1WY8A

Solution structure of the n-terminal ubiquitin-like domain in human np95/icbp90-like ring finger protein (nirf)
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
89
structure length
89
Chain Sequence
GSSGSSGMWIQVRTIDGSKTCTIEDVSRKATIEELRERVWALFDVRPECQRLFYRGKQLENGYTLFDYDVGLNDIIQLLVRPDSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution Structure of the N-terminal Ubiquitin-like Domain in Human Np95/ICBP90-like Ring Finger Protein (NIRF)
rcsb
source organism Homo sapiens
molecule tags Ligase
molecule keywords Np95-like ring finger protein, isoform a
total genus 12
structure length 89
sequence length 89
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2005-02-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00240 ubiquitin Ubiquitin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 1wy8A00
2C5LC 4G3XB 4W9LA 2UYZB 2BWFA 2KFKA 2ZNVC 3EECA 2RGFA 1P3QU 2A5UA 1WGDA 3M62B 4MGIE 2KFKB 4AJWA 1XQQA 4XZ4A 2JRHA 3A9JB 2MA9B 2KTRA 2KWVB 3A9JA 1R4MI 5AEKB 3SDLC 2GBMA 4DHJD 1KM7A 2LVOA 3PLVA 5CHFA 4HK2A 5KHOA 3ONSA 3IVFA 1VCBA 4XC2A 4A20A 4BBNC 3R3MA 4ASWC 4BKTA 3VH4B 4PYUA 2FUHB 3EFUA 3NHEB 3QC8B 4I6NB 2HD5B 1GG3A 4TUUA 3VXWA 2IZVB 2L8JA 4HCNB 5FR6A 4KZ0A 1WXVA 3RULA 2DYOA 1OEYJ 3A4RA 4HPLB 2KQ7A 4JQWC 1UZXB 2BKRB 1KJTA 4HJKA 3DPDA 2Z0EB 3NZSA 2BKFA 4BOZB 2G3QB 4LJPB 4IWPA 4TQ1A 2XK5A 4YL8A 1V80A 5AZGA 3UGBB 3UIPB 2FCMA 1Q1OA 2EMTA 4I6PA 2MBOA 4WJQA 1IP9A 1RAXA 2GOWA 1V81A 1J19A 3N32A 2LGDA 3AULA 2DZJA 1SGHA 3IHPC 5AZFA 3L17A 2O2VB 1KLVA 2ASQA 4AOFA 1P0RA 1WE6A 4FJZA 2JY6A 4P7IA 2KJHB 3UQAA 3ZRCA 1K8RB 1YD8U 3QARA 3V62A 1G6JA 1V49A 2GBRA 2J0JA 2KXJA 3N3KB 4NNJB 1WX8A 2JT4B 3CSFA 4KIKB 3DDCB 3QAQA 4MGKE 2CR5A 3EHVA 4KIKA 1WXAA 3BINA 1F9JA 2C9WB 2L3ZA 1V6EA 2JZ3B 4G50A 3KYDD 1YX5B 2IY1B 1KOTA 2EKEC 3JSVA 2RPQA 1S1QB 2DZKA 3H7PA 4IG7B 4BKSD 3SU8X 1Y8RC 2K8BA 3DOWA 3ZO5B 4A3OA 2LXCA 2KANA 4DHJB 2KFJA 3PREA 4F7ZA 4IC7B 5C1ZA 3PRMB 2ZPNA 1NDDA 3QIJA 2ZVNA 3HHMA 4WQOB 1UGMA 2KX0A 5TR5A 2CHZA 3ZNID 1P1AA 1ZGUB 4MH0E 3PVLA 2G4DB 3CF6E 1P9DU 2DX5B 1YQBA 3RD2A 2K1FA 5IA7A 3A9KB 1S3SG 2BYFA 3H9DA 4MELA 3V6CB 3PPAA 2IYDB 3MJWA 3QA8A 1UD7A 3HM3A 4ZRIA 3RCZA 3ZW3A 4MSMB 3VTUA 2RSUA 2M1MA 5E6NA 2L05A 1E8WA 3WAOA 4FLHA 3NZUA 2LRWA 3KUZA 2L76A 3V6EB 2LD9A 5DPRA 2N1WA 4DHZE 2FNJB 5AZHA 2KWCA 4ZDVA 4M8NA 1J0GA 3H1UA 1E7UA 2A4ZA 2DENB 4EEWA 3M95A 3DBSA 2IO0B 1V5OA 5EDSA 3H6NA 4NQKE 2EMSA 2MW5A 3ZNHB 1I35A 1TTNA 2N9XA 4IWOA 3L16A 4DDID 5LLIA 2LGXA 1GJZA 5D2MB 4PS7A 3PRZA 2ZNVB 2AYOB 1WM2A 3R7QA 3W1YA 5C23A 4KZCA 1YX6B 4WJOA 3AI5A 4GDKA 2KMCA 1WRDB 4GDLB 2XK5B 2DYMA 2XEWA 2BWES 3U8ZA 3B08A 1RFAA 3SD5A 2NBUA 3HIZA 2LJ5A 4GGQA 4RMAA 4DDGD 5KHQA 4MSQB 4GOCA 2LRUA 2DHZA 1GC6A 4AUQC 4GXBA 1UELA 3AXCA 5E6OA 1BT0A 4HLEA 4AWJA 4G11A 3TBLD 5J17A 1HE8A 2CU1A 3ZRFA 1XT9B 4BBNF 1LM8B 2FCNA 3QJZA 4FA6A 5JHBA 3ZVVA 1WX9A 3ECIA 1V9JA 1LQBA 1C1YB 4W9KA 1EUVB 3KVFB 1SE9A 3V61A 4JL9A 1WR6E 1X1MA 5GMVA 4E74A 2LUEA 1SIFA 3PHXB 4ICUA 4PS3A 3DBHI 2DAFA 3QCAA 2R2OA 2KLGA 3B1LX 2KC2A 2KQSA 4KSKC 4KVGB 1WMHB 2K6QA 2YLMA 2I1KA 2YVCA 3PT2B 3PS6A 3QX1A 4MGYE 3VTVA 1D3ZA 4WJNA 3DVGX 4NJ7A 4B95A 4NAWB 3RUIB 4LDTB 3PGEA 2L0TA 2V4LA 1JRUA 1WXSA 3Q3FA 1R4NI 3P2BA 3ZTCA 3R66C 1WI0A 2OOBB 4IWQA 1WF9A 4OVUA 2JRIB 4BOSC 2D2QA 2FAZA 3M3JA 1Z2MA 4KDLB 2K39A 2C7HA 2ZVOA 5G2NA 1H8CA 4W9JA 4HXDA 4ANVA 2LZ6A 3V60A 3NY5A 2BF8B 2LVPA 3WANA 1H4RA 1WGHA 2C60A 2XBBC 5DPWA 4FADA 1E8YA 2MP2B 4NPNA 2BYEA 2MP2A 4W9GA 1WGRA 5IAAC 4ANWA 1E90A 4II3B 1L7YA 2MSED 5CTRC 5L95C 1WYWB 3UINB 3ML9A 4FBJB 2AWTA 5LXIB 2Z0DB 4HWIB 2KTFA 3DBLI 3D32A 4TQ0A 5D94A 3W1SA 3SHQA 2I1JA 2LI5A 2WX1A 2JF5A 3WALA 4EFOA 5LXHA 1WY8A 3ZDMC 3UQBA 2NCNA 1WE7A 2RD0A 3APFA 3DVNU 1WJUA 3VUXA 4N9F4 4EUTA 2W9NA 3L54A 4K7WA 4W9HA 2MQJA 1L2NA 1V2YA 2L0FA 2Y5BB 2D11A 2IO3B 4IW0A 3W1SC 3ML8A 4EZKA 5D7GA 4TV3A 1WZ0A 3CMMB 2KO3A 4WJPA 2DZIA 1NBFC 4K7SA 2KKCA 2KNBA 4MGZE 2ZJDA 2M4NA 4K1RB 1IPGA 1OQYA 4BFRA 2KDEB 2LXAA 3H7SA 3MHSD 4FHKA 4GSWA 3TJPA 3APDA 3JVZX 4ZYNA 3QK0A 4DBGA 1GNUA 3TIXA 3X0WA 4II2B 2Z59B 2N1VA 4EZLA 4CO7A 4AJYB 3NS8A 3PTFC 2KTRB 1TGZB 2KDFB 3OAWA 2KDIA 1I42A 4IM3A 2G4SA 1E7VA 3ZDTA 2KD0A 3RZWC 4ANUA 4GMVA 2V1YA 2FIFA 4J6IA 1IYFA 4W9IA 3QWZB 4ZRKA 2J0MA 4B9KA 2KHWB 4W9CA 3L13A 1WJ6A 2ZPYA 1WM3A 2N7DA 3GOEA 3ALBA 3HK0A 1WH3A 3OJ4B 2WWZA 3PZDA 4HPMB 3ZUNA 1WJNA 3HM6X 4URKA 4LDTD 2PE6B 3ZLZA 2CS4A 1Q5WB 3VUYA 3H7PB 1FXTB 3X23A 4GDKB 4W9FA 4GDLA 2GBKA 2D10A 4X57B 4B6WA 1E8XA 2PE9A 3U30A 2QHOA 4FN2A 1LFDA 2LGYA 2WX0A 4G0NB 1QZEA 4JGHB 2REXA 4NY0A 2IO1B 2MLBA 3QHTA 2BGFA 2LWPA 3WIMA 4E71A 4RM8A 2O6VB 4M0WB 5DPTA 5D6JB 5CHWA 4WAAA 2O6VA 3OLMD 4MM3A 2CHWA 2AL6A 2DYBA 2JVCA 2NPTA 3DVNV 1WR1A 3JYUA 2NR2A 2NPTB 1NI2A 3U7DA 2C7NB 2J0KA 2VRRB 2UWQA 2KN5A 4PYZA 1EF5A 3KUDB 2RR9A 3VH3B 3UIOB 1V86A 2M17A 3OJ3A 1MG8A 2ZCCA 3UF8A 2MBBB 2KX3A 4ANXA 4IM0A 3VDZA 3VFKA 2B3AA 1U4AA 2MX2A 1ISNA 1GC7A 4MJSA 3VHTC 5CHVC 3GZNI 4LCDE 2GBNA 1ZW7A 3L10B 1OEYA 4CYEA 4K81A 4IUMB 4EZJA 4W9DA 2PPHA 3R7RA 3ZIMA 2N9PC 1WMHA 2WDTB 3PLUA 3N30A 4MEMA 3PRPB 5L83A 3ZKJC 1WGYA 1WXMA 2KJRA 2ZCBA 2OJRA 5G55A 5JZEB 4FJVB 2KZRA 3IBEA 3QQ8B 3WAMA 1E5WA 3RT3B 3AU5A 2O6VD 2JPHA 3CSTA 3RYTA 5DPSA 4BKSA 1YJ1A 2GBJA 3ZNZB 2DZMA 4RM9A 2KWUB 3B0AA 4KV2A 4GIVA 2MBEA 3IFWB 3DCGA 3IG3A 5CX3A 1CMXB 1Z5SB 2KLCA 2HTHA 2N9EB 3PHWB 4HDQA 5J2RA 2BYVE 2PJHA 1J8CA 1V5TA 2JUOA 3ENEA 1T0YA 3T9LA 1E8ZA 1WIAA 4WWPA 1C3TA 2HE7A 1ZKHA 2KOXA 3VVWB 4EKUA 2O2VA 3KH0A 2KMAA 5DCNA 2JZZA 1Q0WB 3ZTDA 4HCPB 4ZRJA 1OTRB 4FULA 4HDOA 3S2AA 3Q3JA 3RZFA 3AU4A 3DVGY 1RLFA 3APCA 3WA0A 2CKHB 3MTNB 2J7QB 3KYCD 2MCNB 2AL3A 4A3PA 2KJ6A 1GUAB 3TMPB 4KDIC 2PEAA 1YIWA 2KDBA 4WWOA 4DK5A 2L00B 2NBWB 4JLCA 3A4SC 2K8HA 3VAWA 2C7MB 2MRPA 3JSVB 2IBIB 2IY0B 4GB9A 4GU2A 2HJ8A 5E6PA 4EOYA 3LDZE 3DBRI 2FIDA 2M8SA 2CHXA 4HVBA 2DAJA 3NOBA 5JHAA 2KC1A 3WAPA 4BKGA 3TCAA 1WJ4A 2WYQA 1RRBA 2ZEQA 4NAWA 3KUCB 2LASA 1P98A 1WX7A 5JH5C 2JWZA 3K9OB 4GN1A 4K7UA 4NJ6A 3JW0X 3DQVA 2NVUI 2MWSB 3BY4B 2NBVB 4FHJA 4WWNA 1WGGA 2D3GA 4NQLB 2AEHA 4LJOB 2FCQA 1XD3B 4E3CA 3O65B 3A33B 3KW5B 4MDKE 1WFYA 3A9KA 3VUWA 1LXDA 4F8CB 4DXAB 4AP4C 1EF1A 3C0RB 1UBQA 2K8CA 2LVQA 2FCSA 3LJ3A 3L0WB 3M63B 4M8MA 4FJYA 3TL5A 2ZZPB 2BPSA 3PSEB 4OVVA 3VTWA 4PS8A 4MJSB 3I3TB 2L7RA 1OGWA 4DHZB 5HKHA 1VD2A 1WZ3A 4TKNA 2D07B 2JXXA 2N7EA 4CHKA 4IM2A 3A1QA 3L08A 1EO6A 4ICVA 2K6DB 2MBHA 3A1QB 4F1SA 3ZNGC 2IO2B 1UBIA 4KSLC 2KK8A 4DWFA 1TBEA 5BO4B 2N4FA 2V3SA 3T8MA 1A5RA 1UH6A 2G45B 1M94A 2KVRA 3PV1A 4I6LB 2MBQA 2M0XA 2GMIC 5J18A 2K25A 4W9EA 1AARA 2NS5A 1TZ1A 3EC8A 4XX5A 3K9PB 2R2QA 4BVUC 1PQSA 3VQIA 4JIOU
chains in the Genus database with same CATH superfamily
1ESFA 1WGDA 4MGIE 2KFKB 3Q8BA 1XQQA 3A9JB 2MA9B 3MFGA 1R4MI 2LUMA 1CJEA 2GBMA 4A20A 3EFUA 1P7FA 3QC8B 1XO3A 1SJHD 2RDHA 3P42A 4HCNB 1HQRD 3FKYA 2WXLA 2DYOA 4JQWC 4ZRQA 1KJTA 3NZSA 2BKFA 4LK0M 1V80A 2EMTA 2MBOA 4JX1C 4WJQA 1WGKA 1VLBA 2DZJA 3V05A 2JWUA 3L17A 1P0RA 4JWSC 4UDUC 2JY6A 3UQAA 1YD8U 3QARA 4KKJA 1V49A 3HUIA 1WX8A 3BIID 4KIKB 3DDCB 4MGKE 1OFFA 1JMLA 3BZDB 3N1YC 4G50A 2B76B 4DHJB 2KFJA 4IC7B 4A6QA 2WQYB 3PRMB 2ZPNA 1GPXA 1JROA 1UGMA 1DGJA 4S0RA 3L4PA 3PVLA 1UWMA 3Q8CA 1YQBA 1C4AA 1UD7A 1J7CA 3VTUA 2RSUA 2M1MA 5E6NA 2L05A 3T3NA 2I2YA 3WCQA 2KWDA 2LRWA 2QJLA 4YXDB 3V6EB 4ZDVA 2AQ2B 1J0GA 2IO0B 5EDSA 1QILA 4ZHOA 1TTNA 1SF0A 3U2SC 3L16A 1N6ZA 3V3XA 2QIEB 2ZNVB 1YX6B 4WJOA 2FBWB 4GDKA 4OVZA 2DYMA 2K0PA 3TEYA 1KRHA 2BWES 5T8IA 3SFEB 2GLSA 4C00A 2N0SB 1GC6A 4HLEA 4BBNF 5JHBA 1IBXB 1LQBA 1C1YB 4PT5A 1EUVB 3V61A 1SE9A 3IAM1 3U4EG 1SIFA 4ICUA 4PS3A 1STEA 3R2TA 1BMLC 3DBHI 4KVGB 2N9LA 1WMHB 2YLMA 2I1KA 3QX1A 4WJNA 3MC9A 2V4LA 1I4HA 1WXSA 3P2BA 3ZTCA 3R66C 1WI0A 3NVZA 4OVUA 2JRIB 3Q3MC 4KDLB 2K39A 2C7HA 2VZKB 1QF6A 4HXDA 2LZ6A 2EKIA 3NY5A 3RPFC 2BF8B 1R4NB 3DHGC 3WANA 2C60A 2XBBC 2LEKA 3MHZA 4NJCA 1YN5A 3AEGB 5L95C 1WYWB 1J7AA 5LXIB 4HWIB 3DBLI 3AE7B 3W1SA 3ZJTA 1C77A 2NCNA 1HEZE 3APFA 1WJUA 3AE6B 2G1EA 2L0FA 3P4QB 2IO3B 3W1SC 4TV3A 2TSSA 1NYRA 1DOIA 2IJ0A 4A55A 1OQYA 2LXAA 1GB1A 3MHSD 4FHKA 1QQRA 3APDA 4ZYNA 4II2B 4L1BA 1QOBA 3FC4A 4EZLA 4CO7A 3AE4B 1XLOA 1K52A 2LMCA 1I7HA 2KDFB 5JXVA 4IM3A 3GB1A 4ZYSA 1FRDA 4HEA1 2FIFA 1EM7A 2AQ1B 3BK2A 4W9IA 2OEDA 3QWZB 1TY0A 1YQ4B 2KHWB 4W9CA 3L13A 5BYRA 1M4VA 1WM3A 3GOEA 3ALBA 3HK0A 1WH3A 2ICIA 3OJ4B 5H8YE 4URKA 4LDTD 1UNSA 3BK1A 3TSSA 1YQ3B 4X57B 2PE9A 1LFDA 4K3BA 2HJ1A 2HDEA 1ROEA 2WXFA 1ET6A 3GP7A 4KGTA 2N7JA 4M0WA 3OLMD 2AL6A 2JVCA 2NPTA 4EE2A 1WR1A 1A70A 1NI2A 2VRRB 2KN5A 1FD6A 1EF5A 1T0RC 5HFYA 1L4DB 5GXGB 3UIOB 5IN7A 3UF8A 2QMTA 2MX2A 1ISNA 1EU3A 2VH2A 3VHTC 1L0YB 4RH6A 5CHVC 3GZNI 1PGXA 2GBNA 2BQQA 3R7RA 2K3UA 2M19A 2V3NA 4C56C 1T6BX 3ZKJC 1D4BA 2D3AA 3MJ5A 2OJRA 3B2FA 4FJVB 1NI3A 4LNOA 3WAMA 3AEFB 2O6VD 4KGRA 1HZ6A 5DPSA 2HTME 2X38A 1LO5D 3ZNZB 4YSXB 3B0AA 4KV2A 3DCGA 4IOIE 5CX3A 5BMGA 3NVYA 2KLCA 2HTHA 2N9EB 3DBHB 5J2RA 2NTTA 4C4VA 1J8CA 1T0YA 3VVWB 1E6EB 1FMAD 2BT6A 4KKIA 2JZZA 1MFWA 4HCPB 1OTRB 4ZRJA 4FULA 3SR6A 3DVGY 3APCA 3KYCD 4A3PA 2BTEA 3TMPB 1YIWA 1FO4A 4WWOA 2JZPA 3A4SC 2C7MB 2MRPA 5BYQA 4RGNA 3SFDB 4GU2A 4B0MA 2FIDA 2M8SA 2DAJA 2KC1A 3P4PB 2GRIA 5EE9A 2WYQA 3LB8C 2LASA 1P98A 2J52A 4GN1A 4NJ6A 4K7UA 5MPOA 2W3RA 4B0EA 2D3BA 4FHJA 1WGGA 2D3GA 4E3CA 2PVOD 1CK1A 4MDKE 1HXYD 3VUWA 2K8CA 3BVMA 4FJYA 3TL5A 1YJIA 3DHIC 3PSEB 3KWVA 4PS8A 1YOVB 4M01A 5EE0A 3Q3OC 5H92C 2N7EA 3DHHC 4CHKA 3P4RB 1SJED 1SB3C 4KSLC 1V97A 5BO4B 2M0AA 1JWAD 2EELA 4LNFA 2IDYA 3R2IA 4NAMA 2BW2A 1JW9D 3PV1A 1L6UA 2GMIC 4C80A 3NZ3A 4W9EA 1TZ1A 3EC8A 2LGIA 2WLBA 4G3XB 4W9LA 2BWFA 2KFKA 1SE4A 2ZNVC 4JE3B 1P3QU 2JRHA 3AEAB 2KTRA 1PGAA 5AEKB 3ZQ4A 2LVOA 3PLVA 5CHFA 2SEBD 4ASWC 3VH4B 3NHEB 2HD5B 1GG3A 3Q3NC 1LGRA 2IZVB 2L8JA 2WXMA 3DBRB 2KQ7A 1P7EA 2MH7A 4HJKA 1I4QA 1XLNA 1KH0A 4TQ1A 3ZYYX 2V4IB 4I6PA 1YN3A 2JYEA 1RAXA 2GOWA 4BAXA 1V81A 4TMAB 1QOAA 1SGHA 3IHPC 1WXQA 2O2VB 2ASQA 2L1AA 4AOFA 3VRBB 1WE6A 2KJHB 3H8HA 3ZRCA 2WDQB 3V62A 2GBRA 3I57A 2KXJA 3N3KB 1V1OA 2JT4B 2CR5A 1SBBB 2C9WB 2L3ZA 1V6EA 1MPEA 1MVKA 3KYDD 4RGOS 2PTLA 3IAS1 2IY1B 1KOTA 2EKEC 1S1QB 3AE3B 2DZKA 3H7PA 2I38A 3UI3A 3DOWA 3FILB 4A3OA 4F7ZA 1P1AA 1T0QC 1PFDA 1ZGUB 4MH0E 3Q8AA 1FCCC 2J42A 4NZLB 3H9DA 2BYFA 1XEEA 3HM3A 3RCZA 4YSZB 4RFBA 2PLPA 3WAOA 4FLHA 3SEBA 1CQVA 2L76A 5DPRA 2X8XX 2FNJB 3H1UA 4EEWA 3M95A 4N59A 2MW5A 2QCZA 1I35A 4DXFA 2N9XA 4IWOA 5LLIA 2LGXA 3EGRA 2KDMA 1ZDVA 1TIFA 4KZCA 2IGDA 1K51A 2KMCA 4GDLB 4XWWA 1RFAA 1SSNA 5C2TB 2NBUA 2WDRB 4RMAA 2ONQA 4MSQB 3RNEC 2DHZA 4Q2JA 3ZXVA 4G11A 3TBLD 1HE8A 3ZRFA 1XT9B 4FA6A 3ZVVA 2WXQA 1WX9A 1K53A 4MH8A 1TKEA 1WR6E 2LUEA 3W5VB 4M02A 2DAFA 2R2OA 3NVWA 2BVCA 2K6QA 2YVCA 4QAYA 3PT2B 1E7PB 3DVGX 4LDTB 1SE2A 1R4NI 1N63A 4HRSA 4O1NA 2OOBB 4IWQA 1L0XB 4WH4A 2D2QA 2FAZA 3M3JA 2V0GA 5G2NA 4ANVA 3KWLA 1C9FA 4FADA 2MP2A 4ANWA 5HG2A 3VR8B 4II3B 1L7YA 2MSED 5E6JA 2QILA 1IGCA 1ZXIA 2KTFA 2E3TA 4XDDA 5D94A 2I1JA 2LI5A 2WX1A 4EFOA 3UQBA 5LXHA 1TS2A 2WXJA 3DVNU 1IGDA 3AEBB 4DXGA 4EUTA 2W9NA 3L54A 4K7WA 3BWUD 1YNTE 2MQJA 1I4PA 2Y5BB 2D11A 1FRRA 1FXIA 4WJPA 2WU5B 2YEPF 4J3OD 4RNAA 4MGZE 4BFRA 3GZNB 3H7SA 3NRZA 3QK0A 2MEKA 2V3PA 2Z59B 3AE5B 4JWUC 3BVZA 3PTFC 1I42A 2NMQA 1E7VA 3ABVB 3RFZB 4ANUA 2K22A 4ZRKA 2DNFA 5I4DA 4B9KA 3E56A 1AN8A 2N7DA 3GS2A 4HPMB 3ZLZA 1Q5WB 2J53A 3VUYA 1FXTB 4GDKB 2GBKA 4USAA 4FN2A 2E6XA 1QZEA 1RM6C 1YN4A 3QHTA 2LWPA 3WIMA 4M0WB 2BS3B 1JWMD 2DYBA 4MM3B 1SE3A 3KUDB 2RR9A 4YTNB 1MG8A 1B1ZA 3VDZA 1RFKA 4MJSA 1ZW7A 3L10B 1OEYA 4CYEA 4K81A 4EZJA 4W9DA 2PPHA 1TY2A 1WMHA 1UWXA 4MEMA 4LLGM 5L83A 1MG4A 1WXMA 4OW0A 2KJRA 2XN9C 1KFYB 2ZCBA 3KLSX 5G55A 2INNE 3QQ8B 2XNAC 2RDGA 2OHFA 2JPHA 4A8XC 3RYTA 1VDVA 1F77A 1YJ1A 4CQNA 2GBJA 2KWUB 4HKZE 3B9JA 4K3CA 1CMXB 1Z5SB 4WQMA 4C4VB 1N5WA 1VRAB 2BYVE 2WGSA 2ACZB 3T9LA 1WIAA 1C3TA 1ZKHA 2KOXA 4EKUA 3TEWA 2WP9B 3AU4A 2CKHB 1I4RA 4OZCA 2J7QB 1IBXA 4KDIC 2JX5A 2KDBA 4DK5A 1WYGA 3LXFA 3RN9C 3JSVB 2IBIB 1KLUD 2IY0B 3HVDA 2HJ8A 4EOYA 3P1MA 1B9RA 2CHXA 1HA5A 3TCAA 3KUCB 4D2KA 1F2RI 3TUOA 2JWZA 3K9OB 1UF0A 3AH7A 3DQVA 2MWSB 5D3DA 2CJNA 3O65B 2KN4A 1WFYA 3A9KA 4F8CB 1EF1A 3C0RB 1UBQA 1E0ZA 2LVQA 2FCSA 3AE8B 1XLPA 1N61A 3BYYB 1QOFA 5FKAC 4MJSB 2L7RA 1OGWA 1FPYA 4DHZB 1YMHE 4TKNA 2JXXA 2K6DB 2MBHA 4F1SA 2IO2B 1TBEA 2WXGA 2N4FA 2V3SA 1TS3A 1DOYA 2YEPB 3AB5A 2M0XA 3ZJVA 2K25A 1TJEA 2NS5A 4WAFA 4YTMB 1N62A 2R2QA 1PQSA 1Y56A 2DBYA 2UYZB 1QLBB 4AJWA 1FEHA 3M62B 1D5MC 4XZ4A 1D5XC 2KWVB 4ITKA 3SDLC 4DHJD 1KM7A 4R3DA 1XCTL 4FXCA 5KHOA 3ONSA 3IVFA 1VCBA 3RNAC 3R3MA 3ZJUA 3DWMA 3KQ4A 3AM9A 3VXWA 4KZ0A 3RULA 2WDVB 1OEYJ 1UZXB 3DPDA 1TZOA 5AZGA 4LJPB 3UIPB 2XK5A 1Q1OA 3Q8FA 2QDFA 3N32A 3NVVA 1FNUA 3AULA 5AZFA 1KLVA 4XDCA 1NVID 4P7IA 4KX6B 3AECB 1K8RB 1G6JA 2J0JA 4NNJB 1SIJA 3QAQA 3EHVA 2J4XA 1WXAA 5BMHA 3PO0A 2CJOA 3AE9B 2RPQA 3VRAB 3SU8X 4PK1A 2LXCA 2KANA 3PREA 4JPSA 1NDDA 3QIJA 5TR5A 2CHZA 3ZNID 4AS1A 1WWTA 1P9DU 3ZXRA 2W55A 2JXTA 3RD2A 2K1FA 1S3SG 3V6CB 2IYDB 3ZW3A 4MSMB 2WXNA 3NZUA 5IKCM 3TEZA 3KUZA 2LD9A 4DHZE 2DENB 3PZ8A 3DBSA 1V5OA 3H6NA 4OZBA 3MP9A 1EWCA 5G5GA 5D2MB 2BB5A 4PS7A 1ZXHA 3PRZA 3W1YA 1WM2A 3R7QA 1E10A 4OHJA 3N20C 3AI5A 3MC0B 1WRDB 2XK5B 1ZE3D 2Y3AA 5EE1A 3B08A 4HKQA 3OG5A 1T3QA 1F0ZA 3SD5A 2AQ3B 3HIZA 2DWQA 1JQ4A 2INPE 3I63C 4DDGD 2Y5PA 3AEDB 1Q10A 3O13A 4WWMA 5D3IB 3T3OA 3Q14C 4GXBA 1UELA 3AXCA 5E6OA 4AWJA 1FNVA 2OJWA 2CU1A 3URYA 1LM8B 1L0VB 1TKGA 2INCC 1V9JA 3ECIA 2WNMA 4JL9A 1X1MA 5GMVA 3N9YC 4S17A 1N5XA 2KLGA 2KC2A 4KSKC 4C7ZA 1JWUD 4MGYE 1GAQB 3VTVA 4NJ7A 5C3JB 4B95A 4NAWB 2L0TA 2QEJC 4ZRPA 3Q3FA 2LHEA 4RF1A 4BOSC 2ZW0A 2ZVOA 3V60A 2LVPA 2ZW1A 1KLGD 1WGHA 5TSSA 2MP2B 3PZ7A 4A9AA 4W9GA 1WGRA 5IAAC 4US8A 1E90A 4AQ7A 1FFUA 5CTRC 3UINB 2IGHA 2AWTA 4TQ0A 3FILA 1PYWD 1NEKB 3WALA 1WY8A 1TS5A 1WE7A 5G5HA 2G9HD 2GB1A 2LGSA 1C4CA 4W9HA 2SAKA 1V2YA 3I5JC 4EZKA 5D7GA 1WZ0A 2KO3A 4RF0A 2DZIA 2KKCA 2KNBA 2LJIA 4K1RB 2M4NA 2JYTA 4LTUA 3JVZX 3RNBC 1GNUA 4YT0B 3TIXA 2KAJA 4AJYB 4LNIA 2BB6A 1TGZB 2Q5WD 2KDIA 2G4SA 3ZDTA 2KD0A 4GMVA 4J6IA 1IYFA 2GI9A 4LNKA 2BS2B 2ZPYA 2WWZA 3PZDA 3ZUNA 3HM6X 2R61A 3DWGC 2WHIA 4ZOHC 1JALA 3H7PB 1XLQA 4W9FA 4GDLA 5AUIA 2LGYA 2WX0A 4G0NB 4JGHB 1FIQA 5LNK1 4NY0A 3HVZA 4E71A 4XWTA 5DPTA 2QC8A 5CHWA 2O6VA 4MM3A 2CHWA 3EUB2 1MJDA 2NR2A 2C7NB 2J0KA 2MHJA 3GE3C 4PYZA 1GOZA 3VH3B 1V86A 3OJ3A 2ZCCA 4IM0A 3VFKA 2B3AA 1U4AA 1MI0A 5HHDG 4C7YA 4LCDE 4IUMB 2N9PC 4P1BC 5FR3A 3PLUA 2FE8A 2RPVA 3IT6B 2KZRA 3IBEA 1QKZA 3AU5A 1R7SA 5BYSA 3NUHB 2KYWA 2DZMA 3EFCA 4RM9A 3NS1A 2MBEA 3IFWB 3IG3A 1VZ7A 2W3SA 3PHWB 4HDQA 2PJHA 4BZAA 1V5TA 2JUOA 3ENEA 1E8ZA 4WWPA 4HJGE 3RNCC 1BUIC 5DCNA 2ON8A 3ZTDA 1QT9A 3HRDD 2W82A 3Q3JA 3RZFA 1C79A 1RLFA 3C8YA 3MTNB 2AL3A 2KJ6A 1MHXA 2PEAA 4OZAA 2L00B 4JLCA 3VAWA 4H2AA 4YTPB 1TKYA 3U52E 2M56B 5E6PA 3LDZE 3DBRI 4HVBA 3J9CA 3WAPA 2ZEQA 1RRBA 1WX7A 5JH5C 4RCOA 3EA6A 3JW0X 3Q2AC 3BY4B 2NBVB 4WWNA 2IGGA 3A33B 2KQ4X 1F2RC 4AP4C 4DXAB 2PKOA 1WRIA 3L0WB 2ZZPB 2BPSA 3VTWA 1HTQA 4M00A 5HKHA 1UUPA 2D07B 2VH1A 1D6EC 4IM2A 2KACA 4ICVA 2JQRB 1RYJA 3A1QB 1VR9A 3ZNGC 1TYGB 1A5RA 3T8MA 3U7ZA 1VJKA 4YSYB 5EE3A 3N1ZC 1UH6A 2G45B 2DLBA 4N6EB 1JCKB 4I6LB 5BMIA 2MBQA 5J18A 2H89B 1AARA 3GE8C 1ZUD2 4XX5A 5IP4D 4BVUC 2KT7A 2C5LC 4REZA 3EECA 2RGFA 2A5UA 2JU6X 4RGTA 2MJEA 1E9MA 1AW7A 3A9JA 2WS3B 4HK2A 4XC2A 4BBNC 3I9V1 4BKTA 4PYUA 1C4PA 1ET9A 2FUHB 4I6NB 1VZ8A 3Q8EA 4YWGG 4TUUA 5FR6A 4XE0A 1WXVA 3A4RA 4HPLB 2K9XA 2N9KA 2BKRB 3RNGC 1EU4A 2Z0EB 4BOZB 2G3QB 1I4XA 4IWPA 4L2YA 4YL8A 3UGBB 2FCMA 1IP9A 1J19A 2LGDA 4MT5A 2WXIA 1F52A 3MC8A 4LNNA 4FJZA 1NYQA 4TSSA 2D3CA 3CSFA 1SEBD 1AWDA 5HI1A 2PIAA 4KIKA 1FCLA 3BINA 1ZPSA 1F9JA 1PUTA 2JZ3B 1YX5B 3JSVA 1PDXA 4IG7B 2UU7A 4BKSD 1Y8RC 2K8BA 3ZO5B 1NENB 2K5PA 4ARIA 1ACCA 5C1ZA 4WQOB 2ZVNA 3HHMA 1HZ5A 1R4MB 2KX0A 4L23A 1FNWA 3AE1B 3ETRA 1L5PA 2G4DB 1FFVA 3CF6E 2DX5B 3W9CB 4XGAB 2JSVX 5IA7A 1ZOYB 3A9KB 4MELA 3PPAA 3E9SA 3MJWA 3QA8A 4ZRIA 1KTKA 1E8WA 2V9HA 2WXRA 1MHHE 4GLSC 2N1WA 3RMKC 2PVGC 5AZHA 2KWCA 4M8NA 4MACA 2WU2B 1E7UA 2A4ZA 2Y5CA 4NQKE 2EMSA 3ZNHB 3ZGZA 1V8CA 2KVZA 4DDID 1GJZA 4P6VF 1CZPA 1DOXA 2AYOB 5C23A 4N58A 1C78A 2XEWA 1SXTA 3U8ZA 2LFIA 5AUKA 2LJ5A 4GGQA 3NG0A 5KHQA 4GOCA 2LRUA 4AUQC 3W2DA 1BT0A 2WXHA 5J17A 2INDC 2IPKD 2FCNA 3QJZA 1C76A 3R8BA 1N60A 4W9KA 3KVFB 1FXAA 4E74A 5IO9A 3PHXB 1PGBA 3QCAA 3B1LX 4US9A 2KQSA 3PS6A 1D3ZA 3RUIB 1XCQL 2RDBC 3PGEA 1YJJA 1JRUA 1JWBD 1WF9A 3CWIA 1Z2MA 1H8CA 1D5ZC 1ENFA 2BBCA 4HROA 4W9JA 2FUG1 2Z8LA 1H4RA 5DPWA 1E8YA 4NPNA 2BYEA 4WIPA 2WXKA 4KGSA 4FBJB 3ML9A 4IDIA 2Z0DB 3P4SB 3D32A 3BVGA 3SHQA 1T0SC 2JF5A 3ZDMC 2MJDA 2RD0A 1JWSD 3VUXA 4N9F4 3DBLB 1L2NA 4ZHPA 4IW0A 3ML8A 3CMMB 2QSDA 3IXSA 1BXTA 1F1HA 1NBFC 2LHDA 4K7SA 2ZJDA 1IPGA 2KDEB 2AX5A 4GSWA 3TJPA 4DBGA 3X0WA 4RGMA 2N1VA 3NS8A 2KTRB 1XXGA 1HTOA 3OAWA 2W54A 3RZWC 2V1YA 1TS4A 1V1PA 2J0MA 4A90A 1VZ6A 1WJ6A 3CIRB 1WJNA 2WXOA 2PE6B 2CS4A 1KF6B 2H88B 1QOGA 3X23A 2D10A 1JRPA 4B6WA 1E8XA 3LYYA 4XYCA 2QHOA 3U30A 3C19A 1T5XD 2NTSA 2REXA 2IO1B 1ZDXA 2MLBA 2BGFA 1WSPA 4RM8A 2O6VB 5D6JB 4P16A 4WAAA 4HPPA 4ACFA 2MJ3A 2PMVA 3DVNV 3JYUA 2NPTB 3U7DA 2UWQA 2L32A 3OWEB 2M17A 4ANXA 2MBBB 2KX3A 1GC7A 5IOIA 3ZIMA 2L83A 3B2GA 2WDTB 4WURA 3N30A 1XF5L 3PRPB 1WGYA 3VR9B 5JZEB 4DQOC 1E5WA 3RT3B 2L52A 3FAHA 3CSTA 4BKSA 4GIVA 1FM0D 3AV8A 2VZKD 1RWSA 1J7BA 3Q69A 1OQRA 3TEXA 1UGJA 2KMMA 3N1XC 2HE7A 2O2VA 3KH0A 2KMAA 1Q0WB 2BYTA 1AYFA 1L6VA 3AMZA 4HDOA 3S2AA 3WA0A 3RI7C 1L4ZB 2MCNB 1GUAB 2RMMA 1V1PB 2NBWB 2K8HA 3AEEB 3NJTA 1ZP0B 3IT4B 4GB9A 2CU3A 3NOBA 5JHAA 4BKGA 1GB4A 1WJ4A 4NAWA 3W5UB 3AN1A 2BS4B 5FK9C 2NVUI 4P1CC 4NQLB 2AEHA 4LJOB 1OQQA 2FCQA 1XD3B 3AE2B 3KW5B 2WXPA 1LXDA 3RNFC 3LJ3A 3M63B 4M8MA 1EWYC 4OVVA 1K50A 3I3TB 1VD2A 1DYQA 1WZ3A 3Q6BA 1IUEA 2PW9A 3A1QA 3L08A 1EO6A 1UBIA 2KK8A 4DWFA 1I4GA 1TT5B 1M94A 2KVRA 2D5GA 3BYTB 4ARCA 3P63A 3K9PB 3VQIA 4JIOU 4IKGA
chains in the Genus database with same CATH topology
2C5LC 4G3XB 4W9LA 2UYZB 2BWFA 2KFKA 2ZNVC 3EECA 2RGFA 1P3QU 2A5UA 1WGDA 3M62B 4MGIE 2KFKB 4AJWA 1XQQA 4XZ4A 2JRHA 3A9JB 2MA9B 2KTRA 2KWVB 3A9JA 1R4MI 5AEKB 3SDLC 2GBMA 4DHJD 1KM7A 2LVOA 3PLVA 5CHFA 4HK2A 5KHOA 3ONSA 3IVFA 1VCBA 4XC2A 4A20A 4BBNC 3R3MA 4ASWC 4BKTA 3VH4B 4PYUA 2FUHB 3EFUA 3NHEB 3QC8B 4I6NB 2HD5B 1GG3A 4TUUA 3VXWA 2IZVB 2L8JA 4HCNB 5FR6A 4KZ0A 1WXVA 3RULA 2DYOA 1OEYJ 3A4RA 4HPLB 2KQ7A 4JQWC 1UZXB 2BKRB 1KJTA 4HJKA 3DPDA 2Z0EB 3NZSA 2BKFA 4BOZB 2G3QB 4LJPB 4IWPA 4TQ1A 2XK5A 4YL8A 1V80A 5AZGA 3UGBB 3UIPB 2FCMA 1Q1OA 2EMTA 4I6PA 2MBOA 4WJQA 1IP9A 1RAXA 2GOWA 1V81A 1J19A 3N32A 2LGDA 3AULA 2DZJA 1SGHA 3IHPC 5AZFA 3L17A 2O2VB 1KLVA 2ASQA 4AOFA 1P0RA 1WE6A 4FJZA 2JY6A 4P7IA 2KJHB 3UQAA 3ZRCA 1K8RB 1YD8U 3QARA 3V62A 1G6JA 1V49A 2GBRA 2J0JA 2KXJA 3N3KB 4NNJB 1WX8A 2JT4B 3CSFA 4KIKB 3DDCB 3QAQA 4MGKE 2CR5A 3EHVA 4KIKA 1WXAA 3BINA 1F9JA 2C9WB 2L3ZA 1V6EA 2JZ3B 4G50A 3KYDD 1YX5B 2IY1B 1KOTA 2EKEC 3JSVA 2RPQA 1S1QB 2DZKA 3H7PA 4IG7B 4BKSD 3SU8X 1Y8RC 2K8BA 3DOWA 3ZO5B 4A3OA 2LXCA 2KANA 4DHJB 2KFJA 3PREA 4F7ZA 4IC7B 5C1ZA 3PRMB 2ZPNA 1NDDA 3QIJA 2ZVNA 3HHMA 4WQOB 1UGMA 2KX0A 5TR5A 2CHZA 3ZNID 1P1AA 1ZGUB 4MH0E 3PVLA 2G4DB 3CF6E 1P9DU 2DX5B 1YQBA 3RD2A 2K1FA 5IA7A 3A9KB 1S3SG 2BYFA 3H9DA 4MELA 3V6CB 3PPAA 2IYDB 3MJWA 3QA8A 1UD7A 3HM3A 4ZRIA 3RCZA 3ZW3A 4MSMB 3VTUA 2RSUA 2M1MA 5E6NA 2L05A 1E8WA 3WAOA 4FLHA 3NZUA 2LRWA 3KUZA 2L76A 3V6EB 2LD9A 5DPRA 2N1WA 4DHZE 2FNJB 5AZHA 2KWCA 4ZDVA 4M8NA 1J0GA 3H1UA 1E7UA 2A4ZA 2DENB 4EEWA 3M95A 3DBSA 2IO0B 1V5OA 5EDSA 3H6NA 4NQKE 2EMSA 2MW5A 3ZNHB 1I35A 1TTNA 2N9XA 4IWOA 3L16A 4DDID 5LLIA 2LGXA 1GJZA 5D2MB 4PS7A 3PRZA 2ZNVB 2AYOB 1WM2A 3R7QA 3W1YA 5C23A 4KZCA 1YX6B 4WJOA 3AI5A 4GDKA 2KMCA 1WRDB 4GDLB 2XK5B 2DYMA 2XEWA 2BWES 3U8ZA 3B08A 1RFAA 3SD5A 2NBUA 3HIZA 2LJ5A 4GGQA 4RMAA 4DDGD 5KHQA 4MSQB 4GOCA 2LRUA 2DHZA 1GC6A 4AUQC 4GXBA 1UELA 3AXCA 5E6OA 1BT0A 4HLEA 4AWJA 4G11A 3TBLD 5J17A 1HE8A 2CU1A 3ZRFA 1XT9B 4BBNF 1LM8B 2FCNA 3QJZA 4FA6A 5JHBA 3ZVVA 1WX9A 3ECIA 1V9JA 1LQBA 1C1YB 4W9KA 1EUVB 3KVFB 1SE9A 3V61A 4JL9A 1WR6E 1X1MA 5GMVA 4E74A 2LUEA 1SIFA 3PHXB 4ICUA 4PS3A 3DBHI 2DAFA 3QCAA 2R2OA 2KLGA 3B1LX 2KC2A 2KQSA 4KSKC 4KVGB 1WMHB 2K6QA 2YLMA 2I1KA 2YVCA 3PT2B 3PS6A 3QX1A 4MGYE 3VTVA 1D3ZA 4WJNA 3DVGX 4NJ7A 4B95A 4NAWB 3RUIB 4LDTB 3PGEA 2L0TA 2V4LA 1JRUA 1WXSA 3Q3FA 1R4NI 3P2BA 3ZTCA 3R66C 1WI0A 2OOBB 4IWQA 1WF9A 4OVUA 2JRIB 4BOSC 2D2QA 2FAZA 3M3JA 1Z2MA 4KDLB 2K39A 2C7HA 2ZVOA 5G2NA 1H8CA 4W9JA 4HXDA 4ANVA 2LZ6A 3V60A 3NY5A 2BF8B 2LVPA 3WANA 1H4RA 1WGHA 2C60A 2XBBC 5DPWA 4FADA 1E8YA 2MP2B 4NPNA 2BYEA 2MP2A 4W9GA 1WGRA 5IAAC 4ANWA 1E90A 4II3B 1L7YA 2MSED 5CTRC 5L95C 1WYWB 3UINB 3ML9A 4FBJB 2AWTA 5LXIB 2Z0DB 4HWIB 2KTFA 3DBLI 3D32A 4TQ0A 5D94A 3W1SA 3SHQA 2I1JA 2LI5A 2WX1A 2JF5A 3WALA 4EFOA 5LXHA 1WY8A 3ZDMC 3UQBA 2NCNA 1WE7A 2RD0A 3APFA 3DVNU 1WJUA 3VUXA 4N9F4 4EUTA 2W9NA 3L54A 4K7WA 4W9HA 2MQJA 1L2NA 1V2YA 2L0FA 2Y5BB 2D11A 2IO3B 4IW0A 3W1SC 3ML8A 4EZKA 5D7GA 4TV3A 1WZ0A 3CMMB 2KO3A 4WJPA 2DZIA 1NBFC 4K7SA 2KKCA 2KNBA 4MGZE 2ZJDA 2M4NA 4K1RB 1IPGA 1OQYA 4BFRA 2KDEB 2LXAA 3H7SA 3MHSD 4FHKA 4GSWA 3TJPA 3APDA 3JVZX 4ZYNA 3QK0A 4DBGA 1GNUA 3TIXA 3X0WA 4II2B 2Z59B 2N1VA 4EZLA 4CO7A 4AJYB 3NS8A 3PTFC 2KTRB 1TGZB 2KDFB 3OAWA 2KDIA 1I42A 4IM3A 2G4SA 1E7VA 3ZDTA 2KD0A 3RZWC 4ANUA 4GMVA 2V1YA 2FIFA 4J6IA 1IYFA 4W9IA 3QWZB 4ZRKA 2J0MA 4B9KA 2KHWB 4W9CA 3L13A 1WJ6A 2ZPYA 1WM3A 2N7DA 3GOEA 3ALBA 3HK0A 1WH3A 3OJ4B 2WWZA 3PZDA 4HPMB 3ZUNA 1WJNA 3HM6X 4URKA 4LDTD 2PE6B 3ZLZA 2CS4A 1Q5WB 3VUYA 3H7PB 1FXTB 3X23A 4GDKB 4W9FA 4GDLA 2GBKA 2D10A 4X57B 4B6WA 1E8XA 2PE9A 3U30A 2QHOA 4FN2A 1LFDA 2LGYA 2WX0A 4G0NB 1QZEA 4JGHB 2REXA 4NY0A 2IO1B 2MLBA 3QHTA 2BGFA 2LWPA 3WIMA 4E71A 4RM8A 2O6VB 4M0WB 5DPTA 5D6JB 5CHWA 4WAAA 2O6VA 3OLMD 4MM3A 2CHWA 2AL6A 2DYBA 2JVCA 2NPTA 3DVNV 1WR1A 3JYUA 2NR2A 2NPTB 1NI2A 3U7DA 2C7NB 2J0KA 2VRRB 2UWQA 2KN5A 4PYZA 1EF5A 3KUDB 2RR9A 3VH3B 3UIOB 1V86A 2M17A 3OJ3A 1MG8A 2ZCCA 3UF8A 2MBBB 2KX3A 4ANXA 4IM0A 3VDZA 3VFKA 2B3AA 1U4AA 2MX2A 1ISNA 1GC7A 4MJSA 3VHTC 5CHVC 3GZNI 4LCDE 2GBNA 1ZW7A 3L10B 1OEYA 4CYEA 4K81A 4IUMB 4EZJA 4W9DA 2PPHA 3R7RA 3ZIMA 2N9PC 1WMHA 2WDTB 3PLUA 3N30A 4MEMA 3PRPB 5L83A 3ZKJC 1WGYA 1WXMA 2KJRA 2ZCBA 2OJRA 5G55A 5JZEB 4FJVB 2KZRA 3IBEA 3QQ8B 3WAMA 1E5WA 3RT3B 3AU5A 2O6VD 2JPHA 3CSTA 3RYTA 5DPSA 4BKSA 1YJ1A 2GBJA 3ZNZB 2DZMA 4RM9A 2KWUB 3B0AA 4KV2A 4GIVA 2MBEA 3IFWB 3DCGA 3IG3A 5CX3A 1CMXB 1Z5SB 2KLCA 2HTHA 2N9EB 3PHWB 4HDQA 5J2RA 2BYVE 2PJHA 1J8CA 1V5TA 2JUOA 3ENEA 1T0YA 3T9LA 1E8ZA 1WIAA 4WWPA 1C3TA 2HE7A 1ZKHA 2KOXA 3VVWB 4EKUA 2O2VA 3KH0A 2KMAA 5DCNA 2JZZA 1Q0WB 3ZTDA 4HCPB 4ZRJA 1OTRB 4FULA 4HDOA 3S2AA 3Q3JA 3RZFA 3AU4A 3DVGY 1RLFA 3APCA 3WA0A 2CKHB 3MTNB 2J7QB 3KYCD 2MCNB 2AL3A 4A3PA 2KJ6A 1GUAB 3TMPB 4KDIC 2PEAA 1YIWA 2KDBA 4WWOA 4DK5A 2L00B 2NBWB 4JLCA 3A4SC 2K8HA 3VAWA 2C7MB 2MRPA 3JSVB 2IBIB 2IY0B 4GB9A 4GU2A 2HJ8A 5E6PA 4EOYA 3LDZE 3DBRI 2FIDA 2M8SA 2CHXA 4HVBA 2DAJA 3NOBA 5JHAA 2KC1A 3WAPA 4BKGA 3TCAA 1WJ4A 2WYQA 1RRBA 2ZEQA 4NAWA 3KUCB 2LASA 1P98A 1WX7A 5JH5C 2JWZA 3K9OB 4GN1A 4K7UA 4NJ6A 3JW0X 3DQVA 2NVUI 2MWSB 3BY4B 2NBVB 4FHJA 4WWNA 1WGGA 2D3GA 4NQLB 2AEHA 4LJOB 2FCQA 1XD3B 4E3CA 3O65B 3A33B 3KW5B 4MDKE 1WFYA 3A9KA 3VUWA 1LXDA 4F8CB 4DXAB 4AP4C 1EF1A 3C0RB 1UBQA 2K8CA 2LVQA 2FCSA 3LJ3A 3L0WB 3M63B 4M8MA 4FJYA 3TL5A 2ZZPB 2BPSA 3PSEB 4OVVA 3VTWA 4PS8A 4MJSB 3I3TB 2L7RA 1OGWA 4DHZB 5HKHA 1VD2A 1WZ3A 4TKNA 2D07B 2JXXA 2N7EA 4CHKA 4IM2A 3A1QA 3L08A 1EO6A 4ICVA 2K6DB 2MBHA 3A1QB 4F1SA 3ZNGC 2IO2B 1UBIA 4KSLC 2KK8A 4DWFA 1TBEA 5BO4B 2N4FA 2V3SA 3T8MA 1A5RA 1UH6A 2G45B 1M94A 2KVRA 3PV1A 4I6LB 2MBQA 2M0XA 2GMIC 5J18A 2K25A 4W9EA 1AARA 2NS5A 1TZ1A 3EC8A 4XX5A 3K9PB 2R2QA 4BVUC 1PQSA 3VQIA 4JIOU
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2C5L C;  4G3X B;  4W9L A;  2UYZ B;  2BWF A;  2KFK A;  2ZNV C;  3EEC A;  2RGF A;  1P3Q U;  2A5U A;  1WGD A;  3M62 B;  4MGI E;  2KFK B;  4AJW A;  1XQQ A;  4XZ4 A;  2JRH A;  3A9J B;  2MA9 B;  2KTR A;  2KWV B;  3A9J A;  1R4M I;  5AEK B;  3SDL C;  2GBM A;  4DHJ D;  1KM7 A;  2LVO A;  3PLV A;  5CHF A;  4HK2 A;  5KHO A;  3ONS A;  3IVF A;  1VCB A;  4XC2 A;  4A20 A;  4BBN C;  3R3M A;  4ASW C;  4BKT A;  3VH4 B;  4PYU A;  2FUH B;  3EFU A;  3NHE B;  3QC8 B;  4I6N B;  2HD5 B;  1GG3 A;  4TUU A;  3VXW A;  2IZV B;  2L8J A;  4HCN B;  5FR6 A;  4KZ0 A;  1WXV A;  3RUL A;  2DYO A;  1OEY J;  3A4R A;  4HPL B;  2KQ7 A;  4JQW C;  1UZX B;  2BKR B;  1KJT A;  4HJK A;  3DPD A;  2Z0E B;  3NZS A;  2BKF A;  4BOZ B;  2G3Q B;  4LJP B;  4IWP A;  4TQ1 A;  2XK5 A;  4YL8 A;  1V80 A;  5AZG A;  3UGB B;  3UIP B;  2FCM A;  1Q1O A;  2EMT A;  4I6P A;  2MBO A;  4WJQ A;  1IP9 A;  1RAX A;  2GOW A;  1V81 A;  1J19 A;  3N32 A;  2LGD A;  3AUL A;  2DZJ A;  1SGH A;  3IHP C;  5AZF A;  3L17 A;  2O2V B;  1KLV A;  2ASQ A;  4AOF A;  1P0R A;  1WE6 A;  4FJZ A;  2JY6 A;  4P7I A;  2KJH B;  3UQA A;  3ZRC A;  1K8R B;  1YD8 U;  3QAR A;  3V62 A;  1G6J A;  1V49 A;  2GBR A;  2J0J A;  2KXJ A;  3N3K B;  4NNJ B;  1WX8 A;  2JT4 B;  3CSF A;  4KIK B;  3DDC B;  3QAQ A;  4MGK E;  2CR5 A;  3EHV A;  4KIK A;  1WXA A;  3BIN A;  1F9J A;  2C9W B;  2L3Z A;  1V6E A;  2JZ3 B;  4G50 A;  3KYD D;  1YX5 B;  2IY1 B;  1KOT A;  2EKE C;  3JSV A;  2RPQ A;  1S1Q B;  2DZK A;  3H7P A;  4IG7 B;  4BKS D;  3SU8 X;  1Y8R C;  2K8B A;  3DOW A;  3ZO5 B;  4A3O A;  2LXC A;  2KAN A;  4DHJ B;  2KFJ A;  3PRE A;  4F7Z A;  4IC7 B;  5C1Z A;  3PRM B;  2ZPN A;  1NDD A;  3QIJ A;  2ZVN A;  3HHM A;  4WQO B;  1UGM A;  2KX0 A;  5TR5 A;  2CHZ A;  3ZNI D;  1P1A A;  1ZGU B;  4MH0 E;  3PVL A;  2G4D B;  3CF6 E;  1P9D U;  2DX5 B;  1YQB A;  3RD2 A;  2K1F A;  5IA7 A;  3A9K B;  1S3S G;  2BYF A;  3H9D A;  4MEL A;  3V6C B;  3PPA A;  2IYD B;  3MJW A;  3QA8 A;  1UD7 A;  3HM3 A;  4ZRI A;  3RCZ A;  3ZW3 A;  4MSM B;  3VTU A;  2RSU A;  2M1M A;  5E6N A;  2L05 A;  1E8W A;  3WAO A;  4FLH A;  3NZU A;  2LRW A;  3KUZ A;  2L76 A;  3V6E B;  2LD9 A;  5DPR A;  2N1W A;  4DHZ E;  2FNJ B;  5AZH A;  2KWC A;  4ZDV A;  4M8N A;  1J0G A;  3H1U A;  1E7U A;  2A4Z A;  2DEN B;  4EEW A;  3M95 A;  3DBS A;  2IO0 B;  1V5O A;  5EDS A;  3H6N A;  4NQK E;  2EMS A;  2MW5 A;  3ZNH B;  1I35 A;  1TTN A;  2N9X A;  4IWO A;  3L16 A;  4DDI D;  5LLI A;  2LGX A;  1GJZ A;  5D2M B;  4PS7 A;  3PRZ A;  2ZNV B;  2AYO B;  1WM2 A;  3R7Q A;  3W1Y A;  5C23 A;  4KZC A;  1YX6 B;  4WJO A;  3AI5 A;  4GDK A;  2KMC A;  1WRD B;  4GDL B;  2XK5 B;  2DYM A;  2XEW A;  2BWE S;  3U8Z A;  3B08 A;  1RFA A;  3SD5 A;  2NBU A;  3HIZ A;  2LJ5 A;  4GGQ A;  4RMA A;  4DDG D;  5KHQ A;  4MSQ B;  4GOC A;  2LRU A;  2DHZ A;  1GC6 A;  4AUQ C;  4GXB A;  1UEL A;  3AXC A;  5E6O A;  1BT0 A;  4HLE A;  4AWJ A;  4G11 A;  3TBL D;  5J17 A;  1HE8 A;  2CU1 A;  3ZRF A;  1XT9 B;  4BBN F;  1LM8 B;  2FCN A;  3QJZ A;  4FA6 A;  5JHB A;  3ZVV A;  1WX9 A;  3ECI A;  1V9J A;  1LQB A;  1C1Y B;  4W9K A;  1EUV B;  3KVF B;  1SE9 A;  3V61 A;  4JL9 A;  1WR6 E;  1X1M A;  5GMV A;  4E74 A;  2LUE A;  1SIF A;  3PHX B;  4ICU A;  4PS3 A;  3DBH I;  2DAF A;  3QCA A;  2R2O A;  2KLG A;  3B1L X;  2KC2 A;  2KQS A;  4KSK C;  4KVG B;  1WMH B;  2K6Q A;  2YLM A;  2I1K A;  2YVC A;  3PT2 B;  3PS6 A;  3QX1 A;  4MGY E;  3VTV A;  1D3Z A;  4WJN A;  3DVG X;  4NJ7 A;  4B95 A;  4NAW B;  3RUI B;  4LDT B;  3PGE A;  2L0T A;  2V4L A;  1JRU A;  1WXS A;  3Q3F A;  1R4N I;  3P2B A;  3ZTC A;  3R66 C;  1WI0 A;  2OOB B;  4IWQ A;  1WF9 A;  4OVU A;  2JRI B;  4BOS C;  2D2Q A;  2FAZ A;  3M3J A;  1Z2M A;  4KDL B;  2K39 A;  2C7H A;  2ZVO A;  5G2N A;  1H8C A;  4W9J A;  4HXD A;  4ANV A;  2LZ6 A;  3V60 A;  3NY5 A;  2BF8 B;  2LVP A;  3WAN A;  1H4R A;  1WGH A;  2C60 A;  2XBB C;  5DPW A;  4FAD A;  1E8Y A;  2MP2 B;  4NPN A;  2BYE A;  2MP2 A;  4W9G A;  1WGR A;  5IAA C;  4ANW A;  1E90 A;  4II3 B;  1L7Y A;  2MSE D;  5CTR C;  5L95 C;  1WYW B;  3UIN B;  3ML9 A;  4FBJ B;  2AWT A;  5LXI B;  2Z0D B;  4HWI B;  2KTF A;  3DBL I;  3D32 A;  4TQ0 A;  5D94 A;  3W1S A;  3SHQ A;  2I1J A;  2LI5 A;  2WX1 A;  2JF5 A;  3WAL A;  4EFO A;  5LXH A;  1WY8 A;  3ZDM C;  3UQB A;  2NCN A;  1WE7 A;  2RD0 A;  3APF A;  3DVN U;  1WJU A;  3VUX A;  4N9F 4;  4EUT A;  2W9N A;  3L54 A;  4K7W A;  4W9H A;  2MQJ A;  1L2N A;  1V2Y A;  2L0F A;  2Y5B B;  2D11 A;  2IO3 B;  4IW0 A;  3W1S C;  3ML8 A;  4EZK A;  5D7G A;  4TV3 A;  1WZ0 A;  3CMM B;  2KO3 A;  4WJP A;  2DZI A;  1NBF C;  4K7S A;  2KKC A;  2KNB A;  4MGZ E;  2ZJD A;  2M4N A;  4K1R B;  1IPG A;  1OQY A;  4BFR A;  2KDE B;  2LXA A;  3H7S A;  3MHS D;  4FHK A;  4GSW A;  3TJP A;  3APD A;  3JVZ X;  4ZYN A;  3QK0 A;  4DBG A;  1GNU A;  3TIX A;  3X0W A;  4II2 B;  2Z59 B;  2N1V A;  4EZL A;  4CO7 A;  4AJY B;  3NS8 A;  3PTF C;  2KTR B;  1TGZ B;  2KDF B;  3OAW A;  2KDI A;  1I42 A;  4IM3 A;  2G4S A;  1E7V A;  3ZDT A;  2KD0 A;  3RZW C;  4ANU A;  4GMV A;  2V1Y A;  2FIF A;  4J6I A;  1IYF A;  4W9I A;  3QWZ B;  4ZRK A;  2J0M A;  4B9K A;  2KHW B;  4W9C A;  3L13 A;  1WJ6 A;  2ZPY A;  1WM3 A;  2N7D A;  3GOE A;  3ALB A;  3HK0 A;  1WH3 A;  3OJ4 B;  2WWZ A;  3PZD A;  4HPM B;  3ZUN A;  1WJN A;  3HM6 X;  4URK A;  4LDT D;  2PE6 B;  3ZLZ A;  2CS4 A;  1Q5W B;  3VUY A;  3H7P B;  1FXT B;  3X23 A;  4GDK B;  4W9F A;  4GDL A;  2GBK A;  2D10 A;  4X57 B;  4B6W A;  1E8X A;  2PE9 A;  3U30 A;  2QHO A;  4FN2 A;  1LFD A;  2LGY A;  2WX0 A;  4G0N B;  1QZE A;  4JGH B;  2REX A;  4NY0 A;  2IO1 B;  2MLB A;  3QHT A;  2BGF A;  2LWP A;  3WIM A;  4E71 A;  4RM8 A;  2O6V B;  4M0W B;  5DPT A;  5D6J B;  5CHW A;  4WAA A;  2O6V A;  3OLM D;  4MM3 A;  2CHW A;  2AL6 A;  2DYB A;  2JVC A;  2NPT A;  3DVN V;  1WR1 A;  3JYU A;  2NR2 A;  2NPT B;  1NI2 A;  3U7D A;  2C7N B;  2J0K A;  2VRR B;  2UWQ A;  2KN5 A;  4PYZ A;  1EF5 A;  3KUD B;  2RR9 A;  3VH3 B;  3UIO B;  1V86 A;  2M17 A;  3OJ3 A;  1MG8 A;  2ZCC A;  3UF8 A;  2MBB B;  2KX3 A;  4ANX A;  4IM0 A;  3VDZ A;  3VFK A;  2B3A A;  1U4A A;  2MX2 A;  1ISN A;  1GC7 A;  4MJS A;  3VHT C;  5CHV C;  3GZN I;  4LCD E;  2GBN A;  1ZW7 A;  3L10 B;  1OEY A;  4CYE A;  4K81 A;  4IUM B;  4EZJ A;  4W9D A;  2PPH A;  3R7R A;  3ZIM A;  2N9P C;  1WMH A;  2WDT B;  3PLU A;  3N30 A;  4MEM A;  3PRP B;  5L83 A;  3ZKJ C;  1WGY A;  1WXM A;  2KJR A;  2ZCB A;  2OJR A;  5G55 A;  5JZE B;  4FJV B;  2KZR A;  3IBE A;  3QQ8 B;  3WAM A;  1E5W A;  3RT3 B;  3AU5 A;  2O6V D;  2JPH A;  3CST A;  3RYT A;  5DPS A;  4BKS A;  1YJ1 A;  2GBJ A;  3ZNZ B;  2DZM A;  4RM9 A;  2KWU B;  3B0A A;  4KV2 A;  4GIV A;  2MBE A;  3IFW B;  3DCG A;  3IG3 A;  5CX3 A;  1CMX B;  1Z5S B;  2KLC A;  2HTH A;  2N9E B;  3PHW B;  4HDQ A;  5J2R A;  2BYV E;  2PJH A;  1J8C A;  1V5T A;  2JUO A;  3ENE A;  1T0Y A;  3T9L A;  1E8Z A;  1WIA A;  4WWP A;  1C3T A;  2HE7 A;  1ZKH A;  2KOX A;  3VVW B;  4EKU A;  2O2V A;  3KH0 A;  2KMA A;  5DCN A;  2JZZ A;  1Q0W B;  3ZTD A;  4HCP B;  4ZRJ A;  1OTR B;  4FUL A;  4HDO A;  3S2A A;  3Q3J A;  3RZF A;  3AU4 A;  3DVG Y;  1RLF A;  3APC A;  3WA0 A;  2CKH B;  3MTN B;  2J7Q B;  3KYC D;  2MCN B;  2AL3 A;  4A3P A;  2KJ6 A;  1GUA B;  3TMP B;  4KDI C;  2PEA A;  1YIW A;  2KDB A;  4WWO A;  4DK5 A;  2L00 B;  2NBW B;  4JLC A;  3A4S C;  2K8H A;  3VAW A;  2C7M B;  2MRP A;  3JSV B;  2IBI B;  2IY0 B;  4GB9 A;  4GU2 A;  2HJ8 A;  5E6P A;  4EOY A;  3LDZ E;  3DBR I;  2FID A;  2M8S A;  2CHX A;  4HVB A;  2DAJ A;  3NOB A;  5JHA A;  2KC1 A;  3WAP A;  4BKG A;  3TCA A;  1WJ4 A;  2WYQ A;  1RRB A;  2ZEQ A;  4NAW A;  3KUC B;  2LAS A;  1P98 A;  1WX7 A;  5JH5 C;  2JWZ A;  3K9O B;  4GN1 A;  4K7U A;  4NJ6 A;  3JW0 X;  3DQV A;  2NVU I;  2MWS B;  3BY4 B;  2NBV B;  4FHJ A;  4WWN A;  1WGG A;  2D3G A;  4NQL B;  2AEH A;  4LJO B;  2FCQ A;  1XD3 B;  4E3C A;  3O65 B;  3A33 B;  3KW5 B;  4MDK E;  1WFY A;  3A9K A;  3VUW A;  1LXD A;  4F8C B;  4DXA B;  4AP4 C;  1EF1 A;  3C0R B;  1UBQ A;  2K8C A;  2LVQ A;  2FCS A;  3LJ3 A;  3L0W B;  3M63 B;  4M8M A;  4FJY A;  3TL5 A;  2ZZP B;  2BPS A;  3PSE B;  4OVV A;  3VTW A;  4PS8 A;  4MJS B;  3I3T B;  2L7R A;  1OGW A;  4DHZ B;  5HKH A;  1VD2 A;  1WZ3 A;  4TKN A;  2D07 B;  2JXX A;  2N7E A;  4CHK A;  4IM2 A;  3A1Q A;  3L08 A;  1EO6 A;  4ICV A;  2K6D B;  2MBH A;  3A1Q B;  4F1S A;  3ZNG C;  2IO2 B;  1UBI A;  4KSL C;  2KK8 A;  4DWF A;  1TBE A;  5BO4 B;  2N4F A;  2V3S A;  3T8M A;  1A5R A;  1UH6 A;  2G45 B;  1M94 A;  2KVR A;  3PV1 A;  4I6L B;  2MBQ A;  2M0X A;  2GMI C;  5J18 A;  2K25 A;  4W9E A;  1AAR A;  2NS5 A;  1TZ1 A;  3EC8 A;  4XX5 A;  3K9P B;  2R2Q A;  4BVU C;  1PQS A;  3VQI A;  4JIO U; 
#chains in the Genus database with same CATH topology
 1ESF A;  1WGD A;  4MGI E;  2KFK B;  3Q8B A;  1XQQ A;  3A9J B;  2MA9 B;  3MFG A;  1R4M I;  2LUM A;  1CJE A;  2GBM A;  4A20 A;  3EFU A;  1P7F A;  3QC8 B;  1XO3 A;  1SJH D;  2RDH A;  3P42 A;  4HCN B;  1HQR D;  3FKY A;  2WXL A;  2DYO A;  4JQW C;  4ZRQ A;  1KJT A;  3NZS A;  2BKF A;  4LK0 M;  1V80 A;  2EMT A;  2MBO A;  4JX1 C;  4WJQ A;  1WGK A;  1VLB A;  2DZJ A;  3V05 A;  2JWU A;  3L17 A;  1P0R A;  4JWS C;  4UDU C;  2JY6 A;  3UQA A;  1YD8 U;  3QAR A;  4KKJ A;  1V49 A;  3HUI A;  1WX8 A;  3BII D;  4KIK B;  3DDC B;  4MGK E;  1OFF A;  1JML A;  3BZD B;  3N1Y C;  4G50 A;  2B76 B;  4DHJ B;  2KFJ A;  4IC7 B;  4A6Q A;  2WQY B;  3PRM B;  2ZPN A;  1GPX A;  1JRO A;  1UGM A;  1DGJ A;  4S0R A;  3L4P A;  3PVL A;  1UWM A;  3Q8C A;  1YQB A;  1C4A A;  1UD7 A;  1J7C A;  3VTU A;  2RSU A;  2M1M A;  5E6N A;  2L05 A;  3T3N A;  2I2Y A;  3WCQ A;  2KWD A;  2LRW A;  2QJL A;  4YXD B;  3V6E B;  4ZDV A;  2AQ2 B;  1J0G A;  2IO0 B;  5EDS A;  1QIL A;  4ZHO A;  1TTN A;  1SF0 A;  3U2S C;  3L16 A;  1N6Z A;  3V3X A;  2QIE B;  2ZNV B;  1YX6 B;  4WJO A;  2FBW B;  4GDK A;  4OVZ A;  2DYM A;  2K0P A;  3TEY A;  1KRH A;  2BWE S;  5T8I A;  3SFE B;  2GLS A;  4C00 A;  2N0S B;  1GC6 A;  4HLE A;  4BBN F;  5JHB A;  1IBX B;  1LQB A;  1C1Y B;  4PT5 A;  1EUV B;  3V61 A;  1SE9 A;  3IAM 1;  3U4E G;  1SIF A;  4ICU A;  4PS3 A;  1STE A;  3R2T A;  1BML C;  3DBH I;  4KVG B;  2N9L A;  1WMH B;  2YLM A;  2I1K A;  3QX1 A;  4WJN A;  3MC9 A;  2V4L A;  1I4H A;  1WXS A;  3P2B A;  3ZTC A;  3R66 C;  1WI0 A;  3NVZ A;  4OVU A;  2JRI B;  3Q3M C;  4KDL B;  2K39 A;  2C7H A;  2VZK B;  1QF6 A;  4HXD A;  2LZ6 A;  2EKI A;  3NY5 A;  3RPF C;  2BF8 B;  1R4N B;  3DHG C;  3WAN A;  2C60 A;  2XBB C;  2LEK A;  3MHZ A;  4NJC A;  1YN5 A;  3AEG B;  5L95 C;  1WYW B;  1J7A A;  5LXI B;  4HWI B;  3DBL I;  3AE7 B;  3W1S A;  3ZJT A;  1C77 A;  2NCN A;  1HEZ E;  3APF A;  1WJU A;  3AE6 B;  2G1E A;  2L0F A;  3P4Q B;  2IO3 B;  3W1S C;  4TV3 A;  2TSS A;  1NYR A;  1DOI A;  2IJ0 A;  4A55 A;  1OQY A;  2LXA A;  1GB1 A;  3MHS D;  4FHK A;  1QQR A;  3APD A;  4ZYN A;  4II2 B;  4L1B A;  1QOB A;  3FC4 A;  4EZL A;  4CO7 A;  3AE4 B;  1XLO A;  1K52 A;  2LMC A;  1I7H A;  2KDF B;  5JXV A;  4IM3 A;  3GB1 A;  4ZYS A;  1FRD A;  4HEA 1;  2FIF A;  1EM7 A;  2AQ1 B;  3BK2 A;  4W9I A;  2OED A;  3QWZ B;  1TY0 A;  1YQ4 B;  2KHW B;  4W9C A;  3L13 A;  5BYR A;  1M4V A;  1WM3 A;  3GOE A;  3ALB A;  3HK0 A;  1WH3 A;  2ICI A;  3OJ4 B;  5H8Y E;  4URK A;  4LDT D;  1UNS A;  3BK1 A;  3TSS A;  1YQ3 B;  4X57 B;  2PE9 A;  1LFD A;  4K3B A;  2HJ1 A;  2HDE A;  1ROE A;  2WXF A;  1ET6 A;  3GP7 A;  4KGT A;  2N7J A;  4M0W A;  3OLM D;  2AL6 A;  2JVC A;  2NPT A;  4EE2 A;  1WR1 A;  1A70 A;  1NI2 A;  2VRR B;  2KN5 A;  1FD6 A;  1EF5 A;  1T0R C;  5HFY A;  1L4D B;  5GXG B;  3UIO B;  5IN7 A;  3UF8 A;  2QMT A;  2MX2 A;  1ISN A;  1EU3 A;  2VH2 A;  3VHT C;  1L0Y B;  4RH6 A;  5CHV C;  3GZN I;  1PGX A;  2GBN A;  2BQQ A;  3R7R A;  2K3U A;  2M19 A;  2V3N A;  4C56 C;  1T6B X;  3ZKJ C;  1D4B A;  2D3A A;  3MJ5 A;  2OJR A;  3B2F A;  4FJV B;  1NI3 A;  4LNO A;  3WAM A;  3AEF B;  2O6V D;  4KGR A;  1HZ6 A;  5DPS A;  2HTM E;  2X38 A;  1LO5 D;  3ZNZ B;  4YSX B;  3B0A A;  4KV2 A;  3DCG A;  4IOI E;  5CX3 A;  5BMG A;  3NVY A;  2KLC A;  2HTH A;  2N9E B;  3DBH B;  5J2R A;  2NTT A;  4C4V A;  1J8C A;  1T0Y A;  3VVW B;  1E6E B;  1FMA D;  2BT6 A;  4KKI A;  2JZZ A;  1MFW A;  4HCP B;  1OTR B;  4ZRJ A;  4FUL A;  3SR6 A;  3DVG Y;  3APC A;  3KYC D;  4A3P A;  2BTE A;  3TMP B;  1YIW A;  1FO4 A;  4WWO A;  2JZP A;  3A4S C;  2C7M B;  2MRP A;  5BYQ A;  4RGN A;  3SFD B;  4GU2 A;  4B0M A;  2FID A;  2M8S A;  2DAJ A;  2KC1 A;  3P4P B;  2GRI A;  5EE9 A;  2WYQ A;  3LB8 C;  2LAS A;  1P98 A;  2J52 A;  4GN1 A;  4NJ6 A;  4K7U A;  5MPO A;  2W3R A;  4B0E A;  2D3B A;  4FHJ A;  1WGG A;  2D3G A;  4E3C A;  2PVO D;  1CK1 A;  4MDK E;  1HXY D;  3VUW A;  2K8C A;  3BVM A;  4FJY A;  3TL5 A;  1YJI A;  3DHI C;  3PSE B;  3KWV A;  4PS8 A;  1YOV B;  4M01 A;  5EE0 A;  3Q3O C;  5H92 C;  2N7E A;  3DHH C;  4CHK A;  3P4R B;  1SJE D;  1SB3 C;  4KSL C;  1V97 A;  5BO4 B;  2M0A A;  1JWA D;  2EEL A;  4LNF A;  2IDY A;  3R2I A;  4NAM A;  2BW2 A;  1JW9 D;  3PV1 A;  1L6U A;  2GMI C;  4C80 A;  3NZ3 A;  4W9E A;  1TZ1 A;  3EC8 A;  2LGI A;  2WLB A;  4G3X B;  4W9L A;  2BWF A;  2KFK A;  1SE4 A;  2ZNV C;  4JE3 B;  1P3Q U;  2JRH A;  3AEA B;  2KTR A;  1PGA A;  5AEK B;  3ZQ4 A;  2LVO A;  3PLV A;  5CHF A;  2SEB D;  4ASW C;  3VH4 B;  3NHE B;  2HD5 B;  1GG3 A;  3Q3N C;  1LGR A;  2IZV B;  2L8J A;  2WXM A;  3DBR B;  2KQ7 A;  1P7E A;  2MH7 A;  4HJK A;  1I4Q A;  1XLN A;  1KH0 A;  4TQ1 A;  3ZYY X;  2V4I B;  4I6P A;  1YN3 A;  2JYE A;  1RAX A;  2GOW A;  4BAX A;  1V81 A;  4TMA B;  1QOA A;  1SGH A;  3IHP C;  1WXQ A;  2O2V B;  2ASQ A;  2L1A A;  4AOF A;  3VRB B;  1WE6 A;  2KJH B;  3H8H A;  3ZRC A;  2WDQ B;  3V62 A;  2GBR A;  3I57 A;  2KXJ A;  3N3K B;  1V1O A;  2JT4 B;  2CR5 A;  1SBB B;  2C9W B;  2L3Z A;  1V6E A;  1MPE A;  1MVK A;  3KYD D;  4RGO S;  2PTL A;  3IAS 1;  2IY1 B;  1KOT A;  2EKE C;  1S1Q B;  3AE3 B;  2DZK A;  3H7P A;  2I38 A;  3UI3 A;  3DOW A;  3FIL B;  4A3O A;  4F7Z A;  1P1A A;  1T0Q C;  1PFD A;  1ZGU B;  4MH0 E;  3Q8A A;  1FCC C;  2J42 A;  4NZL B;  3H9D A;  2BYF A;  1XEE A;  3HM3 A;  3RCZ A;  4YSZ B;  4RFB A;  2PLP A;  3WAO A;  4FLH A;  3SEB A;  1CQV A;  2L76 A;  5DPR A;  2X8X X;  2FNJ B;  3H1U A;  4EEW A;  3M95 A;  4N59 A;  2MW5 A;  2QCZ A;  1I35 A;  4DXF A;  2N9X A;  4IWO A;  5LLI A;  2LGX A;  3EGR A;  2KDM A;  1ZDV A;  1TIF A;  4KZC A;  2IGD A;  1K51 A;  2KMC A;  4GDL B;  4XWW A;  1RFA A;  1SSN A;  5C2T B;  2NBU A;  2WDR B;  4RMA A;  2ONQ A;  4MSQ B;  3RNE C;  2DHZ A;  4Q2J A;  3ZXV A;  4G11 A;  3TBL D;  1HE8 A;  3ZRF A;  1XT9 B;  4FA6 A;  3ZVV A;  2WXQ A;  1WX9 A;  1K53 A;  4MH8 A;  1TKE A;  1WR6 E;  2LUE A;  3W5V B;  4M02 A;  2DAF A;  2R2O A;  3NVW A;  2BVC A;  2K6Q A;  2YVC A;  4QAY A;  3PT2 B;  1E7P B;  3DVG X;  4LDT B;  1SE2 A;  1R4N I;  1N63 A;  4HRS A;  4O1N A;  2OOB B;  4IWQ A;  1L0X B;  4WH4 A;  2D2Q A;  2FAZ A;  3M3J A;  2V0G A;  5G2N A;  4ANV A;  3KWL A;  1C9F A;  4FAD A;  2MP2 A;  4ANW A;  5HG2 A;  3VR8 B;  4II3 B;  1L7Y A;  2MSE D;  5E6J A;  2QIL A;  1IGC A;  1ZXI A;  2KTF A;  2E3T A;  4XDD A;  5D94 A;  2I1J A;  2LI5 A;  2WX1 A;  4EFO A;  3UQB A;  5LXH A;  1TS2 A;  2WXJ A;  3DVN U;  1IGD A;  3AEB B;  4DXG A;  4EUT A;  2W9N A;  3L54 A;  4K7W A;  3BWU D;  1YNT E;  2MQJ A;  1I4P A;  2Y5B B;  2D11 A;  1FRR A;  1FXI A;  4WJP A;  2WU5 B;  2YEP F;  4J3O D;  4RNA A;  4MGZ E;  4BFR A;  3GZN B;  3H7S A;  3NRZ A;  3QK0 A;  2MEK A;  2V3P A;  2Z59 B;  3AE5 B;  4JWU C;  3BVZ A;  3PTF C;  1I42 A;  2NMQ A;  1E7V A;  3ABV B;  3RFZ B;  4ANU A;  2K22 A;  4ZRK A;  2DNF A;  5I4D A;  4B9K A;  3E56 A;  1AN8 A;  2N7D A;  3GS2 A;  4HPM B;  3ZLZ A;  1Q5W B;  2J53 A;  3VUY A;  1FXT B;  4GDK B;  2GBK A;  4USA A;  4FN2 A;  2E6X A;  1QZE A;  1RM6 C;  1YN4 A;  3QHT A;  2LWP A;  3WIM A;  4M0W B;  2BS3 B;  1JWM D;  2DYB A;  4MM3 B;  1SE3 A;  3KUD B;  2RR9 A;  4YTN B;  1MG8 A;  1B1Z A;  3VDZ A;  1RFK A;  4MJS A;  1ZW7 A;  3L10 B;  1OEY A;  4CYE A;  4K81 A;  4EZJ A;  4W9D A;  2PPH A;  1TY2 A;  1WMH A;  1UWX A;  4MEM A;  4LLG M;  5L83 A;  1MG4 A;  1WXM A;  4OW0 A;  2KJR A;  2XN9 C;  1KFY B;  2ZCB A;  3KLS X;  5G55 A;  2INN E;  3QQ8 B;  2XNA C;  2RDG A;  2OHF A;  2JPH A;  4A8X C;  3RYT A;  1VDV A;  1F77 A;  1YJ1 A;  4CQN A;  2GBJ A;  2KWU B;  4HKZ E;  3B9J A;  4K3C A;  1CMX B;  1Z5S B;  4WQM A;  4C4V B;  1N5W A;  1VRA B;  2BYV E;  2WGS A;  2ACZ B;  3T9L A;  1WIA A;  1C3T A;  1ZKH A;  2KOX A;  4EKU A;  3TEW A;  2WP9 B;  3AU4 A;  2CKH B;  1I4R A;  4OZC A;  2J7Q B;  1IBX A;  4KDI C;  2JX5 A;  2KDB A;  4DK5 A;  1WYG A;  3LXF A;  3RN9 C;  3JSV B;  2IBI B;  1KLU D;  2IY0 B;  3HVD A;  2HJ8 A;  4EOY A;  3P1M A;  1B9R A;  2CHX A;  1HA5 A;  3TCA A;  3KUC B;  4D2K A;  1F2R I;  3TUO A;  2JWZ A;  3K9O B;  1UF0 A;  3AH7 A;  3DQV A;  2MWS B;  5D3D A;  2CJN A;  3O65 B;  2KN4 A;  1WFY A;  3A9K A;  4F8C B;  1EF1 A;  3C0R B;  1UBQ A;  1E0Z A;  2LVQ A;  2FCS A;  3AE8 B;  1XLP A;  1N61 A;  3BYY B;  1QOF A;  5FKA C;  4MJS B;  2L7R A;  1OGW A;  1FPY A;  4DHZ B;  1YMH E;  4TKN A;  2JXX A;  2K6D B;  2MBH A;  4F1S A;  2IO2 B;  1TBE A;  2WXG A;  2N4F A;  2V3S A;  1TS3 A;  1DOY A;  2YEP B;  3AB5 A;  2M0X A;  3ZJV A;  2K25 A;  1TJE A;  2NS5 A;  4WAF A;  4YTM B;  1N62 A;  2R2Q A;  1PQS A;  1Y56 A;  2DBY A;  2UYZ B;  1QLB B;  4AJW A;  1FEH A;  3M62 B;  1D5M C;  4XZ4 A;  1D5X C;  2KWV B;  4ITK A;  3SDL C;  4DHJ D;  1KM7 A;  4R3D A;  1XCT L;  4FXC A;  5KHO A;  3ONS A;  3IVF A;  1VCB A;  3RNA C;  3R3M A;  3ZJU A;  3DWM A;  3KQ4 A;  3AM9 A;  3VXW A;  4KZ0 A;  3RUL A;  2WDV B;  1OEY J;  1UZX B;  3DPD A;  1TZO A;  5AZG A;  4LJP B;  3UIP B;  2XK5 A;  1Q1O A;  3Q8F A;  2QDF A;  3N32 A;  3NVV A;  1FNU A;  3AUL A;  5AZF A;  1KLV A;  4XDC A;  1NVI D;  4P7I A;  4KX6 B;  3AEC B;  1K8R B;  1G6J A;  2J0J A;  4NNJ B;  1SIJ A;  3QAQ A;  3EHV A;  2J4X A;  1WXA A;  5BMH A;  3PO0 A;  2CJO A;  3AE9 B;  2RPQ A;  3VRA B;  3SU8 X;  4PK1 A;  2LXC A;  2KAN A;  3PRE A;  4JPS A;  1NDD A;  3QIJ A;  5TR5 A;  2CHZ A;  3ZNI D;  4AS1 A;  1WWT A;  1P9D U;  3ZXR A;  2W55 A;  2JXT A;  3RD2 A;  2K1F A;  1S3S G;  3V6C B;  2IYD B;  3ZW3 A;  4MSM B;  2WXN A;  3NZU A;  5IKC M;  3TEZ A;  3KUZ A;  2LD9 A;  4DHZ E;  2DEN B;  3PZ8 A;  3DBS A;  1V5O A;  3H6N A;  4OZB A;  3MP9 A;  1EWC A;  5G5G A;  5D2M B;  2BB5 A;  4PS7 A;  1ZXH A;  3PRZ A;  3W1Y A;  1WM2 A;  3R7Q A;  1E10 A;  4OHJ A;  3N20 C;  3AI5 A;  3MC0 B;  1WRD B;  2XK5 B;  1ZE3 D;  2Y3A A;  5EE1 A;  3B08 A;  4HKQ A;  3OG5 A;  1T3Q A;  1F0Z A;  3SD5 A;  2AQ3 B;  3HIZ A;  2DWQ A;  1JQ4 A;  2INP E;  3I63 C;  4DDG D;  2Y5P A;  3AED B;  1Q10 A;  3O13 A;  4WWM A;  5D3I B;  3T3O A;  3Q14 C;  4GXB A;  1UEL A;  3AXC A;  5E6O A;  4AWJ A;  1FNV A;  2OJW A;  2CU1 A;  3URY A;  1LM8 B;  1L0V B;  1TKG A;  2INC C;  1V9J A;  3ECI A;  2WNM A;  4JL9 A;  1X1M A;  5GMV A;  3N9Y C;  4S17 A;  1N5X A;  2KLG A;  2KC2 A;  4KSK C;  4C7Z A;  1JWU D;  4MGY E;  1GAQ B;  3VTV A;  4NJ7 A;  5C3J B;  4B95 A;  4NAW B;  2L0T A;  2QEJ C;  4ZRP A;  3Q3F A;  2LHE A;  4RF1 A;  4BOS C;  2ZW0 A;  2ZVO A;  3V60 A;  2LVP A;  2ZW1 A;  1KLG D;  1WGH A;  5TSS A;  2MP2 B;  3PZ7 A;  4A9A A;  4W9G A;  1WGR A;  5IAA C;  4US8 A;  1E90 A;  4AQ7 A;  1FFU A;  5CTR C;  3UIN B;  2IGH A;  2AWT A;  4TQ0 A;  3FIL A;  1PYW D;  1NEK B;  3WAL A;  1WY8 A;  1TS5 A;  1WE7 A;  5G5H A;  2G9H D;  2GB1 A;  2LGS A;  1C4C A;  4W9H A;  2SAK A;  1V2Y A;  3I5J C;  4EZK A;  5D7G A;  1WZ0 A;  2KO3 A;  4RF0 A;  2DZI A;  2KKC A;  2KNB A;  2LJI A;  4K1R B;  2M4N A;  2JYT A;  4LTU A;  3JVZ X;  3RNB C;  1GNU A;  4YT0 B;  3TIX A;  2KAJ A;  4AJY B;  4LNI A;  2BB6 A;  1TGZ B;  2Q5W D;  2KDI A;  2G4S A;  3ZDT A;  2KD0 A;  4GMV A;  4J6I A;  1IYF A;  2GI9 A;  4LNK A;  2BS2 B;  2ZPY A;  2WWZ A;  3PZD A;  3ZUN A;  3HM6 X;  2R61 A;  3DWG C;  2WHI A;  4ZOH C;  1JAL A;  3H7P B;  1XLQ A;  4W9F A;  4GDL A;  5AUI A;  2LGY A;  2WX0 A;  4G0N B;  4JGH B;  1FIQ A;  5LNK 1;  4NY0 A;  3HVZ A;  4E71 A;  4XWT A;  5DPT A;  2QC8 A;  5CHW A;  2O6V A;  4MM3 A;  2CHW A;  3EUB 2;  1MJD A;  2NR2 A;  2C7N B;  2J0K A;  2MHJ A;  3GE3 C;  4PYZ A;  1GOZ A;  3VH3 B;  1V86 A;  3OJ3 A;  2ZCC A;  4IM0 A;  3VFK A;  2B3A A;  1U4A A;  1MI0 A;  5HHD G;  4C7Y A;  4LCD E;  4IUM B;  2N9P C;  4P1B C;  5FR3 A;  3PLU A;  2FE8 A;  2RPV A;  3IT6 B;  2KZR A;  3IBE A;  1QKZ A;  3AU5 A;  1R7S A;  5BYS A;  3NUH B;  2KYW A;  2DZM A;  3EFC A;  4RM9 A;  3NS1 A;  2MBE A;  3IFW B;  3IG3 A;  1VZ7 A;  2W3S A;  3PHW B;  4HDQ A;  2PJH A;  4BZA A;  1V5T A;  2JUO A;  3ENE A;  1E8Z A;  4WWP A;  4HJG E;  3RNC C;  1BUI C;  5DCN A;  2ON8 A;  3ZTD A;  1QT9 A;  3HRD D;  2W82 A;  3Q3J A;  3RZF A;  1C79 A;  1RLF A;  3C8Y A;  3MTN B;  2AL3 A;  2KJ6 A;  1MHX A;  2PEA A;  4OZA A;  2L00 B;  4JLC A;  3VAW A;  4H2A A;  4YTP B;  1TKY A;  3U52 E;  2M56 B;  5E6P A;  3LDZ E;  3DBR I;  4HVB A;  3J9C A;  3WAP A;  2ZEQ A;  1RRB A;  1WX7 A;  5JH5 C;  4RCO A;  3EA6 A;  3JW0 X;  3Q2A C;  3BY4 B;  2NBV B;  4WWN A;  2IGG A;  3A33 B;  2KQ4 X;  1F2R C;  4AP4 C;  4DXA B;  2PKO A;  1WRI A;  3L0W B;  2ZZP B;  2BPS A;  3VTW A;  1HTQ A;  4M00 A;  5HKH A;  1UUP A;  2D07 B;  2VH1 A;  1D6E C;  4IM2 A;  2KAC A;  4ICV A;  2JQR B;  1RYJ A;  3A1Q B;  1VR9 A;  3ZNG C;  1TYG B;  1A5R A;  3T8M A;  3U7Z A;  1VJK A;  4YSY B;  5EE3 A;  3N1Z C;  1UH6 A;  2G45 B;  2DLB A;  4N6E B;  1JCK B;  4I6L B;  5BMI A;  2MBQ A;  5J18 A;  2H89 B;  1AAR A;  3GE8 C;  1ZUD 2;  4XX5 A;  5IP4 D;  4BVU C;  2KT7 A;  2C5L C;  4REZ A;  3EEC A;  2RGF A;  2A5U A;  2JU6 X;  4RGT A;  2MJE A;  1E9M A;  1AW7 A;  3A9J A;  2WS3 B;  4HK2 A;  4XC2 A;  4BBN C;  3I9V 1;  4BKT A;  4PYU A;  1C4P A;  1ET9 A;  2FUH B;  4I6N B;  1VZ8 A;  3Q8E A;  4YWG G;  4TUU A;  5FR6 A;  4XE0 A;  1WXV A;  3A4R A;  4HPL B;  2K9X A;  2N9K A;  2BKR B;  3RNG C;  1EU4 A;  2Z0E B;  4BOZ B;  2G3Q B;  1I4X A;  4IWP A;  4L2Y A;  4YL8 A;  3UGB B;  2FCM A;  1IP9 A;  1J19 A;  2LGD A;  4MT5 A;  2WXI A;  1F52 A;  3MC8 A;  4LNN A;  4FJZ A;  1NYQ A;  4TSS A;  2D3C A;  3CSF A;  1SEB D;  1AWD A;  5HI1 A;  2PIA A;  4KIK A;  1FCL A;  3BIN A;  1ZPS A;  1F9J A;  1PUT A;  2JZ3 B;  1YX5 B;  3JSV A;  1PDX A;  4IG7 B;  2UU7 A;  4BKS D;  1Y8R C;  2K8B A;  3ZO5 B;  1NEN B;  2K5P A;  4ARI A;  1ACC A;  5C1Z A;  4WQO B;  2ZVN A;  3HHM A;  1HZ5 A;  1R4M B;  2KX0 A;  4L23 A;  1FNW A;  3AE1 B;  3ETR A;  1L5P A;  2G4D B;  1FFV A;  3CF6 E;  2DX5 B;  3W9C B;  4XGA B;  2JSV X;  5IA7 A;  1ZOY B;  3A9K B;  4MEL A;  3PPA A;  3E9S A;  3MJW A;  3QA8 A;  4ZRI A;  1KTK A;  1E8W A;  2V9H A;  2WXR A;  1MHH E;  4GLS C;  2N1W A;  3RMK C;  2PVG C;  5AZH A;  2KWC A;  4M8N A;  4MAC A;  2WU2 B;  1E7U A;  2A4Z A;  2Y5C A;  4NQK E;  2EMS A;  3ZNH B;  3ZGZ A;  1V8C A;  2KVZ A;  4DDI D;  1GJZ A;  4P6V F;  1CZP A;  1DOX A;  2AYO B;  5C23 A;  4N58 A;  1C78 A;  2XEW A;  1SXT A;  3U8Z A;  2LFI A;  5AUK A;  2LJ5 A;  4GGQ A;  3NG0 A;  5KHQ A;  4GOC A;  2LRU A;  4AUQ C;  3W2D A;  1BT0 A;  2WXH A;  5J17 A;  2IND C;  2IPK D;  2FCN A;  3QJZ A;  1C76 A;  3R8B A;  1N60 A;  4W9K A;  3KVF B;  1FXA A;  4E74 A;  5IO9 A;  3PHX B;  1PGB A;  3QCA A;  3B1L X;  4US9 A;  2KQS A;  3PS6 A;  1D3Z A;  3RUI B;  1XCQ L;  2RDB C;  3PGE A;  1YJJ A;  1JRU A;  1JWB D;  1WF9 A;  3CWI A;  1Z2M A;  1H8C A;  1D5Z C;  1ENF A;  2BBC A;  4HRO A;  4W9J A;  2FUG 1;  2Z8L A;  1H4R A;  5DPW A;  1E8Y A;  4NPN A;  2BYE A;  4WIP A;  2WXK A;  4KGS A;  4FBJ B;  3ML9 A;  4IDI A;  2Z0D B;  3P4S B;  3D32 A;  3BVG A;  3SHQ A;  1T0S C;  2JF5 A;  3ZDM C;  2MJD A;  2RD0 A;  1JWS D;  3VUX A;  4N9F 4;  3DBL B;  1L2N A;  4ZHP A;  4IW0 A;  3ML8 A;  3CMM B;  2QSD A;  3IXS A;  1BXT A;  1F1H A;  1NBF C;  2LHD A;  4K7S A;  2ZJD A;  1IPG A;  2KDE B;  2AX5 A;  4GSW A;  3TJP A;  4DBG A;  3X0W A;  4RGM A;  2N1V A;  3NS8 A;  2KTR B;  1XXG A;  1HTO A;  3OAW A;  2W54 A;  3RZW C;  2V1Y A;  1TS4 A;  1V1P A;  2J0M A;  4A90 A;  1VZ6 A;  1WJ6 A;  3CIR B;  1WJN A;  2WXO A;  2PE6 B;  2CS4 A;  1KF6 B;  2H88 B;  1QOG A;  3X23 A;  2D10 A;  1JRP A;  4B6W A;  1E8X A;  3LYY A;  4XYC A;  2QHO A;  3U30 A;  3C19 A;  1T5X D;  2NTS A;  2REX A;  2IO1 B;  1ZDX A;  2MLB A;  2BGF A;  1WSP A;  4RM8 A;  2O6V B;  5D6J B;  4P16 A;  4WAA A;  4HPP A;  4ACF A;  2MJ3 A;  2PMV A;  3DVN V;  3JYU A;  2NPT B;  3U7D A;  2UWQ A;  2L32 A;  3OWE B;  2M17 A;  4ANX A;  2MBB B;  2KX3 A;  1GC7 A;  5IOI A;  3ZIM A;  2L83 A;  3B2G A;  2WDT B;  4WUR A;  3N30 A;  1XF5 L;  3PRP B;  1WGY A;  3VR9 B;  5JZE B;  4DQO C;  1E5W A;  3RT3 B;  2L52 A;  3FAH A;  3CST A;  4BKS A;  4GIV A;  1FM0 D;  3AV8 A;  2VZK D;  1RWS A;  1J7B A;  3Q69 A;  1OQR A;  3TEX A;  1UGJ A;  2KMM A;  3N1X C;  2HE7 A;  2O2V A;  3KH0 A;  2KMA A;  1Q0W B;  2BYT A;  1AYF A;  1L6V A;  3AMZ A;  4HDO A;  3S2A A;  3WA0 A;  3RI7 C;  1L4Z B;  2MCN B;  1GUA B;  2RMM A;  1V1P B;  2NBW B;  2K8H A;  3AEE B;  3NJT A;  1ZP0 B;  3IT4 B;  4GB9 A;  2CU3 A;  3NOB A;  5JHA A;  4BKG A;  1GB4 A;  1WJ4 A;  4NAW A;  3W5U B;  3AN1 A;  2BS4 B;  5FK9 C;  2NVU I;  4P1C C;  4NQL B;  2AEH A;  4LJO B;  1OQQ A;  2FCQ A;  1XD3 B;  3AE2 B;  3KW5 B;  2WXP A;  1LXD A;  3RNF C;  3LJ3 A;  3M63 B;  4M8M A;  1EWY C;  4OVV A;  1K50 A;  3I3T B;  1VD2 A;  1DYQ A;  1WZ3 A;  3Q6B A;  1IUE A;  2PW9 A;  3A1Q A;  3L08 A;  1EO6 A;  1UBI A;  2KK8 A;  4DWF A;  1I4G A;  1TT5 B;  1M94 A;  2KVR A;  2D5G A;  3BYT B;  4ARC A;  3P63 A;  3K9P B;  3VQI A;  4JIO U;  4IKG A; 
#chains in the Genus database with same CATH homology
 2C5L C;  4G3X B;  4W9L A;  2UYZ B;  2BWF A;  2KFK A;  2ZNV C;  3EEC A;  2RGF A;  1P3Q U;  2A5U A;  1WGD A;  3M62 B;  4MGI E;  2KFK B;  4AJW A;  1XQQ A;  4XZ4 A;  2JRH A;  3A9J B;  2MA9 B;  2KTR A;  2KWV B;  3A9J A;  1R4M I;  5AEK B;  3SDL C;  2GBM A;  4DHJ D;  1KM7 A;  2LVO A;  3PLV A;  5CHF A;  4HK2 A;  5KHO A;  3ONS A;  3IVF A;  1VCB A;  4XC2 A;  4A20 A;  4BBN C;  3R3M A;  4ASW C;  4BKT A;  3VH4 B;  4PYU A;  2FUH B;  3EFU A;  3NHE B;  3QC8 B;  4I6N B;  2HD5 B;  1GG3 A;  4TUU A;  3VXW A;  2IZV B;  2L8J A;  4HCN B;  5FR6 A;  4KZ0 A;  1WXV A;  3RUL A;  2DYO A;  1OEY J;  3A4R A;  4HPL B;  2KQ7 A;  4JQW C;  1UZX B;  2BKR B;  1KJT A;  4HJK A;  3DPD A;  2Z0E B;  3NZS A;  2BKF A;  4BOZ B;  2G3Q B;  4LJP B;  4IWP A;  4TQ1 A;  2XK5 A;  4YL8 A;  1V80 A;  5AZG A;  3UGB B;  3UIP B;  2FCM A;  1Q1O A;  2EMT A;  4I6P A;  2MBO A;  4WJQ A;  1IP9 A;  1RAX A;  2GOW A;  1V81 A;  1J19 A;  3N32 A;  2LGD A;  3AUL A;  2DZJ A;  1SGH A;  3IHP C;  5AZF A;  3L17 A;  2O2V B;  1KLV A;  2ASQ A;  4AOF A;  1P0R A;  1WE6 A;  4FJZ A;  2JY6 A;  4P7I A;  2KJH B;  3UQA A;  3ZRC A;  1K8R B;  1YD8 U;  3QAR A;  3V62 A;  1G6J A;  1V49 A;  2GBR A;  2J0J A;  2KXJ A;  3N3K B;  4NNJ B;  1WX8 A;  2JT4 B;  3CSF A;  4KIK B;  3DDC B;  3QAQ A;  4MGK E;  2CR5 A;  3EHV A;  4KIK A;  1WXA A;  3BIN A;  1F9J A;  2C9W B;  2L3Z A;  1V6E A;  2JZ3 B;  4G50 A;  3KYD D;  1YX5 B;  2IY1 B;  1KOT A;  2EKE C;  3JSV A;  2RPQ A;  1S1Q B;  2DZK A;  3H7P A;  4IG7 B;  4BKS D;  3SU8 X;  1Y8R C;  2K8B A;  3DOW A;  3ZO5 B;  4A3O A;  2LXC A;  2KAN A;  4DHJ B;  2KFJ A;  3PRE A;  4F7Z A;  4IC7 B;  5C1Z A;  3PRM B;  2ZPN A;  1NDD A;  3QIJ A;  2ZVN A;  3HHM A;  4WQO B;  1UGM A;  2KX0 A;  5TR5 A;  2CHZ A;  3ZNI D;  1P1A A;  1ZGU B;  4MH0 E;  3PVL A;  2G4D B;  3CF6 E;  1P9D U;  2DX5 B;  1YQB A;  3RD2 A;  2K1F A;  5IA7 A;  3A9K B;  1S3S G;  2BYF A;  3H9D A;  4MEL A;  3V6C B;  3PPA A;  2IYD B;  3MJW A;  3QA8 A;  1UD7 A;  3HM3 A;  4ZRI A;  3RCZ A;  3ZW3 A;  4MSM B;  3VTU A;  2RSU A;  2M1M A;  5E6N A;  2L05 A;  1E8W A;  3WAO A;  4FLH A;  3NZU A;  2LRW A;  3KUZ A;  2L76 A;  3V6E B;  2LD9 A;  5DPR A;  2N1W A;  4DHZ E;  2FNJ B;  5AZH A;  2KWC A;  4ZDV A;  4M8N A;  1J0G A;  3H1U A;  1E7U A;  2A4Z A;  2DEN B;  4EEW A;  3M95 A;  3DBS A;  2IO0 B;  1V5O A;  5EDS A;  3H6N A;  4NQK E;  2EMS A;  2MW5 A;  3ZNH B;  1I35 A;  1TTN A;  2N9X A;  4IWO A;  3L16 A;  4DDI D;  5LLI A;  2LGX A;  1GJZ A;  5D2M B;  4PS7 A;  3PRZ A;  2ZNV B;  2AYO B;  1WM2 A;  3R7Q A;  3W1Y A;  5C23 A;  4KZC A;  1YX6 B;  4WJO A;  3AI5 A;  4GDK A;  2KMC A;  1WRD B;  4GDL B;  2XK5 B;  2DYM A;  2XEW A;  2BWE S;  3U8Z A;  3B08 A;  1RFA A;  3SD5 A;  2NBU A;  3HIZ A;  2LJ5 A;  4GGQ A;  4RMA A;  4DDG D;  5KHQ A;  4MSQ B;  4GOC A;  2LRU A;  2DHZ A;  1GC6 A;  4AUQ C;  4GXB A;  1UEL A;  3AXC A;  5E6O A;  1BT0 A;  4HLE A;  4AWJ A;  4G11 A;  3TBL D;  5J17 A;  1HE8 A;  2CU1 A;  3ZRF A;  1XT9 B;  4BBN F;  1LM8 B;  2FCN A;  3QJZ A;  4FA6 A;  5JHB A;  3ZVV A;  1WX9 A;  3ECI A;  1V9J A;  1LQB A;  1C1Y B;  4W9K A;  1EUV B;  3KVF B;  1SE9 A;  3V61 A;  4JL9 A;  1WR6 E;  1X1M A;  5GMV A;  4E74 A;  2LUE A;  1SIF A;  3PHX B;  4ICU A;  4PS3 A;  3DBH I;  2DAF A;  3QCA A;  2R2O A;  2KLG A;  3B1L X;  2KC2 A;  2KQS A;  4KSK C;  4KVG B;  1WMH B;  2K6Q A;  2YLM A;  2I1K A;  2YVC A;  3PT2 B;  3PS6 A;  3QX1 A;  4MGY E;  3VTV A;  1D3Z A;  4WJN A;  3DVG X;  4NJ7 A;  4B95 A;  4NAW B;  3RUI B;  4LDT B;  3PGE A;  2L0T A;  2V4L A;  1JRU A;  1WXS A;  3Q3F A;  1R4N I;  3P2B A;  3ZTC A;  3R66 C;  1WI0 A;  2OOB B;  4IWQ A;  1WF9 A;  4OVU A;  2JRI B;  4BOS C;  2D2Q A;  2FAZ A;  3M3J A;  1Z2M A;  4KDL B;  2K39 A;  2C7H A;  2ZVO A;  5G2N A;  1H8C A;  4W9J A;  4HXD A;  4ANV A;  2LZ6 A;  3V60 A;  3NY5 A;  2BF8 B;  2LVP A;  3WAN A;  1H4R A;  1WGH A;  2C60 A;  2XBB C;  5DPW A;  4FAD A;  1E8Y A;  2MP2 B;  4NPN A;  2BYE A;  2MP2 A;  4W9G A;  1WGR A;  5IAA C;  4ANW A;  1E90 A;  4II3 B;  1L7Y A;  2MSE D;  5CTR C;  5L95 C;  1WYW B;  3UIN B;  3ML9 A;  4FBJ B;  2AWT A;  5LXI B;  2Z0D B;  4HWI B;  2KTF A;  3DBL I;  3D32 A;  4TQ0 A;  5D94 A;  3W1S A;  3SHQ A;  2I1J A;  2LI5 A;  2WX1 A;  2JF5 A;  3WAL A;  4EFO A;  5LXH A;  1WY8 A;  3ZDM C;  3UQB A;  2NCN A;  1WE7 A;  2RD0 A;  3APF A;  3DVN U;  1WJU A;  3VUX A;  4N9F 4;  4EUT A;  2W9N A;  3L54 A;  4K7W A;  4W9H A;  2MQJ A;  1L2N A;  1V2Y A;  2L0F A;  2Y5B B;  2D11 A;  2IO3 B;  4IW0 A;  3W1S C;  3ML8 A;  4EZK A;  5D7G A;  4TV3 A;  1WZ0 A;  3CMM B;  2KO3 A;  4WJP A;  2DZI A;  1NBF C;  4K7S A;  2KKC A;  2KNB A;  4MGZ E;  2ZJD A;  2M4N A;  4K1R B;  1IPG A;  1OQY A;  4BFR A;  2KDE B;  2LXA A;  3H7S A;  3MHS D;  4FHK A;  4GSW A;  3TJP A;  3APD A;  3JVZ X;  4ZYN A;  3QK0 A;  4DBG A;  1GNU A;  3TIX A;  3X0W A;  4II2 B;  2Z59 B;  2N1V A;  4EZL A;  4CO7 A;  4AJY B;  3NS8 A;  3PTF C;  2KTR B;  1TGZ B;  2KDF B;  3OAW A;  2KDI A;  1I42 A;  4IM3 A;  2G4S A;  1E7V A;  3ZDT A;  2KD0 A;  3RZW C;  4ANU A;  4GMV A;  2V1Y A;  2FIF A;  4J6I A;  1IYF A;  4W9I A;  3QWZ B;  4ZRK A;  2J0M A;  4B9K A;  2KHW B;  4W9C A;  3L13 A;  1WJ6 A;  2ZPY A;  1WM3 A;  2N7D A;  3GOE A;  3ALB A;  3HK0 A;  1WH3 A;  3OJ4 B;  2WWZ A;  3PZD A;  4HPM B;  3ZUN A;  1WJN A;  3HM6 X;  4URK A;  4LDT D;  2PE6 B;  3ZLZ A;  2CS4 A;  1Q5W B;  3VUY A;  3H7P B;  1FXT B;  3X23 A;  4GDK B;  4W9F A;  4GDL A;  2GBK A;  2D10 A;  4X57 B;  4B6W A;  1E8X A;  2PE9 A;  3U30 A;  2QHO A;  4FN2 A;  1LFD A;  2LGY A;  2WX0 A;  4G0N B;  1QZE A;  4JGH B;  2REX A;  4NY0 A;  2IO1 B;  2MLB A;  3QHT A;  2BGF A;  2LWP A;  3WIM A;  4E71 A;  4RM8 A;  2O6V B;  4M0W B;  5DPT A;  5D6J B;  5CHW A;  4WAA A;  2O6V A;  3OLM D;  4MM3 A;  2CHW A;  2AL6 A;  2DYB A;  2JVC A;  2NPT A;  3DVN V;  1WR1 A;  3JYU A;  2NR2 A;  2NPT B;  1NI2 A;  3U7D A;  2C7N B;  2J0K A;  2VRR B;  2UWQ A;  2KN5 A;  4PYZ A;  1EF5 A;  3KUD B;  2RR9 A;  3VH3 B;  3UIO B;  1V86 A;  2M17 A;  3OJ3 A;  1MG8 A;  2ZCC A;  3UF8 A;  2MBB B;  2KX3 A;  4ANX A;  4IM0 A;  3VDZ A;  3VFK A;  2B3A A;  1U4A A;  2MX2 A;  1ISN A;  1GC7 A;  4MJS A;  3VHT C;  5CHV C;  3GZN I;  4LCD E;  2GBN A;  1ZW7 A;  3L10 B;  1OEY A;  4CYE A;  4K81 A;  4IUM B;  4EZJ A;  4W9D A;  2PPH A;  3R7R A;  3ZIM A;  2N9P C;  1WMH A;  2WDT B;  3PLU A;  3N30 A;  4MEM A;  3PRP B;  5L83 A;  3ZKJ C;  1WGY A;  1WXM A;  2KJR A;  2ZCB A;  2OJR A;  5G55 A;  5JZE B;  4FJV B;  2KZR A;  3IBE A;  3QQ8 B;  3WAM A;  1E5W A;  3RT3 B;  3AU5 A;  2O6V D;  2JPH A;  3CST A;  3RYT A;  5DPS A;  4BKS A;  1YJ1 A;  2GBJ A;  3ZNZ B;  2DZM A;  4RM9 A;  2KWU B;  3B0A A;  4KV2 A;  4GIV A;  2MBE A;  3IFW B;  3DCG A;  3IG3 A;  5CX3 A;  1CMX B;  1Z5S B;  2KLC A;  2HTH A;  2N9E B;  3PHW B;  4HDQ A;  5J2R A;  2BYV E;  2PJH A;  1J8C A;  1V5T A;  2JUO A;  3ENE A;  1T0Y A;  3T9L A;  1E8Z A;  1WIA A;  4WWP A;  1C3T A;  2HE7 A;  1ZKH A;  2KOX A;  3VVW B;  4EKU A;  2O2V A;  3KH0 A;  2KMA A;  5DCN A;  2JZZ A;  1Q0W B;  3ZTD A;  4HCP B;  4ZRJ A;  1OTR B;  4FUL A;  4HDO A;  3S2A A;  3Q3J A;  3RZF A;  3AU4 A;  3DVG Y;  1RLF A;  3APC A;  3WA0 A;  2CKH B;  3MTN B;  2J7Q B;  3KYC D;  2MCN B;  2AL3 A;  4A3P A;  2KJ6 A;  1GUA B;  3TMP B;  4KDI C;  2PEA A;  1YIW A;  2KDB A;  4WWO A;  4DK5 A;  2L00 B;  2NBW B;  4JLC A;  3A4S C;  2K8H A;  3VAW A;  2C7M B;  2MRP A;  3JSV B;  2IBI B;  2IY0 B;  4GB9 A;  4GU2 A;  2HJ8 A;  5E6P A;  4EOY A;  3LDZ E;  3DBR I;  2FID A;  2M8S A;  2CHX A;  4HVB A;  2DAJ A;  3NOB A;  5JHA A;  2KC1 A;  3WAP A;  4BKG A;  3TCA A;  1WJ4 A;  2WYQ A;  1RRB A;  2ZEQ A;  4NAW A;  3KUC B;  2LAS A;  1P98 A;  1WX7 A;  5JH5 C;  2JWZ A;  3K9O B;  4GN1 A;  4K7U A;  4NJ6 A;  3JW0 X;  3DQV A;  2NVU I;  2MWS B;  3BY4 B;  2NBV B;  4FHJ A;  4WWN A;  1WGG A;  2D3G A;  4NQL B;  2AEH A;  4LJO B;  2FCQ A;  1XD3 B;  4E3C A;  3O65 B;  3A33 B;  3KW5 B;  4MDK E;  1WFY A;  3A9K A;  3VUW A;  1LXD A;  4F8C B;  4DXA B;  4AP4 C;  1EF1 A;  3C0R B;  1UBQ A;  2K8C A;  2LVQ A;  2FCS A;  3LJ3 A;  3L0W B;  3M63 B;  4M8M A;  4FJY A;  3TL5 A;  2ZZP B;  2BPS A;  3PSE B;  4OVV A;  3VTW A;  4PS8 A;  4MJS B;  3I3T B;  2L7R A;  1OGW A;  4DHZ B;  5HKH A;  1VD2 A;  1WZ3 A;  4TKN A;  2D07 B;  2JXX A;  2N7E A;  4CHK A;  4IM2 A;  3A1Q A;  3L08 A;  1EO6 A;  4ICV A;  2K6D B;  2MBH A;  3A1Q B;  4F1S A;  3ZNG C;  2IO2 B;  1UBI A;  4KSL C;  2KK8 A;  4DWF A;  1TBE A;  5BO4 B;  2N4F A;  2V3S A;  3T8M A;  1A5R A;  1UH6 A;  2G45 B;  1M94 A;  2KVR A;  3PV1 A;  4I6L B;  2MBQ A;  2M0X A;  2GMI C;  5J18 A;  2K25 A;  4W9E A;  1AAR A;  2NS5 A;  1TZ1 A;  3EC8 A;  4XX5 A;  3K9P B;  2R2Q A;  4BVU C;  1PQS A;  3VQI A;  4JIO U; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...