1WY7A

Crystal structure of a putative rna methyltransferase ph1948 from pyrococcus horikoshii
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
201
structure length
196
Chain Sequence
RKKELAIALSKLKGFKNPKVWLEQYRTPGNAASELLWLAYSLGDIEGKVVADLGAGTGVLSYGALLLGAKEVICVEVDKEAVDVLIENLGEFKGKFKVFIGDVSEFNSRVDIVIMNPPFGSQRKHADRPFLLKAFEISDVVYSIHLAKPEVRRFIEKFSWEHGFVVTHRLTTKIEIPHRKKLERITVDIYRFSKVI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the putative RNA methyltransferase PH1948 from Pyrococcus horikoshii, in complex with the copurified S-adenosyl-L-homocysteine
pubmed doi rcsb
source organism Pyrococcus horikoshii
molecule tags Transferase
molecule keywords hypothetical protein PH1948
total genus 65
structure length 196
sequence length 201
chains with identical sequence B, C, D
ec nomenclature ec 2.1.1.-:
pdb deposition date 2005-02-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05175 MTS Methyltransferase small domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 1wy7A00
1JR4A 1AQIA 4PINA 2ZFUA 5EHIA 5ICGA 3JWGA 2AOXA 4IV0A 5KQRA 5KYGA 3FTCA 4P7GA 2AOVA 1R74A 4QDJA 5C1IA 2FK8A 4YMGA 3DTNA 3IHTA 4PYJA 3DR5A 3Q7EA 2PV0A 3MHTA 4QPPA 5DPMA 5EIFA 5D1HA 4A6DA 2R3SA 3C3YA 3BT7A 3I58A 3T7RA 3LECA 4X41A 5DM0A 1QZZA 5EGSA 3I9FA 2HR1A 3NJRA 4HTFB 4C05A 5LSAA 2G71A 3OE5A 2N47A 4FP9A 1JG1A 4HC4A 2UYHA 2YTZA 1R6AA 3GRZA 3OFJA 4MWZA 3AXSA 4DCMA 4XUDA 3KR2A 2DPMA 3SSNA 2AR0A 3KQOA 3CC8A 1BHJA 4QDKA 1KR5A 5GOZA 3OU7A 4U7PB 1L3BA 5DM2A 5E9QA 4FT4A 5BW5A 5FA5A 1G55A 4CKEA 3ID6C 3P9CA 5LQCA 5KQSA 8MHTA 4BY9E 3HA3A 2P3OA 2YVLA 2XVAA 2IH4A 3G8AA 5GIPE 1QYRA 2VZ9A 4EVIA 3FUWA 3DULA 3KPJA 4L7VA 3MTEA 4KWCA 3G88A 5FQNA 5K0JA 5HFJA 3I64A 3FPGA 5E8JA 2PXXA 4RVGA 4EQZA 1X1CA 1D2HA 2FHPA 3BWCA 5CM2Z 2PJDA 4YUWA 4FGZA 3OE4A 5H02A 3P2EA 3P2KA 4E70A 3LPMA 2ZBPA 3GCZA 5CVUA 1I9GA 4PYQA 2OXTA 4ZTBA 1R8XA 2JHPA 3DLCA 5EMJA 1X1DA 3RIEA 3HTXA 2IIPA 1VP3A 2JH8A 2ZBRA 5D1NA 3GGDA 1O54A 5DXJA 5EVJA 4C4AA 3P2IA 3V8VA 3EPPA 3ME5A 2ZIEA 1EG2A 5DLYA 2PX8A 5EEHA 4YUVA 2CWWA 3EGVA 2QRVB 1EAMA 2P41A 5K09A 4MTLA 2B3TA 3KPUA 1IXKA 2ZIFA 2AZTA 4QTTB 1XCLA 2O07A 3ORHA 4C07A 3FTDA 1G8AA 4YUZA 2AOUA 4GEKA 1DL5A 1PRYA 4DQ0A 4ER7A 1I4WA 4GQBA 4PGGA 5B1SA 3EVBA 4RX1A 3K6RA 2ZULA 4UOEA 4M36A 4OBXA 2IP2A 2QM3A 4X60A 2G72A 3RODA 2JG3A 2PLWA 3SGLA 3IV6A 5EHGA 4ER3A 4GF5A 1UFKA 2KW5A 4AZSA 4F85A 5K01A 2IH5A 2C7PA 4PIPA 2C7QA 4G56A 3DMGA 1P39A 4HGZA 4LG1A 2QYOA 1WY7A 4PYIA 3PVCA 4RTNA 1NT2A 5E8RA 3LDGA 3MERA 2PX5A 5K8VA 2Q41A 2EX4A 2EG5A 1JQDA 3FPHA 9MHTA 1WXWA 4Y2HA 3GRYA 4PYLA 5P8WA 4R6XA 2CMHA 1NW8A 2PWPA 1SQGA 5EQJB 3AY0A 3U81A 5K0EA 1EJ6A 4PNEA 3QOXA 5BW4A 1I1NA 3FPFA 2I9KA 2NXJA 1Y8CA 2ZIGA 3GJYA 3KHKA 1JTFA 5ICCA 3FPEA 2XYRA 4P7JA 3JWIA 5DRYA 1NW6A 3QOWA 1F38A 2OBFA 3O31A 4YUXA 1AF7A 3A7DA 2HMYB 3Q87B 4GUAA 4RSRA 1ZQ9A 2NXEA 2BR3A 1RJGA 3KR1A 2WA2A 4PGHA 3UJ9A 3VC2A 3DXXA 3HEMA 3M6VA 1QAOA 2B9EA 3BGIA 1DUSA 5EC8A 3RW9A 1NW7A 1YZ3A 2ZLBA 3PLAE 2JHCA 3B7PA 2ZBQA 3CJQA 3HP7A 3I53A 3NDIA 3X0DA 5K0GA 1RJFA 4RTSA 1N7JA 2FCAA 3BWYA 4X61A 2FRXA 2I62A 5EG5A 3SSMA 3TPZA 4KDCA 5FQOA 3E7PA 3FYCA 5FUBA 1DCTA 4FS8A 3MGGA 1VPTA 1Q0SA 4KIFA 2VS1A 1JG2A 1HMYA 3TKYA 4ISCA 4CXMA 5E2BA 3FRHA 4RTJA 2ONYA 3LGAA 3C0KA 3TKAA 2C7RA 1YZHA 3JWJA 3UFBA 4OA8A 2PWYA 5FCDA 3KQSA 5GM2A 1BKYA 2IFTA 5EZQA 3HVJA 3P9KA 3MCTA 1FP1D 4XUEA 2FK7A 1XJ5A 1XVAA 2IGTA 4A6EA 1JQ3A 5DX8A 2ZW9A 4M37A 4PCAA 3WSTA 4BLUA 3FUVA 10MHA 1D2GA 4LWPA 5FWAA 4RWZA 3KPYA 4E31A 4C06A 3HCEA 4RVDA 4WVLA 3UWPA 4POOA 1MHTA 2IBSA 3LDFA 2P8JA 3LHDA 2AOWA 3HVIA 4HGYA 4GBED 4HSGA 3SM3A 3ELDA 5GM1A 4RTRA 4RTKA 1INLA 1NV8A 3DH0A 2NXCA 5DSTA 3BZBA 5DWQA 5FADA 5K0CA 3EGEA 3DMHA 1EIZA 2O57A 1O9GA 3G7UA 3OZSA 4HTFA 5DTRA 5K0BA 5E1BA 3THRA 3UJAA 3B89A 3HVKA 5CCBA 5LQNA 5EIWA 3D2LA 4MIKA 4OQEA 4EKGA 1SQFA 2GB4A 1SKMA 1JG3A 2AN5A 4RTOA 3P8ZA 4PCLA 5KVAA 2GA9A 2UYQA 3MB5A 5ERGB 3KR0A 2IH2A 3EVFA 3UJBA 5CD1A 1P1CA 3GWZA 2QY6A 1JTEA 5F2OA 2NNWB 3EVZA 1ORIA 1X1AA 3G2QA 5G02A 1OR8A 5FTWA 4KRGA 2BM9A 5K0NA 2F8LA 1G6Q1 3MTIA 1IY9A 3BKWA 2ZTHA 1WZNA 2OY0A 1M6YA 4RTQA 3BGVA 4GC5A 2VDWA 3CJRA 1P91A 2OO3A 3F4KA 5DX0A 2BZGA 3NMUF 3GIWA 2Y1XA 2HTEA 3KQWA 5DXAA 2ZVJA 4C03A 5JUWA 4RTMA 1VIDA 1QAQA 3KKZA 3PB3A 2NP6A 2YXEA 2Z6QA 2PKWA 4O29A 1AV6A 2AVNA 3OZTA 5DX1A 1RI2A 1XDZA 2GLUA 5CVEA 2VP3A 2P7HA 5IH3A 1PJZA 1WS6A 4FT2A 3O7WA 5EMLA 3THSA 4C04A 1QAMA 4KIGA 3EVGA 4E2XA 5LQJA 2H11A 3CJTA 2BR5A 5E9JA 2GH1A 2O05A 3G5LA 5K03A 2OZVA 3LDUA 3FYDA 1YB2A 5DM4A 2OB2A 2AVDA 5MHTA 3G89A 4RVHA 3E23A 4CTJA 2GAFA 1KPGA 2OPBA 4PYKA 5ICEA 2YXLA 2CL5A 5HIKA 3NVMB 2P7IA 1M6EX 4HRAA 1YUBA 2YXDA 3LCCA 1O9HA 3CVOA 4PIMA 5FHRA 3UJ7A 3TFWA 1ZGJA 2XYQA 3V97A 1NV9A 3GRUA 3R9XB 5FULA 3C6MA 2BM8A 4M7RA 3SR4A 1RI3A 5EKXA 4P58A 2GPYA 4QTUB 3G8BA 5DM1A 2NXNA 2PBFA 3GNLA 1H1DA 2PT9A 3UA4A 4PWYA 4QPNA 4ATNA 4CWAA 4E30A 3AWIA 4LECA 4MQ4A 2ONZA 1BOOA 1B42A 1G38A 5EMKA 3LCVB 3M33A 5F2NA 2CKDA 1FBNA 1M0EA 3G2MA 4E2ZA 4GOND 4Y30A 2IDJA 3UJCA 1YF3A 4EMSA 1N2XA 5M5BA 2B2CA 3KR9A 4PYNA 4B17A 1IM8A 5CVDA 3JWHA 2P35A 4GOLD 4NECA 3C6KA 3DP7A 3ANXA 3M6XA 3P9IA 3P71T 1VLMA 2PVCA 1XDSA 3BWMA 3OCJA 3G2OA 3HVHA 1JQEA 2PY6A 4QQKA 3LBYA 2O06A 4IV8A 2Z6AA 1G8SA 2I6GA 5GIOE 4GC9A 5HIMA 1R00A 3HNRA 2O0LA 3UJ6A 1VP9A 2XYVA 1MJFA 2E5WA 3FZGA 4OX9Y 3BWBA 5HIIA 2ZWVA 3TM4A 4YV2A 1TPYA 2K4MA 3O4FA 4M38A 3P9NA 5F2KA 2AOTB 1KXZA 3DXZA 3NTVA 3KPVA 4KW7A 4P7KA 5BXYA 3G2PA 3UJ8A 3ER8A 4KDRA 4EKIA 2VDUE 1NW3A 1JG4A 1ORHA 4HG2A 1V39A 3PFGA 3DLIA 3IYLW 2ZWAA 1NBIA 4FZVA 5EPEA 4RVFA 4CKCA 4YV0A 3MCZA 2B78A 1R18A 1BC5A 1JSZA 3GU3A 4H0NA 4QVGA 3SVZA 3HCCA 3SMQA 3L8DA 5GWXA 2ZZNA 3VSEA 3G5TA 3OZRA 3BGDA 5HOQA 2G1PA 2HWKA 2IPXA 3FUTA 1KP9A 2ESRA 1X1BA 4QQNA 4CTKA 2V7EA 3R6TA 1FP2A 4GOOD 5ICFA 2WK1A 1HNNA 1XXLA 3KQVA 5CVJA 4F84A 2OKCA 3IEIA 4RV9A 4C08A 4AUKA 5C9ZA 4HH4A 2YUIA 1NBHA 2DULA 2YX1A 1XTPA 3HM2A 1KPIA 2PX4A 5T6BA 3UZUA 4BLWA 3R0QA 4BP3A 5K05A 3NVKI 3DXYA 2GS9A 3B5IA 1ZGAA 3OPNA 3OU2A 4ER5A 3NWEA 3A26A 2OYRA 1RJEA 1Q0TA 3LSTA 2ZZMA 2ZSUA 3PT9A 2XBMA 3B3GA 3M4XA 4K6MA 1NE2A 3E05A 1KIAA 2C7OA 5CVVA 4YMHA 5DTMA 1L3IA 1WXXA 3ELWA 4DCGA 3UJDA 5LQRA 3KU1A 1FPQA 4E2WA 3KQYA 1XDUA 2HNKA 4R8RA 2ZZKA 4AZWA 3GXOA 1ZKDA 1P1BA 2PT6A 3LX6A 4Z2YA 3DOUA 4RTLA 1KYZA 3S68A 4DKJA 1AQJA 1FJXA 3FUXA 1T43A 3AXTA 3LL7A 5CIYA 1EQAA 1Z3CA 4JXJA 4PYOA 4FR0A 4EK9A 1RJDA 3HCFA 3FRIA 2ERCA 3PFHA 3HCBA 3NW9A 4XCXA 5LQUA 1N7IA 2AOUB 4KVZA 3BKXA 1L3CA 4PONA 3KQMA 3TOSA 3OFKA 1JSXA 2EFJA 3TRKA 3FPJA 2QRVA 7MHTA 3FTFA 1TW2A 4LWOA 5EOVA 1ZHFA 2P3LA 5HILA 1VE3A 5DTQA 3R3HA 2Y1WA 4ER0A 3LBFA 2HV9A 3CKKA 3VYWA 3QV2A 5E2AA 3SSOA 3PX2A 5BP7A 3VC1A 3KQQA 5DT2A 3GDHA 4E32A 4BP1A 3TR6A 3EMBA 2V74B 3EVEA 2XVMA 2FPOA 3B3JA 2H00A 3GRVA 5EMMA 2AOTA 2VDVE 3DMFA 2IDKA 3EEOA 5CCXA 1VQ1A 5EZSA 2NP7A 2ZCJA 4IWNA 1D2CA 4P7FA 3T0IA 5DSXA 5FHQA 1RI1A 3TLJA 4ER6A 4IKPA 3PX3A 1YFLA 3UA3A 1SG9A 3E8SA 4GOMD 4FSDA 3CBGA 3CCFA 5E1MA 1X19A 2PXAA 4DF3A 3HA5A 5E1DA 5U4XA 2PSSA 1G60A 4X1OA 2PXCA 2I7CA 2A14A 2ORED 4X63A 3A7EA 4AZTA 3HCDA 5E9WA 2AN4A 3TQSA 1F3LA 2UYOA 3EEYA 3R24A 2H1RA 1TW3A 4R8SA 3HA7A 3C3PA 4OQDA 2Z6UA 2G70A 5EEGA 1R8YA 4MHTA 2AN3A 3BXOA 3H2BA 1XCJA 5T64A 3KPWA 3MAGA 2IBTA 4OA5A 3TMAA 3REOA 4CKBA 3A4TA 3K0BA 2OB1A 5KS2A 2EJUA 2CMGA 4YUYA 1L9KA 4QVKA 5C0OE 4YV1A 4AX8A 3M70A 5JR3A 3SX0A 5GINE 3I5UA 2AS0A 3KQTA 1RI4A 3A25A 3MQ2A 3NWBA 5EKUA 3TM5A 4DM3A 5CUQA 2BH2A 3GRRA 2WA1A 1SVUA 3KQPA 3CGGA 1KHHA 1UWVA 4XUCA 5DRTA 1KPHA 2LD4A 4F86A 2G8NA 1EJ0A 2ADMA 2PGXA 2R6ZA 3SXJA 3B3FA 2QE6A 5HEKA 1SUIA 3LKDA 5LQAA 1YFJA 4DMGA 3ERCA 3LKZA 4U7TB 3A27A 1SUSA 3EGIA 3GO4A 5FWDA 3T7TA 2JH9A 1VL5A 3BUSA 4V0RA 4BLVA 1L1EA 2BR4A 2FYTA 5K0LA 4E2YA 5HZMA 3M6UA 2JHAA 3LCUA 4RYLA 4R05A 2PX2A 2YR0A 5T67A 2EJTA 1KYWA 1U2ZA 3OU6A 3PS9A 2UYCA 4OBWA 5FA8A 2JJQA 3P97A 5GP1A 3ELYA 1ZG3A 4AZVA 1NKVA 1QANA 4R6WA 3M6WA 3AJDA 3NDJA 4WXHA 4RTPA 4DA4A 5LR6A 5LQKA 5E1OA 5K0FA 2NYUA 3HCAA 2B25A 3DUWA 3ELUA 2P1DA 2UZ4A 4DZRA 4E33A 2P40A 3EVDA 1VBFA 3FUUA 3ER9A 3EVCA 3EMDA 3UBTA 1RI5A 5HIJA 4PYMA 4V0QA 4FSXA 1NW5A 3T7SA 1UIRA 3EVAA 3PTAA 3FTEA 2P3QA 2YQZA 5IKMA 1WG8A
chains in the Genus database with same CATH superfamily
3F6SA 2Z8ZA 1Z33A 1RVV1 3L46A 2PUCA 1CFZA 3MTBA 2RHJA 4H4DA 3QEMB 1DTWA 4C7OB 3W5BA 1IEXA 3DOIA 4Q34A 2XI4A 3DEKA 4K26A 4TMZA 3VR5H 4DUGD 3BQNB 4KDEA 5LU8A 5B1IA 2CXQA 1N3LA 1F8GA 1X94A 4UKDA 5IJAA 3H11B 3EULA 4Q24A 4ZRMA 3WQBA 1IOWA 1HE4A 4EO7A 1WV0A 3TX6A 4QPPA 3JASB 4YP9A 121PA 1Z2PX 4H3KB 1G5PA 5ENDA 5JO9A 4MGHA 2P9TA 3EB9A 3I5XA 4QEZA 1USKA 2QNIA 3ZHSA 1NZFA 4C05A 4DJDC 4HC4A 2LBPA 3ADCA 3MTJA 3X1KA 1OIXA 1T10A 1C5KA 3KVOA 4YCCA 4PZUA 3KQOA 4DIKA 2GNPA 4NU6A 4R1QA 3BQ9A 2GDJA 3C98A 1VG8A 1J5PA 1JR3E 4RSHA 4PC6A 4U39A 3HDQA 5CITA 1WKBA 3D9QX 3ND8A 5FEMA 2ZYAA 3VRHA 1CQXA 2R00A 3JPWA 3O82A 4KQFA 1QYVA 4AF8A 2GT1A 3U9SA 4ZT6A 1TYEB 4I99A 4ARUA 1FRFS 1SC3A 3CURA 4U7WA 3ZD8A 5ICMA 1U2DA 1V37A 3MRTA 3UB3A 2VHXA 4HNTA 2ZSEA 1Z4JA 3DE7X 1D6MA 2D00A 4CRWB 4J7UA 2P78A 3E3LA 4TV8F 3S2EA 2QRNA 3VH4A 3U61B 1A1VA 1Y6RA 1Q7GA 3VPXA 4WJZA 3QMPA 3DLCA 1GKLA 2JZOA 1X1DA 3UWSA 1OSNA 3H6KA 4QAQA 3T3MB 2YHBA 1MN6A 4RZQA 3ZHCA 3AFNA 4UHHA 1YHNA 2AG8A 2TYSB 4BKQA 1GA6A 4IG4A 3EXG2 2Z9CA 3B53X 3VR6A 4C4AA 1H5NA 2VDPB 2MJLA 3A6JA 1KAHA 3HU2A 4OL9A 1G21B 1K88A 3EGVA 4MYTA 3R8XA 3SX4A 4GRAA 5EXSA 2IHVA 4C01A 2AZTA 4J0IA 2PRKA 1U9IC 3PRHA 1BSVA 1KI4A 1V7QA 3KDSE 4CMEC 3FCUB 4F8JA 4XYEA 2YN2A 1TXGA 4ER7A 2ZWPA 1QGED 1W9MA 4MVJF 1G2QA 4CM1A 3TZQA 1L7VC 1KZ7B 4S0XA 2V5AA 3H4MA 3GZNA 1VSUA 2TMGA 5TNXA 3P1JA 3PJFA 2ZUBA 4M36A 1BD3A 2DHDA 4YJ3F 2ZJ4A 3OPYA 4AP9A 1J9EA 2I03A 1QGAA 4KNVA 3N05A 4D43A 2OXEA 3INGA 3H4TA 2VZEA 1YIOA 3LX5A 4HWSA 4RSMA 5CNMA 1M1UA 5KAMA 5KNBD 5IBRA 4JLDA 4JNKA 3IAEA 4HGZA 5AM0A 3K1TA 5IUKC 3DOHA 5FJIA 1EGMB 1GV1A 1WY7A 1CIJA 2X3FA 2O2ZA 2PX5A 2IHTA 3HJHA 3GP8A 2Q41A 2F64A 4JBIA 2OHJA 1JQDA 2PK3A 3L7DA 4OP3A 5A4IS 5HWSA 2WDZA 2CMHA 2XH8A 3UCEA 1OPRA 5K0EA 1WHSA 3OPYB 1C8VB 4C2UA 3KRTA 4WLVA 2W2KA 4FVTA 4NLLA 5AD1A 4R01A 4AIRA 1TRKA 2IYOA 4B4WA 1RHMA 4C1NA 2VNJA 2W2QA 3O9MA 5TLSA 4HYTA 1NW6A 1F38A 3O21A 3QUQA 1GYRA 2D1TA 2B0JA 3LLUA 3CTPA 3NM6B 1M5UA 1ESDA 2D5AA 2HZBA 1VJ0A 3Q87B 4TZKA 3TLYA 1OYVA 3ZVRA 3TL3A 1DG9A 3PF8A 3ADDA 1HDIA 1LPNA 4YP1A 1ETHA 5AVRA 1VLQA 2RK4A 2VJNA 4LSMA 1DEHA 2C99A 3EPJA 1RS0A 3PT5A 1HZZC 4MRAA 3FDIA 2GBLA 4XXHA 1RJ9A 1JHRA 1Z9BA 3KZKA 3CJQA 1A72A 1NMSA 2QL5A 3C3WA 1MOQA 4HYYA 2P5TB 2J9RA 4MUJA 1TQ4A 3DV0A 1Y1SA 4HGNA 1UXIA 4NZOA 1KYXA 2IXEA 2JCSA 1V71A 1QO0A 4MVJE 2Q6IA 1LPMA 1M8JA 1OQAA 1DCTA 3JQAB 4XIGS 5C7YA 2FUCA 1ZH8A 1UMKA 2VHVA 1DEKA 1N2BA 2V58A 3RGGA 1MCZA 2HCBA 1ZK1A 1DWQA 3QBDA 1CUAA 1OLXB 2HDOA 2JCGA 2ACKA 2JARA 3TPFA 4D8XA 2BPOA 2G9VA 1C30B 2JKYA 5CW1A 1ZUWA 3MWDB 4B4VA 2JEOA 4N5MA 4P0TA 4BQPA 4PZCA 2Z9DA 3U7IA 621PA 2PX0A 3FYUC 2BMJA 1JQ3A 4LYHA 2ZW9A 1XN4A 1R15A 4Y2UA 4Z9XA 3EXHB 3TTSA 4BLUA 1SG0A 4DFDA 1FZTA 2J0VA 5FWAA 3VR5D 2J85A 2Q4EA 4WVLA 2WLTA 3ENVA 2P8JA 3LHDA 3S2UA 3FCYA 4M1SA 4Q1FA 2VYVA 4NEQA 1Y5LA 3QPAA 1FEZA 2V03A 4E08A 2IZ5A 4QU5A 4CU5A 4A8HA 1D2AA 3ZIAA 1RHJA 3OZXA 3RSLA 1EE1A 5DTRA 3AI7A 4X1IA 1KAEA 5ILOA 1WXEA 3O1JC 2W2LA 3S5UA 5CB8A 1OZGA 4QM6A 2BBOA 4MIKA 1M7GA 2YASA 2HYDA 1U0LA 1NVDA 1RADA 3PLRA 3HJCA 2XJ4A 3TW8A 4JI7B 1YUNA 3WYCA 2XRFA 1JG3A 2WIBA 1Y7TA 1OXMA 2W4IA 4XI9A 5I7VA 3ZJUA 1NBWB 1QNFA 2F43B 4ZFNA 3OD1A 4H7FA 1DTWB 4NY1A 3S8EA 1EUCA 4HDMA 1RLUA 1SIBE 4BLOA 4L4SA 4RM3A 3RUCA 5H59A 3H3FA 3PICA 3TZEA 4IXDA 3A37A 2XA9A 1XMXA 2G9ZA 4K0KB 1M74A 4LF4B 4LHWA 5HF5A 3HB9A 2ZK7A 2AEEA 1WZUA 3HEAA 4P82A 1ZNZA 1TUIA 3BXGA 1J90A 3DJFA 1FDIA 1T6YA 4L72A 4UUOA 4C03A 1C81A 1QK5A 3AG6A 3KKZA 4YP7A 7REQA 3A6PC 3QLJA 1JPUA 2R1VA 4LJSA 3T4UA 2J87A 5DX1A 4MMXB 4ZK2A 4DLWA 2GLUA 1XKLA 5THKA 5J1SB 3CBQA 3SHQA 2I71A 2VPIA 4JXKA 1C7FA 3U4GA 4D9NA 5CXSA 1M73E 2QTAA 4YALA 4G0WA 1XZHA 2HIMA 1L5RA 3U7JA 1U28C 1EMDA 2VDWB 3OSUA 2AHRA 3T6KA 3O4VA 2JDID 1GTJ1 4XM0A 1IN1A 2F3TA 2GZRA 4XQGA 3W1WA 2CNLA 2G07A 2GAFA 4A5OA 1E3WA 4F4DA 1P5JA 1SZJG 3MUFA 1C50A 3W90A 3K5HA 2CL5A 2R8XA 3BMCB 5TMDA 4B4OA 2OSVA 1Z62A 2JJ8A 2R68A 2NPOA 3OZEA 3ZS9A 4KQMA 1HE2A 1Q7CA 2YV4A 2R96A 4PIMA 4WHMA 3SR3A 4KR6A 5FBWB 3DT6A 1JE0A 1QG0A 1H22A 3R6DA 4M6WA 4O2BF 4PU0A 3QI2A 2YC4C 4MK4A 4PQFA 4ZC8A 5EKXA 1D0SA 2FUNB 4H08A 4WADA 2PA3A 1WABA 1ZOSA 2XMDA 2H1LA 4TN1A 3ZW9A 4K86A 4D3FA 3A9SA 4R0VA 2BCJQ 3M33A 4P3YA 4F92B 1L7AA 1RQLA 1LI7A 3PYMA 3ZX5A 2A9QA 1M0EA 5K3FB 1DAEA 3CFYA 3RVNA 1N2CA 5KOHB 3C7DB 2HA0A 3DE6X 1II8B 4EA7A 4EMSA 4G5GA 3BE5A 2WWYA 2FRDA 4RH3A 1CUCA 5DBFA 4KSYA 1TQ2A 2OCDA 5IT9A 3DLBA 4O2BA 3H5VA 4Q48A 4YMSA 1C7ZA 1IAQA 1VLMA 4DDMA 3BX1A 1VM6A 4IFTA 2GCPA 3TMYA 2I66A 3WWCA 4ETWA 1GL3A 4BYMA 9ABPA 3C24A 1CUHA 1ABBA 1RM0A 5GIOE 1OFHA 2F1RA 3F6BX 1EESA 3BS4A 2ATXA 4OX9Y 4D8UA 1N25A 1RKQA 2FRDC 4FGKA 4MW9A 4TLDA 4DUZB 1E63A 5K3SA 4UEJA 1TPYA 1CR4A 1EUQA 2K4MA 1ZU4A 4MW1A 1XVIA 5DYTA 4ALJA 4JLOA 3LIPA 1Z5WA 3UB2A 1I3CA 3NTVA 4P7KA 3USZA 5MF6A 5CTJA 2PIDA 2XUIA 3CSSA 3IP7A 5K51A 1QGOA 1FU8A 1YQQA 2EKZA 4QATA 5DVZA 2YZNA 3PEVA 5ECYA 1IPHA 3BERA 2VO1A 3IYLW 1ZY2A 1KKLA 4DBLE 1LX7A 3TNFA 2WUGA 3HC7A 4XJTA 1W8DA 1WMEA 4IIUA 5ISMA 2H0RA 1F2TA 3I12A 3PHHA 1V4NA 5HUJA 1M10A 2H1IA 4TT3D 4M9ZA 4RKFA 2MU1A 3M1IA 2P62A 2QQ0A 1UMCA 3ENQA 3V00A 5I9LA 2J3DA 4PRKA 2EJVA 3ONVA 1YRLA 1SM4A 1FTYA 1ZD3A 5EFZA 4G01B 3R75A 3V8BA 1JV2B 4AUMA 3F5DA 5F7XA 2VP5A 4C9BA 1QVAA 4M0EA 4JITA 3KXIA 1AU9A 1Q0UA 2ZIXA 1TCCA 3CH5A 5A3RA 2WNSA 4DN6A 1Z73A 3Q3IA 1YK1A 1ZJWA 4OB8A 1DIGA 1BDHA 1ID1A 1R66A 1RBZA 1THGA 2AFIB 5BO5A 1G59A 3NWEA 2Q8QA 3DEZA 4E51A 3TN7A 1IATA 1QR6A 3OEED 2ZSUA 5IYZF 4PAWA 1V3TA 2PMBA 3WJ1A 5ALRA 3NP9A 5DDIP 1ZJ4A 3M9LA 1T0HB 3S70A 3HBLA 3ELWA 4DCGA 3H19A 5KC9A 2C96A 4BNXA 4UHEA 4JS0A 5G0SA 4KN5A 3SXPA 3PC2A 1ZKDA 4D7AA 1RRFA 1Z0KA 3WNQA 2HQBA 5AHXA 3OSZA 4GOXA 4KWEA 2XUKA 4MLDA 1TPZA 2WYHA 3OOWA 3T5CA 4EZBA 1X86B 3JD0A 5B64A 3NQ41 2HO5A 1ZA1A 1LWNA 3AJEA 1X7ZB 2FF7A 2V1XA 5DNWA 3RV3A 1USVA 2YDXA 2FX5A 4XVCA 2C2MA 1AKRA 1B8NA 2JAPA 1LDMA 2VWHA 1SRRA 3A6EA 3DCNA 2HZ7A 3ORFA 4KUHA 4O5OA 1YKSA 2GD6A 3RASA 4F9GA 1ZHHA 3BJZA 3JPYA 3L82B 1VE3A 3TKLA 4AKHA 5K99A 4TT8A 3U37A 3NXKA 2GAOA 2AE2A 3MWYW 4UU8A 5DN9A 4MQMA 1I2ZA 2HUNA 2XZOA 3I04M 3WA7A 1DFIA 4ZYYA 1GPBA 2ORVA 4FQ5A 4KO1S 1TM7E 3GELA 2V74B 4AULA 4DPLA 4R0MA 2Q28A 4B3CA 1OH6A 4MJ3A 1VCIA 2RC6A 1F0NA 1NQOA 4F9EA 2Q5OA 1MQSA 1TMGE 2WF9A 5GVRA 5JECA 4U7GA 2ORWA 1TZJA 4IWXA 1ZMBA 3NRCA 4W82A 2O19A 2PAAA 2AKEA 2ZRHA 4Z0NA 4ARVA 4IRXA 5K3CA 1NXSA 2QMOA 1B73A 2PANA 3PX3A 4CTMA 1QBGA 4OF4A 4QDOA 3E8SA 3H3XA 3KTOA 3NKLA 5I7RA 2BP7A 1FFYA 1E18A 4QJBA 1OHHA 2OV3A 1VRWA 2NU9A 2IQ5A 1UMDB 2CXPA 3LY8A 1IBRA 4DC1A 1JHQA 4M1QA 1EX1A 2OCGA 2BCGY 1U5BB 3DDWA 4L8FA 3J7AC 4IX9A 4UU1A 5DULA 1KZ6A 4PXYA 3W8RA 3NHZA 3HGTA 3JAWB 3PFKA 4RKQA 1JDUA 3TBFA 4BTEA 3QF7A 5LMCA 1HV8A 1SQ0A 1LLQA 4D4LA 2P4HX 4X71A 3X2EA 5FPYA 4KITB 2C3UA 4ZO6A 4XGQA 2R62A 2ZREA 1KZGB 3FF1A 3TMAA 3AZQA 2OZLB 1ECLA 4G85A 4GLFA 1SCKA 4HQOA 1XEXA 1Z7WA 5C4MA 2C9YA 4O4JA 5EMHA 5CB4F 1FJGB 1NVMB 3VKGA 3KDAA 2VZ0A 1BEUB 3NHRA 1ZO8A 2YC2C 2E55A 3OZGA 5TPWB 3I5UA 3OT5A 1YA4A 2KPOA 3OZFA 5B1DA 3LW8A 3INNA 3RFXA 2ZKIA 3KQPA 3DW3X 2BTEA 2D1YA 3EDMA 2D0OB 2X9GA 1A95A 4UBIA 1AMNA 3QX8A 4QDTA 5J2TA 3MMPA 1IC6A 1T24A 5K7SA 3DV2A 3LY5A 3WIDA 4JI2B 1Z83A 3EGIA 4D9IA 3C8UA 2UZIR 4R3WA 4CGZA 1BCRA 2D4HA 3Q9LA 3LDAA 4O6VA 1T35A 5K0LA 1FP7A 1EDOA 2O7NA 2PU7A 4NJEB 4BC0A 5FAKA 1VL2A 1YKFA 2ISQA 4FCCA 1ZGHA 3AJ9A 3QU5A 4FZJA 4PC1A 4XIYA 5T67A 3ZE2B 3DGEC 4XEUA 2QN1A 1D2RA 3HY4A 3P97A 1OLUA 5IVHA 1RCFA 3C2QA 2HFJA 1J2UA 2OILA 3HE3A 3AYZB 4RTPA 2WJWA 3H8JA 4LDJA 4MRMB 1BCRB 3U3OA 5K0FA 2J9XB 4WNCA 5LL6P 3VR1A 2XCUA 3BGWA 4IXMA 3FSGD 1WCIB 1YSCA 2Z2XA 4NJOA 1ZHOA 4GRDA 1QU2A 2VF2A 4EMUA 4V0QA 4HSEA 2ZUDA 1QJ4A 3SOPA 1NR7A 3QA9A 2C8VA 2ATVA 4IINA 1EUYA 2AOXA 3F49S 3GNSA 1O08A 4I55F 1WUHS 3B60A 4WKNA 4XYMA 2WIFA 5DLPA 3KSBC 2VDRB 1YE8A 1YXMA 2VWPA 4GBJA 4TL9A 3FTCA 4UEOA 2ZJZA 5CGQB 3M5DA 1V25A 3B6ZA 1GRVA 1U2GC 5TARA 3PR1A 1C3LA 2GD1O 4G0PA 4I1VA 4Q4HB 4BQFA 2JLWA 3FB1A 4R7GA 1PVDA 3LUPA 5AVKA 1J6UA 4YLEA 1VSQA 2AT1A 4YACA 4OQFA 4JLMA 3AUYA 3GQBB 4LHXA 4QOEA 3K73O 1R2QA 3N8IA 4YGXB 2IYEA 3TLMA 1GPAA 1T8UA 4LK3A 1Z63A 3DCJA 1JHOA 3I5MA 5IWAB 2VH2A 1OZAA 1B6RA 5ICSA 4DIOA 1AQLA 3OU7A 4YI3A 3SX2A 1U2EA 5ED4A 1ZRNA 4R54A 1XEAA 2BP7B 3PQ5A 4RHEA 2RSLA 4D3XA 5LQCA 1OZFA 2PA0A 1A8SA 1GFWA 2ZU0C 4H16A 4JIGA 1DC7A 1QGUA 3B13B 4FGUA 3CE6A 4JSRA 5TF0A 1GDDA 5DHSA 4BZPA 3L05A 5C37A 2DKOA 3PLNA 4D4MA 1CEYA 3HHEA 1QFXA 3FB4A 2VZ9A 4Y9SA 3SXUA 1L5OA 1ZUD1 5HM6A 4GZMA 4MS1A 4FQ7A 5FR1A 4CDRA 2DWOA 2YWRA 1UCFA 1ESMA 1DAIA 2RHRA 3DMPA 3GBPA 4GMHA 4PF1A 3ZTTA 4XCVA 5EJMA 3SZGA 4ETIA 2G9RA 4F4FA 5T57A 4XX1A 3GFRA 5DWVA 5KX5B 2OHOA 4PZLA 3MFYA 1GADO 3LPMA 3IE2A 3KOXA 4PYQA 3RJMA 5CDFA 4ENWA 3W79A 5ANRB 4YQZA 3S2ZA 2ZRQA 1QE3A 5JJCA 1OZ0A 3TL6A 1U2GA 3HGMA 2YJ6A 3OO0A 4G86A 4Y9DA 2XB2A 1OWMA 1UJNA 3PGLA 4FOPA 5C53B 3WRWA 3F5QA 4LI0A 5BVGA 2QRKA 1Y5IA 3NLLA 3Q6NA 3CB4A 4CMEA 4ARAA 1F7UA 1WPQA 4I4TA 2PT5A 4BN0A 1IXKA 3K1YA 1WV1A 3V1TC 3GT4A 1XDDA 2ZJ0A 1SIOA 4DMRA 1X1EA 4PGGA 3UGJA 3CG4A 2ES4A 4U9IS 5GONB 5M3BA 3AW9A 4UASA 4YMIA 1H2EA 4JKOA 4AYWA 3TG8A 2F9LA 2IP2A 2QM3A 3GEPA 3N9IA 3NT2A 2F3PA 3RI3A 3RODA 5KVVA 1Y63A 4RELA 2K7FA 5FOXA 2E85A 5DHRA 3D7MA 1WW8A 1S3SA 1JR3A 4YWJA 3WGYA 1P4GA 4LZNA 4UEQA 4I50B 1NQVA 3SC2A 5IMBA 5KUTA 3AF2A 4E4YA 3BFJA 4P3NA 4OHCA 2QEQA 4CKXA 3PVCA 4HFJA 1VPWA 2W6QA 1ACMA 2AE1A 4L22A 4OUKX 4NE9A 4CF3A 2IDMA 3FCEA 3E61A 2ONJA 5AM2A 3A2LA 2G0TA 4FW8A 3FFAA 2OLEA 1EFTA 4HKTA 1UAAA 1T4BA 2W4QA 3GOQA 4J1TC 1RQ7A 1YR3A 4KN8A 5CPFA 3S0JA 4BGIA 1Y8CA 1T4MA 5HUQA 1YWGO 4NULA 1RNLA 2P9CA 3EG9A 1BX3A 3JQCA 1ZOPA 4FWIB 3K0SA 3EGXA 3D2BA 4LC0A 3TRHA 2BTOA 1JILA 1WB5A 2HRDA 4NDAA 3DCYA 4ZTZB 2GGSA 2II6A 5ARCA 3TRFA 3VC2A 1E98A 2DPGA 4P6VF 1HZZA 1RTKA 2VDMB 2XMBA 3Q7PA 5L6MB 3OZIA 2EFYA 1Y80A 2BHRA 2FMTA 1MB4A 1PWHA 4EDHA 1EA7A 2Q8PA 3PHBE 2JHCA 3TFOA 3O73A 2CMKA 5B4VA 1FF9A 2ZQ5A 1UL1X 3BF7A 3II6X 4NBWA 3JWEA 2I54A 2PPLA 1XTRA 3EAQA 4KIFA 1XU7A 4B74A 1ZVJA 2OV6A 1HG1A 3UMSA 4DXHA 4CXMA 1JZTA 2XHEA 5KTSA 5LMZA 1SKYE 2IU3A 1OLSA 1YZHA 4S3MA 4QOIA 5HF9A 1OWOA 5ESRA 2PWYA 4U2DA 1OF1A 3WL5A 2ZE5A 2PLNA 4Q9JA 3CUUA 5IJ0B 3R7LA 2AW3A 4PTLA 5TS3A 4FMBB 3R6GA 5LXTF 1L6RA 1WZEA 5BRJA 3NBXX 2GEJA 2OCXA 3UHPA 5E3HA 2WBLC 1N7HA 4U7FA 4O2BB 2ZTSA 3AT1A 5B2EA 4UE3S 1C14A 1JL3A 1UFQA 1X92A 2BDUA 1YD7A 3EEBA 3P4UA 3PUWA 4P31A 3U3ZA 4U2KA 4RTKA 3FNFA 1LPAB 1NV8A 4DREA 2XDAA 3I1FA 5EE5B 3B1FA 1QHHB 3DMHA 4E3WA 1Y4ZA 3G7UA 1U0EA 3NHUA 2V8BA 4HTFA 5K6RA 1KMHA 4FYHA 4BO4A 1LNSA 1DP4A 4MVJA 5KMGB 1EX6A 4M1MA 3NNSA 1HO3A 2GHTA 1SVKA 3PRYA 5EIWA 4EITA 4R2WA 3AHCA 3M5PA 2IKQA 4TZ6A 1NMEA 2BHNA 4X6YA 4J1QA 2HDHA 3R9XA 5EFOA 3LP8A 1NN5A 2QJTA 1K08A 1MV8A 3JZMA 3PR3A 4A23A 1J1IA 3BA6A 4FX5A 4BWYA 4F46A 3KR0A 4M3NA 2IH2A 2NVBA 1YVEI 3BILA 3BMCA 1XZLA 1Q16A 3BMNA 4MVCA 4CTOA 1I3KA 2NNWB 3EVZA 1R50A 2FPRA 3FR7A 1XKTA 2GK7A 4GP9A 5FTWA 3PU6A 4OQ4A 5TR9A 1JKJB 2JI4A 1K5GA 2X2FA 3ACDA 3V8RA 1JWBB 2A5LA 2CXNA 4AY3A 3HP4A 2PZGA 2UZAA 2ECKA 1DKQA 3BGVA 4NCIA 3WHPA 3IP6A 3B9QA 2VDWA 3LUJA 3TUIC 4OK5A 1CIVA 5F77A 5C1BA 2BZGA 3REQA 2QTRA 2IYYA 1DQYA 4GI2A 4ZI5A 1VIDA 4D3YA 4R2KA 4JOQA 3BIFA 3KLNA 4BCDA 1PFWA 1YB5A 4FYWA 1Z4QA 1Y5NA 3ORSA 9GPBA 1PBNA 3Q12A 4IF6A 4ZVTA 3OEHD 2CLMB 3H2YA 3SICE 1UXOA 3VR3D 2BD0A 2DRIA 3N8KA 1QZXA 2PSEA 1XHFA 2BMAA 3GPCA 2JKVA 4P3KA 3ONWA 5I9TA 5E7MA 1DHTA 5CDTA 4UZFA 5K3AA 4F04A 4F85A 4B80A 1SURA 2VH1A 1Q1GA 5KYXA 1EDDA 3MLAA 5ULLA 3ML1A 1TIKA 3QLVC 3TYXA 2MYUA 1X3LA 2EBWA 3ZJVA 2IHJA 2HBRA 1BHQ1 5B36A 3VNSA 5E38A 1JQBA 2O7VA 4PLFA 2BOVA 4AO6A 2CC2A 2KJQA 2GF2A 3BXEA 3NR2A 5H70A 3TFWA 2BFDB 4EO9A 2IBTA 2VXBA 2ZITA 4BQIA 3RC8A 3AF6A 1Z6GA 3SG0A 1AUPA 3DQZA 1RWMA 3D54D 1LSUA 4N47A 4CDNA 1NLFA 2OZEA 2PBFA 3L1KA 3QVTA 4B3SB 2F4NA 3RK1A 2ENWA 3EIEA 5ALTA 2AFIE 1HRDA 2ONZA 5CW2A 1B42A 1U5AA 2PMWB 4UATA 2JAXA 3VVMA 5C8DA 3VR3A 2WWTA 3N6VA 1HFEL 4NIMA 3WQRA 5D85A 3LQ2A 1B8OA 4W7HA 1N2XA 4ZV9A 2H7CA 4YBRA 3V1UA 4FFPA 4R40A 2IYSA 4PYNA 1YMUA 1TGYA 4AG3A 5CVDA 4BZZA 1LJUA 2HPAA 5IDWA 3I1IA 2I65A 2HK9A 3E8MA 4Q93A 1TAHA 1DC8A 3M81A 1WBDA 1A27A 3K7EA 3HVHA 4Q7MB 3SFZA 5FFMA 1EFCA 2CDRA 3EXHA 2ZRIA 3L1HA 2NNLD 1W4AA 1XYGA 2CVZA 2HJ9A 3PF9A 3KLOA 1GFIA 1GG5A 2OFWA 1Q22A 5HDQA 2RHMA 2Y27A 1Q50A 3MWDA 4LQ4A 1E32A 1VP9A 4F4IA 3FETA 2QAGB 3I2IA 2XNSA 1DG3A 3IBTA 3KYCB 2H52A 4M7WA 5EJGA 1BX1A 1NXOA 2VRWA 4XLLA 3IVCA 3B1KA 2M9MA 4LQDA 4MA5A 4D81A 4Z7NB 1JSRA 3DXZA 4K3VA 3UN1A 5KPJA 1XZDA 2QL7A 4JROA 2ZAGA 2HA5A 2LUOA 1LS1A 4IFEA 3UJ8A 4CCYA 2GEUA 4PAQA 5J4KA 3IILA 5DLEA 1PLJA 1DKNA 1L5HB 3D1VA 4E5KA 3PQCA 1R0WA 5AJYA 3ZQJA 5E4TA 2HDNB 4LS3A 2PE5A 2ZT6A 1E4OA 1S2LA 1CR2A 1E2DA 3QPDA 3C6YA 5F9MA 3S5JA 4BCBA 1W2GA 3Q8KA 2KMLA 1N8NA 1PJ4A 1BC5A 5JH7F 2R2AA 4KQIA 1JSLA 1JJFA 1DEAA 1QTIA 1XMJA 1JJBA 2GETA 2OHFA 2VTVA 3ICVA 4U9HS 5BMVF 3VSEA 2FP4B 4UCQA 4IGIA 4B6GA 3AU8A 4IWYA 1P2TA 1PR5A 4LSWA 4C4XA 5JD4A 4NG5A 1QQ7A 1UFOA 2JANA 4TMFA 3RC9A 1KI9A 2PMCA 4FYKA 1J4AA 1H2FA 4DQVA 4PPQA 1AK1A 2PJZA 3NH6A 3UAOA 5L4LA 3VPFA 1R9GA 2VJKA 5I7SA 4OPMA 4N54A 1RYNA 2QX4A 4RJKA 1EM6A 2JBAA 1ZCFA 4M4SA 2ZCVA 2YDYA 3OU2A 5F33A 5JMTA 1RPZA 1D8TA 1CX9B 4BNYA 2VAWA 2R2GA 2YCBA 3QIAA 1OV4A 1NE2A 3A3NA 3JWPA 5CVVA 2A1UA 1RRPA 5G3YA 1Z6QA 3UJDA 1FPQA 2L69A 5SV2A 1YZNA 2I8AA 3UOWA 1G8PA 4WZAE 2PT6A 2JVJA 3PQDA 4BBZA 1QIKA 2Z4TA 3S68A 4Q3DA 4RNDB 1X70A 4QLBA 4EJMA 2GN4A 2Q6LA 1FLDA 1M8GA 4H7IA 1EQAA 1G0NA 1Z0JA 3GZNB 3PQEA 4FR0A 2BEJA 4NNOA 3P2YA 1CKEA 4DA8A 3D4IA 3E7FA 4GE0A 4NMHA 3KJIA 3VZBA 1K3UB 2KS6A 2RB4A 5NULA 3VAAA 4A2QA 3KQMA 3RYTC 1Y48E 4AX4A 2W90A 3L0YA 1EXDA 1W73A 4L4RA 1CDOA 4RCYA 2R6R1 4IBOA 2Q0QA 1AQNA 4LWOA 4H1UA 1JAYA 5EOVA 3UT6A 9LDBA 3WV5A 3DBOB 3IO5A 3W6PA 4OHMA 4RANA 3ER6A 3I6MA 5TX7A 5BSMA 4D8WA 1GNLA 5T4BA 5CEFA 3LVRE 3ZCSA 4Q9LA 2H1OA 3KQQA 1XYVA 2QS9A 4CMBA 5B58C 3L01A 4UMDA 3UC9A 1JKIA 4BQSA 2YFYA 3SF0A 3QVSA 3B3JA 1PT6A 1AIPA 1RQ2A 1XTSA 1V11B 2H00A 3C4JA 3GRVA 3C1TA 3VH1A 1OIWA 5I4CA 1BRTA 1M8PA 1T9ZA 1BDIA 3RTCA 3RSFA 2X0JA 2P9FA 2RGUA 1Q1ZA 1E4EA 2QE7D 5DSXA 4OI1A 1J2RA 2GZSA 1ZIDA 3O8QB 4ALIA 2XRMA 4G4GA 1TL7C 4R68A 1Z08A 3CF0A 1J25A 2EZTA 4BMPB 4L75A 2CL6X 4XPZA 4S2EA 4XEHA 3DFIA 3ETCA 4Q0MA 5DP1A 2I7CA 1MJGA 2ECFA 2ORED 3KB2A 5A05A 4EYKA 5CA1A 1N77A 1N3YA 3TQSA 2I6FA 1VKNA 2Q2OA 2WKWA 4NYJR 4GM0A 2GRJA 2H1RA 2X19A 1CUVA 1ORRA 4QO7A 2VPWA 2WD9A 3IESA 4DMKA 3QMVA 3QTBA 4QGAA 3IEMA 3UUFA 3NCTA 1XKQA 4ZEWA 1CQZA 4WV3A 1CETA 1ECJA 4AJNA 3U56A 2JIZD 1RD4A 1JAIA 4B81A 1KYYA 4P7BA 4ZJYA 3M3HA 7ABPA 3EDYA 3L7OA 3OUUA 4FNGA 2OXRA 4NR0A 3BK7A 4M1WA 1UF9A 5JCOC 1J5EB 2KQUA 3SX0A 4EA9A 3CEJA 1OCEA 3H9QA 1T1SA 1DJPA 2C0QA 2ZIZA 4MEBA 3WICA 4AMZA 1ZK4A 4BXOB 2O7QA 3I28A 3N6XA 1QIIA 1VIVA 3RFCA 2I99A 4A10A 4DR7B 2FZKA 4DG9A 2C0CA 1WBBA 3MTAA 2VBFA 4WNAA 2DB3A 3VNQA 1TCVA 3NOOA 4IPTA 4NESA 2EIHA 1JVSA 3WDMA 4W63A 2QAGC 4XPIB 4YRFA 4B8ZA 5D87A 4X00A 3JVVA 1LQUA 3GEGA 2DY1A 4J2TA 5CLQA 1ETUA 4HATA 2GM4A 4PHTA 4IJKA 1E7MA 1DC4A 1T29A 2VJCA 2W4MA 2XXJA 4HPJB 3NIGB 4GXTA 4QIHA 4C4TA 1E5VA 3DTVD 3L7LA 4GL2A 3H0EA 3O9ZA 1W46A 1T2NA 1MB3A 3WGJA 3ZXXA 5LR6A 2SHKA 5J63A 3AKDA 3E3NA 4YFVA 4PXSA 4TMKA 5CYOA 1U7HA 3DBVO 3ER9A 4JWTA 3R76A 4Y2TA 1CUFA 3V9AA 3WL3A 4PYMA 3X43A 2H1SA 3GARA 3T7SA 2AJ8A 2DHRA 4LRWA 4Z8YA 4UVGA 5CHEA 2QQ5A 2BMDA 2EFHB 3VKFA 2FV8A 3LXMA 4EFLA 3WYFA 4FILA 2YBEA 3B5JA 5FBHA 3AGPA 3U7RA 2B4YA 2AQKA 2QG9A 2WU4A 1P77A 1C2TA 3AINA 4LTMA 4JEUA 4BNLA 3R5JA 2XADA 2A59A 2ZTLA 3G0CA 2R9VA 3GJ8A 2H54A 3Q6IA 1LQ2A 3BM5A 2CWDA 1QRAA 2KWIA 3T7RA 1ZBDA 2Q8NA 4ZV7A 3TW0A 4AN4A 3LJKA 3ZV3A 3ZCXA 3UJHA 3GVIA 1BH6A 3G49A 3GRPA 2FUG6 3L7NA 4WH0A 4C6HA 5D3MB 4S1PA 3EK2A 1QTQA 1QWOA 2CXRA 3AXSA 1ZEMA 1G291 2ZP1A 3R3SA 1NMZA 1W2HA 4QRIA 3SSNA 4ASUA 5K2OA 3JYLA 3G9XA 3E1GA 2WFAA 1KJ8A 1M1NB 1KR5A 3DMRA 1GA1A 4YCAA 2FEKA 2V6JA 1N5JA 5AESA 1KK0A 4FT4A 4M1EA 3K0CA 1V4VA 1AB6A 1X9IA 2IQIA 3SDZA 5K0TA 4XGKA 1L4BA 2OQ2A 2HMAA 1U7PA 3UK1A 3V6MA 1SUBA 2CLOB 3IOMA 4L51A 4WWHA 5IJ0A 1L8XA 4BVGA 2OG1A 1QV6A 2GVNA 3RHZA 1QP4A 2D2XA 2XNKA 1QYRA 3C6XA 1YAHA 1BS1A 4KTTE 2IVZA 3VYTB 2Q7OE 2ZTUA 1ZGCA 4P3OA 4BMSA 4TWRA 4ZOLF 3FPGA 3I37X 4BRSA 4B76A 4DLZA 1IY1A 1FSZA 1LDGA 3IJRA 3K5PA 3KKMA 3L7IA 4FGZA 3OE4A 2JRLA 1MT3A 3TR0A 2ZRDA 2YYZA 5LZ4A 3BD7A 1GRRA 1NDUA 1IDN1 1M6VB 1VGRA 3IAUA 3ETLA 4U5XA 5J5AA 2PPVA 4N6OA 1W0KD 2C9OA 1GNRA 5D7BA 2VDLB 5KYVA 2CF6A 5KSOA 4MJ7A 1KMIY 2OTCA 3JQ8A 2C29D 5IJ9B 1XEWX 2CWWA 1HDYA 1EAMA 1R6BX 2A67A 2Q6OA 3L1VA 3PDIA 2B3TA 4FMDB 1PP4A 2D5LA 4NG4A 1P8AA 3ORHA 1GU0A 3NJ4A 3PL1A 3H5WA 4C88A 3K70D 4Q7KA 1W9HA 3QGMA 4G5OA 1IUNA 3QVJA 3AZPA 4G5HA 1J2EA 4FCVA 5G1NA 1UZAA 4V0OA 1W4LA 3OE7D 4I4LA 4EUFA 3A9CA 1ZP6A 1OX6A 4RXTA 2ZJBA 1JMVA 3MOIA 4MO2A 4TTPA 4B4UA 2IW3A 3MILA 3E15A 2AG0A 4OMDA 4Y18A 2Z98A 5F2EA 1NLZA 4EB0A 3OT1B 4RXMA 2XTNA 3T06B 4BAUA 1RRGA 2P6NA 2ZXFA 4BDSA 3MN1A 3FGZA 2YJ5A 9MHTA 1T3HA 1G16A 2G6TA 1K4YA 2X5OA 2Z56A 3IIIA 3KVRA 1POXA 4MGKR 2XKKA 2ONKA 2YBDA 3ZQKA 5BW4A 2XXAA 3JYHA 4INZA 1R0BA 3FPEA 5CNJA 3OT4A 1HYQA 4BNKA 2BH9A 2IWRA 4F1KA 3DTTA 1IBKB 4V0KA 3V4VB 2IU0A 1HX7A 4LZAA 2IIVA 2JASA 2ZS8A 3GCGA 4LBZA 4CG0A 4ITRC 1QYXA 1UP7A 4QGFA 1ZQ9A 2EFEB 2BR3A 2VDJA 4N9QA 3TTUA 4D9MA 5JQWA 3QUSA 2A0XA 1R5NA 3KUCA 4GNRA 1QYWA 3I9MA 3F71A 3OH8A 3OLZA 4AZ0B 4BGEA 1V3VA 5LMNB 1B6TA 4G5SA 3B1JA 2IOQA 4D80A 1O6GA 1QIHA 3E8XA 3OLCX 1WXFA 2Z3WA 1M75A 1OXKB 3H8SA 2CKMA 3SSMA 5JHHB 4GP7A 3C8ZA 4AYXA 2HPHA 3H42B 1X9HA 3C1OA 1PFGA 4ESVA 4MPRA 4FX2A 9LDTA 1UEIA 4XSVA 2MIIA 4NK5A 3TJZA 2ZSFA 4TKUB 3P96A 2C9MA 3ANLA 4TRMA 1G8HA 3ADKA 2PO7A 1ODCA 4GYWA 3W6NA 4IQGA 5KOIA 1NOKA 1GGNA 4BNTA 3WWYA 1CJMA 1T6BY 3SXUB 4GI3A 5JTUA 2QN2A 1VHQA 1S8OA 1XB2A 4O2AB 2FFQA 1MENA 3KJXA 3HFJA 4CDGA 3JQ7B 1O8BA 4Q4JB 1JHMA 4XM1A 3IAM1 4LSGA 4RA9A 4EABA 2FWRA 3G2HA 4O2RA 3MOGA 2WB4A 2VQ6A 2AC4A 5BXQC 2I2XB 4X20A 3ZZMA 2ECQA 2Y4OA 2YV1A 5BRNA 2OAEA 3TSWA 5AKJA 1I9CA 2I3AA 3K9QO 2UYYA 4N9WA 3IO3A 1A5BB 2F59A 1QIDA 4RY8A 4FE4A 1GUZA 4Y0NA 2VQEB 4AKIA 2VSFA 4IHAA 2DUMA 4KK4A 2VNHA 4UU0A 1M6NA 3PXEA 4LF5B 2WF5A 3GX1A 1NQTA 4HFMA 5DYWA 2H48A 2Y66A 2PYDA 5GJCA 4Q3NA 1WWKA 1NVVR 3V1NA 4ZOCA 1NXWA 4Q4HA 4LIPD 4S1NA 1BVRA 3FHOA 4MKHA 3DT9A 4BVBA 2H1FA 2TECE 4D74A 5JRDS 1C8BA 5CIYA 1AGYA 3C3EA 3P8ZA 3UYKA 4CIXA 4ZTUB 4ENVA 4DLAA 4FLEA 4ND8B 3LO8A 2FGKA 2XE4A 3MB5A 4I2VA 4OXKA 4DTIA 4WZAA 3M82A 3CZ4A 3T4XA 4AK9A 4OATA 5AHWA 5HEKA 1I0ZA 4ENQA 3E9NA 3ZNQA 1JP7A 3NALA 1W0JD 1G8MA 4WZ6A 5JATA 4FI3C 3BXFA 3ZBQA 2O8CA 3W5JA 2G08A 1VJ5A 2UAGA 4FDUA 4V2IA 4X1YB 4AMVA 1J0DA 1KO5A 2CLHB 3GIWA 1MFZA 2J6BA 5FBLB 1IXRC 4BP9A 5LNK1 2ZUEA 3IPLA 1YZKA 2DH6A 1AV6A 4Q7JB 3UG7A 4ZQGA 2DVMA 4AG5A 3Q4GA 4IDQA 1XC7A 3PR2B 2NG1A 3RUAA 4AF6A 2VEDA 1G98A 1P61B 1XMSA 5EMLA 4AXBA 3G0HA 2W83A 5AK0A 4KIGA 1DMRA 1CFJA 2HBYA 1KQPA 2QT0A 5E9JA 4B71A 1PG5A 4OB7A 3KV1A 5FI3A 2JGFA 2OV8A 1EP9A 3V32A 4DSTA 1KMMA 4EJ0A 3P9PA 2VTKA 4E5SA 4RO0A 3JW8A 4Y1FA 4M8IA 5FO1A 3ZNPA 4EFNA 1F4LA 2PKCA 4L0QA 4UEWA 2P7IA 2J3MA 1MEJA 1Z2NX 1XIVA 2KBFA 4HDKA 4XE5A 4O4LF 4OX9B 1BE8A 2MSKA 2PZMA 4G8CA 5TPWA 4MRSA 3UJ7A 1FDWA 2MTBA 4TS1A 3QKIA 1PWEA 1KHTA 2PV7A 4MLCA 1A5SB 3WMFA 5HZKA 2R6DA 1ZH4A 3M4ZA 4BO0A 1WETA 2NUTA 3W6UA 1TECE 2ALJA 2NZYA 5E3JA 3VHQA 4E30A 5GZ3A 1IHXA 4LF8B 1U8YA 1V9LA 2DWUA 4OP1A 4BEJA 1O95C 4G0VA 1XZNA 3IJ5A 2MMGA 1GUDA 3WR5A 2LKCA 3P0EA 3R0JA 4LYAA 3ZWAA 3AVOA 4EW6A 1OWPA 2ZIUB 4BL5A 1QIJA 4J49A 4KYUA 4RZUA 3LUGA 3Q3HA 1RWWA 521PA 4I8DA 2PGOA 3QUBA 1B00A 2XB8A 4US2R 2UV8A 5J47A 3X1JA 2GFIA 3BWMA 4FBLA 3IIJA 4KXQA 2C31A 1QFJA 3N2KB 2Z6AA 2BW0A 4BC1A 3KT3A 3OLWA 2I6GA 2Q50A 3A1TA 4NDZA 2O6HA 2XYVA 1XTBA 3U4MA 3QV1A 1B6SA 3MIZA 3NZEA 3RU9A 1PS0A 4B6SA 3ZD7A 2AKYA 4Q9DA 5JWHA 1NJGA 1USWA 2RH4A 1PJCA 2IXBA 1U04A 3DE0X 5DYIA 4JR0A 1JFLA 1U3VA 5FLXA 5FV4A 4J90A 1E7QA 2I4IA 4WZBE 5C8YB 1VE5A 1GZVA 3ROEA 1JG7A 1A9RA 2REBA 3PFNA 3OE7A 4PQYA 1CULC 1F12A 5CIWA 5C1PA 1T15A 4M9UA 3PNKA 1TM5E 2Z6UA 1AMUA 2O3TA 1B14A 4QOJA 2O9JA 4L4YA 3OQOA 3IDQA 4B85A 3G9QA 4M87A 2ZZNA 1YFKA 5A3SA 3R0XA 1SUWA 2EGHA 2HSZA 1Y6QA 1F51E 4MAMA 4DANA 2CDAA 2IP1A 2Q3JA 5EP1A 5LBIA 4C7MA 1J7JA 2G8LA 2I4NA 4JMPA 4IDGA 1QCYA 4RZHA 2WK1A 1HNNA 4BBPA 5CVJA 5H3HA 1U63A 5EZYB 3H75A 1E7RA 2A0UA 4F84A 4B3GA 4V0SA 3WE7A 5JBQA 4OI0A 3D3JA 3IMGA 4KR9A 2P77A 3PUHA 2CV2A 4B3FX 4CEJB 3UZUA 4DJJA 3CNEA 4MV4A 1T3LA 3WBKA 2JBHA 2QLNA 4CW7A 4EHDA 3VZQA 5BOSA 1OTHA 3HI6A 1BGVA 1RBQA 2GUGA 1LW6E 3ZW8A 5D5PA 3EYWA 1Y34E 5AT1A 3E7DA 4KE8A 3LPLA 2R751 1X1QA 2P2YA 3CW9A 3LHKA 2CUZA 3M4XA 4GXRA 2KB0A 2PBZA 4K6MA 5DMHA 1XQ6A 4I5IA 3OT1A 2ZSIA 3QQ5A 2PXHA 3OFNA 5DTMA 5JZBA 1AURA 1KYQA 1W4BA 3AKZA 1VC2A 4DLLA 4GKJB 2IUYA 4AZWA 5CRIA 2GARA 1NFRA 1DRWA 3VO1A 1FJXA 4TWZA 1YQEA 4QPCA 4IH1A 4X5OA 3OQ6A 3GAMA 3KVVA 2WE8A 1YJXA 3NT5A 3PGKA 5EJFA 1KO7A 5L3ZA 5IAAA 3RUIA 3P5BA 5BN3B 2DFVA 3QWAA 3HCPA 4GPBA 3U4HA 1OYOA 4X54A 3CRMA 5ENVA 1L3CA 1I4EB 4HRYA 1OAOC 5KYWA 2EFJA 2COKA 2NTEA 3KYDB 3ZI4A 4PSAA 2P4EA 3E5MA 2IEBA 3MUOA 4D96A 1Z6TA 3JQ8B 4U5QA 3BXZA 1TCUA 1LX6A 3EMVA 3NB0A 2XKJE 4NWIA 5F4BA 3RWBA 1F2TB 1Y6ZA 2ATIA 3VYWA 4P9NA 3SSOA 3TGLA 2IUFA 2L18A 5A62A 3Q8XB 4ZI2A 4WK4B 1H2WA 4P0QB 4P5EA 4CU2A 4DXDA 3WNZA 1TZ2A 2FCRA 3K8QA 1AXGA 2ZSJA 2JIMA 4OH7A 2FPOA 4UHKA 4D41A 4LUCA 1IZ0A 4AS2A 4KCGA 1R37A 2HC9A 1FSPA 1SB9A 1S7CA 3KBOA 3NHJA 1BMFD 1E2UA 3TO5A 3ZVKA 2FE4A 5DFAA 5U1PA 4MKIA 1XSEA 1GL6A 5D3QA 4EPVA 1TLLA 1JEEA 3GVHA 3QHPA 1KI6B 3ZDZB 3JALB 2ZI9A 3BPSA 4A73A 2Y1EA 1C1HA 1LNQA 8ADHA 4A91A 1DTEA 2LXNA 1B15A 4MKZA 3REFA 2GXQA 1D2EA 4LXQA 1M1NA 5JXIA 4X63A 4O4IB 4FKZA 5BV1A 2M1ZA 2NTJA 1II8A 5CG1A 4D0SA 3UXYA 5I7FA 1BFUA 1XPUA 1XVVA 4IHJA 4X3OA 4Y2YA 2CVHA 1CE8A 2G77B 4ARBA 1Z4PX 4BO3A 1F8YA 2ZDQA 3UBMA 2QSUA 4ZCIA 3HYRA 3T99A 3WGTA 1SCUA 4NS1A 4MUAA 2YVUA 3TH5A 2WKRA 1T2VA 2OB1A 3FFXA 3K9WA 2G04A 3GRFA 2QIPA 3NBUA 1YZUA 2ZUWA 5KC8A 2BGWA 1BMFA 2WJHA 4R8VA 4YV1A 1V8OA 5JR3A 2VP2A 1D6SA 1JJIA 3HPQA 2O2YA 1EHCA 3HSSA 3IOYA 2PLRA 3CCBA 3DL0A 1DDIA 3QMMA 1N2OA 4YK7A 5AVYA 1A9PA 3M89A 4PNZA 1AXEA 3B1ZA 2DFDA 4N48A 3TXYA 2QTHA 3E5NA 4ZDKA 3N2ZB 4WKOA 2HX1A 2JAUA 3TOVA 1THMA 2QYSA 1H93A 1S4MA 2UYGA 4NENB 2WYWA 3SAJA 1TMKA 2CV1A 1ZFNA 3C3BA 3FSRA 2RKBA 1T2AA 3HI4A 4XWKA 3COYA 5H82A 3OQNA 2W8BA 4OJYA 5HE9A 3ZHUA 2AC7A 4S12A 3PDUA 1L1EA 2BR4A 2RH9B 3PNYA 5JO0A 2EVWX 8GPBA 1VL8A 3N8DA 4YECA 4D9HA 4W5JA 4E09A 3D8SA 1B26A 3Q0IA 2XQGA 3ACBA 1W581 4QFDA 4N49A 5MDHA 2DTXA 1ORTA 2DMRA 1P7VA 1UK7A 2OCLA 4B35A 2NYUA 4ZZ2A 4DPKA 3C48A 2UZ4A 2AW5A 1N7GA 1HQCA 4ZT3A 1UM9B 1RAAA 4X8MA 2H1WA 4HYQA 5HCIA 1DWOA 3DSRA 4I55A 5CU7A 5IKMA 1GTZA 3UGTA 3ZZUA 4BXOA 3FNBA 5EHIA 4IJ5A 4K6FA 4DV1B 4OJTA 4DQUA 3OJWA 3R3XA 5HPYB 3OFVA 2BRUC 3MF4A 4R69A 5KQRA 5CDGA 4MOWA 4NZZA 1RSZA 3QELB 3THWB 1R74A 4DPMA 4I2NA 3H2JA 3ZE8A 1GZ3A 2P68A 3DTNA 3LW7A 2QX6A 3GZTB 3VAZA 3DZJA 4D3SA 4M88A 1A7AA 1WTAA 1DDOA 4FDLA 5EIFA 2OORA 3CYFA 5LBTA 5I7EA 4HT3B 4IJMA 5AJXA 1O6CA 3QG5A 1SUDA 4F4UA 5CJ2A 4PG8A 1AO0A 3V4SA 1XRMA 1Z5VA 3UAYA 4AP5A 3UVEA 4ZQEA 4FMCB 1MP0A 1LK5A 4JFAA 4NCBA 3NOXA 4DCMA 2HQSA 3HCNA 3SBDA 5LLTA 2GZMA 3IHWA 2AH5A 2B8TA 1PZEA 3AMVA 5KNCA 3D3QA 5CB4B 3R3UA 4X7BA 1P3Y1 3MA0A 1O6FA 3C5EA 3FNGA 4OEHA 1DTSA 4RMIA 5BW5A 5EE1A 3D8TA 2CNWA 4B31A 4F5ZA 4UM9D 1BXZA 1AVTA 1HYEA 3R5XA 1AHIA 1NVGA 1OZHA 3K5IA 4AKEA 1I7SB 5DGHA 1T5LA 4LYYA 5ALJA 2W42A 3O8QA 4WFJA 1K8YB 3NAZA 3BXHA 4GE3A 3G8AA 1OLXA 4MS3A 1GTL1 3KPJA 1O96A 3WDKA 2FQQA 1ISFA 3Q41A 4FSHA 4L76A 3TLEA 1BWQA 3I8OA 1WM1A 4ZAZA 4CM6A 1KF0A 3LI2A 3JQAA 4TUYF 1C9NA 4LFCB 1AE1A 4LFBB 1MQ9A 1FP6A 4E70A 1DPGA 2IU4A 2HDWA 3V97A 3ZZ1A 5K3EA 3HWSA 2HMTA 1I51A 1Y9AA 1CJCA 3F4LA 3ZGVA 1WRBA 2AYYA 4CM5A 4YV7A 2B1JA 1F6WA 4MVJH 3HWRA 1D9ZA 2RG7A 3P9ZA 1SOAA 4JJFA 4YUVA 2C9BA 1PZGA 2IJGX 1XVUA 2PL3A 3PC4A 2RHLA 3PNMA 4O2LA 1Z4NA 4MTLA 4WL0A 4IFBA 2OBBA 1EHIA 1XK7A 3LHIA 4C07A 4QM7A 4K5QA 2J6HA 4B82A 2FMUA 2CEAA 1Q0QA 4J16A 5EE3A 4DQ0A 4L8LA 5J58A 4QPDA 2QRZA 4C0WA 4EGQA 2EAUA 3P2OA 4RX1A 5EAIA 2OQVA 2YJGA 1U1IA 3AEKA 1YGYA 1H8HA 2W2KB 1OASA 5FI0B 4D42A 1BE0A 3VO8A 5TV2A 1L5SA 1A2BA 4BASA 1AN9A 1G7CA 4DUGA 2J0SA 4OHYA 2IH5A 2C7QA 1HSOA 2XHZA 3CLSC 3JTMA 5AH0A 3KLPX 3C4VA 1A2QA 3DC7A 5JPIA 2D2VA 1V1JA 3NJ8A 3A1WA 4ETNA 1HBJA 1MQAA 4PVDA 1DBRA 2JNWA 4XASA 1MJHA 2ZYSA 4L57A 1KI8A 1R4NA 4AJKA 2HH9A 3D43A 2NU8A 2HK7A 2WT8A 3VUEA 1JALA 4BHTA 3WGUA 3UMCA 3GFTA 5P8WA 1YR6A 2ZRBA 3P0HA 3ZOKA 4BWGA 4GVLA 4KBYA 4DV6B 2AK2A 2BBWA 3QSYA 1KSHA 2IC5A 2MYTA 4Z7JA 5B1EA 3TCKA 3N5KA 3U39A 5CJPA 3Q1KA 1YE5A 1F6BA 4EMTA 2HEGA 1Z68A 2OBFA 3U4QA 1RYZA 3PWKA 2CD7A 4PSDA 4MKRA 3K32A 1RJGA 1JLHA 3PEUA 3DOOA 3N07A 4KLZA 5A5DA 3M6VA 1G5IA 1SVLA 1TFUA 4GI7A 4AURA 4EHKA 2G80A 4F7WA 2CV0A 1Y9EA 3B70A 2R6HA 1L7EA 4ZKEA 3QP9A 2QVLA 4KFRA 3WQQA 5B7GA 1QM5A 3STWA 4EHFA 1FYEA 5K0GA 1EVLA 4QT0A 1COWD 1K9VF 2FCAA 2RGCA 1L5HA 2EW8A 1J24A 3HU3A 5FUBA 5EIEA 2H06A 1U0GA 2NU6A 1ULZA 1VSTA 3RSCA 2G5GX 2OV4A 4TGLA 3ZCTA 2B4QA 3G1TA 4LGYA 1XR3A 1A8IA 4JSYA 4KQJA 3JYPA 4A5SA 3RVQA 2WJAA 4WK2B 4GXNA 2R48A 2CBZA 3F3YA 4LGMA 2OBYA 1EX7A 2GXSA 4KHZA 2FK7A 3JD4A 4O3FA 1JYEA 4JOSA 3I6YA 2QTZA 4KVFA 4M37A 4V2UA 1DBPA 1JYFA 1L7BA 1WXHA 2NACA 5EIAA 4EBBA 1J8MF 1NDHA 1PYDA 4KREA 2J4DA 3ZDBA 1I6WA 4IR7A 5L3QB 3FAZA 5HSGA 3L07A 5EJ2A 1UANA 4RS3A 1G9SA 4JLSA 1E7SA 1HFJA 1ZI6A 1OD6A 3SM3A 1JEYB 1QK4A 3OM0A 1E9RA 5HW0A 2WWXA 1X0VA 3OTHA 4EY4A 1CUXA 3Q8MA 2H31A 3IKLA 1G9XA 4FC7A 4RMHA 1APBA 3NANA 5KNCD 3O03A 4EGCB 2ZIAA 1XPJA 3TEFA 5LN1A 3HJBA 1E1RD 2VQFB 1H5UA 1U65A 5C7IO 5F1OA 1U0NA 2WICA 4CEHA 1KI3A 4FFWA 3L8GA 2VSQA 3H11A 4NXNB 3HBMA 3KWMA 4D0LB 1M1YE 2TMKA 3LS2A 7AT1A 3JARA 3FZNA 4NYJQ 4UQOA 4KO3S 3EG5A 4BJ5A 4ECAA 1QVRA 4MTCA 4B3TB 4MWSA 1NQWA 4ZO4A 3R7WA 1PL0A 4RPCA 3NTXA 4F6LA 5B7PA 6AT1A 4DMFA 1P60A 1DRUA 1SCDA 2GPTA 3GWZA 4G0MA 4QQRA 3AVVA 2QPAA 4KRGA 4HQKA 2F8LA 2YKGA 3EAGA 4TKVB 4FYMA 3WDSA 3E22B 3BKWA 4G5QA 4Z4EA 5EWJB 4EG7A 1M6YA 4ABYA 4A8JB 1NVKA 2H5LA 3EIUA 1UPAA 4GC5A 2H4WA 4HNRA 1VE7A 5C80A 1OVGA 4HYEA 4BO6A 2IZ0A 5LUBA 2Y1XA 2RH8A 3KQWA 4YGYA 1RHRA 5DXAA 1JB9A 3NATA 2PMFA 3CVYA 2YXEA 2OD9A 1E5QA 2J33A 3EXIA 3MWJA 3D4PA 4EI2A 2JLUA 1T1EA 2W37A 3NKFA 4I1RA 4ZA2A 3VTFA 2PU5A 4MCJA 1GHTA 1I4DD 1XXHE 2C9ZA 1ND5A 4IIEA 1K97A 5IJWA 3V48A 5K5EA 5C52B 2E49A 3G5LA 3MD9A 4DYVA 5LZ8A 3F8SA 4FFSA 4KPEC 2IOFA 5KSZA 5IVKA 4WBNB 3BWDD 3H5IA 1KIFA 1GZSA 4WLUA 3DS8A 1SEVA 2YXLA 3F3MA 5AI9A 3GFVA 1XJWA 3BMNB 4IKEA 4NBLA 4UJ3A 1M6EX 1TT5B 1JLMA 1NM5A 4QXRA 1Q15A 2B6NA 3W04A 3W3AH 3JSAA 3OF5A 4RIEA 4KX3A 4HI0E 2GZ2A 1T9AA 4A27A 1RKBA 2IY9A 1B7GO 3K3PA 4P08A 3ZCRA 3OPMA 2XV1A 1ZJ5A 2RH5A 5DM1A 1XP5A 2NXNA 3P7MA 4BAZA 4J0CA 1QX3A 1JZQA 4YEDA 4AROA 4FZ5A 4QFCA 1KMHB 2FZEA 1VSBA 4J0DA 1PW5A 4QGHA 2J9FB 1JA1A 4WCFC 5F2NA 3FOCA 3JTEA 2XMSA 3VPGA 1ZRMA 4LJ6A 5ITWA 2JHGA 1EI9A 2BMFA 3AEQA 1I2MA 1ZD1A 3H4VA 5ALNA 3IULA 5DWDA 3HU5A 3SZOA 2JBWA 3BIOA 2Y71A 3IBSA 5HMLA 3TJMA 2XUDA 4K88A 5IFLA 3DP7A 1GUYA 4TRRA 1FNDA 3S3TA 3TQTA 1NSTA 1OREA 4DMMA 1MNAA 1UKVY 4HOYA 2ZRCA 3QPWA 5B6JA 1G8SA 2B92A 1UBRS 2IY8A 2Q5FA 1JBEA 4HUQB 4YPFA 3QOYA 4RHCA 4AMBA 4R2XA 2PX6A 1ODTC 3AL2A 2E5WA 4S1VA 4AB1A 2C3OA 2Z30A 4GKVA 4B73A 1ZA2A 3LBHA 2X6TA 3G17A 3F1LA 1NWHA 2XX3A 4PPNA 4ZGWA 1Y8ZA 3O4FA 5GWXA 1WQ1R 2ZE8A 3LRXA 2Y4NA 5BN4B 4GR9A 3U3JA 2V3VA 4H4CA 4TLEA 1D2NA 2GYWA 2WM3A 4LYFA 4OHFA 4RM2A 1H85A 5DK4A 4KE6A 4L8GA 3K96A 1XZEA 5JPCA 1PSDA 1N1EA 3VGPA 3U5TA 1P0QA 3T5PA 4UNSA 5JAHA 3ILYA 2POQX 4JP8A 3I32A 2QN8A 1TEVA 4JLPA 3HYLA 5E6UB 3FLEA 1F0YA 1XVTA 2I87A 3IXLA 2AZ4A 3OZRA 3PL5A 3SU8A 2G1PA 1ULTA 3GCXA 5JTTA 1SXJC 2P9BA 2YHAA 5CXQA 2WWRA 5JAIA 1Y7PA 3EXAA 2NLOA 1SUAA 1XRQA 1CRPA 3KVYA 5CT9A 3IDAA 4O4IF 1KERA 5JWOA 3UUEA 4YLGA 1U7ZA 4N12A 3PA6A 2PS1A 4PC3A 1ZXXA 1LSJA 2DGDA 3K9GA 4HGQA 3DFFA 3HCRA 5EWMA 3WOVA 1XALA 2PD6A 2OZPA 2PZKA 4ZODA 2YWCA 3U3XA 4DLTA 1JQJC 4HXFB 4BAGA 2Q9AA 5FTJA 1B93A 1WIWA 4DWWA 4ZN6A 3S8MA 5D01A 1DAGA 3ASUA 1PGJA 4RMNA 2B0CA 2J3JA 3KC2A 1EIWA 2QU8A 1ATZA 2ZYTX 1Y3DE 1C4XA 3PNSA 4FFOA 4EELA 2QNBA 3CONA 3KAQA 1I30A 3F97A 5CJJA 1VJTA 3DWIA 4HAUA 4WACA 4K2AA 5LQRA 5LYJB 1L7MA 5H9VA 3HJGA 3ZX4A 3LYLA 4DQKA 1E6LA 2XR1A 3D0RA 4HJRA 3G1UA 4AO8A 1NY5A 1P1BA 3ONEA 1BQEA 3PWSA 5HF8A 3BSFA 2I8CA 3UV6A 1SXPA 1E1QD 4EB6B 4PYOA 1X0XA 1OPXA 2JH3A 2RK6A 3NIWA 2A3NA 4JJZA 5BW8A 9ATCA 1CJSA 1N7IA 1ESCA 1VI5A 4K9KA 1ZN7A 1L7RA 5EYPB 1YC5A 1NF3A 4QBFA 1M2EA 3F47A 4LX8A 2QYTA 4GFDA 3F2VA 1B0PA 2ZVDA 4HPXB 2R1TA 4P81A 4EL0A 5HOEA 3TZCA 3HWX1 1EDEA 1Y1TA 1PNTA 2FLWA 3BB4A 3C6QA 3EIOA 4UBKA 4X95A 5F51A 3I2GA 4B7UA 5BPFA 3I8SA 1BYUA 1BNCA 3LBFA 4I9UA 3VYVA 3ZPXA 2V7VA 1H42A 3AL3A 3NDPA 4A1FA 3PJDA 1Y3AA 4F60A 4MW4A 1KP3A 4KMMA 3TVTA 3EEIA 4PYRA 3G0GA 4OHBA 4UMFA 2NQ8A 4DCNA 3A2KA 2WJ6A 3OZUA 2M6SA 4WJLA 4GR4A 2M6RA 2XKAA 1W85B 4RYDA 4JCCA 1R10A 4R9VA 3PEWA 2Z1DA 5I4BA 1RYHA 1M1ZA 3OPQA 3FCOA 1D2CA 1PSZA 3EZFA 3K1ZA 3OMLA 3V2IA 5JZOA 4BNFA 1R1DA 3TLXA 1SUEA 4AY5A 3NGLA 3W5CA 1QKKA 1VG0B 1XU4A 2H7YA 4FGLA 1JHYA 4IDNA 2CLKB 1KTVA 2F1IA 1LPOA 1I7LA 2IGBA 3OFSA 3A3PA 2VPZA 3NPAA 1XWWA 1SHKA 3P94A 5B2FA 1GG8A 2OMKA 4OGGA 5KTPA 3HV2A 4YAEA 1OBFO 2CCJA 1D4ZA 1CLUA 3GIDA 2OLKA 4PX5A 1OTXA 2EYUA 3R0IA 2FW6A 4MB2A 3FVRA 5AI0A 6Q21A 5K0SA 4ZT7A 1KJYA 3PUKA 3SJCA 4OM8A 3RSZA 2J3IA 3ABZA 3TIFA 1X2EA 4JI4B 4GT1A 4OQDA 3OMXA 3V8PA 5LP1A 4L1KA 3IBGA 3ETGA 5F78A 5I9IA 4TLLB 1VG1A 5I47A 1NY6A 3IGFA 1OH8A 3GY0A 1N3BA 4TTAA 2W00A 4YDRA 4B0OA 3AB7A 1S9HA 4BGVA 4QKQA 3HB4X 2RD2A 1N33B 1K3FA 2ZIWB 3CR8A 3GFPA 4WEQA 1I36A 3E2IA 4IW3B 4DW8A 1WW2A 1GL9B 3Q7RA 4MV3A 4FD2A 2Q9CA 1NL3A 1IK4A 1AKQA 1QHIA 3DB2A 3O2JA 4Q3LA 3QFFA 5TVGA 5A4JA 5GINE 2C4UA 2PSJA 3QU4A 2A9RA 3KHSA 5CUQA 1I80A 1SVUA 4MAFA 3CGGA 2GPWA 3VZDA 2MR6A 4Z49A 4N41A 2XZLA 1I24A 1ZI8A 2ORYA 2DHQA 2WYUA 2I4LA 4F86A 2VF7A 5J1TB 2Q3MA 4MICA 3TZ6A 5HQ3A 5AI5A 4MQLA 1DQSA 3ODGA 5KQGA 4LOHA 1E6EA 3LFUA 2GVZC 3V6LA 2J67A 2VQ3A 3ETDA 3PHIA 4ZXPA 3I42A 4S1TA 3NYIA 4HWRA 1TYAE 2NZ8A 4LYJA 4QYSA 4OO3A 4V0RA 1YJ8A 5MN4A 4E2YA 3GJ0A 3RWOA 3CEHA 1DAFA 4LMRA 4R05A 2CL7X 1GZ6A 4DCVA 1R0SA 1KE1A 4P93A 1L4LA 3PS9A 3QM1A 2YWDA 3WFIA 3BD6A 5AQ1A 4BNZA 1QPGA 1C1YA 3EUAA 1CF9A 1CS0A 3GGOA 1D07A 1NJFA 5L4SA 4Z4IA 1UZLA 3OP4A 3R3JA 4KGDA 2NU7B 4C4PA 5EHZA 3DXFA 4DUPA 3EEFA 1TUGA 4GPAA 3L4EA 3RS9A 1NA5A 2FVXA 3PTAA 1FE8A 1W36B 3OO1A 4WVFA 3WNCA 4ZOLA 2PLFA 4JVOA 5HG0A 1JUDA 4TKMA 1CUWA 1EU1A 2XF8A 1OYYA 4OJKA 1B23P 1FFXB 1SHUX 1UQTA 3CUKA 1Y9DA 3OEHA 4L5JA 2IXGA 4DBZA 1MX9A 2CHQA 4YMGA 4DHWA 3V2UA 4CM4A 1S1CA 4N7JA 3NHLA 3BZUA 1ZD2P 3LK6A 4RGYA 5LOVA 1BRMA 3W1EA 2R3SA 1RZUA 3K9CA 4HMQA 1J8VA 1PTJA 2F4VB 1KIMA 3NJRA 1H4QA 1G6KA 1NUHA 1HDOA 5DGTA 1JG1A 1RU3A 2HV8A 3OFJA 4LGCA 5ALDA 4RPGA 4XUDA 4YO7A 4E1BA 3G0OA 1BJRE 4UREA 4C6RA 4A0SA 3F74A 4JLAA 2BFCB 4RPLA 1JEOA 4K6CA 5EJ7A 3GLHA 1R7RA 3RRMA 1TM4E 1VBKA 2KM1A 3DPIA 3PWZA 2I22A 4IO1A 1YJCA 2Q2VA 4ZMSA 2CXXA 3A9WA 1PNOA 2X7JA 3HA3A 3UATA 3CUYA 2BEKA 1FK8A 1E9AA 1T91A 3EC7A 5HFAA 5BV8A 1IN6A 2GK4A 3GK3A 4TV8B 5DBOA 1Z75A 3OTQA 3ZWYA 4JYMA 1UJ5A 4DQXA 2NSHA 3BCSA 3M9WA 3NFYA 3OIYA 3WRVA 1JBQA 1MA0A 1M54A 2WW8A 3M6IA 1VKZA 2XUQA 5BORA 4DJEC 3O8OA 5JS7A 5DNCA 1NUTA 1XXHB 3QKWA 5H02A 5BMVB 5CT5A 2WHYA 1KZ4A 3P20A 1W2WB 3KQKA 2PGAA 2DFKB 4I8IA 5F21A 2JH8A 4BNHA 4EUSA 4OSEA 1WE2A 4JB8A 1NAHA 3WB0A 5DLYA 1VXOA 3LWNA 3PKIA 2WD8A 1A4UA 1TAUA 5AUQA 3BHIA 4HS4A 5BW6B 1GV0A 4ND3A 4DKXA 3UOAB 1DRKA 4EEKA 5KKNB 2Q5CA 1A7JA 2IPLA 1YDMA 2JFOA 2PD4A 3E5RA 3IKMB 1VHDA 2QXYA 1P5ZB 3JQGB 1MO5A 1KFJB 3KEFA 3PPXA 3FOAA 3OPYI 4JVMA 4L2IA 4UE2A 3U0BA 4DY4A 5FPKA 2RGAA 2CN1A 2G72A 4RUKA 3BIWA 4NL4H 3LM8A 4E5UA 4JQZA 1OI3A 1Z6YA 3ANYB 1GARA 4HUJA 4RBNA 3ISTA 4RU1A 1FFEA 4UUPA 5B2ZA 3LH5A 1WUYA 4JKIA 1CEXA 4INOA 4FYXA 3RVPA 5K8VA 2V7XA 3C3MA 3AHIA 3AX6A 3V5NA 1X8JA 1A4XA 4HD8A 4Y2HA 5K3BA 4CLXA 4CUJA 2PR2A 1GGKA 1XLTC 4X6XA 2PWPA 4A0QA 4D0NA 3OZAA 4UPEA 1T2DA 4CMHA 3RTDA 1J9ZA 2GBFA 1TMOA 3E9ZA 4MMZB 1FS4A 3PE6A 1UKCA 1K1EA 4J3JA 1D04A 3JQGA 2ETVA 2XAUA 1PJSA 4I9FA 2NV2B 2Y0DA 3JWIA 4M54A 2JCVA 5KX5F 3SQNA 3TZKA 1JDNA 1AF7A 2NO1A 1WJGA 3VVLA 4UM9B 1YMQA 1U9CA 4TKZA 5AK3A 2QUAA 3G2KA 3HB1A 2XMGA 1HTBA 1VA4A 4CKCB 3CRW1 3WGMA 3E5HA 1BU5A 1JJVA 1JR3D 3MJFA 2ZXUA 3DR3A 4Q39A 3CINA 3V3TA 4EG6A 3I6QA 2AEJA 3VNBA 1RJFA 1N7JA 5EG5A 5C7OO 6LDHA 2NIPA 1CWUA 1GG9A 3HJTA 2VP6A 4KLRA 2EW1A 1R64A 1Z0AA 3ORYA 2PNJA 3RU2A 5JNSA 4QE3A 5K6AC 4OXQA 4EFDA 1FLVA 5I7AA 2M6KA 4TVBA 3TKYA 2IK8A 4Q4AB 4P32A 4ISCA 4DB4A 1G3RA 4B5LA 2BC9A 5CFLA 4B6PA 2OAQ1 3N6RA 3L8MA 4GIBA 2BJHA 1DJQA 4MRNA 2CCGA 3EH2A 4K1XA 4HMPA 5ALWA 1KE2A 2AGVA 3VI4B 3ZW7A 4E15A 3EF0A 2BKLA 3ELBA 1NJSA 4FFBA 10MHA 1DIBA 3UV3A 3STXA 3LT0A 1H66A 2Y68A 4GPTA 1L5GB 8ATCA 1LLFA 2GNAA 2YQ4A 3K0AB 3SFTA 4C06A 2F3RA 2FUEA 5A5GA 4URHA 2PRSA 2FPGB 3AI2A 1FYXA 3AR3A 2R6GA 3CMCO 1W6RA 4KLCA 4S35A 5LOVF 4E5MA 4JB2A 1OTYA 2AQIA 5JVDF 2PUBA 1N2CB 221PA 3HKBA 1OXXK 1G8JA 3MB8A 4MGYR 4AZ3B 1UEJA 4L9WA 3EXFB 2XUFA 4F11A 3MMZA 4EA6A 3EDCA 2CHUA 3UJAA 2I7XA 2QD4A 2YN4A 3CKLA 2DUUA 2V7GA 2RGWA 3TLCA 3ZHVA 1EINA 3U16A 2FZCA 4EKGA 4L9RA 2OZKA 2PCLA 3S2YA