1WY7A

Crystal structure of a putative rna methyltransferase ph1948 from pyrococcus horikoshii
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
201
structure length
196
Chain Sequence
b'RKKELAIALSKLKGFKNPKVWLEQYRTPGNAASELLWLAYSLGDIEGKVVADLGAGTGVLSYGALLLGAKEVICVEVDKEAVDVLIENLGEFKGKFKVFIGDVSEFNSRVDIVIMNPPFGSQRKHADRPFLLKAFEISDVVYSIHLAKPEVRRFIEKFSWEHGFVVTHRLTTKIEIPHRKKLERITVDIYRFSKVI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords hypothetical protein PH1948
molecule tags Transferase
source organism Pyrococcus horikoshii
publication title Crystal structure of the putative RNA methyltransferase PH1948 from Pyrococcus horikoshii, in complex with the copurified S-adenosyl-L-homocysteine
pubmed doi rcsb
total genus 65
structure length 196
sequence length 201
chains with identical sequence B, C, D
ec nomenclature ec 2.1.1.-:
pdb deposition date 2005-02-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05175 MTS Methyltransferase small domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 1wy7A00
1KPIA 4PYQA 5E1DA 4ER7A 1Y8CA 2FK8A 4EVIA 3GCZA 4XCXA 2UYCA 2WK1A 1VP9A 5E8RA 3I53A 3SSOA 3S68A 2N47A 4E2YA 5DTRA 1JQDA 3B3JA 4M36A 3HCBA 2OXTA 5GWXA 5K03A 1G8AA 1XCJA 4DMGA 4X41A 1WG8A 4QVGA 2WA1A 2YQZA 4BLWA 3M6XA 3TOSA 3PX2A 2YTZA 3A27A 4YMGA 2EX4A 3P9NA 4KW7A 4EKIA 3M70A 5GM2A 3FTEA 3KQWA 3DMGA 1D2CA 3IEIA 4PGGA 1G55A 2JHAA 5K0GA 1RJDA 3SMQA 5K8VA 1IXKA 1SUSA 1R18A 1NBHA 1O54A 4AX8A 2O05A 1X1DA 3HVKA 3CVOA 3MCTA 3FUVA 1N2XA 4E32A 1UIRA 3L8DA 3HCCA 4DA4A 4RTQA 1G6Q1 4PYKA 3KPUA 1EJ0A 2BM9A 3G2QA 1L3IA 1XDZA 3P9CA 5GP1A 4YUZA 4CKCA 3E7PA 2ZVJA 3LPMA 1RJGA 1MJFA 5LQCA 1WXWA 2JH8A 1BHJA 3EPPA 2XYQA 1HNNA 1ZG3A 5HEKA 3NW9A 3GXOA 2VDWA 3UJ7A 3Q87B 3T7RA 5FADA 2NNWB 1XXLA 4JXJA 2CKDA 1P1CA 4LWPA 5KVAA 3E05A 2BZGA 3PVCA 4CXMA 5DTMA 4PONA 2B2CA 1KPHA 3B3GA 4HSGA 3TLJA 5KQRA 3FYDA 2VS1A 3KR9A 5E1MA 5JR3A 1KIAA 5EIWA 3ELDA 4HTFA 1UFKA 4C4AA 4ER3A 2AS0A 5K0EA 4BP1A 4CKEA 1YF3A 3VSEA 2VZ9A 4R05A 3KQPA 3R0QA 4P58A 5CVEA 3V8VA 2P7IA 3VYWA 5LQRA 4QVKA 5DRTA 2C7PA 3OFKA 1KP9A 2V74B 3CJRA 2G8NA 1M6YA 2B9EA 2BM8A 2BR3A 2C7OA 4GUAA 1JG4A 4E30A 3EVFA 3E8SA 3TRKA 3TR6A 4CTJA 1RI5A 1KR5A 4EQZA 2E5WA 3KQYA 1WXXA 5K09A 3GU3A 3LDFA 2B3TA 2ZLBA 3EGIA 1DUSA 5T6BA 3B3FA 5FA5A 5KYGA 2QYOA 1NV8A 5LQAA 3OFJA 1NW8A 5DX0A 3REOA 2P3LA 3SR4A 2AOTA 5EG5A 3THSA 1X19A 2ZCJA 3UWPA 5CVVA 3LBFA 5BW4A 5BXYA 4YV2A 2Y1WA 3FPFA 3PLAE 1XCLA 3G8AA 3A7EA 2PXXA 4EKGA 3GO4A 5E9WA 3GRRA 3P9KA 3THRA 4X63A 3NVMB 4PYNA 2AZTA 3LKDA 3DP7A 3ME5A 5DXJA 3BZBA 2JJQA 4BLUA 2ZWAA 5DXAA 3UFBA 4C07A 3UJBA 1G60A 2GH1A 2XYVA 3M6UA 2PVCA 2O0LA 5F2KA 4YUVA 1M6EX 4E31A 4U7PB 4QTTB 2GAFA 5K0CA 2PXAA 2QM3A 2XYRA 2G72A 3DXYA 3P97A 1AQJA 4NECA 3ANXA 2GS9A 4KDCA 1ZQ9A 5FHQA 1NW6A 4DF3A 5K0FA 5H02A 2H11A 4GOLD 4GOMD 4RTKA 3LCVB 5HIKA 1F3LA 1FP2A 2FPOA 1VPTA 2FYTA 2Q41A 4FZVA 3KPVA 3KQQA 1UWVA 3FTCA 1X1BA 4BP3A 5K0BA 5GIPE 2DPMA 4DZRA 1KYWA 4R6WA 3OZSA 3DXZA 2EG5A 3EVGA 2OY0A 4RVHA 2IH4A 3BUSA 3PB3A 1FBNA 5IH3A 4XUEA 1QAMA 2K4MA 3CJQA 4QPNA 3CBGA 2EJUA 4FSXA 4X1OA 3G2MA 2OB1A 2XVMA 2NP7A 2IPXA 5F2OA 5FHRA 3FUTA 5K0NA 3T0IA 5HIMA 2HV9A 2ZBRA 4HH4A 5HIIA 3SVZA 2ZBQA 3HA3A 3MQ2A 3Q7EA 4OBXA 3P8ZA 3D2LA 5FTWA 2AVNA 1RJEA 4E33A 4RYLA 2CWWA 3HCEA 4KRGA 3CCFA 2AOXA 2PY6A 3QOWA 5DSXA 3OE4A 4P7JA 3G5LA 1H1DA 4C06A 3HTXA 3C0KA 4MQ4A 3TM4A 4LG1A 2HWKA 3BKWA 5ICFA 4ZTBA 4E2ZA 4YUXA 3G88A 2ADMA 2I7CA 4Y30A 2B78A 3EGVA 5E1BA 2OYRA 3OCJA 5IKMA 3OU2A 5FWDA 5EKXA 4DM3A 1Q0TA 3MERA 1MHTA 5FCDA 4E2WA 3NVKI 2FK7A 4MHTA 4CWAA 2BR5A 5E2BA 1TW2A 5F2NA 1R74A 3BGVA 1RI3A 4POOA 1PRYA 1N7IA 1YFLA 1OR8A 1EG2A 1JSXA 2VDVE 3G8BA 3UA3A 4DCMA 2ZW9A 3A7DA 3BWBA 1XDUA 2C7RA 3HA5A 2AOUA 4PIMA 4LECA 2LD4A 1JG3A 2QRVB 4HC4A 4IWNA 2AOTB 4GBED 4QTUB 4GEKA 5D1HA 5DM2A 3VC1A 3E23A 3PX3A 5EEGA 1I4WA 3F4KA 3I58A 3LECA 3OU6A 2OO3A 2JH9A 3TFWA 3KPYA 2PT9A 3AXSA 3BGIA 2F8LA 3TQSA 3OZTA 3FUWA 3O31A 3ELUA 3BWMA 5EGSA 4OA5A 2EFJA 3DTNA 2B25A 5EHIA 3EVDA 4FT2A 4A6EA 3VC2A 4Z2YA 4YUYA 4KWCA 3KPWA 2KW5A 1YB2A 5C9ZA 1WY7A 3ER8A 3LX6A 3DMFA 3DUWA 1QYRA 1O9HA 3FPEA 2OKCA 3LKZA 3KQOA 3I5UA 2Y1XA 1YUBA 4KIFA 2AOWA 1SQFA 5CUQA 2ONYA 4HRAA 5E9QA 4GC5A 3KR1A 1FP1D 1QANA 3FRHA 5E1OA 3PS9A 1SG9A 2ORED 4WVLA 4RTRA 2O07A 4X60A 1G8SA 1KXZA 1NE2A 2H1RA 4X61A 5FQNA 3IV6A 5CVDA 5DRYA 3P2IA 4O29A 5LR6A 5C0OE 3UJ6A 4RTJA 4BY9E 3WSTA 3K0BA 3UBTA 3PFGA 4PINA 3JWJA 3UZUA 2PV0A 2AN3A 3ELYA 3P2EA 2P1DA 3HM2A 2HNKA 2ZBPA 3NDJA 4OX9Y 2V7EA 1DL5A 2NXEA 4FP9A 2UYQA 4YV0A 3QOXA 4XUDA 3TM5A 4V0RA 2ZWVA 2BR4A 4M37A 5E8JA 5EMLA 5CIYA 5CM2Z 2NYUA 1I9GA 10MHA 1JSZA 5DWQA 2IBSA 1L9KA 4KIGA 3FTFA 1VP3A 1BKYA 5LQUA 3FPJA 2PLWA 2CL5A 5KQSA 3DOUA 5GM1A 2HMYB 2H00A 2UYOA 3MGGA 5GINE 2QY6A 2ONZA 3OPNA 5HILA 2R3SA 1KYZA 3GIWA 1EQAA 3R6TA 2NXNA 1EAMA 1AQIA 3KKZA 4V0QA 3LDGA 4C08A 3NTVA 1SKMA 4KDRA 3CGGA 1SVUA 2PX8A 3K6RA 1P39A 2JG3A 3UJCA 5KS2A 5EPEA 1Z3CA 2O57A 3UJDA 3X0DA 4YV1A 7MHTA 3SXJA 3LCCA 1JG2A 3LCUA 4IV0A 1JR4A 1KHHA 2CMGA 5HOQA 2A14A 4PYOA 4AZWA 1WS6A 1EJ6A 2GA9A 2BH2A 1DCTA 3JWHA 1EIZA 3KQSA 2QE6A 3AJDA 1N7JA 2PT6A 1VE3A 3DXXA 4U7TB 3AXTA 2UYHA 1XDSA 4RVFA 2WA2A 2ZZKA 1AV6A 4M38A 2AOVA 5U4XA 2HTEA 4ER6A 5GIOE 2IFTA 2GB4A 4HG2A 1R6AA 2OZVA 3MTIA 2FRXA 5FA8A 5K01A 4A6DA 2YXEA 3PTAA 2P40A 2YX1A 3OE5A 1NT2A 5EMKA 1R8YA 2ZFUA 3FUXA 3HCFA 2ZIEA 1BC5A 3M4XA 3OU7A 2NP6A 1ORHA 2YVLA 3TPZA 5C1IA 4PYMA 4G56A 3C3YA 4RTPA 2OBFA 4PYJA 1WZNA 4F84A 3SSMA 3GRYA 2I62A 2NXJA 2YR0A 2AR0A 5HIJA 2IP2A 3NMUF 3BWYA 2ZIFA 5E2AA 3KQMA 4UOEA 3NWEA 2GPYA 2PWYA 4R8SA 4B17A 4CKBA 1D2HA 3DH0A 3FPGA 2ZSUA 2XBMA 1NW3A 5JUWA 5FULA 4ATNA 3DR5A 4P7FA 3KQVA 4C05A 2YXDA 3AWIA 2Z6AA 1M0EA 3SX0A 4E2XA 1ZHFA 1VL5A 2G70A 1JTEA 2IH5A 4L7VA 2IH2A 5DT2A 4MTLA 4RTNA 3GWZA 4DCGA 5ICCA 1NV9A 5T64A 1FJXA 2G1PA 5CD1A 1TPYA 2VDUE 4K6MA 5DX8A 3IHTA 3RODA 3MTEA 4RV9A 3MAGA 2ESRA 2PGXA 4F86A 3BKXA 3C3PA 4H0NA 3TKAA 1BOOA 2IIPA 5HZMA 3EMBA 3LGAA 4CTKA 3HVIA 1L3CA 5DM4A 4F85A 3HCAA 3ERCA 5DSTA 4C03A 2P3OA 1RI4A 3LHDA 1I1NA 2NXCA 3R3HA 4QPPA 1QAOA 5ICGA 3GDHA 4R8RA 8MHTA 3DMHA 3EVEA 3SM3A 3T7SA 5HFJA 3GRZA 3ID6C 3PT9A 4BLVA 2JHPA 5BP7A 2Z6QA 3HEMA 3G89A 5FQOA 3M6VA 4AZTA 1KPGA 4WXHA 5EOVA 4KVZA 3NWBA 3O7WA 5G02A 3M33A 3DLIA 4FSDA 3SSNA 3TMAA 4PNEA 3I9FA 3QV2A 3AY0A 5EMMA 2YXLA 5K05A 5DM1A 3G2PA 3UJ9A 1JQEA 2EJTA 1D2GA 2CMHA 1ZKDA 4OQDA 1VIDA 3EEYA 1VQ1A 3GNLA 2XVAA 4E70A 5EHGA 1AF7A 3BT7A 4HGYA 2P41A 4EMSA 5M5BA 4M7RA 1V39A 4R6XA 3FZGA 4AUKA 3BWCA 4HGZA 3LSTA 5DLYA 3PFHA 4AZVA 5K0JA 3TKYA 2PX4A 3DLCA 4EK9A 3A25A 1X1CA 4GF5A 3RW9A 3B89A 5BW5A 2PXCA 3EGEA 5EKUA 5E9JA 4OA8A 5EMJA 2PX5A 4ER5A 3DULA 4FS8A 3FYCA 1JTFA 4LWOA 1NW7A 2AN5A 2AOUB 4GC9A 5EEHA 1QZZA 5T67A 3EVZA 2IGTA 3KU1A 1P1BA 3HA7A 4MWZA 4RSRA 3GRUA 3KQTA 4DKJA 1VBFA 3UJ8A 1PJZA 3CKKA 4QQNA 3EVBA 1NBIA 1L1EA 3KR2A 4RWZA 3BGDA 2PSSA 1L3BA 4DQ0A 5DM0A 5LQJA 3LBYA 3G7UA 5EIFA 3CJTA 3C6KA 1R00A 2HR1A 3G2OA 4PIPA 3GGDA 2I9KA 2ZIGA 1IY9A 3O4FA 5DPMA 4ISCA 4IV8A 2I6GA 3HNRA 3EVCA 4RTMA 5EC8A 1ZGJA 3C6MA 3KPJA 1QAQA 2FCAA 1X1AA 2OPBA 4GQBA 4XUCA 3FUUA 5EQJB 3UA4A 3MB5A 3HVHA 4PGHA 3I64A 4FR0A 4PCLA 4PWYA 4ER0A 1IM8A 1NW5A 2C7QA 3UJAA 2ZZMA 2R6ZA 3ER9A 2FHPA 3B7PA 1YZ3A 4FT4A 1U2ZA 4P7KA 4IKPA 1T43A 3LDUA 4GOND 1YFJA 5CCXA 5ERGB 1RJFA 1RI1A 3A26A 2P7HA 4RVDA 3P2KA 5FWAA 3EVAA 4PYLA 2PKWA 3EMDA 3LL7A 5CVJA 1SQGA 5EVJA 3ELWA 5ICEA 2P35A 5LQNA 3R24A 5DX1A 2OB2A 4YUWA 3M6WA 1Q0SA 5EZQA 3MHTA 1O9GA 1XVAA 2PX2A 3MCZA 5GOZA 2ZZNA 3OZRA 2VP3A 4OQEA 5P8WA 2PWPA 5DTQA 4RVGA 4MIKA 3P9IA 3BXOA 2ZULA 2ERCA 5LQKA 3CC8A 4PYIA 1G38A 3FRIA 1F38A 1INLA 1JG1A 3GRVA 1FPQA 3EEOA 3P71T 2IDJA 5EZSA 3RIEA 3JWGA 2G71A 4RX1A 2Z6UA 2JHCA 1XJ5A 3NDIA 3HP7A 1JQ3A 4OBWA 2PBFA 3R9XB 4QDKA 2P3QA 4RTLA 2IBTA 1R8XA 5K0LA 1RI2A 5B1SA 3SGLA 5MHTA 5CCBA 3HCDA 3GJYA 3B5IA 2P8JA 2IDKA 5LSAA 3H2BA 4P7GA 4PCAA 3KR0A 2UZ4A 4RTOA 2GLUA 1SUIA 2YUIA 1XTPA 4RTSA 1TW3A 3KHKA 3G5TA 3JWIA 1B42A 3V97A 1ZGAA 4HTFB 4GOOD 9MHTA 1YZHA 4QDJA 4C04A 1NKVA 2QRVA 1VLMA 1ORIA 2ZTHA 3FPHA 3FTDA 4FGZA 3HVJA 1P91A 5D1NA 2AN4A 1HMYA 3NJRA 2PJDA 4Y2HA 5CVUA 4AZSA 2O06A 5FUBA 3T7TA 3U81A 3ORHA 2DULA 3A4TA 3IYLW 4YMHA 2AVDA 4QQKA
chains in the Genus database with same CATH superfamily
4GVLA 1DO2A 1FNMA 2HREA 3ZI7A 1VBKA 3B2QA 3F67A 2VXOA 1JZTA 1VP9A 3R7SA 3FPBA 3COJA 4C4ZA 1T0JB 3KYJB 5CM8B 4E2YA 2CLMB 1AX9A 4O2RA 2OD2A 1HFEL 4A4DA 4ZQEA 5C52B 4ZT4A 4DMGA 4X41A 1W2WB 4A73A 2F55A 4QOGA 4EB0A 1CY2A 4NARA 2BSQA 3D4LA 4RJJA 3SJUA 2VZEA 2C3OA 5JI2E 2DF8A 2WU0A 1ZH2A 3DEAA 3S29A 4XD7A 2EX4A 4KRXA 3P9NA 5HCNA 1E7RA 2QLBA 1DKUA 2DXIA 4V1CI 1TJ4A 3GLUA 2EZ4A 2A9OA 4QDXA 1JGTA 3SMQA 3AK4A 1CR0A 3L8EA 4MK4A 5I7AA 1HOXA 1Q1BA 1S2IA 2OO5C 2W11A 1B76A 4AX8A 3CVOA 5J9FA 4JKYA 3OPYA 1BAPA 1M7BA 4HGOA 3IQXA 3ZKWA 4KACA 4UTNA 1KFBB 4DQLA 5C53B 3DO8A 1PWZA 4F5WA 3NORA 5GP1A 4MAMA 1YVDA 3V8QA 2RGUA 1BIFA 4RVUA 4C2AA 5ICMA 5KOJB 4TS9A 4MOWA 2TMGA 2GN6A 4MAAA 1I3CA 1ZO8A 4WOPA 1W94A 1KA9H 4WXPA 3EE6A 3QBEA 3U4QA 1ZHHA 3SZUA 4MRPA 3STUA 3D6FA 5K8CA 2GEFA 2ZR8A 3NCTA 4YDHB 5J2UA 2GZ3A 5FTKA 5L9AA 1PT8A 1IOVA 2OBYA 4YR9A 2XNKA 2ADOA 4DJ5X 3FFBA 1MOZA 5ESXA 5IC4A 2JLZA 4DYVA 2RJOA 4LF6B 5EWMA 3RJ5A 1YJBA 4DSOA 3QEJA 4CETA 3R5JA 2IYNA 3EZGA 4YQEA 3QPCA 2ZAYA 1E2FA 2AFVA 3ELDA 1Y7TA 4JYCA 2EBHX 4P4LA 2JHFA 1XZCA 3RYIA 3HJTA 1RKQA 2ZIZA 5CB4B 4M9RA 1LW7A 1V71A 3PQ6A 3QVLA 4TMKA 1FUEA 2IOFA 3UAYA 2F6RA 2QRUA 3I5MA 4KSCA 1Q92A 4WJKB 5E6SB 4BKRA 2CCJA 1RI5A 1N2GA 4M8NE 4YAIA 2GHRA 1COZA 3GH1A 4W8OA 3RGGA 4V1CA 3GLQA 5FR2A 5KNCH 4PR0A 1UM8A 1MPXA 5CJPA 1JU9A 4GZ5A 1EI9A 3ZEAA 1J42A 1ZMXA 3DO5A 1JHDA 1LWOA 1GLVA 4I4TF 5CTJA 1G2OA 2B82A 2WJWA 3K9NA 3KIPA 4NE9A 3GCDA 4RFSA 3SR4A 3STVA 4AJIA 1JDUA 3OOWA 5EG5A 3IJEB 1B93A 3UMRA 1IXSB 2A0YA 1G8GA 3LVRE 1P0IA 5DF1A 3C85A 4OPMA 2Q3EA 3RRFA 5JWHA 2PZ8A 3SF8B 1EFCA 3FG9A 3NM4A 1JJVA 4TT3A 3NRCA 3GRRA 5JCOA 3FHLA 4OB7A 3FOWA 3CZAA 3GFFA 1NKSA 2BTOA 2F3PA 2CF6A 5F52A 1ZAYA 4URHA 4G0XA 5B6PA 2KX7A 4D6YA 2GH1A 2DPXA 1YU9A 1MPTA 2PRYA 2XDQB 3LUHA 1RZUA 4KBFA 5T57A 4ZO9A 1GVHA 5IKOA 2GN2A 2JGDB 1WB5A 3WO0A 4DQVA 3MGCA 3S55A 3FZYA 1Y0BA 2IPOA 1V8OA 3ES9A 1CZNA 4KO2S 1A9PA 4F4FA 4RNCA 4KNVA 5H02A 4GOLD 2W8BA 4RTKA 3JQAB 3GW8A 1H0HA 4U2CA 2BGNA 3EARA 2Q41A 3IAAA 4K6CA 3SNKA 2GM9A 2JIDA 1AKTA 1GCOA 1NVXQ 4YREA 3DBHB 3EW9A 1I0LA 3KALA 1DBSA 1BYUA 3ZWBA 4K0KB 4GDFA 2J0SA 2MT9A 1QAMA 1U9ZA 3OF3A 4GGMX 2DPGA 3A05A 1NFFA 3OCZA 1L5HA 1R0KA 1EFVB 3D4OA 4HLDA 4QGGA 2A0UA 3KP1A 4PX5A 3WQBA 2BD0A 1NE7A 1C14A 1EE9A 5F2OA 4CDMA 4IEIA 2R1VA 1BEZA 3GYGA 3IP6A 4NBSA 3KLBA 4C2TA 3JYQA 3EK2A 3B13B 4OBEA 2VJBA 3VGPA 1RZRA 5IDQA 2CB9A 5FTWA 4ZO6A 2HT6A 3HY4A 3FVVA 3NC1C 4H3KB 2GJ9A 4QXAA 1VI6A 3OX1A 4O2BF 1EBUA 1R6UA 1CZRA 2A92A 4CZ2A 2VBIA 1Q16A 1UPTA 1WVGA 1M7GA 3UK7A 3UEOA 1PUJA 5INTA 3AVUA 2O1XA 1ZFNA 2HWKA 3VOAA 1ZR4A 4Y30A 1DT3A 2VJAA 1GO2A 1Q1EA 3OQJA 3OPMA 2OYRA 2OGSA 5IKMA 4DM3A 1XI2A 2ZSBA 5IM5A 1KKLA 3P96A 2VPQA 3LC2O 4LSZA 3PUXA 4PFJA 2BJWA 2WBLC 5JYCA 1U1DA 2RHBA 4FM9A 3CSSA 1Z28A 1JBKA 1RI3A 5J5VA 4B6EA 4KNYA 2IPNA 1ZIYA 4NIMA 3IESA 1EFAA 3IKJA 5CLLA 3DLHA 5GZ1A 4PIMA 2LD4A 4FFMA 4R8LA 1CP2A 2XA2A 1SUCA 3LVBA 3PWSA 2BZ0A 4D8VA 4DIEA 1QVAA 1SG6A 3PX3A 5CPFA 5TGTA 1M6VB 2ORVA 4NAUA 3SHWA 3UHPA 4BN4A 3ORYA 2WB2A 1DGQA 1CDDA 1W1WA 5L95A 1FVXA 3BGIA 1BMFA 2Z09A 5FPPA 2H57A 3BFPA 1SQ5A 3R3SA 4MR8A 5HFAA 4HHEA 3O31A 2ZROA 3O2NA 3V4FA 5JMTA 1G291 1GPDG 3GB9A 4MNTA 4X7PA 3VV2A 4DS3A 2I2XB 4S12A 2YYZA 3DTNA 3PNYA 2DHCA 4BQEA 1MO3A 2JLCA 3E7FA 3FF1A 1U2DA 3QVXA 4Q4HA 2QTRA 5AHOA 1GD1O 4OGFA 3BD8A 5C9ZA 3CNBA 1Y89A 1DAHA 5KUTA 2FG7C 3DUWA 4WPGA 2P2LA 2VQ3A 3A1SA 2IY7A 1IUOA 1QDEA 2QLNA 4KQIA 4XM0A 1YTLA 2KQUA 5FBQB 1SQFA 4PQGA 4D7AA 4MS4B 5B4UA 2QD5A 1EGAA 1V16B 3BSWA 4BO0A 2I6XA 1I3LA 4DSAA 1YSCA 4ARZA 3D6NB 4YIHA 1DCMA 4DR7B 3EXFA 1YZTA 2AFHE 4EW2A 4F46A 5FQNA 1KXZA 4TLEA 2H0QA 3TWOA 3ZHUA 5IABA 4RXUA 3OCUA 5IWCA 2O8BA 1MG0A 2YY6A 3UJ6A 3VO8A 4FEAA 1W5AA 3W0LB 1K08A 3H5WA 1K0FA 2XOEA 3CUEF 3OTIA 221PA 3PIIA 5CX4A 4BTEA 4GMXA 2AZ4A 5A5VA 5IX8A 4W5OA 5ELLA 4B84A 1XXHA 1BW9A 1JV2B 2Y71A 3HM2A 2APJA 4OX9Y 3FDZA 1DC3A 3IKMB 1YVEI 4FP9A 1JEQB 1GGJA 3F3KA 4Q02A 4RNDB 3GLHE 1VHTA 4V0RA 1U8YA 4RWEA 4EG1A 2OAP1 3LBAA 5KVCA 1MP0A 1JSZA 1NNLA 3L0SA 5I4KA 3E9RA 5LBUA 1Y81A 4KC0A 1DZIA 2JRCA 4LBZA 2PLWA 5EXEA 4I0WB 2DLNA 2X5KO 2F9FA 2QQ5A 5JG7A 3HYNA 3T5TA 2ZT5A 3B78A 4IPTA 4MVXA 2QRHA 1KI8A 2HK6A 3QRWA 3GIWA 4HNAA 5D2CA 1DBPA 3TQOA 4OLBA 4P0PB 1JI3A 3A6EA 4XA8A 3U26A 4K9RA 4CIXA 4Q7QA 1YZKA 3IPLA 1SVUA 1GCIA 3FBTA 3TSCA 4BJ5A 2JG3A 4BS9A 4G2TA 3KUUA 4QVIA 4P3PA 2ZDHA 5CM9C 1WEHA 1Z6QA 3UFXA 3N86A 1KNQA 3VJMA 4C0QC 3FVQA 2QR2A 4HXFB 1HK7A 4KYTA 3MC1A 1TGVA 5DSZA 2BMAA 1JQBA 1X87A 2OOSA 1SCNE 4Q12A 1L4BA 5DZSA 4CKBB 4B3RB 1WMEA 5JSQA 1NUAA 1Z34A 1VG9B 4NYJQ 4TQGA 4OL0A 3ZI4A 2I34A 4IDBA 3KETA 4XJSA 4YCCA 1NQ5A 3CR3C 3FCEA 3MTIA 5AD1A 2XRYA 1AQNA 3K0AB 3M34A 3AESB 3CPJB 5EP1A 4NL4H 1QOPB 4KPGA 2Y8EA 4BV2A 3HEAA 4RHCA 2NZ2A 3I04A 3NONA 3ZDYB 4JC0A 1M83A 1GCUA 1QG2A 2HMAA 4NOMA 2PFGA 3PUYA 4CKWA 1T3TA 2OBFA 1E8NA 3DC7A 5FLKA 3WP1B 1NBOA 3GAAA 1U2PA 4R69A 4ZI7A 3Q9NA 2J33A 3Q3IA 4XQ0A 1UXJA 4IW3B 3VX4A 4Y2RA 4D46A 2XW6A 2WFLA 1KMMA 2QQFA 3W5CA 3RS8A 4WK2B 1DEAA 4Z9AA 4GGPA 3SDZA 1H23A 4ND2A 4S1VA 3KZXA 4TT3D 2SHKA 1E3LA 3LXRA 2NADA 3ROEA 4M0LA 3TF5A 2WILA 3AL2A 1RM5A 3T7AA 1QU3A 4NU8X 3HP1A 1JA9A 2G70A 5CEJA 1DARA 1UIMA 1HWYA 1ULHA 1W48A 4L7VA 5E38A 2VJNA 2A4KA 4OQFA 1NV9A 1ULBA 4RK0A 2P4SA 3UXMA 2C8KA 3K9LA 4HDAA 4R16A 4TS4A 4YP6A 4A1FA 2PKEA 1TZJA 2GSWA 2PGXA 2ODWA 3D8NA 4V24A 1J5XA 1MQSA 2QN1A 4AN0A 2GFQA 5CBPA 3KO8A 3FSRA 1HT1E 2FN8A 2HU7A 2QL6A 2XGOA 3P52A 4MKZA 4LOJA 1NMYA 4P4UA 3F3SA 4I1YA 4LPKA 3TW0A 3LHDA 2DEUA 4FEGA 1SZCA 2BW0A 3QX9A 4L02A 2NTEA 3GDHA 4LF5B 1GGFA 3EGDB 1Z6ZA 3D8HA 1R2QA 3PT9A 5KCMA 3OBBA 3TD6A 2DECA 3D5QA 1S5PA 2FWMX 1G9XA 1Y82A 3DMYA 1G41A 2OBLA 3NBXX 1Q57A 2WYVA 3NM5A 4CNQA 3GX1A 3M33A 5J4VA 1J8QA 1P4JA 1QHIA 5ELXA 2GPJA 2PH1A 4GVXA 5JAIA 1XTTA 1Z63A 1BMQA 3G2PA 4QFCA 4QU9A 4F4HA 8AT1A 2O5CA 4DEXA 1NN0A 2DLCX 4P2GA 1MABA 5HZGA 3WAJA 1FP4B 2QN3A 4GICA 4JZKA 4Q39A 1TYBE 2J32A 4EY7A 4AUKA 2QU7A 3TFOA 1A77A 2P9GA 4UZFA 4F4IA 4W5NA 3THYB 1XXHB 4BIIA 4X1KA 1CKEA 1FEZA 4LQ4A 4ESOA 2PSEA 3PF8A 4CM3A 5BSWA 1N36B 4FOOA 3KSRA 4J07A 4F96A 2WV7A 1FA9A 2G63A 5KQMA 2AJ8A 2FZ5A 2AN5A 4GC9A 1Q44A 2GYVA 3GL9A 4GZ6A 5EQTA 1C1DA 3BQMB 3BHJA 1XRRA 4N7BA 3SQLA 4I4NA 2AEFA 4YP5A 3ZWVA 4QUAA 1ZZEA 4WHMA 1RP7A 3HU2A 4PQFA 3C4JA 4RWZA 1LPMA 1UKEA 1ZINA 4O4JA 3ZE9A 5IPFA 1SCAA 2F9LA 3GWGA 2WQ7A 1R00A 1LKZA 2BHLA 2C9ZA 1PFGA 1XYGA 1ZZGA 2YWHA 3WMXA 1J4AA 2Q3BA 4MP6A 4PLGA 5LQDA 3GPBA 4LSGA 4IJKA 2XMBA 2W0SA 1ZJZA 3KEMA 4JP8A 1Q0LA 1R9MA 1U1GA 2W7TA 1KMNA 3N2GB 3A9UA 4G5OA 1GPJA 2H8GA 4IXDA 4ER0A 5JOQA 1K7XB 3NV9A 3PC3A 4X20B 3E3AA 5DI9A 4PG6A 4FFNA 5LN1A 5JH7F 2CK3A 4K9KA 5C8DA 5AM4A 2AA3A 3C3WA 5E6SA 1XHEA 4YRNA 4R0NA 4BWFB 5IARA 4Z1MD 3AEUA 3C43A 3FBGA 4CIYA 1DDIA 2H29A 4GOND 1EK5A 4PO1A 1GZ5A 2DT8A 3EZXA 5H4HA 4YUYA 3D8RA 4HJXA 1JEAA 4EITA 1SQGA 4RIIA 4JP3A 3ZNOA 3EFEA 4HWGA 5EZQA 3ZX4A 3AOEA 1O9GA 4KQHA 2RONA 3X1WA 3AM3A 4DIFA 4RMHA 3M82A 1E58A 1ZU5A 1FNNA 2XGSA 3C7KA 4X6LA 4YI5A 3W6PA 2W8ZA 3ECCA 1N2BA 3KLNA 2QT9A 4X93A 1LSJA 1TAHA 5ALOA 3VUFA 1NGSA 1OBFO 2JA1A 2XHEA 5LA6B 5JCXA 5LQKA 2D2FA 4Y9SA 1JG1A 3R7FA 1XU7A 5HBGA 4RX1A 2FMHA 1QOZA 3WA6A 2VYFA 3E9QA 4YJ2F 5EQFA 3VPFA 4DC1A 5DV9A 4HN9A 1OTYA 2BI7A 2BYTA 1JSRA 2FI1A 1RI2A 3V8BA 1DEKA 2Q2QA 4MUKA 1IZ7A 2VP0A 3SGLA 3T5AA 5CT8A 1DRJA 3F78A 4TWIA 4EJ0A 1NSYA 3VI4B 1Y3HA 2DE0X 3OZ7A 5FD8A 1VL0A 5AM5A 3PFCA 3T99A 4JXXA 4B8YA 5I7RA 1A98A 1A7AA 2JKZA 4AMYA 2YXPX 4CEIA 2GYUA 4AAYA 2ZYUX 3I12A 1PZEA 3PG5A 1N9ZA 5MN5A 2FG5A 1GA1A 2XA1A 4HTAA 2P9YA 3BL8A 2ONCA 4JT9A 3T4UA 3QMVA 1KL7A 1ZXXA 4ALJA 2I2BA 4KHPB 2W2QA 3FAKA 4ZT5A 2WE7A 4N7RA 5SV2A 3HB1A 4NABA 1UM9B 4IDDA 3IL2A 4DCPA 4S05A 2GN4A 3H2YA 5EWMB 3NIDB 3LV8A 1DEOA 4S04A 3DD5A 4QXMA 1SKYB 5JJ5A 2LPMA 2YZ7A 1EWKA 4GMHA 1SBHA 2AQIA 2ZTLA 4D1YA 3R8FA 1G19A 4MVJG 4H7KA 4UEJA 3VR0A 3ANTA 1RHJA 3LOQA 3E18A 5NLLA 1JQDA 1DWOA 1USUA 1FS4A 2J3JA 3DWEX 3NR2A 4M36A 4D3ZA 3M6MD 1G8AA 5C7YA 3VKUA 1SH7A 3TJZA 2Q45A 5EZYB 4FMDF 4CKYA 2CV0A 5C4GB 3ZV3A 3DE7X 5G0SA 1MG5A 2HWYA 1OZHA 4P83A 4YQZA 3TTWA 3UJ3X 2A6PA 2Y6VA 5E3HA 1Z0KA 1M9NA 4KW7A 2B0CA 2LDXA 5GM2A 3RVSA 1H0KA 1N3YA 2HQ1A 3FNGA 3PR1A 4I1SA 4J2HA 1D2CA 3NPMA 4N39A 1ZK2A 2QPAA 4P22A 1OH5A 3ASYA 3RADC 3COVA 3ET5A 3CF2A 4HXGA 3CO0S 1J39A 3F6YA 4YV7A 3CVYA 4O63O 1QWSA 5HKLA 5IJ9B 3C1AA 4L9WA 2V7TA 2XTNA 5EINA 1GAWA 4B74A 4WEQA 1GDHA 3LNCA 3P0EA 2OCBA 1VMEA 2X0DA 4RVCA 3EPPA 4ML3A 1UC8A 2B7LA 3CEHA 2J7PA 2OPHA 4E21A 1T9ZA 1Z38A 1GNSA 5IF9A 1X9IA 3HDHA 4LPSA 3KQHA 4NYJR 5C8VA 4EHHA 2EJWA 5H1YA 3K0FA 3T5DA 2CVHA 4M1QA 4BMNA 4BMZA 1L5NA 1K6JA 1CUIA 2EF1A 1OJLA 2NNWB 4Z9BA 1RKBA 4D74A 3QU4A 4MPPA 3WGGA 1PX2A 2VPTA 4LNUB 2FPIA 5FL3A 2DR3A 3H2SA 5B2EA 5FWXA 4BWGA 4P92A 4W6ZA 2VS1A 1YMQA 4XRRA 1E1NA 2O2YA 4HFJA 4QBKA 2ISSD 1FX0A 1XZBA 1GFSA 1M2FA 2NQTA 1X77A 5A3QA 1SC1A 1D09A 2N9UA 3EDMA 1ZN9A 3T0GA 4QULA 1SC3A 4QUIA 5CVEA 3O8OB 3AVQA 3GLKA 4H77A 2PKQO 4NYMR 1PR4A 4LK2A 4X8OA 3GY0A 1M6YA 1BQ4A 4MJLA 3E8SA 3H4MA 5ESWA 4EDFA 2JIOA 4EQZA 4J0HA 4A23A 3BMXA 1B2RA 3DLBA 1R66A 2E4ZA 4N5MA 1T4BA 2AV6A 3CH5A 5FI5A 4DLVA 3O93A 3L18A 1VHLA 5KYXB 3TO5A 1DG1G 3EIQA 4B31A 5G1OA 3U3KA 1MC1A 2AW5A 2ZQ5A 2BBSA 4TVKA 1UP6A 2FFJA 4KRFA 2Q7OE 3UWPA 1PJCA 3PNVA 4H6VA 4UJ5A 4ZOCA 3RIMA 3PQ8A 2JZCA 4Q4DA 3UPTA 3HJFA 1JZQA 3LOUA 1G9TA 2SBTA 3A7EA 3ZWKA 5C4IA 1GSHA 2BGUA 1AGNA 3VR4H 3LQQA 3U5ZB 4X63A 3ITEA 4Y2JA 5IU6A 5K3AA 2F4NA 2WZBA 4LJKA 3S2IA 1KEKA 1DXOA 1FJGB 1RP1A 4GL4A 4AC9A 5C8YF 4H7HA 4G5QA 2RGCA 4UFOA 4YMTA 5ALVA 4CN8A 1J97A 1YS1X 1ZD9A 1F5NA 3G2JA 4TUYA 1UC4B 2BKLA 5ED0A 1LLDA 3QVSA 3WGJA 4P54A 1NW6A 1JMVA 3VC3A 2YYAA 1TCBA 1XL0A 3LCVB 3M8KA 1IVSA 4NMHA 2IYZA 4EABA 4UNQA 2DPMA 3ZXIA 5KNLA 3OPQA 4L0QA 2QLTA 4R6WA 1GG8A 1K2WA 1U2RA 3EVGA 4IIUA 4LVOA 2LP4Y 5CYPA 4JA0A 5AKXA 5AWFC 4ACAA 1NVVQ 2BUCA 3OHSX 2GAJA 2EJUA 4TMXA 5FPTA 4DBLE 3PEEA 2NP7A 4LDNA 1E7WA 1UWKA 1T6ZA 3IUYA 4AJJA 3ZWXA 1NG9A 4ESHA 3FUTA 1K92A 3FNHA 3QY0A 3IUPA 1AGXA 3H1BA 3M49A 3O3MB 2ZBQA 2JJMA 1LBQA 2XKKA 3UFXB 4Z7QB 1A95A 2WMDA 1HE4A 3P8ZA 4AZ3A 1RJEA 1XVUA 3HFSA 2AZMA 3U61B 5LL6P 2BY4A 3COZA 5THKA 3PNPA 2FPXA 4GMKA 5LCXA 4HWRA 5JCZA 1BD3A 1CRQA 2CNWD 4P7JA 3D8UA 4C06A 5COQA 4JYAB 4ZREA 4KN9S 3OOHA 2P5SA 2BFCA 2TMDA 5TMPA 4E2ZA 4YUXA 2ZIWB 1NXXA 1NQOA 2ADMA 2B78A 2OAGA 3K31A 1E6KA 3B9PA 4R7ZA 4R41A 4EHIA 5EKXA 2XX3A 1GRQA 3GJTA 4HH3C 1Z6XA 4B6RA 2GF0A 2C8JA 4Y2VA 2FK7A 2BSAA 2GPWA 4NV1A 3RHFA 3TI7A 2WT4A 3V1UA 5JQGF 2FMTA 2VTBB 1CVIA 1MA3A 3RU9A 1GT6A 4UBIA 1PR0A 2HSGA 3QHQA 1EG2A 1ZLXA 4ALMA 3OX2A 2Q4OA 2WIAA 1WD7A 4WDQA 1I9CA 5AXCA 2F3TA 5DT9A 3QI2A 1WUIS 2JAOA 3BBPA 3QUCA 4WZAE 2HDWA 1ZUHA 2AG0A 2AOTB 3EEBA 2WWRA 3OM8A 4GEKA 4DCSA 1L2TA 2WQZA 1YZVA 2EWMA 3KPYA 5KIAA 2OZLA 3EISA 1L5WA 1OPXA 3MXTA 4DG5A 2XI4A 3ABZA 1BWQA 4O6VA 2GEDA 2D1QA 4MVJP 1HMPA 3OF5A 5DTJA 4MUHA 3X2FA 1PKEA 4PHHA 5PGMA 2DBVO 1A4IA 3GROA 5I7SA 1GN9A 1MABB 5ENVA 2LIVA 3T94A 3QVGA 4J9UE 2D06A 3E1GA 3ZHQA 3TD9A 1Q74A 5J2UF 2JAHA 5TR9A 4DV3B 3AKDA 4YROA 1HY3A 2RKOA 3GMIA 3I5UA 1LRLA 1XNHA 1C3OA 1UBFA 3K32A 5D5PA 5TARA 2VVTA 1C41A 1RNLA 1YR7A 2QLJA 1E9EA 4DUGA 4IHJF 3I30X 1ZM2A 2QZ4A 4CMEC 5KSPA 4IRMA 2XVYA 2Q50A 4LZPA 4MQ6A 3AERA 1GSIA 4C88A 1I13A 4EPTA 3LUPA 4B71A 2RE8A 3A2MA 1SEPA 1TYEB 5KTYA 1Z22A 1PK8A 2EDCA 2X77A 3MT7A 1PD0A 4YAGA 4WCFC 1RLOA 1XZKA 1HF3A 2X41A 3QPUA 4IZ6A 3N6VA 4JC8A 4AYWA 4JQCA 1BJRE 4EO9A 2BR4A 4MGHA 1FF9A 5CM2Z 3CWCA 2NSYA 1CK4A 4M22A 4PFSA 2QJWA 2VCEA 4KR6A 2VTKA 1E2MA 2X8BA 2XMGA 3I1FA 4GX5A 4NKRA 4UUNA 4ZQBA 3T41A 4DIOA 2J30A 5JSYA 5B4VA 2ZVDA 3HA2A 1JXAA 1QRUA 4O25A 4CL8A 1ZVJA 4X8LA 3FCXA 4E15A 2BT4A 2PZKA 1WZ2A 3MGGA 4V0OA 2PV7A 2W6PA 5JWRA 5LD2C 4KVGA 1XPOA 3TNLA 1ICEA 4QM6A 1CEEA 1UKAA 4N8SA 3ADCA 1BH2A 1UPUA 3AKYA 3CZ9A 5EHXA 2PU5A 4ENSA 5K6AA 2LW7A 3Q8WA 2WTNA 2O4UX 2VXBA 4Q37A 5BSRA 3OI7A 2J6BA 2RI1A 4FFLA 3EIWA 4NF2A 2QT0A 2YVQA 5GZ3A 3NGMA 1OLSB 2PL9A 2FW6A 5KOIA 4RCZA 4NV0A 4ALLA 2I78A 3SJZA 4XOUA 3EULA 1V26A 2BFFB 4HL6A 5FORA 3AXTA 3U37A 1RSZA 2D0OB 2WUFA 2HMVA 1DIBA 1KAOA 4GM0A 2GB4A 2QAGA 1HYBA 1UMBB 3CT6A 1Y8RB 5REQA 3TLBA 4GOJA 4Q9DA 1DG3A 5I8ZA 1SU4A 3A0UA 2NAFA 1F2TA 3CKLA 3NYRA 4GKKB 5L6MB 5HFNA 1Z8NA 3JQAA 1QP4A 4FJ1A 2Z9BA 2KPOA 2NP6A 3KKKA 3TPZA 1T9GS 5CVTA 2NV0A 2WM2A 1HKHA 1SD2A 3FNEA 2XJ9A 3MTJA 1TVKB 3UHOA 1XOIA 2WUDA 3TKLA 1JFLA 4AN1A 3SSMA 1VL6A 3TRHA 1VYUA 1CUFA 1Z0IA 2C7GA 1WU8A 4Q1AA 5J2TB 2EFDB 1LSSA 1W1UA 2A86A 2Q2WA 2YVAA 4OLHA 1UDRA 5EERA 3EQ2A 2WU1A 3HBNA 5FULA 4ZZ0A 1BCSB 1PJLA 3R09A 2YXDA 1EEHA 4L5CA 4HLNA 3MNFA 4YJKA 1N34B 1V7ZA 2Y1GA 3P45A 1GZ6A 1IMOA 1GPKA 1UH5A 2J45A 4Q3LA 4GKJB 4G0UA 4J43A 3ZY6A 1CR6A 4WUVA 1JDPA 1VSUA 1Y9JA 1MB2A 5ICCA 4ZRNA 2VF5X 4ZV7A 5BYBA 3T54A 1NOIA 2ECFA 3IQIX 4XDZA 1JFRA 2Z3WA 2R2GA 2CCKA 2G17A 3LGAA 1DC5A 1JMYA 5M3BA 3WK4A 1E2JA 1APBA 5U1PA 3ERCA 3D54D 4UEWA 1YL6A 4CV2A 5BMVF 3C4QA 1SEVA 1U7OA 1VCMA 4MRAA 4OXKA 3VSCA 2G6TA 1U7TA 4RHYA 3RRYA 4D9BA 1H3FA 1TM1E 2WYHA 4P86A 2HBRA 2QU8A 1PTJC 1R8QA 1ZICA 2Y1FA 4WXHA 2NVUB 5A9SB 3MWEB 2E49A 2XE8A 1MZPA 5HPYB 2ZETA 3GJ3A 5CFMA 4DMMA 2ID8A 2YZNA 3QV2A 1THZA 3HFRA 5A7HA 2R62A 2Q7DA 3TZQA 3DLTA 4G8BA 2F43A 3R7BA 1HE3A 1R88A 2FXIA 2VLIA 3C3XA 2N75A 3CF4G 3M5DA 4WL0A 3B85A 5CDTA 4BFUA 3UGJA 4H1HA 2JFOA 1LLCA 4NZYA 5JPIA 1RD4A 3L1HA 5GQSA 4YCMA 3OIFA 1JWAB 1U1FA 1QZXA 3FB1A 5TQ2B 1C4XA 3Q3HA 3H9UA 5DLYA 3U16A 1WW8A 1K89A 3GEMA 1FVFA 3LUBA 3NXSA 3IVAA 4L0CA 1US8B 2NV2B 2FN9A 1K27A 1V8BA 1XDWA 1RAHA 3A25A 4ZT7A 5AW3A 2VWQA 4MI9A 3B52X 3C5HA 1EBFA 3GPIA 4MV9A 4PYRA 4XARA 5CNJA 4JJ6A 4OA8A 4G07A 4FS8A 4PF1A 4CLDA 3ONNA 4MUEA 1T1RA 2BELA 1NTOA 2YS6A 3G0IA 3O8RA 3AVYA 2MYNA 3KSUA 1F4VA 3BDVA 1NU8A 2IGTA 3EVZA 1ZH0A 2I1WA 3KU1A 4N54A 1P1BA 4Q1VA 2FXVA 2OBNA 4MWZA 2HF8A 1E5XA 3TSYA 2G4LA 4MQEA 1VBFA 5A04A 4PIVA 3KR2A 4ZMSA 3GC6A 5L3SB 4FXPA 4YJ2A 4U1RA 2XMCA 3KSDO 5I7WA 3MJTA 4D80A 3QELA 1PYDA 3C6BA 3HY3A 4CF3A 3ZQ4A 4R84A 6LDHA 2PKYX 3EHDA 2RGRA 2ZIGA 4M1ZA 5CT5A 3GA0A 4JLOA 4QDTA 3HBMA 4BZXA 1FZTA 3N7AA 1DQRA 3G85A 5HA5A 3C6MA 2J6IA 4YBZA 3X1XA 1BE0A 1HDCA 4OIFA 3R5XA 4BNDB 2PM8A 1T1SA 1UBMS 1V3TA 4ND3A 3TIFA 1E4EB 3UJAA 2ZU6A 4F5YA 2R6ZA 3E82A 5KSWB 2P6RA 4B46A 5IKEA 4IGIA 1UDBA 4DRYA 4CF7A 3OQIA 1KXJA 3ASVA 1W5BA 4ECEA 3W3AH 4P53A 2OCLA 2OK8A 1S3IA 3WK5A 4OFWA 3MQ4A 3WGOA 4KUHA 2XNDD 3LL7A 4TPKA 4RTJA 4KFUA 5ICEA 1YOBA 2JB9A 1J2TA 3R24A 5HBRA 1JLLA 3R4CA 5DHQA 2PUBA 3MHTA 4LN1A 3AJEA 3S44A 3TB6A 4OQEA 3ICCA 3UT0A 1JFFB 2PH3A 4DDWA 2OAQ1 3BIWA 4GZMA 2PWPA 1BDMA 1VJCA 4Q4CA 2KWIA 3HDGA 4Q3OA 1G6HA 3HL0A 5DGHA 4F2WA 2CXSA 1N2HA 3FRIA 3IDZA 1P80A 4EHAA 1LNZA 1PJQA 2HY7A 1X94A 3TH5A 5KTKA 5EZSA 1IZYA 1Q1AA 2NYAA 1JQ5A 1NVTA 2NU8B 4BN5A 3C70A 2OSVA 3IO3A 2ZSHA 3SS7X 4LHZA 5K0LA 2WYOA 3ZXUB 1UDWA 4Q7EA 5C1OA 3TJMA 1ADBA 1F60A 1WUJS 2R8RA 4AULA 4HEQA 5FEMA 2IYYA 3BFKA 3MWKA 2IX3A 1TT5B 1TMOA 3QZUA 2RBKA 2GBGA 3TZLA 1AK9A 4MDHA 2WNHA 1PSDA 5AJXA 4PICA 1A72A 1IZ0A 2B36A 4UUMA 3I45A 3WJ7A 4L4ZA 5ERXA 4HDKB 2EARA 1MKYA 1GGEA 2Q7XA 2BUBA 3R0IA 3QY9A 5AJUA 2VP4A 4QHYA 3IE1A 4HQ0A 1GT91 2J85A 3DA8A 4E1BA 1ORIA 3S2UA 4RE6A 1Y8RA 2C57A 3GN1A 4FGZA 5GPBA 3WOVA 3CRW1 4EB8A 1QB7A 3ZDXB 1GP2A 2VEOA 2C2ZA 4FDUA 4I5DA 3FMFA 1PNVA 2FWIA 2R6AA 3ORHA 1K4MA 4KFTA 4DM4A 2CFRA 4ON9A 2PUDA 1W75A 2PD6A 4B44A 1ATZA 3MOSA 1BS9A 2ISCA 3LLCA 3SLKA 4MKHA 1YDEA 4CKEB 4F2HA 3N2YA 5JJKA 4LCBA 4CKWB 2AXNA 2BFCB 3M9WA 2BWJA 1B0PA 3WLJA 3HYSA 1Z88A 5FBRB 3FNIA 3GGJA 4X6YA 3N8NA 2XDAA 5ILQA 3TLKA 1XRPA 5ADHA 1ZIDA 4YRDA 4BMVA 4K2AA 3GUCA 4IQFA 3E0XA 3QVOA 1HDGO 3F6EX 3QF7A 3PNBA 1YGPA 3RYIB 2XZLA 4AY2A 1QB8A 3WADA 5HS4A 4PGGA 3TNJA 1FDSA 4OIMA 4ZT6A 1MQ9A 3COWA 4OBBA 1CLUA 4CMJA 3HVRA 2XBLA 1ZISA 2G25A 3FWPA 2QE7D 4JNKA 1VSQA 4P3YA 4C3UA 3HCCA 1IBSA 3CPEA 3PGVA 1N1GA 5LYYA 3VZDA 4IVPA 1YVPA 2E1RA 1W5TA 1EJ0A 3BSYA 5DU2A 1QQ7A 1S01A 3AHHA 1KEZA 3Q6IA 4BB6A 4XJTA 5LZ7A 3R8XA 2BMJA 1KO7A 1RM0A 5LQCA 2H1VA 1UJMA 4OM7A 1T13A 3E3OA 5EE9A 5KOHB 1T2AA 5B37A 2MIIA 2HX1A 1X9HA 4ZYWA 1QYDA 5BSTA 2WWIA 4L73A 4KXWA 4MW2A 3LC1O 3BWEA 5AVSA 3PHBE 1ZNYA 5BR7A 2GN0A 2QORA 3DE6X 4NH0A 2IGBA 3L41A 4B4VA 4XCQA 1CWUA 5AR1A 2EAUA 4AP6A 4RGYA 3A9CA 3B5JA 3EGOA 1FFEA 3JY6A 5IVIA 4YT4A 1ECBA 2JFNA 2DTEA 2AFHB 3DZJA 2UVQA 4F3RA 2IYAA 4D4KA 5G0WA 5K0EA 1RJ9B 2Q6OA 1DU4A 5JCJA 2P4HX 4F12A 2R4UA 1AMNA 4FFBB 3LUKA 3U3MA 3AEQA 3TSAA 4UOZA 1KP9A 2PJRA 3IHKA 3JTMA 1W5FA 4KQJA 1TO2E 1TX4B 4Q9JA 2ZM5A 1QKJA 4L51A 1G2IA 1N7HA 4A15A 2ZB8A 4R2HA 2XRZA 2G1JA 4QUGA 4YCJA 3VU9A 5DHTA 3PE3A 3OZIA 1V48A 4J4BA 4ZIRB 1RBYA 1RYMA 2AWOA 2CJWB 1KVRA 3FNBA 1CZLA 1PWHA 4R2XA 5JANA 3WGTA 4IF6A 1DXYA 4UDYX 2W58A 4FEEA 1IBLB 1ZEJA 3EDOA 5LLDA 1USWA 1AUOA 2O7VA 1XVLA 1GZ4A 5CVVA 5DFAA 5JEEA 5TS3A 2Y1WA 2DUMA 1A96A 2HLPA 3PLAE 1DG9A 1E5DA 4TTQA 1KRXA 2V6GA 3LXXA 2F1HA 4QUHA 5F9FA 5E9WA 2ZATA 2HF7A 1BROA 2QM0A 1IG0A 3LLMA 1F3OA 4HAYA 4JC4A 4DIBA 4RDXA 2Z95A 4JBGA 4IMIB 2BCEA 1IY0A 2LBPA 1PZGA 2V7BA 4QGAA 1NZFA 3VU8A 3W9YA 2NO7A 2ZWAA 4U00A 3OTWA 2P91A 4LQLA 1HORA 4J0QA 3WJ2A 3SS8A 5A02A 4E31A 4E88A 2V58A 4D3SA 4YRAA 6AT1A 1J1UA 1U3FA 3ANNA 1WBDA 1LLUA 3AX6A 1XRSB 1PJTA 3GVPA 4AJOA 4MUAA 1JR2A 2D5BA 4NECA 2A59A 2HO5A 1F0KA 4OK5A 1CUXA 2X0FA 2GS9A 4MV0A 4KDCA 3PGLA 3THOA 1K7CA 4IRXA 5BQ3A 5GJBA 3RIYA 3AOGA 2GN1A 3MJEA 2VSYA 4PLVA 5D3ZA 3WGIA 2ZM6B 1U8XX 1UCFA 3HCPA 3UB4A 2IZ5A 4ARAA 1ZJ4A 1U9YA 2CE7A 3EQ6A 3FOAA 1VCIA 1X0XA 3DXZA 3QKSA 4PPFA 5E7MA 1OTHA 3MWGA 4EZIA 2REQA 1ZC4A 4PWZA 5IH3A 1SOAA 4NCBA 3AF4A 4Z4QA 3EXFB 3LHFA 2Z2YA 3L5KA 4XSVA 2XVMA 1FXSA 1J20A 2C3MA 5K0NA 1JR3A 3EG9B 2HV9A 3QFTA 4HH4A 4OK6A 5ITVA 4N5IX 1YASA 3NVAA 4M99A 4R5HA 1X2BA 2BLNA 1S2LA 4HBGA 1XKQA 2P79A 3DSRA 4V0MA 1G2PA 4ZU3A 4KITB 6REQA 1LSUA 1ZOPA 3HCEA 1JVSA 2CLDX 1NUQA 2YJ3A 2VDOB 3AFNA 4I5FA 5DBEX 5ELMA 3UH0A 3GBVA 3HBAA 2AF3C 3FFWA 5IDYA 4B85A 3R9WA 3FKQA 4NYIQ 1XQ1A 2FPPA 2VDNB 4E5YA 4FZRA 2VJLA 4EFLA 1F17A 1XLWA 1RPAA 3JQAD 2PKXA 4BUJA 4LG1A 4S1OA 1VMKA 5LA6A 2DH6A 1NN3A 1V5IA 1VA4A 2FG6C 5FYDA 2EBWA 4JJKA 5E4FA 1SA0B 4V0ME 3OCJA 3VR6H 3OU2A 2NO6A 1FYDA 2GDZA 1UOPA 1G20E 3BCUA 4GD3Q 5FPKA 1COWD 4MYCA 3OX4A 3D2CA 4LX8A 4MHTA 1YIOA 5EN4A 3CW2A 1K6MA 4YRLA 1XTJA 4M6WA 5F98A 2OBBA 1XA0A 1JKXA 2O3JA 4FGSA 1OR8A 4MQLA 3G8BA 4LXQA 1KFKB 5F1PA 5FH9A 1NI4B 2RMKA 5HJ7A 4G41A 4R2JA 1H69A 1ZH6A 4IWNA 1E3MA 2E85A 4CFSA 3T8YA 2ZYWX 1XZIA 3H5OA 1IOWA 5K8TA 2XDWA 2OO3A 3OD1A 1EQ2A 5JNWA 4LY6A 4L22A 4N01A 1AHNA 2MR5A 4E09A 4R9UC 3RUDA 1ESNA 1IJFA 2I87A 3T1OA 4E5DA 4EHFA 3BF7A 4WMLA 4ZYUA 1LDYA 5LD2B 2BV3A 2B4AA 3NBUA 1XLVA 3DD1A 2YWRA 3TQHA 3M2PA 1PVOA 1N5LA 1VHQA 5AFSA 2GEKA 3QLUC 3VH1A 3L40A 2PZJA 3B9RA 4XAQA 5IKPA 4EQ6B 4YMIA 3OC6A 5KYYB 4NENA 2WIGA 2R6HA 3QVMA 3FPEA 3TEFA 2OKCA 3KTAB 4EM6A 3I2IA 4UHDA 4F56A 3KWMA 1NHGA 3LI2A 2OFPA 1U0HC 2J1LA 2QX6A 1JIJA 5CUQA 1H2ZA 3ROXA 1PFYA 3C7TA 2MYPA 2IF0A 1H9BA 2WJVA 2ZT8A 3THWB 1L5HB 4ND8A 1XZPA 2XUHA 4EL5A 1WUYA 3U7QA 3MCVA 5K8JB 4KFRA 1XEWX 2MTBA 4BFVA 4XX0B 1NE2A 1VSTA 1LBHA 4LXHA 3PX7A 4UCWA 1YI1A 4MQMA 3HKBA 1V41E 3H11B 3TUZC 1Q95A 1UWCA 4PINA 2HRRA 3L8FA 1M8FA 1R6DA 1VLHA 4KQGA 4ZYLA 4KR0A 3WLAA 2G7MC 4Q1BA 4CF5A 2X9QA 4LVCA 3NDJA 3QE4A 5ULLA 4G9EA 3SYNA 2WG2A 3I2YX 3LBIA 1YBAA 4PC3A 4UBKA 5EMLA 3RQSA 5C37A 4M86A 3Q3GE 4MEBA 1O5TA 4D9IA 10MHA 4W8GA 2GEBA 5U4QA 2X1VA 3SBEA 2NV6A 3KKNA 6GPBA 4KIGA 3VH4A 4FLEA 2A9JA 2VF7A 4BMDA 3AP3A 1HE1C 1E0DA 3KJIA 1QP0A 1L5FA 1D07A 2QSYA 1L7QA 3QBJA 4FN5A 5HILA 2XEDA 1GGKA 2CZGA 4TVOA 4B3GA 2X6RA 3UVEA 1NBMA 1OMOA 1AD2A 4N7JA 3M9XA 1OFGA 3CYFA 3F2VA 3DQQA 4XIFA 4JDUA 1D7OA 3MZ0A 2G4VA 1DC6A 3HJAA 3RK4A 5CXQA 1E5TA 2Z04A 3L02A 5T3UA 1OWOA 3THXB 4CLXA 1Z3CA 4JLSA 4OGGA 1PEKE 4TRRA 1FFDA 3HZRA 2DC1A 3O7MA 3SJAA 4JQSA 3IVRA 1BGWA 4I14A 5AVQA 2BF7A 2H4ZA 2IYOA 3LFUA 1PBTA 2GI4A 2P8SA 4EGAA 2J0QA 3JWHA 3I72A 2DBZA 3PXGA 4FB4A 1N7JA 3F9IA 5C5DA 3QYFA 1KAGA 1QIHA 2GO1A 2OZEA 2FZ4A 2Q27A 4JI3B 3GPLA 2VXCA 4Y1RB 2VRNA 4G86A 2AWNA 4RZXA 2X5JO 3W9BA 1P9OA 2NW6A 2IQIA 3LUCA 1HZZA 4PSKA 1OHHA 5AJHA 5EUBA 3WR5A 4QUBA 1W29A 3UHAA 1Y4SA 5DMXA 5CT6A 4BMSA 3CEJA 4U8GA 2HEIA 5AQ1A 1NLYA 3ROTA 2ZJ4A 2TYSB 5AH0A 3G8CA 1ISHA 2I62A 2P78A 3OE1A 2RI6A 1OLUB 2E6UX 2BFDA 5KC8A 4KIWA 1U11A 2C4KA 3ZE2B 3FD8A 4X1IA 3FOFC 3DM5A 1ZIXA 1VIMA 2P67A 1MFZA 2FZVA 3NWEA 3PRJA 3DJFA 4IS3A 3TDMA 1SQ6A 2Q3CA 1E3JA 1U80A 3DDWA 1NW3A 2E4AA 3MN1A 1P33A 3N8GA 4L6CA 3ZU2A 3R41A 1DDOA 2YFHA 3INYA 4UARA 5LBTA 3H5TA 1MC8A 1YQDA 4RO0A 1EXVA 3LL4A 4EUFA 5KJFA 2AX3A 3AZQA 2A9VA 4ALIA 4A8TA 5JAUA 3L84A 3OIYA 2GCIA 2E4YA 2PZAA 4BV8A 2AGVA 2ICAA 1NVUQ 3H19A 2XTAA 3I9NA 5AUQA 1DJQA 2G1KA 3HVIA 3N8HA 1DX4A 4MQBA 4U2FA 5T4FA 4F85A 5TJ9A 1L5KA 3RBAA 8ABPA 3RYCA 1H85A 5TLSA 1CJVC 2NU8A 2P68A 3BG5A 2P3OA 4JLMA 5DASA 3R7LA 3VFDA 4RCYA 1Y3DE 2PX3A 3CUWA 4R8RA 4C01A 4R1UA 3MW8A 1Y8ZA 1T9BA 2HXSA 1SM4A 1MVLA 5I9LA 1EJ2A 2OHJA 3R0JA 2WY2D 2QVZX 2PGJA 5EGNA 3OFVA 5L4SA 3KOOA 1UBEA 4XGNA 4QUEA 5CMLA 5EMMA 2NT4A 4YAUA 4WAUA 3A2KA 2XKJE 3OIWA 3A28A 3A32A 4L1KA 4RFLA 4FHFA 4MKFA 1DELA 3JWEA 3QLVC 5DE3A 5DXFA 1AF7A 4HGYA 3CT4A 1W73A 3EXHB 3HV2A 5IFKA 1X7ZA 2C07A 3F6SA 3FDIA 3KQUA 3RSLA 4DR3B 3OUZA 3HPRA 1W36D 4HPWA 5L45A 3IBGA 3IUBA 3V8RA 4PTYA 3AVTA 4D9FA 3VDQA 2E18A 5ESRA 3CTPA 1KGDA 1TKBA 3RT1A 1KY4A 2A30A 1VKOA 2GCEA 4M87A 3FETA 5HDQA 4XGKA 2G9NA 3VSAA 1F14A 2NU6B 2QUAA 2PX5A 1H4QA 1KEEB 4II3A 5A2QA 5EEHA 5HR5A 3IEVA 4KMMA 2PIDA 4MWEA 3S70A 3S2YA 4GS5A 3ZU3A 4C1NA 1TAUA 4C9BA 1J99A 1HI9A 1NXQA 2NUBA 5G40A 3GDFA 4YJ3B 3OPYI 3G68A 2WOOA 4Q93A 2B1QA 3WZLA 1SBZA 3A2NA 2CNBA 4ZKEA 5MF6A 2ZUUA 2NZVG 2C4VA 1SHKA 1YJ5A 2AEMA 2OWDA 1IG3A 1R0ZA 2P69A 2Y68A 3C7DB 1LJUA 1NJ6A 3CJTA 5DHPA 5H82A 4KKVA 1SVMA 4OLFA 2I99A 4OEHA 3G6KA 1E1DA 2CFTA 5FFNA 3BBLA 2EFHB 3SDSA 4NOLA 4DEVA 1ZNZA 3N7UA 1GGVA 1FP4A 4II7A 4B9AA 3BWDD 5JT1A 2BGTA 3PSAA 1U8FO 4JT2A 1XZAA 4FQ7A 5JS1A 2NM0A 1WLSA 4KAFA 5DLDA 5HJ5A 3EODA 5EXXA 4C3OB 1SULA 1F8FA 2BAGA 2WOJA 2IA5A 1C8LA 1U6IA 1XCMA 1J49A 2IRWA 1EFVA 1TK3A 3W2FA 3B7PA 2QYHA 3BFJA 3KJNA 4WFKA 3FIUA 2O23A 3IQDB 1EK0A 2UYGA 2B2NA 1YUNA 1XU4A 7ADHA 4EHLA 2CUNA 3ZJVA 2LVBA 2Q3MA 1P3JA 5EJAA 4ZRDA 4B7CA 3M6WA 4Y6OA 1ZN2A 3IAS1 3NHMA 4B3IA 1JI0A 3OZEA 3EIEA 1CZKA 4AY5A 5P8WA 1QGED 3IPXA 3QU2A 4M8KA 1HDEA 2FSGA 1LCIA 3W4JA 2PBZA 3K70B 1IUNA 3GP8A 3L0BA 1GEEA 2QNRA 3HLKA 2ZJOA 4Q3DA 1P1FA 2PBFA 4K6FA 2FMFA 1KR2A 1N9KA 3ETGA 2DBRA 3O3CA 4PZPA 3RUEA 3RH0A 2Q5EA 1JLRA 2P0AA 2YASA 2BLLA 5GZ6A 1HYHA 5JZ9A 4KVAA 4MYRA 3MTAA 5JDCC 3SC4A 5H16A 3PT5A 2EL9A 1YCDA 4NQZA 3DL4A 3HRKA 4GPZA 2P8JA 4XQEA 4UPEA 1VSVA 2RC5A 1I1OA 2ODBA 2Q3JA 4X95A 3RVNA 3B6ZA 2BJHA 5AHWA 1ZGCA 3K0KA 2C04A 1JHQA 3NG1A 3LOPA 4CTMA 5AW5A 2Y3IA 1ZMBA 4B6FA 4AJPA 3GT7A 1CERA 3OJLA 1M6VA 1HDXA 1YZHA 2DBQA 1KRHA 1F1JA 2GEJA 1LS1A 3JAWB 5DP1A 1P81A 1V5GA 2HPAA 2I33A 3BILA 3OZAA 3ONVA 5AI0A 4HGQA 2QZJA 3LCRA 4NV3A 3R2JA 1QIEA 3A4TA 3EY9A 3JD4A 4WN3A 3L7IA 2W98A 1QKIA 3KZCA 3IPAA 1W88B 4YI3A 1J22A 1IN6A 3ROPA 1BMFD 1FDRA 4HLCA 3WZ2A 3OKPA 2UYCA 2DCMA 3RKSA 4XZ3A 4B81A 3KEGA 4GRDA 5KYXA 5REQB 1F0NA 1U3WA 4AK9A 4YXWA 4G0YA 1D4ZA 1K4YA 2RGNC 4ZKDA 4FYVA 4DPKA 4RL6A 1STOA 3I39X 3LIIA 4GFDA 6NULA 2WUVA 3H05A 3M6XA 5DBGA 3T7IA 5K0GA 4F2DA 5FUXA 1JXOA 2HU5A 1NQTA 1P9NA 3CVJA 3BCRA 3QKWA 1TMYA 2PR2A 4G9GA 4HSEA 2J3DA 1DPFA 1JJBA 3C3DA 3O8OA 4EHKA 4FPXA 2P6UA 1KK0A 2EKZA 4QATA 3IP9A 2G76A 2Y27A 3EVTA 4CT5A 4F4CA 4YCLA 1KE2A 4WDRA 1FP6A 2BF4A 4ZDIA 5IC5A 4K28A 3R6LA 3KB8A 1L3IA 3ZV5A 3S81A 2CDCA 1BVHA 1QNLA 5K8LA 1VZ3A 4L4SA 2LE0A 3WHKA 1KQNA 4AIRA 4FOLA 3RU3A 1M2EA 7REQB 3UJNA 2W2TA 3B8HA 1CUHA 2RJNA 4G24A 1XNGA 4LRSB 4RYDA 4LAFA 3P32A 2CL6X 3VOBA 4FBLA 4N5DA 1MIOA 1L5RA 1XEWY 4JBXA 5FADA 3AT1A 3RS9A 4E14A 4QDZA 2QTZA 4EKDA 4NPHA 4BX3A 2ZRNA 3T7EA 1F7UA 1K3TA 1P1HA 2CVPA 2QTBA 3ZKAA 2JW5A 4F6RA 3FOCA 2OP1A 3FHTA 5IULC 1PV2A 1YCGA 3KR9A 3A58B 3KX2A 4FGUA 2IP1A 4KXNA 2AC2A 1VL2A 2EFEB 2YWGA 1E1RD 4LXYA 3WGKA 1WL8A 3F5MA 3I2JA 3Q9UA 4GP6A 2C1XA 4ER3A 1QGUB 1LBEA 4F45A 2F64A 3KOWA 5DRTA 1YNOA 1TM3E 1XP5A 2R96A 3KWLA 4BQPA 1EH5A 1Q21A 2VHQA 3GEIA 3M7IA 2B9EA 4FZ3A 4JUCA 2Q5LA 4OH7A 3V7WA 4HXEB 3P0JA 1K8YB 3PXAA 3SQNA 1ZX1A 1DSSG 3KQYA 2NLOA 5K0TA 5IUNC 3EAQA 4JWKA 2GF2A 2WTMA 3NHFA 1OKKA 3B3FA 1BSVA 2VA9A 1NXVA 5F77A 4XVUA 2I3AA 3C6QA 1NW8A 1PNTA 4HDCA 3VJLA 1KKMA 4Z9XA 3QTLA 3MRXA 1J0DA 3AEKB 2YHIA 3HVUA 4I99A 3VSDA 2PG3A 3AHCA 4K9DA 5ITSA 4NU0A 2WHQA 4IDOA 2PU7A 4MKRA 4CL2A 5BPHA 3ZN2A 1EWYA 5K20A 1JH9A 2YBDA 2JZOA 3BM5A 1EMDA 3I6QA 4WH0A 2VO1A 2FP4B 2J3EA 3L6UA 3LT1A 4W1QA 4WKGA 3K2BA 2YOHA 4BO5A 4DXHA 2VJOA 1D04A 5MGBA 3LMKA 3OC0A 3PEYA 1U9CA 4LJLA 3VH3A 2XYVA 4M6WB 1D6SA 5LYJA 2PWBA 4AX4A 5K0CA 3G2IA 3O1HB 2D3TA 4BGEA 2C4TA 5KBYA 4LRYA 2CT8A 3CUSA 3FJYA 3CG4A 5MFZA 4C5AA 2PRSA 1DWQA 3V1KA 5DBHX 2WJIA 1E2EA 1C3VA 1Y5RA 3OJEA 4P38A 3EOAI 4RVNA 3KTFA 1G64A 4GOMD 3IHLA 5HIKA 3VR3A 3JQGA 3SBOA 1FP2A 2FYTA 3UUGA 5DIFA 2CVQA 4BP3A 1GXSA 4DQDA 2GCOA 2HFKA 2R4TA 2WV9A 1VE5A 4B7XA 3IT2A 1NNI1 2BFOA 3OZSA 3GARA 2OR3A 4O1IA 3OZUA 2NIPA 3HBJA 2B5WA 4W9MC 3CE9A 5CNKA 3E8XA 1IUKA 1XCBA 2AJTA 3B6EA 3A1NA 1M33A 1ZLYA 4C78A 1M1NA 4N4AA 1H3EA 1KTVA 3EGCA 4PX2A 4TRMA 2GM3A 1S2DA 3AMVA 5HIIA 2NU7A 1HNZB 3NHZA 4QTZA 1Z08A 1KORA 2AFIA 3UK2A 1QLJA 5EI5A 3WL7A 2Q4TA 2Z2XA 3D4PA 3PLNA 4LJYA 2OXEA 2R85A 4IUDS 3GLFB 2VUHB 2GVDC 5EUMA 4MB0A 3TIXB 1WCV1 2AHOA 1JTVA 4I19A 5IRCD 4FMPA 1CIPA 5DSXA 3HTXA 1RYEA 4P84A 2BZ1A 2ERYA 2W0MA 3IEUA 5CHEA 2CL7X 3BKWA 5JBIA 2XSZA 1CQJB 3Q88A 3TLAA 5DEIA 1ZOSA 3KKLA 3ZUPA 4YRMA 1E61A 3C1UA 4RZQA 3ZZNA 2OAEA 3E3NA 1EP1B 2X40A 3H1EA 3P5SA 3P20A 3WBBA 5J4YA 2BJVA 1E1RA 2GK6A 1IONA 5BV0A 3PBKA 5BNZA 2X5OA 3C15C 4ZVPA 1PG5A 3D7LA 3HI6A 4J0CA 2RAVA 3A3KA 3COSA 2AOUA 3F71A 1RBMA 4ARUA 4B1FA 3JQFC 1J90A 4JENA 4ZN6A 1ZOLA 4ONEA 1M1ZA 4CKZA 3LECA 4RDHA 5DK6A 5KDLA 1CB7A 5A4IS 2IITA 3KYCB 3QFFA 1SRQA 3D7KA 3FDJA 5FF9A 5CEFA 5EGSA 2WHPA 4PPNA 2HQOA 1GGMA 1RMYA 2VATA 2ZYVX 3FSJX 3MLBA 3T4PA 5CXUA 4A6EA 3EVDA 1ZEMA 4INOA 4LDAA 4G4JA 4M1SA 2JJ8A 4Z2YA 1TM7E 1D1TA 5A4FS 2XUIA 3K6KA 2W4IA 4DMLA 1AKUA 3AEYA 1YB6A 2VHEA 3HO8A 4JCOA 4C6HA 1KETA 3ETCA 1O9HA 1HLFA 3TRDA 2DBYA 1Z0AA 1C3LA 2QJFA 4PANA 5HRCA 1EDOA 2V45A 3DTVA 1YR9A 3V1TC 3L77A 1RLJA 1KERA 2PRZA 4GC5A 4LOLA 2DSNA 2YNMD 5FNVF 2FSUA 1XA4A 5LVAA 1T3HA 4KQEA 2FW0A 2HL6A 4RTRA 4I3FA 1AZWA 2QL5A 2JAWA 3SN6A 4EWLA 2UVPA 1FFGA 5HM6A 4QTXA 2H0RA 3P2IA 2Z83A 2O3QA 1VKJA 4IP0A 1ECLA 4P5EA 2UV8A 4I9FA 3HZHA 1X1EA 4WJZA 3SX4A 2D1SA 4EPYA 3GFOA 4I1OA 4IHJA 3ZHBA 3JQQA 5JXWA 4OMCA 4TTVA 2HNKA 1K3FA 3FGPA 2IYTA 1Q17A 1NJ2A 2TMKA 4FYWA 1H2BA 2X19A 2FPIB 4H27A 5KDOA 4OQXA 2F1RA 4ZOBA 1WM1A 1CIVA 1N8SA 1QG0A 4TKLA 3R3YA 1JEOA 4BJHB 4EENA 5C2JB 3B8EA 4UM7A 2PANA 5SYAA 2VNIA 2FPUA 4DPMA 1G4UR 2HD4A 4Q4LA 4DIUA 4I66A 1BKYA 5ALZA 4QG7A 5CDGA 4UHBA 3LQYA 2PEZA 2FN3A 3NKLA 4K9NA 2C2MA 2H00A 2VAPA 4OB6A 1W8IA 2ZXUA 5T4BA 1MRNA 3AUFA 1NSTA 2VYVD 2XTMA 1JE1A 3DQZA 1O94D 1OLOA 2FW8A 3FMVA 3KKZA 3H5AA 2QUKA 1ZBQA 1SKMA 4GBJA 2I6SA 4EA7A 2WUGA 2PZFA 1IVNA 3GJXC 2ACWA 4XYEA 1K9SA 1RHMA 2O57A 4YV1A 1N92A 2CNKA 3W3AD 3LQ4A 4AF7A 1CUBA 2QNBA 4UQPA 1G7TA 2ROQA 5B53A 4FS3A 3I61A 4C87A 3OJ0A 3WFJA 2M9MA 1G6KA 2QXYA 4MO2A 1CHNA 1JHXA 3F6RA 3OCWA 4QPJC 4UC0A 2H07A 4WW0A 3KOYA 5ALPA 3ETJA 1MEJA 1N5KA 1AV6A 4J16A 2OYCA 1XVIA 3SEAA 2MSWA 5KMGB 4IIXA 4A6DA 3O8CA 4NPAA 1Q7EA 2V0GA 4HNHA 4DA6A 3ETEA 3K1AA 2RARA 1IPFA 1EFPA 3USCS 3WB2A 4NNJA 4N18A 2ZI6A 2YQ4A 3P2MA 1DAFA 2VSNA 3EF1A 3H1AA 3OCXA 4PYMA 4RTPA 1H6AA 4QNRA 2RCNA 5TSDA 2B8WA 1GARA 4RSGA 1QZ3A 1WDWB 3GMDA 3PNKA 5HIJA 2G5CA 1A5BB 1E3DA 3GGCA 4BB0A 2ZBUA 5E2AA 2JDID 4E12A 4DFDA 1VDMA 4XQGA 3G6WA 4LZLA 1QRAA 4XWYA 1A76A 4GM4A 1TYZA 1U90A 1IXZA 3GAMA 2RGAA 2VJCA 1OBOA 1RWNA 1BGVA 2AHRA 3DMDA 1RHUA 4M7WA 4LSMA 1L5MA 1JTEA 3H5VA 3AINA 1FS5A 1PDOA 3D3EA 3DC2A 2OHHA 2WDZA 3LY5A 4PN3A 1NFRA 1YC2A 4KN6A 3EGWA 4YJFB 2A84A 5DT2A 3DVAB 2C42A 4WGFA 1YBMA 5KAPA 3DWFA 2HDOA 2Q5FA 3RODA 3OIUA 4F3YA 5KSYA 3C3PA 1JPJA 3II6X 4DMFA 1GTRA 1GTJ1 1Z0FA 2WJGA 3CHYA 5FFFA 1NULA 1YHNA 1TL7C 5B1EA 1L3CA 3O0DA 4WLNA 3QI7A 1P5ZB 3GJZA 5MFPA 1DADA 3PNLA 4JGGA 3ZZTA 4KR7A 1DEXA 2FF7A 2HLDA 4OP2A 3SJCA 2PHZA 1DBIA 1EE1A 1PR1A 1GILA 2A88A 2PQ0A 3GRZA 1G5PA 2QXTA 3G8DA 3MWJA 4A82A 2B9VA 4BZQA 2H2WA 5BP7A 5KNBA 4OHVA 1K6XA 5FQOA 3CX3A 1LI7A 4KO8A 3RVMA 3NIBA 4LE2A 4BBJA 3W7AA 4EEXA 2FEAA 3DMRA 3FPLA 4IJWA 5DTEA 5TEVA 2CXHA 2QYSA 3EEQA 5DCUA 5LZ8A 4HUJA 4M8SA 3DXFA 1E7MA 4PC1A 5CDFA 3WAKA 3BC1A 4P34A 4OFXA 4AY6A 1IDOA 3I9OA 4D4JA 2GK4A 1FVHA 3ETDA 4QSMA 3LX5A 3RBVA 3WLKX 3KFVA 4OAOA 4A92A 4G0WA 1E60A 2P6MA 4D9GA 4IUCS 3REFA 3LKVA 5KYUA 5KTTA 3K9HA 5E6UB 2PH7A 3AIMA 2TMYA 3DYIA 1IIBA 1DKRA 1OBCA 1UJ2A 1TDJA 5CEEA 4IMRA 1YHYA 2G3YA 5B58T 1SA0A 1W88A 3TE7A 4WJLA 2Z2ZA 2E4VA 5CAEA 2CBZA 4K05A 4WD3A 4QJIA 2HZ7A 3WYCA 3JVEA 2ZVQX 3CEAA 3ZGNA 2AC7A 3HGTA 1KH2A 2C58A 4K46A 3VH2A 3IDAA 4PS0A 3RJMA 2QGNA 4IOMA 4Z4GA 1VE9A 1T2EA 3A3OA 2H51A 2UUPA 2IY9A 3DKRA 3MM4A 3ND7A 3QU5A 3GRUA 2V4UA 4KVFA 4BNFA 1EDBA 2W6JA 1EK1A 1VPVA 1V4BA 2DOKA 4H0CA 4L0DA 3U7QB 2HKIA 1QHSA 3OJFA 5KTRA 2NTNA 1RS0A 4OQZA 4BBZA 5LQJA 1Z12A 2GRUA 2XYPA 2V98A 2XB9A 1AURA 5IT9A 1GPNA 3C6XA 1IXYA 4YMUA 3ED5A 3F97A 5FV4A 4NFYA 3WQRA 1PL6A 3LJKA 1U2EA 5LOVB 3EVCA 2JEOA 4B48A 5K4AA 1KDTA 4W4TA 1EFUA 2O7RA 4GQBA 2ZAOA 4G5FA 3BZUA 1P0PA 3E6AA 4H16A 4XIYA 3KT0A 5D6OA 4N82A 1ECGA 2V7UA 4XWAA 4GSLA 4Q7MB 1NP6A 4C30A 3ZIUA 2F59A 1A88A 4DT1A 1MW9X 2C88A 2MMCA 5A4KA 2Q1WA 3HCOA 1VCOA 4TQ9A 3UN1A 1E4OA 1P8AA 2PRJA 4LDQA 1UKZA 4DC0A 1NMQA 5HCIA 1LU9A 2ZTSA 4BO4A 4ZHSA 2AZDA 1KAMA 1T10A 4MIEA 1GRCA 3HCNA 1RZ3A 4JB2A 3GEHA 1W4BA 1Z5VA 2PMKA 5JO0A 3CISA 1QIGA 3GCGA 2ZANA 2AG6A 4BNNA 2OUIA 3MCWA 2QW1A 2XITA 4IZIA 2FWRA 2R1VB 4RV4A 2IHTA 5IANA 2R86A 4QPZA 1B14A 2NSLA 4A2CA 4EA6A 5B7QA 4DCOA 4LJ4A 2C5FA 1G3IA 1UPCA 4NXMB 2PUHA 4H3VA 3GRVA 1C7RA 2BFBB 1Y5NA 2G71A 1O6FA 2WTBA 3RVBA 1XJ5A 2NSJA 2NYRA 5BN3A 4U39A 2I3GA 2W5UA 4DMHA 2WW8A 4HNTA 1FRNA 3GBPA 4HNQA 5HF6A 1XKLA 3V4ZA 3ESXA 2XRMA 2IBTA 1LI5A 1YIDA 1YV9A 3PYLA 3BXPA 4NENB 2H4HA 2Z9CA 1HH4A 5AVZA 3K5HA 2B8EA 5HUJA 2XB2A 1N3BA 3VNQA 1BXRA 3R8CA 3E9EA 1HXHA 4K40A 1N4DA 4DRZA 5LSAA 2RK4A 3OQIB 1T3LA 4KH1A 4J0FA 3G2KA 2FFHA 2EKQA 3JQ6A 1QS0B 3K2IA 3PWTA 5TPWB 4A03A 1THTA 3JATB 5JTTA 3LFHA 5IBRA 2JVIA 5AOVA 3SHOA 3V33A 4GZLA 5THXA 4XB1A 1B15A 1K97A 4BFWA 4K9MA 1OW3B 1Z5ZA 4EG0A 3U56A 2AI1A 3C6ZA 3UYKA 3USZA 4MW6A 3U62A 1OX6A 3DFMA 1U3TA 3WKCA 4AZSA 2EP5A 3JR3A 3U4HA 1NR7A 1VGVA 3WNBA 3DL2A 2PUVA 4E3WA 1ID1A 1VPWA 4ER7A 1BU5A 3THXA 4BKUA 1SHUX 1XWWA 4B3JA 3VO9A 4XSGA 1CY7A 4PG4A 4NPCA 3SSOA 2N47A 3S2ZA 4B7ZA 5IT4A 1QRSA 2IUYA 4G4SO 2DQ4A 5GONA 4U2GA 1LSOA 3C5EA 3W2TA 1NWHA 4L8YA 4WY5A 1WKVA 4Q5IA 4DWWA 2O8CB 1M76A 4YMGA 2ZWIA 1XRMA 1N5IA 1TZKA 3FBWA 2H1OA 4KQ2A 3ILVA 3DHVA 3H2ZA 4H17A 1R0SA 2H4JA 4JLJA 4ZO4A 4BEBA 3X1DA 2A5FA 2O14A 3TTXA 4MI3A 1SUSA 2C9CA 1UZUA 1NBHA 4JLWA 1NRIA 5JNRA 3PKIA 1H05A 4H4CA 4KAAA 5KC9A 4O8CA 5FLEX 1ZGZA 4ZD6A 2FRDC 1VG8A 2OSBA 4ZWNA 3K16A 1NBME 5FWNA 2YZMA 3ZDZB 1KWKA 1T9HA 4YYEA 1QO0A 1TZMA 1UC9A 2L2QA 3E7PA 3ET4A 3AI1A 1RJGA 2N1MA 1THGA 3QKTA 3T7KA 3QQ5A 5KYWB 1FXWA 3SHQA 2KYRA 2VTVA 1IULA 4MV5A 3IMGA 4HO1X 5EHZA 1MH9A 2A94A 2NZUG 2QQGA 3E9CA 1NQUA 1DP4A 5BSHA 1QYCA 2GASA 5J1SB 1JFSA 4R40A 4ZQIA 1MRZA 3JQ7B 4JVSB 4YV0A 1M5TA 2D54A 1SOUA 1NMEA 4GWKA 1ZSVA 2NYVA 1Y98A 3WQQA 4KNWA 5FTJA 4BYMA 2R97A 3B3GA 5JCPA 1MTOA 4CQNA 1RJWA 4A0QA 4GPD1 4UAGA 2FMIA 3QLUA 3TPCA 4N48A 4HAIA 1VXOA 2G9QA 3UYLA 2ATIA 1KJWA 1OOEA 1TXGA 3ONFA 5HJ2A 3K6SB 2MSLA 3KXIA 5AT1A 1GZVA 4L95C 3TG2A 2VZ9A 1XB2A 1S96A 2F3RA 1XMVA 1EZ1A 2AD1A 1D0SA 2X8LA 3KQPA 2FR8A 3ZCVA 3AY6A 3MLEA 3K70D 3OFKA 5JZBA 4WBNB 4IOKA 2C7OA 2BR3A 2VBCA 1ULAA 1ZP6A 4LXUA 2GPBA 2ZB4A 2YMPA 3L0OA 3MGBA 2Q5IA 4L3VA 3N0WA 1J1ZA 5K09A 3LLSA 4OU5A 3UANA 1XWIA 2ZLBA 4QQFA 4YDRA 2RCYA 4IDAA 4FTWA 4P3OA 3UC9A 4CG2A 1DE0A 5KNCD 1NTRA 1M2VA 3EXIB 1KTIA 2O8BB 4WA7A 1W25A 1XCGB 1SUWA 3REOA 4WY8A 3L46A 4DV5B 4DSUA 1FFYA 2R1UA 1L4HA 2IVZA 3A4IA 4FE4A 2DWQA 4R9VA 1L7MA 4HYQA 4JVNA 5ALGA 3VNUA 3T9CA 4FXOA 4M89A 2B99A 1WTAA 3G8AA 3PC6A 4TKVB 1V2HE 2G0TA 3IODA 5B30A 1TQHA 1JT9A 2CBGA 2YWJA 4IH1A 4ESEA 2W6ID 2BFEB 1CUCA 1EM8A 1GQFA 2QROA 1V0JA 4MULA 4BLUA 1JBQA 1KBQA 1Y6RA 2Y1OA 3GQBA 1DEHA 1MAAA 1QFJA 1GSOA 4GI5A 4HEHA 5JO9A 4P1ZA 3TBHA 3M3HA 1PYOA 4L5YA 4EYSA 2ZUCA 2QNIA 3EYAA 3FNQA 3MQFA 3PPIA 3VOSA 5KTOA 3F5DA 3UMCA 1I6LA 1Q50A 1RE0A 4QYIB 4Q4AA 2G5PA 3QEBZ 1IHOA 2WYUA 1VE7A 2QE7A 3GRFA 2QN9A 4CN9A 5IHPA 5JSUA 5JZMA 1WUTA 4NG4A 1U5AA 1BS1A 3H65A 4UATA 4UCXA 5FHQA 1XLUA 2XIJA 1HL3A 2RJ3A 4DF3A 1OX5A 1T9KA 1Y5MA 3W1EA 1SCIA 2Q3FA 2FPOA 3EJ6A 3ZWPA 5EUQB 5F3WB 1ZMRA 2D74A 1UWVA 3GV0A 3LT4A 5CXSA 3ZY2A 3NTOA 3E4CA 3ROQA 4LNHA 4CDGA 2B0JA 4YDSA 1M8GA 1GPLA 3GN2A 3PB3A 3EDYA 3IX7A 2GHIA 1J0EA 2Y0DA 2UVDA 5FKJA 4ZHQF 5FI0B 2O1EA 3DEJA 3IOMA 1FL9A 2HIHA 3DL7A 2ZJ8A 4US1R 5CH3A 3OY7A 1KJYA 4ODIA 2OXRA 1I5EA 2OFWA 5CNIA 1U4SA 4D8WA 4EF5A 5IJAA 3D43A 3X1YA 4EW1A 2E5LB 2YC2C 1CUZA 1QS0A 3D7NA 4WN9B 3PI6A 1TKAA 2HZBA 5ALUA 1XZ8A 2JLYA