3OAW A;  2XGO A;  4JEH A;  1UOH A;  3ZNG A;  3OXF A;  3ZW3 A;  2I2O A;  4HOR A;  3CR3 A;  1V55 E;  4JB8 P;  2OCC E;  3T8M A;  3UX4 A;  1RW2 A;  3G2U A;  3SD5 A;  3FUF A;  3CHQ A;  4FA6 A;  3B7U X;  2KCV A;  3Q15 A;  1DCE A;  4FHK A;  2QY7 A;  3JUI A;  1PY1 A;  1TN7 A;  3EU5 A;  2PNN A;  2KAT A;  1E8W A;  3DSU A;  4GTO A;  3SFY A;  4C0E A;  5ITZ F;  2DCP A;  4PUC A;  4CZ2 D;  3L82 A;  3V31 A;  3IKO B;  3D9I A;  1BI7 B;  3OXG A;  1E8Y A;  1U3C A;  1O1T A;  4GYO A;  4XKC A;  3RO3 A; 
#chains in the Genus database with same CATH homology
 4I17 A;  1HX8 A;  1H6K A;  4U8H A;  2WQH A;  3WXX A;  2YIN A;  3LEW A;  4G23 A;  3MYV A;  4JXT A;  3TG5 A;  3UPV A;  5T8I A;  4DPR A;  5AEN A;  5ANR A;  1HH8 A;  3ZYK A;  4W9R A;  4XZ4 A;  3UT7 A;  3VLE A;  2PQR A;  4EBA G;  3ESL A;  5G04 J;  2GRM A;  3FUH A;  4RVB A;  4I2W A;  4HS2 A;  5FQ4 A;  3APD A;  3TAX A;  2Q7F A;  1A17 A;  4GZ3 A;  5CHE E;  1OUV A;  3S7D A;  3FFL A;  3IHY A;  4JW1 A;  4AOF A;  4HLE A;  2OND A;  3FU6 A;  4ANV A;  1IHG A;  1ZU2 A;  4UQX A;  3EHM A;  4Q96 A;  3UQ3 A;  2WQ7 A;  2X6H A;  4BY6 A;  2MRI A;  2P58 C;  5FTP A;  3Q49 B;  3ZRH A;  3MV2 B;  1KT0 A;  3LJ3 A;  4B94 A;  2I1J A;  1FVH A;  4GB9 A;  3UMV A;  3I4G A;  2FUL A;  1XNF A;  4WNF A;  2YNQ A;  3B7S A;  3TG4 A;  4F3V A;  5KCM A;  3CVN A;  3FTY A;  1HXI A;  3LY8 A;  2X3M A;  2YQ8 A;  2L6J A;  1E90 A;  5A7D B;  3BG0 B;  3L16 A;  3QKY A;  4F53 A;  5BNW A;  3HYM B;  3D9M A;  4GA2 A;  3MKQ A;  4KXK B;  5G55 A;  1JWG A;  1ELK A;  2V5F A;  4NAC A;  3ASH A;  4J8S A;  2JLB A;  4MKT A;  4E85 A;  4D10 C;  4CGV A;  3QK0 A;  2EQX A;  1E7U A;  2UY1 B;  2VSX E;  3S7F A;  4N3B A;  3RRN B;  3FH5 A;  4N3A A;  3CVV A;  3CHR A;  3APF A;  3CVL A;  3C98 A;  3PS6 A;  3LY7 A;  4UWL A;  4U07 A;  4GPK A;  2Y3A A;  3MKR A;  1HFA A;  2X6K A;  3L6A A;  4XX5 A;  1HU3 A;  4N5C A;  2VTB A;  3G2S A;  5JHA A;  2RG8 A;  3L08 A;  2KCL A;  3CKB A;  4XIF A;  2V0P A;  5T4Y A;  3IV0 A;  5ARF A;  4UWH A;  4ABN A;  3SBT B;  4EZL A;  4WND A;  2X6F A;  2WXI A;  5E75 A;  3ZXS A;  1UG3 A;  1UW4 B;  2BF0 X;  5FT9 A;  3SBS A;  3ML8 A;  3FUD A;  2WMN A;  4ANU A;  2WPV A;  2VSY A;  4I1M A;  1Z6T A;  1DVP A;  3N71 A;  5AYW D;  1X5B A;  5EX0 A;  4PH4 B;  3LVR E;  4N2Q A;  3UUX A;  4YND A;  3MCX A;  3R9A B;  1W3B A;  4N39 A;  1LF8 A;  2WXO A;  3FUM A;  1XGW A;  3O48 A;  4C0M A;  2IJG X;  1YA0 A;  4IUL A;  1EDU A;  3Q47 B;  3KEZ A;  4GA0 A;  3HIZ A;  3NZU A;  3FTW A;  4KBQ A;  4L2Y A;  3TJP A;  4CGW A;  4YVO A;  2CG3 A;  4B8C B;  4BSX A;  2VYI A;  5D0Q D;  2WXQ A;  5JJ6 A;  4ATG A;  2XCC A;  4F1S A;  2E0I A;  3P2B A;  4LRZ A;  3I4R B;  5KJN A;  4TRQ A;  2LAH A;  1TEZ A;  4IYP A;  3CSF A;  4ME2 A;  2BUG A;  3ZYM A;  3ASF A;  2CHX A;  3B7R L;  4WWO A;  1EF1 C;  3FY4 A;  4LUN U;  3DBS A;  2AW6 A;  4JA7 A;  2WVI A;  4JL0 A;  3R7R A;  2KZT B;  3ZYL A;  4J8E A;  3ZFW A;  4RG9 A;  4APF A;  4KMO A;  2J4B A;  4GA1 A;  1EYH A;  4I2Z A;  4V3I A;  2VGY A;  3OTN A;  3D9O A;  3IEG A;  3FH8 A;  4HOU A;  2XGS A;  4CT4 A;  3CVW A;  1SZA A;  1OWL A;  3RK6 A;  4F7A A;  1IQR A;  2L0I A;  2CHZ A;  1WAO 1;  3GZ2 A;  4I6E A;  1E7V A;  3D9N A;  2WQ6 A;  4JVS A;  2LAI A;  1E8X A;  4G2V A;  3PUK A;  4ILG A;  4I9E A;  3SFZ A;  3UT4 A;  2FEZ A;  4M3O A;  3D9L A;  4AVX A;  4WWP A;  2AXU A;  4MS6 A;  2XCB A;  2LNI A;  3SZ7 A;  5CMW A;  4I6J A;  3JCK C;  3FTX A;  2XPY A;  5J90 A;  3EJN A;  1HZ4 A;  3PVL A;  4N3C A;  2MOW A;  2C0L A;  4HXI A;  3QDN A;  2IOS A;  3E4B A;  4EZJ A;  3PE3 A;  2VQ2 A;  1JPL A;  2X6I A;  2LO6 A;  2VGX B;  4BT9 A;  2WXK A;  3CK8 A;  2XPI A;  2WXR A;  3CHP A;  3FUI A;  4FP7 A;  5AJD A;  3AU4 A;  2PL2 A;  3ONL A;  4AIF A;  5FQ7 A;  3CIA A;  5EX3 A;  4AY6 A;  1JUQ A;  4MRU A;  3VLF A;  2OVB A;  4I1A A;  3FUK A;  3HDX A;  4EEC A;  3G2T A;  4KVM A;  4RG6 A;  5CCM A;  1UJK A;  2FI7 A;  3EDT B;  3KAE A;  4G24 A;  2XQ0 A;  3CHM A;  5C2Y A;  3CK9 A;  5C1D A;  4N2S A;  4MLP A;  3VLD A;  4H7Y A;  1ELR A;  4B89 A;  3CQC B;  3CKC A;  4U63 A;  3KS2 A;  4C9B B;  2IU1 A;  4BX9 A;  4ILH B;  4CEM A;  3TGO A;  2WXJ A;  5FWQ A;  3FEY A;  4KVO A;  3CHS A;  4G11 A;  3FP3 A;  5FJY A;  1HE8 A;  3ZEF A;  4L2L A;  4AY5 A;  2C2L A;  3ZHE B;  3ASG A;  1U3D A;  1OWP A;  2GGF A;  2A5U A;  4AV7 A;  2NXP A;  3QWP A;  3AS8 A;  4U0Z A;  2KCK A;  4EBA A;  5KJK A;  5ANL A;  2PM6 A;  1N52 A;  3T5V A;  3I3N A;  3PZD A;  4K0R A;  4WNG A;  3SNX A;  2UY1 A;  4JHK A;  4DI4 A;  2WXG A;  5KJL A;  3QJZ A;  4FAD A;  3CVX A;  1E96 B;  4KYO B;  3RIB A;  1IQU A;  3SF4 A;  3SGH A;  3FHE A;  4Q69 A;  3GZ1 A;  5DBK A;  3CVY A;  1KT1 A;  4O6F A;  5JJ7 A;  1JWF A;  2ZU6 B;  5BPP A;  3L22 A;  3MJW A;  2L0T B;  2L9B A;  2VJ8 A;  3O4Z A;  4EPZ A;  4FJY A;  3MGB A;  4A3V A;  1UJJ A;  2CG2 A;  4L7T A;  4BX8 A;  3PRZ A;  3PDN A;  3PNL B;  5CCL A;  4P29 A;  3FU3 A;  4PDX A;  2CFU A;  5BV1 A;  3L17 A;  1HF8 A;  2ILR A;  3LYA A;  1N54 A;  1WM5 A;  3QWW A;  1HS6 A;  4Y6C A;  4B0Z A;  4HVB A;  4BTB A;  3QAR A;  3QC1 A;  1HG2 A;  2XRZ A;  1Y8M A;  4J8F A;  2XEV A;  4JC8 A;  3FTS A;  3B13 A;  3FDH A;  3QAQ A;  2IQC A;  3VTY A;  3QB2 A;  3KD7 A;  3FU5 A;  1HG5 A;  3T5X A;  3QOU A;  4UQZ A;  3ZYQ A;  2ION A;  5LCW C;  2IF4 A;  2J07 A;  3FWV A;  4UI9 C;  3GYZ A;  3ZGQ A;  1Y6I A;  3LXU X;  4FLB A;  4A55 A;  4G1T A;  4BTA A;  4GZD A;  2FF4 A;  5G05 C;  1KLX A;  4DLO A;  4GZ6 A;  5G05 J;  3CVP A;  2BTD A;  3JQ1 A;  4WAF A;  3ONK A;  4FJZ A;  1H2V C;  4GCN A;  3RRM B;  3CST A;  2KZT A;  4L23 A;  2XGM A;  4KZ0 A;  4IRU A;  5D0O D;  4KZC A;  4J0U A;  3LDZ A;  4BT8 A;  4HOQ A;  3FUL A;  4K03 A;  3RRU A;  3NF1 A;  4GU5 A;  4U0U A;  3FTV A;  1B89 A;  5FQ8 A;  3SI5 A;  4I1O B;  3EIQ C;  4UWF A;  1OWM A;  3LY9 A;  2OVF A;  4HOT A;  2PZI A;  4DLQ A;  4ANX A;  3EIJ A;  2A4Z A;  3CGH A;  2HO1 A;  2FBN A;  3FEX A;  4GYY A;  2HYZ A;  2WXN A;  3Q5M A;  4JHJ A;  2NSZ A;  4NUR A;  3Q4A B;  2KC7 A;  2RD0 A;  4G25 A;  5LFA A;  4PS3 A;  4OVV A;  4WWN A;  4CDR A;  4AXH A;  3HVE A;  3QNK A;  1E8Z A;  4GYW A;  4L1B A;  4G26 A;  2J09 A;  3APC A;  5FZQ A;  5KJM A;  3OXL A;  4ACK A;  3UT8 A;  4CDM A;  1Z3Y A;  4FLH A;  1ZBP A;  2R5S A;  2J9Q A;  3LVQ E;  3K9I A;  2GRL A;  3LKU A;  3D3M A;  4GZC A;  2WXP A;  2VGX A;  1HO8 A;  4XE0 A;  4A3T A;  3ZVV A;  5JHB A;  4KT6 B;  3RKV A;  3MV3 B;  5BT1 A;  3ENE A;  1VDY A;  4GZ5 A;  3NQP A;  4A1S A;  4WNE A;  5M72 A;  2FO7 A;  1SQM A;  3MZL B;  4LER A;  4UWK A;  3IHV A;  4I43 A;  1NA3 A;  4TV3 A;  5T3R A;  2OV8 A;  3ZPJ A;  4CT0 A;  2Y4T A;  3CEQ A;  4JPS A;  3GZS A;  1TJC A;  3L13 A;  3CVU A;  4APO A;  4IN3 B;  5AIJ A;  2PM7 A;  3AS4 A;  4UWG A;  3PUJ A;  3AS5 A;  4I6G A;  3S7J A;  1GW6 A;  3ULQ A;  3DPD A;  1QZ2 A;  4UQY A;  3FUN A;  4HFG A;  2LSU A;  4ACL A;  5LOZ A;  4B8A A;  2WB2 A;  4Q94 A;  4URK A;  5EKQ D;  3CHO A;  3ZIM A;  2AXZ A;  1INZ A;  2X38 A;  2LSV A;  3PEU B;  3QWV A;  4EQF A;  1TJF A;  3JQ0 A;  3URZ A;  5G04 C;  2V4L A;  1NZN A;  3ZHE A;  1NP7 A;  4XI9 A;  4RSY A;  3VTX A;  5EDS A;  4JHR A;  4BFR A;  5LX8 A;  2CHW A;  4DK5 A;  5FQ6 A;  1PC2 A;  2WXH A;  3ML9 A;  4CRW A;  4FHJ A;  4AP2 A;  2J4D A;  3FUE A;  3BG1 B;  4QFV A;  4NRH B;  3PEV B;  3CQG B;  3PRE A;  4A1G A;  3LCA A;  2YHC A;  4AEZ C;  1H0A A;  1MHQ A;  1Z3X A;  3GW4 A;  2XRY A;  2KM4 A;  1L5J A;  5BUZ A;  4GML A;  3CK7 A;  2VSN A;  3G2V A;  3MA5 A;  3I5P A;  5AJL A;  4NQ0 A;  3TL5 A;  3L54 A;  3P1U A;  4PS7 A;  5A6C A;  3PE4 A;  3TXN A;  2XPZ A;  4TUU A;  5E76 A;  3CVQ A;  2WXF A;  2PQN A;  4GCO A;  5HQ8 A;  2QFC A;  1OWN A;  4HOS A;  2I9C A;  3MEK A;  4H7X A;  4YVQ C;  3FTZ A;  4WUY A;  4AM9 A;  3AU5 A;  4ILI A;  2IOL A;  3JYS A;  4GMJ A;  3RU0 A;  3MKQ B;  3D9J A;  1QQE A;  4JEU A;  4LCT A;  3HHM A;  3LPZ A;  2JEK A;  2OOE A;  2WXM A;  3IBE A;  1EPU A;  1H2U A;  1FVF A;  4J8D A;  5ENN A;  3U66 A;  2MHK A;  3U64 A;  1OWO A;  2HM8 A;  4CCA A;  1MQS A;  3RJV A;  2J08 A;  2AXV A;  4J6I A;  3OAW A;  2XGO A;  1P5Q A;  4JEH A;  5FZR A;  2NC9 A;  4AJW A;  1DNP A;  4OVU A;  3B7T A;  5LCW J;  2AWI A;  2VTB B;  4UI9 J;  4JZY A;  4FC8 A;  5ARG A;  2J49 A;  1UN9 A;  2C0M A;  2YHE A;  3CV0 A;  1IYG A;  5HI7 A;  3FU0 A;  1NA0 A;  2XHE A;  2E2E A;  4FUL A;  4XKB A;  3OXF A;  3TXM A;  5DIZ A;  3SHF A;  3ZW3 A;  3U9W A;  1WY6 A;  2I1K A;  2I2O A;  4HOR A;  3CR3 A;  3LS8 A;  3D9P A;  2DBA A;  4DI3 A;  5JJT A;  2GW1 A;  5A23 A;  3T8M A;  3UX4 A;  2AVP A;  2WM9 A;  3G2U A;  2V8S E;  4PS8 A;  3SD5 A;  5FZS A;  3FUF A;  3R7Q A;  4EZK A;  3CHQ A;  4R7L A;  2UWJ G;  4FA6 A;  3G2W A;  3B7U X;  2KCV A;  4Y6W A;  2R59 A;  2X6J A;  3Q15 A;  3FUJ A;  4XI0 A;  3ASD A;  4FHK A;  2QY7 A;  4U04 A;  3JUI A;  3ESK A;  4CDN A;  5J08 A;  5BV0 A;  1PY1 A;  3BEE A;  2VSO E;  4FU3 A;  1BPO A;  3FTU A;  2CFZ A;  5G2N A;  2KAT A;  4LEU A;  1E8W A;  4BWR A;  2M63 A;  3FH7 A;  2HR2 A;  4OYS A;  2WMO A;  4DJA A;  4I9C A;  1PAQ A;  3NZS A;  1SZ9 A;  4C0E A;  2WXL A;  4U0S A;  3D9K A;  3EHN A;  1UN8 A;  2DCP A;  5LP0 A;  2R17 C;  1H2T C;  3RO2 A;  3S2A A;  2I6H A;  4ANW A;  1ELW A;  2IFU A;  4PUC A;  3U4T A;  3S7B A;  3U3W A;  4GAA A;  4UI9 K;  1FCH A;  1QNF A;  3PNT B;  3IKO B;  4E6H A;  3PH0 C;  1S0P A;  3CLJ A;  4JA9 A;  3D9I A;  1H19 A;  3OXG A;  1E8Y A;  1U3C A;  5CMY A;  4GYO A;  2Y4U A;  3HVE B;  5BW8 C;  2DIW A;  4XKC A;  3ZN3 A;  3MX3 A;  3RO3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...