1WY8A

Solution structure of the n-terminal ubiquitin-like domain in human np95/icbp90-like ring finger protein (nirf)
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
89
structure length
89
Chain Sequence
GSSGSSGMWIQVRTIDGSKTCTIEDVSRKATIEELRERVWALFDVRPECQRLFYRGKQLENGYTLFDYDVGLNDIIQLLVRPDSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Np95-like ring finger protein, isoform a
publication title Solution Structure of the N-terminal Ubiquitin-like Domain in Human Np95/ICBP90-like Ring Finger Protein (NIRF)
rcsb
source organism Homo sapiens
molecule tags Ligase
total genus 12
structure length 89
sequence length 89
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2005-02-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00240 ubiquitin Ubiquitin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 1wy8A00
4ZDVA 4ANUA 3B0AA 1V86A 3ZRCA 2CS4A 3APFA 2KWUB 3IBEA 4DBGA 2V3SA 2AL6A 4KZCA 3A4SC 1WFYA 3DVNV 2BKFA 2FNJB 4K7WA 1WGRA 3KUDB 1XQQA 2N1WA 4NNJB 1V49A 1P1AA 3PRZA 4W9FA 4DWFA 4HWIB 1OQYA 2JT4B 4DK5A 2LVOA 3KH0A 4GDLB 2PE9A 3DQVA 3PLVA 2GBKA 2ZVOA 1GG3A 3B08A 4HK2A 4W9LA 4FJVB 3U7DA 3CMMB 2M0XA 4FA6A 4MJSA 2XBBC 4DDGD 2I1JA 3ZTCA 4ANXA 1WXMA 5EDSA 1YD8U 3WALA 4URKA 2KC2A 2L05A 2AEHA 3WIMA 4TKNA 1A5RA 4PS3A 2IYDB 1UZXB 1LQBA 1KM7A 3BY4B 4GDKB 4MGZE 4RM8A 4JIOU 4MGIE 2K25A 3AXCA 4WJQA 5J17A 4TV3A 4ANVA 3MTNB 4E3CA 2BKRB 2JZZA 5HKHA 1V5OA 2KFJA 4MSMB 3SD5A 1LM8B 2JXXA 2MCNB 4BBNC 3ZUNA 2G3QB 1VD2A 2WWZA 4JQWC 3N3KB 4GU2A 2PEAA 4A20A 1QZEA 2AYOB 1PQSA 2N7DA 4IG7B 1TBEA 4PS7A 4MSQB 4ZRKA 2IY0B 3QK0A 4M8MA 2FCQA 4MGKE 4BOSC 4NPNA 1UD7A 5BO4B 2IO3B 3VQIA 5D2MB 2REXA 4KIKB 2LVQA 4WQOB 1YQBA 3VHTC 2LUEA 4EKUA 2JPHA 2BGFA 1TZ1A 4I6NB 2MP2B 1E5WA 3ZTDA 4II2B 2KTRB 2L0FA 3QHTA 5LXHA 3Q3JA 4IWPA 2HJ8A 5C1ZA 3C0RB 4F8CB 3IVFA 3L13A 3U30A 2R2QA 4WJOA 1YIWA 3VFKA 3V61A 3LJ3A 3VDZA 4MEMA 3ZO5B 2N7EA 4DHZE 3UF8A 5JHAA 3VUXA 1D3ZA 2LGXA 4XC2A 1IPGA 2M8SA 3KYCD 4WAAA 4DXAB 1WM2A 2GOWA 4E74A 1WZ3A 2DAJA 1WX9A 4BKSD 1WXVA 1R4MI 3D32A 2IY1B 2GBMA 4KZ0A 4W9EA 1SE9A 3VTVA 1WY8A 2DZJA 2NS5A 2C7NB 2PJHA 1EO6A 3QJZA 3K9PB 4GDKA 3RD2A 1WX8A 3VAWA 3HK0A 2PPHA 4MJSB 4HVBA 2KHWB 4FHKA 1WX7A 3A9JB 3H7PA 3WAOA 1WGHA 1GC7A 2LGDA 4X57B 3SHQA 1I35A 2ZNVB 2WX1A 2K1FA 4G3XB 4G0NB 2IBIB 3DBLI 3ZRFA 3PSEB 4W9DA 2HD5B 2KQ7A 2Y5BB 3A9KA 2KKCA 1E8ZA 4LDTB 4I6LB 2MBHA 4W9HA 3VUWA 4BKSA 1C3TA 2V1YA 4HDQA 2LGYA 2ZCBA 4WWPA 3VH4B 2KWCA 4MGYE 3IHPC 2KDEB 1JRUA 2JVCA 4IM3A 1J19A 3NZSA 2K8HA 3ONSA 5E6NA 3N30A 2L0TA 1NDDA 4TQ1A 3X23A 1V80A 2A5UA 5IA7A 2WDTB 4IW0A 3ZDMC 4B9KA 3GZNI 4A3OA 1RFAA 1UH6A 1Q5WB 2CHZA 1WMHA 5C23A 1F9JA 5JHBA 2AWTA 3NZUA 5DCNA 2KDBA 5AZHA 3PT2B 1WGDA 4KSKC 4AJYB 1BT0A 3V6EB 3UQBA 1ZW7A 4IWOA 1WXAA 1RLFA 2J0JA 2JWZA 3CF6E 2KTFA 4GN1A 3VUYA 4I6PA 1V6EA 3R3MA 4BOZB 2O6VB 2L76A 2PE6B 4LDTD 3ZDTA 4HPMB 2MWSB 2FIDA 3ZNZB 4F7ZA 2DYBA 2JY6A 2ZPNA 3DVNU 3L17A 2CU1A 3N32A 1IP9A 4HCNB 2L8JA 3CSFA 3PLUA 1WJNA 3JVZX 4W9GA 4BBNF 2KLCA 4RMAA 4JLCA 3PS6A 1WXSA 3H6NA 2W9NA 4RM9A 3A9JA 3ZNID 2K8CA 1YX6B 4AOFA 1J8CA 2Z0DB 1U4AA 4NQKE 2MA9B 2ZCCA 1LXDA 2JF5A 5GMVA 2KNBA 2ZVNA 3NS8A 3PPAA 1P3QU 3UIPB 4LJPB 1XT9B 2L00B 4KDIC 2NBVB 2KOXA 1C1YB 2L3ZA 3AU5A 3QA8A 4OVUA 2V4LA 1WJ4A 3S2AA 2DENB 1J0GA 2C9WB 2D07B 2G4DB 3H7PB 3HIZA 2MBEA 2O6VD 2LRWA 4ICVA 2BWFA 1WF9A 4IC7B 3OJ4B 3APCA 1IYFA 3PHWB 4BKTA 1SGHA 1KJTA 2OOBB 4K1RB 2EMSA 3UIOB 1ZGUB 2LASA 2MBOA 3A9KB 4ICUA 2DYOA 4WWOA 3PTFC 2DZMA 3LDZE 4TQ0A 2RGFA 1OEYJ 1UBQA 2ZJDA 5IAAC 5LXIB 3KUCB 4M8NA 3DVGX 2KX3A 1RAXA 1WR6E 2KZRA 1I42A 2O2VB 2A4ZA 2JUOA 3W1SC 4HPLB 1E90A 4ASWC 2G4SA 2NR2A 3RYTA 1VCBA 4NQLB 2CKHB 2O6VA 4F1SA 3HHMA 2I1KA 2KVRA 1WMHB 3TBLD 1UELA 4PYZA 3QC8B 2D2QA 2C7HA 2NCNA 1X1MA 3RUIB 1P9DU 4A3PA 2CR5A 5TR5A 2BYVE 4WJNA 2KJHB 3ML8A 2LZ6A 3PREA 3SDLC 4HCPB 3T8MA 3ZNHB 2FCSA 4AUQC 2GBNA 3HM6X 5KHQA 2DHZA 3VH3B 3KW5B 2DYMA 3IG3A 5L95C 4KV2A 2GMIC 4WWNA 4IM0A 1RRBA 3QQ8B 2AL3A 4FHJA 4KDLB 4GIVA 2KMCA 4LCDE 3VXWA 1Q1OA 4CHKA 3NOBA 3NY5A 2MX2A 4K81A 2FCMA 2WYQA 2KFKA 3SU8X 5AZGA 1LFDA 2BPSA 2KJ6A 4HDOA 5L83A 4DDID 3DBSA 3TJPA 1E8XA 1WRDB 2EKEC 3RZWC 2EMTA 3L10B 5DPSA 3BINA 4W9JA 2FAZA 2LXAA 2CHXA 3ZIMA 4DHZB 4EZKA 1G6JA 1WI0A 3R7RA 2JRIB 5DPRA 2N9EB 3QCAA 4AP4C 2HE7A 3W1SA 3WAPA 2D11A 2D10A 3L0WB 3L54A 5AEKB 3RT3B 2MSED 3PVLA 1GC6A 2L7RA 4WJPA 3V60A 2B3AA 2J7QB 2K8BA 3ZKJC 2LI5A 2LXCA 2RPQA 1GJZA 1TGZB 4E71A 1EUVB 4G50A 4EZLA 2MRPA 5CHFA 1V2YA 2KQSA 3H7SA 3JW0X 2O2VA 2R2OA 2IO0B 2MBBB 3RCZA 2M1MA 1H4RA 3ALBA 1NBFC 2DAFA 3ZLZA 1WE7A 1FXTB 3PRPB 4PYUA 2UYZB 3TIXA 2RD0A 2C5LC 2DZKA 4GXBA 4B95A 1OGWA 1UBIA 2MQJA 3B1LX 3IFWB 3VVWB 3V62A 4J6IA 2NBUA 4JL9A 2DZIA 2FCNA 4NY0A 3RZFA 1V9JA 3A1QB 4OVVA 3KYDD 1M94A 3QAQA 3L08A 3UINB 4ZRJA 2RR9A 2DX5B 3DPDA 4YL8A 1KOTA 3M95A 4GB9A 4KSLC 2WX0A 3CSTA 4XZ4A 3ZNGC 4K7SA 1WYWB 1T0YA 2OJRA 1L7YA 1EF1A 5J18A 3W1YA 3OLMD 1P0RA 3K9OB 3R66C 4PS8A 2LRUA 2GBRA 3M62B 1MG8A 3ZW3A 3V6CB 2NBWB 1Z5SB 3QWZB 2MBQA 2K6DB 2J0MA 2KFKB 1WJ6A 2FUHB 2NPTA 4LJOB 4IM2A 4K7UA 4W9IA 1L2NA 2KJRA 3DOWA 2YLMA 3PGEA 2KWVB 4ZYNA 2KDIA 2KN5A 5AZFA 2FIFA 4BKGA 2KMAA 1E8YA 1V81A 1Y8RC 3U8ZA 2KD0A 2BYFA 4ZRIA 2IZVB 2BWES 3EC8A 2XK5B 3TMPB 3AI5A 1H8CA 2KDFB 5FR6A 4FADA 3OAWA 1K8RB 5D94A 2N4FA 2ZZPB 4JGHB 3UGBB 2C60A 2KLGA 5D6JB 5CTRC 3GOEA 3PZDA 1E7UA 3ENEA 4MDKE 4EEWA 1YX5B 3MJWA 4FULA 3ZVVA 4KVGB 1S1QB 4NAWA 1OTRB 4EZJA 4HXDA 4HLEA 1GNUA 1ZKHA 3JSVB 4TUUA 4EFOA 3ECIA 4GGQA 4II3B 1R4NI 1UGMA 3A1QA 2C7MB 4GSWA 4MH0E 5LLIA 2KK8A 2N9XA 5E6PA 1NI2A 1P98A 1XD3B 3Q3FA 4NJ6A 5CHWA 1E7VA 4DHJB 4B6WA 5E6OA 4CO7A 1EF5A 2GBJA 3JYUA 2Z59B 3WANA 3QX1A 3EHVA 2HTHA 5G55A 1WZ0A 2KANA 2LD9A 4W9KA 4BVUC 2ASQA 2J0KA 3A4RA 3ML9A 2LWPA 5KHOA 3WAMA 3T9LA 3APDA 3R7QA 3TCAA 1S3SG 3DVGY 2XEWA 3OJ3A 2QHOA 4HJKA 3NHEB 4ANWA 1WIAA 1Q0WB 2M17A 4GDLA 3DCGA 1TTNA 4N9F4 3QARA 2NVUI 5CX3A 2MW5A 4IWQA 5JZEB 3VTUA 4AWJA 3AU4A 4MELA 5DPTA 3X0WA 2KC1A 2BYEA 2D3GA 4NJ7A 3PHXB 4FJZA 5D7GA 3AULA 2XK5A 2K6QA 3M63B 3UQAA 3I3TB 2NPTB 2MLBA 3QIJA 3PV1A 4DHJD 1V5TA 3DBHI 2KXJA 1OEYA 2K39A 4W9CA 2N1VA 2KX0A 2RSUA 4EUTA 2M4NA 2YVCA 4GMVA 4FN2A 1WH3A 1WR1A 2ZPYA 5J2RA 2IO2B 2KO3A 4M0WB 1Z2MA 5CHVC 4GOCA 3WA0A 4BFRA 1E8WA 2CHWA 3JSVA 3PRMB 3P2BA 3KUZA 4MM3A 3VTWA 5G2NA 3KVFB 1WM3A 4FLHA 1YJ1A 1ISNA 1AARA 3H9DA 3RULA 2Z0EB 4FBJB 1WE6A 4EOYA 5JH5C 1GUAB 4CYEA 2ZEQA 4XX5A 1KLVA 4AJWA 2ZNVC 3O65B 4NAWB 3TL5A 2IO1B 2LVPA 4IUMB 4KIKA 1WJUA 4FJYA 3MHSD 1CMXB 2UWQA 2LJ5A 3DBRI 3L16A 3M3JA 4P7IA 1SIFA 2BF8B 2G45B 2MP2A 2JRHA 3A33B 1HE8A 2N9PC 5DPWA 2KTRA 3EECA 3EFUA 3DDCB 1WGGA 3H1UA 2JZ3B 2VRRB 1WGYA 4G11A 3HM3A
chains in the Genus database with same CATH superfamily
1QQRA 3ZRCA 2CS4A 1QKZA 4DBGA 2BKFA 3AMZA 1DYQA 3KUDB 1V49A 1P1AA 4DWFA 4HWIB 1CZPA 2JT4B 3Q8EA 4GDLB 4LK0M 1N62A 2ZVOA 4HK2A 3CMMB 4XWWA 2XBBC 2Z8LA 4DDGD 3ZTCA 4ANXA 5EDSA 1YD8U 4URKA 2KC2A 2ZW1A 4TKNA 3ETRA 5JXVA 1RYJA 5HG2A 1YJJA 4RM8A 4WJQA 4DQOC 3W9CB 4TV3A 2JZZA 2BW2A 4MSMB 1UNSA 1LM8B 1VZ6A 2JXXA 4BBNC 2G3QB 1VD2A 4JQWC 3N3KB 4A20A 2AYOB 1TS5A 1PQSA 4IG7B 2W54A 1BUIC 2IY0B 1SE3A 3GE8C 2IO3B 4C00A 3VQIA 4YSXB 3VHTC 2BT6A 2LVQA 1YQBA 1QOBA 2JPHA 2BGFA 1FXAA 4I6NB 5LXHA 4N6EB 3BYTB 2R2QA 1FD6A 3VFKA 4MEMA 2N7EA 4ZOHC 5MPOA 2DNFA 2WDVB 5JHAA 1IPGA 1WZ3A 2DAJA 1WX9A 1TY2A 2IY1B 2GBMA 5BYRA 2PJHA 3QJZA 3K9PB 4CQNA 2IGHA 3VAWA 5LNK1 2BVCA 3H7PA 3N1ZC 1NVID 4W9HA 2WDQB 2X8XX 2KQ4X 4L2YA 4HDQA 3BZDB 2ZCBA 4RF1A 2KDEB 4IM3A 1C77A 1XO3A 2K8HA 5E6NA 2KVZA 1V80A 1RWSA 4R3DA 3ZDMC 4B9KA 2J52A 4RGOS 1SB3C 1I4PA 2PTLA 2GRIA 4KSKC 1BT0A 3V6EB 1ZW7A 2WGSA 2JWZA 3VUYA 2KTFA 1SEBD 4RH6A 2LJIA 3E56A 2O6VB 2UU7A 1TKEA 1GAQB 2B76B 1K51A 3ZDTA 2DYBA 2TSSA 2PVOD 1IP9A 4HCNB 1WWTA 5EE0A 2KAJA 3H6NA 3ZNID 1YX6B 2Z0DB 3NVYA 1LXDA 2KNBA 2L00B 2WXRA 4MACA 1F52A 3S2AA 2INCC 4BZAA 2E3TA 4O1NA 4HKQA 1AN8A 2LRWA 2O6VD 1R4NB 1VZ8A 1WF9A 5FR3A 2LFIA 1SGHA 1KJTA 1WSPA 2EMSA 2K9XA 2DYOA 2LMCA 2PIAA 4TQ0A 2RGFA 1UBQA 5IAAC 1UUPA 3KUCB 3HVZA 3NUHB 2OJWA 1WR6E 4A6QA 2LEKA 4OHJA 4HPLB 3ZXVA 1B1ZA 4RGMA 1TJEA 2IGGA 4WWMA 5H8YE 3TBLD 5AUIA 1K52A 3TUOA 3NJTA 3MHZA 1ROEA 1TKYA 2NCNA 1X1MA 2NTTA 1P9DU 2BYVE 3ZNHB 1WYGA 2L32A 4AUQC 2WXPA 3DBHB 3HM6X 5L95C 4IM0A 2WS3B 1RRBA 3QQ8B 2AL3A 3VXWA 3VR9B 1Q1OA 4K81A 5L83A 4HDOA 3PO0A 3TJPA 1WRDB 1KFYB 1F77A 3L10B 5DPSA 3BINA 1KH0A 4EZKA 1WI0A 5DPRA 1M4VA 1C78A 2N9EB 3AE9B 4AP4C 5BMHA 2N9KA 2J7QB 3ZKJC 2RPQA 1EUVB 3P4PB 3MC0B 2KQSA 2O2VA 2IO0B 1UGJA 3RCZA 3MC9A 5D3IB 1JCKB 1QILA 2M0AA 1FCCC 4REZA 3GP7A 3PRPB 4PYUA 3TIXA 1EWCA 2YEPF 4B95A 1XLOA 3B1LX 3IFWB 1L0YB 3VVWB 4J6IA 3T3NA 1N63A 2QCZA 4OVVA 2I38A 2GB1A 1FRDA 4YL8A 1I4QA 5FKAC 2CJNA 1I4RA 3ZQ4A 3OLMD 3R66C 3AEEB 3FILA 3FC4A 2MBQA 1T0RC 2K6DB 2J0MA 4K3CA 2NPTA 4K7UA 1L2NA 2YLMA 2KMAA 1Y8RC 2ONQA 2IZVB 5IKCM 4RGNA 1H8CA 3Q8FA 1C79A 1K8RB 2ZZPB 3RI7C 2BB5A 1MHHE 1GPXA 3GOEA 1E7UA 4EEWA 3O13A 3MJWA 4FULA 3ZVVA 4HXDA 2MJEA 1ZKHA 4TUUA 4EFOA 4GGQA 2JX5A 1SF0A 3A1QA 4GSWA 4MH0E 1NI2A 3Q3FA 1VR9A 1E7VA 3LB8C 4AS1A 2Z59B 3WANA 1T6BX 3QX1A 2GI9A 1FFUA 5G55A 1C76A 1WZ0A 4XWTA 2ASQA 1TS2A 1YQ4B 3IAS1 3T9LA 3TCAA 2QC8A 2XEWA 4ANWA 4GDLA 2JYTA 1IBXB 1P7FA 3X0WA 2Y5PA 2BS3B 1XXGA 3AULA 2XK5A 4YSZB 3QIJA 2WXIA 3B9JA 1SJED 2ZW0A 3Q8AA 4US9A 4YXDB 1VRAB 4LNNA 4A55A 2K39A 2ACZB 2KX0A 2N1VA 2M4NA 2YVCA 2ZPYA 2M56B 4M0WB 1DOIA 1Z2MA 3VRAB 1MI0A 4YTPB 1QF6A 4C4VA 1YOVB 1TYGB 3URYA 4FLHA 3R8BA 1YJ1A 1ISNA 3RULA 1ET6A 5JH5C 1FO4A 2WXFA 4XX5A 4NAWB 4RNAA 2IO1B 4HKZE 1DOYA 4FJYA 4P7IA 2LJ5A 1FFVA 2N9PC 3NVZA 1WGGA 1WGYA 4G11A 1C3TA 3HM3A 3B0AA 1V86A 3AN1A 2KWUB 3NRZA 4KZCA 1Y56A 4K7WA 1HQRD 4LTUA 3V05A 3V3XA 4DK5A 2LVOA 2MJ3A 2ON8A 3PLVA 2OHFA 3ZJTA 4FJVB 3U7DA 5HFYA 1FM0D 1PFDA 3P4RB 4US8A 2AEHA 4PS3A 2IYDB 1LQBA 4JWUC 1IGDA 1D4BA 5HKHA 4E3CA 2RDHA 3ZUNA 1TIFA 1QZEA 2K5PA 1NI3A 1UD7A 2QDFA 2NTSA 4EKUA 2LUEA 2H89B 4B0EA 1KRHA 2KTRB 1IGCA 2Q5WD 3QHTA 2HJ8A 3WCQA 3U30A 3L13A 4F8CB 1HTQA 1KF6B 3OWEB 2VZKB 2M8SA 4WAAA 1ACCA 3LXFA 4JWSC 1GB4A 1R4MI 2QIEB 2W82A 3DHHC 2JZPA 4W9EA 1WY8A 3J9CA 1VDVA 4GDKA 1AYFA 3RD2A 3HK0A 4WAFA 4YTMB 4HVBA 1WX7A 1SE2A 1TKGA 1EU3A 3IAM1 3PZ8A 4G0NB 3DBLI 4N58A 2V3NA 3ZRFA 4RFBA 2HD5B 4KKIA 3W5VB 2MBHA 4BKSA 5EE3A 2VZKD 3AE2B 4WWPA 1A70A 2KWCA 4MGYE 1Q10A 3NZSA 1JWMD 2G9HD 1CQVA 3IXSA 1RFAA 1N6ZA 1CJEA 1JMLA 1DOXA 5JHBA 2K0PA 2AWTA 2KDBA 1WGDA 1RLFA 2J0JA 2XNAC 3R3MA 2L76A 2PE6B 4HPMB 2MWSB 4IDIA 3ZNZB 2ZPNA 2YEPB 3L17A 1YJIA 4ZHPA 1WJNA 4XDDA 1XLNA 2KLCA 1GB1A 1PGBA 4RMAA 4M02A 3A9JA 5HHDG 1J8CA 4DXFA 1U4AA 2ZCCA 1HZ6A 2ZVNA 1N5WA 3PPAA 3UIPB 1XT9B 5H92C 2NBVB 2C9WB 1V1PB 2G4DB 3I57A 4ICVA 4HROA 2BWFA 4IC7B 1IYFA 2GLSA 1ZGUB 2LASA 3A9KB 1ZP0B 3LDZE 4HJGE 4KGTA 4J3OD 2ZJDA 1I4XA 1E9MA 3Q8BA 1RAXA 2KZRA 3W1SC 1E90A 3HUIA 2G4SA 2NR2A 2CKHB 4F1SA 3HHMA 4TMAB 2KVRA 1WMHB 3AE7B 3QC8B 3HVDA 4KKJA 3ZYYX 4C7ZA 2CR5A 3SR6A 4WJNA 2LZ6A 1R4MB 3T8MA 2FCSA 2R61A 5KHQA 4JX1C 3VH3B 3IG3A 2INPE 4WWNA 3N20C 2BTEA 3IT4B 1RM6C 4CHKA 3MP9A 3NY5A 4LNOA 3SU8X 5AZGA 2QEJC 3P42A 4DDID 4NZLB 2IPKD 2RPVA 4ACFA 3DBLB 3DWGC 4W9JA 2LXAA 2CJOA 2WXJA 3ZIMA 2Y5CA 1JQ4A 2D10A 1NYQA 2MSED 4WJPA 3V60A 2LXCA 1GJZA 5GXGB 4E71A 4EZLA 2WXOA 1FNWA 1NENB 1WRIA 1SXTA 3JW0X 2R2OA 3MFGA 3Q8CA 5D3DA 2M1MA 2L83A 3UI3A 3ZLZA 1WE7A 2N0SB 2D3AA 5BMGA 2RD0A 5BMIA 1OGWA 5C2TB 2DBYA 2FCNA 3RZFA 2LHDA 1QLBB 3KYDD 3QAQA 3TEYA 5BYQA 3L08A 4ZYSA 4ZRJA 4LNKA 4XZ4A 3E9SA 3ZNGC 1WYWB 1L7YA 1EF1A 1IBXA 1FRRA 3RNEC 2WXNA 4PK1A 2FUHB 4WQMA 1TT5B 3AEGB 3DOWA 3PGEA 2KWVB 4ZYNA 1DGJA 2FIFA 1V81A 3U8ZA 2BYFA 1HXYD 2W3RA 3EC8A 3RNFC 4M0WA 2WXLA 2RDGA 1CK1A 5FR6A 2L1AA 3BIID 3MC8A 5D94A 2N4FA 3RN9C 4JGHB 2FBWB 3PZDA 2HTME 4NAWA 1OTRB 1SIJA 4EZJA 4GLSC 1MJDA 1FCLA 4NAMA 3H8HA 3ECIA 1T3QA 1L6UA 4II3B 2C7MB 2KK8A 1XEEA 5E6PA 5CHWA 3BVMA 4B6WA 2J4XA 3AB5A 2KANA 2LD9A 5KHOA 2LWPA 1JALA 3R7QA 1EM7A 3B2FA 1F0ZA 5CX3A 2MW5A 5JZEB 1FPYA 5EE1A 5DPTA 2KC1A 2BYEA 3PHXB 4FJZA 5D7GA 3BVZA 3P1MA 3PV1A 2KXJA 3EUB2 1OEYA 2RDBC 2RSUA 1WH3A 1WR1A 2WXKA 4L23A 4RF0A 3WA0A 2MHJA 1E8WA 3JSVA 3P2BA 1XF5L 3KUZA 3VTWA 3EGRA 3KVFB 3DHGC 3H9DA 3RPFC 4EOYA 3ZXRA 4XE0A 1ZPSA 3Q3NC 1I4GA 3Q3OC 4K3BA 5I4DA 4IUMB 4XYCA 1R7SA 2UWQA 3M3JA 3CIRB 2JRHA 3A33B 1HE8A 3P4SB 3AEAB 2KTRA 5DPWA 3EFUA 3H1UA 2PKOA 2WQYB 3P63A 1J7AA 1VJKA 4LNIA 3IBEA 1JW9D 1WFYA 2WXGA 2FUG1 3L4PA 2XN9C 1FMAD 1WGRA 3Q2AC 1OQYA 3KH0A 3KWLA 3RNBC 3B08A 1GG3A 4EE2A 2M0XA 4FA6A 2I1JA 1WXMA 3WALA 3WIMA 4C56C 1UZXB 4ZRPA 1KM7A 4MGZE 4JIOU 4MGIE 4XDCA 2K25A 2BQQA 3AXCA 1XCQL 1AWDA 3U2SC 4ANVA 3MTNB 2BKRB 1V5OA 3FAHA 2WU2B 1FXIA 3SD5A 3U7ZA 3VR8B 2WWZA 4GU2A 1TBEA 4PS7A 3QK0A 2AQ1B 2H88B 5BO4B 3U4EG 4ZHOA 3ZGZA 2REXA 1FNUA 4KIKB 2N7JA 4WQOB 1TZ1A 1BMLC 4YWGG 1MPEA 3Q3JA 5C1ZA 3IVFA 2KT7A 4WJOA 1YIWA 1WGKA 3LJ3A 3VDZA 4JE3B 3UF8A 1YN5A 3ZJUA 2MJDA 4XC2A 3P4QB 3N1YC 3BYYB 4DXAB 1WM2A 3ZJVA 1WXVA 1SE9A 2DZJA 1JROA 4WH4A 2C7NB 1EO6A 2FE8A 1HA5A 2KN4A 1WX8A 2PPHA 4MJSB 2KHWB 1B9RA 1V1PA 1I35A 3SHQA 4X57B 2K1FA 1D6EC 2INNE 3PSEB 4W9DA 1SE4A 1V1OA 2BYTA 3A9KA 1E8ZA 4LDTB 4I6LB 3VUWA 3SFDB 1YN3A 2V1YA 3R2TA 1JRPA 1YNTE 1J7BA 3IHPC 2HJ1A 1J19A 3ONSA 2L0TA 4TQ1A 4S0RA 1EWYC 3X23A 1FEHA 5IA7A 2WDTB 3GZNI 3KWVA 4P1BC 1WMHA 4A90A 5C23A 1F9JA 5AZHA 2MEKA 5DCNA 4AJYB 4D2KA 4IWOA 1WXAA 4H2AA 5AUKA 3RMKC 4GN1A 1PGXA 2INDC 2QSDA 1C4AA 1V6EA 2SAKA 3AEDB 4LDTD 2JY6A 1F2RI 2CU1A 3N32A 2L8JA 3PLUA 3JVZX 4BBNF 3IT6B 4JLCA 2W9NA 4AOFA 5EE9A 4HEA1 1ET9A 4NQKE 2JYEA 3MJ5A 2JF5A 3NS8A 4P1CC 2EKIA 4LJPB 4KDIC 2KOXA 4OVUA 2V4LA 1WJ4A 2D07B 2MBEA 4OZCA 3AE6B 3AH7A 3OJ4B 3APCA 1N61A 3LYYA 3KLSX 2DZMA 1TS4A 2KWDA 4AQ7A 1OEYJ 4DXGA 1GOZA 1I42A 2O2VB 4ARCA 5C3JB 1SBBB 1VCBA 4NQLB 1PDXA 2O6VA 2I1KA 5HI1A 1UELA 4PYZA 3Q14C 2D2QA 2C7HA 4BAXA 4A3PA 1QT9A 1XLQA 1F1HA 3ML8A 4HCPB 4C7YA 2GBNA 2DHZA 2DYMA 2MH7A 4HPPA 3TSSA 4GIVA 2KMCA 2MX2A 2FCMA 3AECB 2KJ6A 3I63C 3Q3MC 3AE8B 3FKYA 1MHXA 2EKEC 3RZWC 1ZOYB 2FAZA 4DHZB 1G6JA 1T0QC 2JRIB 1YQ3B 3QCAA 3WAPA 3W1SA 2D11A 2QJLA 2L7RA 2LHEA 2K8BA 2K22A 1TGZB 4OZBA 2MRPA 1V2YA 3Q6BA 2PVGC 1LO5D 2J53A 4P16A 1TZOA 1D5ZC 1STEA 1H4RA 2LUMA 1IUEA 1NBFC 2DAFA 2WU5B 2UYZB 4GXBA 5IP4D 2LGSA 4YT0B 1UBIA 3V62A 4JL9A 1JWSD 3AE1B 1P7EA 1V9JA 3A1QB 2BS4B 4S17A 3UINB 1KOTA 2KMMA 2WX0A 4LNFA 4M00A 4OZAA 1T0YA 3HRDD 5J18A 3W1YA 1ZE3D 1P0RA 3K9OB 4PS8A 2LRUA 3M62B 1MG8A 3ZW3A 1L0VB 3NZ3A 2NBWB 3QWZB 1E10A 4FXCA 2KFKB 1WJ6A 4IM2A 4W9IA 1TY0A 2KJRA 5AZFA 3SEBA 1OQQA 1E7PB 2KD0A 5IO9A 2XK5B 3TMPB 3AI5A 2KDFB 3OAWA 4HRSA 4PT5A 5CTRC 3TEXA 3BVGA 4MDKE 2JWUA 1S1QB 4HLEA 4C4VB 1UGMA 1R4NI 5LLIA 2N9XA 1XD3B 4NJ6A 4ARIA 4CO7A 1EF5A 2GBJA 3JYUA 3DWMA 1JWBD 4BVUC 2J0KA 2RMMA 3APDA 3OJ3A 2QHOA 1L4DB 3NHEB 1Q0WB 1ZXIA 4N59A 4A8XC 2M17A 3DCGA 1TTNA 4N9F4 2NVUI 3VTUA 3AU4A 2D3GA 4NJ7A 4KX6B 3C8YA 3M63B 3UQAA 3I3TB 5G5GA 1V5TA 3BK2A 3DBHI 4EUTA 4GMVA 4FN2A 1C4PA 2WHIA 2WXMA 1C4CA 1K53A 3RNGC 2IO2B 5CHVC 4GOCA 1XLPA 2WLBA 2CHWA 1BXTA 3B2GA 1V97A 1WM3A 4FBJB 1HZ5A 1WXQA 3N1XC 2ZEQA 2ZNVC 2KACA 1QOGA 2LVPA 1ZUD2 4KIKA 1WJUA 1CMXB 3DBRI 3L16A 1L0XB 1SIFA 2KYWA 1I4HA 2JSVX 4C80A 2JZ3B 2VRRB 4ZDVA 5BYSA 4ANUA 3APFA 1MFWA 2V3SA 3RFZB 2AL6A 1N5XA 3AM9A 4QAYA 3A4SC 3DVNV 4RCOA 2FNJB 3U52E 2V3PA 1XQQA 2N1WA 4NNJB 3PRZA 4W9FA 3C19A 4UDUC 2K3UA 2PE9A 3DQVA 1HTOA 2VH1A 2GBKA 4W9LA 1EU4A 1I7HA 4MJSA 3TEWA 2L05A 1A5RA 3KQ4A 3BY4B 4GDKB 5J17A 2AQ2B 2X38A 2KFJA 4P6VF 2MCNB 2PEAA 4MM3B 2N7DA 4MSQB 4ZRKA 4MGKE 4M8MA 2FCQA 4BOSC 4NPNA 5D2MB 2WP9B 1MG4A 3AEFB 1N60A 2WDRB 2MP2B 3TEZA 1E5WA 3ZTDA 4II2B 2L0FA 4IWPA 4ITKA 3C0RB 3V61A 3ZO5B 3I5JC 4DHZE 3R2IA 1D3ZA 3VUXA 2LGXA 3NS1A 3KYCD 2GOWA 4NJCA 4E74A 4BKSD 3D32A 4KZ0A 2W3SA 3VTVA 1D5MC 2D3BA 2NS5A 2PLPA 3BK1A 1D5XC 5FK9C 2IDYA 3DHIC 4FHKA 3A9JB 3WAOA 1WGHA 1GC7A 2LGDA 2ZNVB 2WX1A 2G1EA 2BBCA 4G3XB 1ESFA 2IBIB 2WNMA 2KQ7A 2Y5BB 2KKCA 3DBRB 1ZXHA 2LGYA 3VH4B 2V0GA 3T3OA 1JRUA 2M19A 2JVCA 3N30A 1NDDA 1E6EB 2A5UA 1OFFA 1PYWD 2AQ3B 4IW0A 3NVVA 4A3OA 1UH6A 2CHZA 1Q5WB 1L4ZB 3OG5A 3EA6A 3NZUA 3PT2B 3UQBA 3CF6E 1VLBA 4I6PA 2DLBA 1FNVA 2HDEA 4BOZB 2OEDA 3BWUD 3RNCC 3W2DA 2FIDA 4YSYB 4F7ZA 3DVNU 2SEBD 4WURA 2E6XA 3CSFA 3NVWA 4W9GA 1JWUD 3PS6A 1WXSA 4RM9A 2K8CA 1QOAA 1JWAD 2MA9B 3Q69A 5GMVA 1P3QU 2J42A 1C1YB 1K50A 2L3ZA 3AU5A 3QA8A 3EFCA 2DENB 1J0GA 3AEBB 3HIZA 3H7PB 4YTNB 1V8CA 3PHWB 4BKTA 2OOBB 4K1RB 3CWIA 3UIOB 4RGTA 2MBOA 4ICUA 4WWOA 3PTFC 1ENFA 3PZ7A 2IJ0A 5LXIB 4M8NA 3DVGX 2KX3A 2A4ZA 2JUOA 1PUTA 4ASWC 1C9FA 3RYTA 2JQRB 1L5PA 2AX5A 2D3CA 4WIPA 3RUIB 2W55A 5TR5A 2KJHB 3PREA 3SDLC 2KDMA 3KW5B 4KV2A 2GMIC 4USAA 3NG0A 4FHJA 4KDLB 2PMVA 4LCDE 3NOBA 3SFEB 2WYQA 2KFKA 2DWQA 1LFDA 2BPSA 3DBSA 5E6JA 1E8XA 2EMTA 1FIQA 2CHXA 4M01A 2L52A 3R7RA 1UF0A 1J7CA 1SJHD 2HE7A 3L0WB 3L54A 5AEKB 3RT3B 3PVLA 1GC6A 1PGAA 2B3AA 1VZ7A 2LI5A 3GE3C 2ICIA 2IGDA 4G50A 5CHFA 1UWMA 3H7SA 1HEZE 2MBBB 1KLUD 1NEKB 3N9YC 3ALBA 4A9AA 4ZRQA 1OQRA 3AE3B 1FXTB 1E0ZA 2C5LC 2DZKA 1UWXA 2MQJA 1MVKA 2NBUA 4IOIE 2DZIA 4NY0A 1M94A 3AE4B 2RR9A 2DX5B 3DPDA 2WXQA 3RNAC 3M95A 4GB9A 4KSLC 2EELA 3CSTA 5G5HA 4K7SA 2OJRA 1F2RC 1TS3A 3W5UB 4OVZA 1SSNA 2GBRA 3V6CB 2PW9A 1Z5SB 2CU3A 1YN4A 3GS2A 3AV8A 4LJOB 2QMTA 4BKGA 2KDIA 2KN5A 2V4IB 1YMHE 1E8YA 1T5XD 2D5GA 4Q2JA 2BWES 4FADA 3UGBB 1AW7A 2C60A 2KLGA 5D6JB 3ABVB 2V9HA 3ENEA 1YX5B 2BB6A 4KVGB 1GNUA 3GB1A 5IN7A 3JSVB 2Y3AA 1XCTL 4L1BA 2JXTA 1P98A 1KTKA 5IOIA 4JPSA 4DHJB 4MT5A 4MH8A 5E6OA 1QOFA 3AE5B 3EHVA 2HTHA 4IKGA 4W9KA 3A4RA 3ML9A 2VH2A 3WAMA 1S3SG 3DVGY 4HJKA 2LGIA 1L6VA 1WIAA 1ZDVA 2NMQA 4TSSA 3QARA 2BS2B 4IWQA 4AWJA 4MELA 2I2YA 4KGRA 3FILB 2K6QA 3VRBB 2NPTB 2MLBA 4DHJD 2N9LA 1NYRA 3I9V1 4W9CA 1T0SC 3GZNB 5J2RA 2KO3A 4BFRA 3PRMB 4MM3A 5G2NA 4LLGM 1AARA 2Z0EB 1WE6A 1GUAB 4CYEA 5T8IA 1ZDXA 2QILA 1KLVA 4AJWA 3O65B 3TL5A 4ZRIA 3MHSD 2BF8B 1KLGD 2G45B 2MP2A 2JU6X 4OW0A 2WXHA 1RFKA 1LGRA 4XGAB 3EECA 4B0MA 4KGSA 5TSSA 3DDCB
chains in the Genus database with same CATH topology
4ZDVA 4ANUA 3B0AA 1V86A 3ZRCA 2CS4A 3APFA 2KWUB 3IBEA 4DBGA 2V3SA 2AL6A 4KZCA 3A4SC 1WFYA 3DVNV 2BKFA 2FNJB 4K7WA 1WGRA 3KUDB 1XQQA 2N1WA 4NNJB 1V49A 1P1AA 3PRZA 4W9FA 4DWFA 4HWIB 1OQYA 2JT4B 4DK5A 2LVOA 3KH0A 4GDLB 2PE9A 3DQVA 3PLVA 2GBKA 2ZVOA 1GG3A 3B08A 4HK2A 4W9LA 4FJVB 3U7DA 3CMMB 2M0XA 4FA6A 4MJSA 2XBBC 4DDGD 2I1JA 3ZTCA 4ANXA 1WXMA 5EDSA 1YD8U 3WALA 4URKA 2KC2A 2L05A 2AEHA 3WIMA 4TKNA 1A5RA 4PS3A 2IYDB 1UZXB 1LQBA 1KM7A 3BY4B 4GDKB 4MGZE 4RM8A 4JIOU 4MGIE 2K25A 3AXCA 4WJQA 5J17A 4TV3A 4ANVA 3MTNB 4E3CA 2BKRB 2JZZA 5HKHA 1V5OA 2KFJA 4MSMB 3SD5A 1LM8B 2JXXA 2MCNB 4BBNC 3ZUNA 2G3QB 1VD2A 2WWZA 4JQWC 3N3KB 4GU2A 2PEAA 4A20A 1QZEA 2AYOB 1PQSA 2N7DA 4IG7B 1TBEA 4PS7A 4MSQB 4ZRKA 2IY0B 3QK0A 4M8MA 2FCQA 4MGKE 4BOSC 4NPNA 1UD7A 5BO4B 2IO3B 3VQIA 5D2MB 2REXA 4KIKB 2LVQA 4WQOB 1YQBA 3VHTC 2LUEA 4EKUA 2JPHA 2BGFA 1TZ1A 4I6NB 2MP2B 1E5WA 3ZTDA 4II2B 2KTRB 2L0FA 3QHTA 5LXHA 3Q3JA 4IWPA 2HJ8A 5C1ZA 3C0RB 4F8CB 3IVFA 3L13A 3U30A 2R2QA 4WJOA 1YIWA 3VFKA 3V61A 3LJ3A 3VDZA 4MEMA 3ZO5B 2N7EA 4DHZE 3UF8A 5JHAA 3VUXA 1D3ZA 2LGXA 4XC2A 1IPGA 2M8SA 3KYCD 4WAAA 4DXAB 1WM2A 2GOWA 4E74A 1WZ3A 2DAJA 1WX9A 4BKSD 1WXVA 1R4MI 3D32A 2IY1B 2GBMA 4KZ0A 4W9EA 1SE9A 3VTVA 1WY8A 2DZJA 2NS5A 2C7NB 2PJHA 1EO6A 3QJZA 3K9PB 4GDKA 3RD2A 1WX8A 3VAWA 3HK0A 2PPHA 4MJSB 4HVBA 2KHWB 4FHKA 1WX7A 3A9JB 3H7PA 3WAOA 1WGHA 1GC7A 2LGDA 4X57B 3SHQA 1I35A 2ZNVB 2WX1A 2K1FA 4G3XB 4G0NB 2IBIB 3DBLI 3ZRFA 3PSEB 4W9DA 2HD5B 2KQ7A 2Y5BB 3A9KA 2KKCA 1E8ZA 4LDTB 4I6LB 2MBHA 4W9HA 3VUWA 4BKSA 1C3TA 2V1YA 4HDQA 2LGYA 2ZCBA 4WWPA 3VH4B 2KWCA 4MGYE 3IHPC 2KDEB 1JRUA 2JVCA 4IM3A 1J19A 3NZSA 2K8HA 3ONSA 5E6NA 3N30A 2L0TA 1NDDA 4TQ1A 3X23A 1V80A 2A5UA 5IA7A 2WDTB 4IW0A 3ZDMC 4B9KA 3GZNI 4A3OA 1RFAA 1UH6A 1Q5WB 2CHZA 1WMHA 5C23A 1F9JA 5JHBA 2AWTA 3NZUA 5DCNA 2KDBA 5AZHA 3PT2B 1WGDA 4KSKC 4AJYB 1BT0A 3V6EB 3UQBA 1ZW7A 4IWOA 1WXAA 1RLFA 2J0JA 2JWZA 3CF6E 2KTFA 4GN1A 3VUYA 4I6PA 1V6EA 3R3MA 4BOZB 2O6VB 2L76A 2PE6B 4LDTD 3ZDTA 4HPMB 2MWSB 2FIDA 3ZNZB 4F7ZA 2DYBA 2JY6A 2ZPNA 3DVNU 3L17A 2CU1A 3N32A 1IP9A 4HCNB 2L8JA 3CSFA 3PLUA 1WJNA 3JVZX 4W9GA 4BBNF 2KLCA 4RMAA 4JLCA 3PS6A 1WXSA 3H6NA 2W9NA 4RM9A 3A9JA 3ZNID 2K8CA 1YX6B 4AOFA 1J8CA 2Z0DB 1U4AA 4NQKE 2MA9B 2ZCCA 1LXDA 2JF5A 5GMVA 2KNBA 2ZVNA 3NS8A 3PPAA 1P3QU 3UIPB 4LJPB 1XT9B 2L00B 4KDIC 2NBVB 2KOXA 1C1YB 2L3ZA 3AU5A 3QA8A 4OVUA 2V4LA 1WJ4A 3S2AA 2DENB 1J0GA 2C9WB 2D07B 2G4DB 3H7PB 3HIZA 2MBEA 2O6VD 2LRWA 4ICVA 2BWFA 1WF9A 4IC7B 3OJ4B 3APCA 1IYFA 3PHWB 4BKTA 1SGHA 1KJTA 2OOBB 4K1RB 2EMSA 3UIOB 1ZGUB 2LASA 2MBOA 3A9KB 4ICUA 2DYOA 4WWOA 3PTFC 2DZMA 3LDZE 4TQ0A 2RGFA 1OEYJ 1UBQA 2ZJDA 5IAAC 5LXIB 3KUCB 4M8NA 3DVGX 2KX3A 1RAXA 1WR6E 2KZRA 1I42A 2O2VB 2A4ZA 2JUOA 3W1SC 4HPLB 1E90A 4ASWC 2G4SA 2NR2A 3RYTA 1VCBA 4NQLB 2CKHB 2O6VA 4F1SA 3HHMA 2I1KA 2KVRA 1WMHB 3TBLD 1UELA 4PYZA 3QC8B 2D2QA 2C7HA 2NCNA 1X1MA 3RUIB 1P9DU 4A3PA 2CR5A 5TR5A 2BYVE 4WJNA 2KJHB 3ML8A 2LZ6A 3PREA 3SDLC 4HCPB 3T8MA 3ZNHB 2FCSA 4AUQC 2GBNA 3HM6X 5KHQA 2DHZA 3VH3B 3KW5B 2DYMA 3IG3A 5L95C 4KV2A 2GMIC 4WWNA 4IM0A 1RRBA 3QQ8B 2AL3A 4FHJA 4KDLB 4GIVA 2KMCA 4LCDE 3VXWA 1Q1OA 4CHKA 3NOBA 3NY5A 2MX2A 4K81A 2FCMA 2WYQA 2KFKA 3SU8X 5AZGA 1LFDA 2BPSA 2KJ6A 4HDOA 5L83A 4DDID 3DBSA 3TJPA 1E8XA 1WRDB 2EKEC 3RZWC 2EMTA 3L10B 5DPSA 3BINA 4W9JA 2FAZA 2LXAA 2CHXA 3ZIMA 4DHZB 4EZKA 1G6JA 1WI0A 3R7RA 2JRIB 5DPRA 2N9EB 3QCAA 4AP4C 2HE7A 3W1SA 3WAPA 2D11A 2D10A 3L0WB 3L54A 5AEKB 3RT3B 2MSED 3PVLA 1GC6A 2L7RA 4WJPA 3V60A 2B3AA 2J7QB 2K8BA 3ZKJC 2LI5A 2LXCA 2RPQA 1GJZA 1TGZB 4E71A 1EUVB 4G50A 4EZLA 2MRPA 5CHFA 1V2YA 2KQSA 3H7SA 3JW0X 2O2VA 2R2OA 2IO0B 2MBBB 3RCZA 2M1MA 1H4RA 3ALBA 1NBFC 2DAFA 3ZLZA 1WE7A 1FXTB 3PRPB 4PYUA 2UYZB 3TIXA 2RD0A 2C5LC 2DZKA 4GXBA 4B95A 1OGWA 1UBIA 2MQJA 3B1LX 3IFWB 3VVWB 3V62A 4J6IA 2NBUA 4JL9A 2DZIA 2FCNA 4NY0A 3RZFA 1V9JA 3A1QB 4OVVA 3KYDD 1M94A 3QAQA 3L08A 3UINB 4ZRJA 2RR9A 2DX5B 3DPDA 4YL8A 1KOTA 3M95A 4GB9A 4KSLC 2WX0A 3CSTA 4XZ4A 3ZNGC 4K7SA 1WYWB 1T0YA 2OJRA 1L7YA 1EF1A 5J18A 3W1YA 3OLMD 1P0RA 3K9OB 3R66C 4PS8A 2LRUA 2GBRA 3M62B 1MG8A 3ZW3A 3V6CB 2NBWB 1Z5SB 3QWZB 2MBQA 2K6DB 2J0MA 2KFKB 1WJ6A 2FUHB 2NPTA 4LJOB 4IM2A 4K7UA 4W9IA 1L2NA 2KJRA 3DOWA 2YLMA 3PGEA 2KWVB 4ZYNA 2KDIA 2KN5A 5AZFA 2FIFA 4BKGA 2KMAA 1E8YA 1V81A 1Y8RC 3U8ZA 2KD0A 2BYFA 4ZRIA 2IZVB 2BWES 3EC8A 2XK5B 3TMPB 3AI5A 1H8CA 2KDFB 5FR6A 4FADA 3OAWA 1K8RB 5D94A 2N4FA 2ZZPB 4JGHB 3UGBB 2C60A 2KLGA 5D6JB 5CTRC 3GOEA 3PZDA 1E7UA 3ENEA 4MDKE 4EEWA 1YX5B 3MJWA 4FULA 3ZVVA 4KVGB 1S1QB 4NAWA 1OTRB 4EZJA 4HXDA 4HLEA 1GNUA 1ZKHA 3JSVB 4TUUA 4EFOA 3ECIA 4GGQA 4II3B 1R4NI 1UGMA 3A1QA 2C7MB 4GSWA 4MH0E 5LLIA 2KK8A 2N9XA 5E6PA 1NI2A 1P98A 1XD3B 3Q3FA 4NJ6A 5CHWA 1E7VA 4DHJB 4B6WA 5E6OA 4CO7A 1EF5A 2GBJA 3JYUA 2Z59B 3WANA 3QX1A 3EHVA 2HTHA 5G55A 1WZ0A 2KANA 2LD9A 4W9KA 4BVUC 2ASQA 2J0KA 3A4RA 3ML9A 2LWPA 5KHOA 3WAMA 3T9LA 3APDA 3R7QA 3TCAA 1S3SG 3DVGY 2XEWA 3OJ3A 2QHOA 4HJKA 3NHEB 4ANWA 1WIAA 1Q0WB 2M17A 4GDLA 3DCGA 1TTNA 4N9F4 3QARA 2NVUI 5CX3A 2MW5A 4IWQA 5JZEB 3VTUA 4AWJA 3AU4A 4MELA 5DPTA 3X0WA 2KC1A 2BYEA 2D3GA 4NJ7A 3PHXB 4FJZA 5D7GA 3AULA 2XK5A 2K6QA 3M63B 3UQAA 3I3TB 2NPTB 2MLBA 3QIJA 3PV1A 4DHJD 1V5TA 3DBHI 2KXJA 1OEYA 2K39A 4W9CA 2N1VA 2KX0A 2RSUA 4EUTA 2M4NA 2YVCA 4GMVA 4FN2A 1WH3A 1WR1A 2ZPYA 5J2RA 2IO2B 2KO3A 4M0WB 1Z2MA 5CHVC 4GOCA 3WA0A 4BFRA 1E8WA 2CHWA 3JSVA 3PRMB 3P2BA 3KUZA 4MM3A 3VTWA 5G2NA 3KVFB 1WM3A 4FLHA 1YJ1A 1ISNA 1AARA 3H9DA 3RULA 2Z0EB 4FBJB 1WE6A 4EOYA 5JH5C 1GUAB 4CYEA 2ZEQA 4XX5A 1KLVA 4AJWA 2ZNVC 3O65B 4NAWB 3TL5A 2IO1B 2LVPA 4IUMB 4KIKA 1WJUA 4FJYA 3MHSD 1CMXB 2UWQA 2LJ5A 3DBRI 3L16A 3M3JA 4P7IA 1SIFA 2BF8B 2G45B 2MP2A 2JRHA 3A33B 1HE8A 2N9PC 5DPWA 2KTRA 3EECA 3EFUA 3DDCB 1WGGA 3H1UA 2JZ3B 2VRRB 1WGYA 4G11A 3HM3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ZDV A;  4ANU A;  3B0A A;  1V86 A;  3ZRC A;  2CS4 A;  3APF A;  2KWU B;  3IBE A;  4DBG A;  2V3S A;  2AL6 A;  4KZC A;  3A4S C;  1WFY A;  3DVN V;  2BKF A;  2FNJ B;  4K7W A;  1WGR A;  3KUD B;  1XQQ A;  2N1W A;  4NNJ B;  1V49 A;  1P1A A;  3PRZ A;  4W9F A;  4DWF A;  4HWI B;  1OQY A;  2JT4 B;  4DK5 A;  2LVO A;  3KH0 A;  4GDL B;  2PE9 A;  3DQV A;  3PLV A;  2GBK A;  2ZVO A;  1GG3 A;  3B08 A;  4HK2 A;  4W9L A;  4FJV B;  3U7D A;  3CMM B;  2M0X A;  4FA6 A;  4MJS A;  2XBB C;  4DDG D;  2I1J A;  3ZTC A;  4ANX A;  1WXM A;  5EDS A;  1YD8 U;  3WAL A;  4URK A;  2KC2 A;  2L05 A;  2AEH A;  3WIM A;  4TKN A;  1A5R A;  4PS3 A;  2IYD B;  1UZX B;  1LQB A;  1KM7 A;  3BY4 B;  4GDK B;  4MGZ E;  4RM8 A;  4JIO U;  4MGI E;  2K25 A;  3AXC A;  4WJQ A;  5J17 A;  4TV3 A;  4ANV A;  3MTN B;  4E3C A;  2BKR B;  2JZZ A;  5HKH A;  1V5O A;  2KFJ A;  4MSM B;  3SD5 A;  1LM8 B;  2JXX A;  2MCN B;  4BBN C;  3ZUN A;  2G3Q B;  1VD2 A;  2WWZ A;  4JQW C;  3N3K B;  4GU2 A;  2PEA A;  4A20 A;  1QZE A;  2AYO B;  1PQS A;  2N7D A;  4IG7 B;  1TBE A;  4PS7 A;  4MSQ B;  4ZRK A;  2IY0 B;  3QK0 A;  4M8M A;  2FCQ A;  4MGK E;  4BOS C;  4NPN A;  1UD7 A;  5BO4 B;  2IO3 B;  3VQI A;  5D2M B;  2REX A;  4KIK B;  2LVQ A;  4WQO B;  1YQB A;  3VHT C;  2LUE A;  4EKU A;  2JPH A;  2BGF A;  1TZ1 A;  4I6N B;  2MP2 B;  1E5W A;  3ZTD A;  4II2 B;  2KTR B;  2L0F A;  3QHT A;  5LXH A;  3Q3J A;  4IWP A;  2HJ8 A;  5C1Z A;  3C0R B;  4F8C B;  3IVF A;  3L13 A;  3U30 A;  2R2Q A;  4WJO A;  1YIW A;  3VFK A;  3V61 A;  3LJ3 A;  3VDZ A;  4MEM A;  3ZO5 B;  2N7E A;  4DHZ E;  3UF8 A;  5JHA A;  3VUX A;  1D3Z A;  2LGX A;  4XC2 A;  1IPG A;  2M8S A;  3KYC D;  4WAA A;  4DXA B;  1WM2 A;  2GOW A;  4E74 A;  1WZ3 A;  2DAJ A;  1WX9 A;  4BKS D;  1WXV A;  1R4M I;  3D32 A;  2IY1 B;  2GBM A;  4KZ0 A;  4W9E A;  1SE9 A;  3VTV A;  1WY8 A;  2DZJ A;  2NS5 A;  2C7N B;  2PJH A;  1EO6 A;  3QJZ A;  3K9P B;  4GDK A;  3RD2 A;  1WX8 A;  3VAW A;  3HK0 A;  2PPH A;  4MJS B;  4HVB A;  2KHW B;  4FHK A;  1WX7 A;  3A9J B;  3H7P A;  3WAO A;  1WGH A;  1GC7 A;  2LGD A;  4X57 B;  3SHQ A;  1I35 A;  2ZNV B;  2WX1 A;  2K1F A;  4G3X B;  4G0N B;  2IBI B;  3DBL I;  3ZRF A;  3PSE B;  4W9D A;  2HD5 B;  2KQ7 A;  2Y5B B;  3A9K A;  2KKC A;  1E8Z A;  4LDT B;  4I6L B;  2MBH A;  4W9H A;  3VUW A;  4BKS A;  1C3T A;  2V1Y A;  4HDQ A;  2LGY A;  2ZCB A;  4WWP A;  3VH4 B;  2KWC A;  4MGY E;  3IHP C;  2KDE B;  1JRU A;  2JVC A;  4IM3 A;  1J19 A;  3NZS A;  2K8H A;  3ONS A;  5E6N A;  3N30 A;  2L0T A;  1NDD A;  4TQ1 A;  3X23 A;  1V80 A;  2A5U A;  5IA7 A;  2WDT B;  4IW0 A;  3ZDM C;  4B9K A;  3GZN I;  4A3O A;  1RFA A;  1UH6 A;  1Q5W B;  2CHZ A;  1WMH A;  5C23 A;  1F9J A;  5JHB A;  2AWT A;  3NZU A;  5DCN A;  2KDB A;  5AZH A;  3PT2 B;  1WGD A;  4KSK C;  4AJY B;  1BT0 A;  3V6E B;  3UQB A;  1ZW7 A;  4IWO A;  1WXA A;  1RLF A;  2J0J A;  2JWZ A;  3CF6 E;  2KTF A;  4GN1 A;  3VUY A;  4I6P A;  1V6E A;  3R3M A;  4BOZ B;  2O6V B;  2L76 A;  2PE6 B;  4LDT D;  3ZDT A;  4HPM B;  2MWS B;  2FID A;  3ZNZ B;  4F7Z A;  2DYB A;  2JY6 A;  2ZPN A;  3DVN U;  3L17 A;  2CU1 A;  3N32 A;  1IP9 A;  4HCN B;  2L8J A;  3CSF A;  3PLU A;  1WJN A;  3JVZ X;  4W9G A;  4BBN F;  2KLC A;  4RMA A;  4JLC A;  3PS6 A;  1WXS A;  3H6N A;  2W9N A;  4RM9 A;  3A9J A;  3ZNI D;  2K8C A;  1YX6 B;  4AOF A;  1J8C A;  2Z0D B;  1U4A A;  4NQK E;  2MA9 B;  2ZCC A;  1LXD A;  2JF5 A;  5GMV A;  2KNB A;  2ZVN A;  3NS8 A;  3PPA A;  1P3Q U;  3UIP B;  4LJP B;  1XT9 B;  2L00 B;  4KDI C;  2NBV B;  2KOX A;  1C1Y B;  2L3Z A;  3AU5 A;  3QA8 A;  4OVU A;  2V4L A;  1WJ4 A;  3S2A A;  2DEN B;  1J0G A;  2C9W B;  2D07 B;  2G4D B;  3H7P B;  3HIZ A;  2MBE A;  2O6V D;  2LRW A;  4ICV A;  2BWF A;  1WF9 A;  4IC7 B;  3OJ4 B;  3APC A;  1IYF A;  3PHW B;  4BKT A;  1SGH A;  1KJT A;  2OOB B;  4K1R B;  2EMS A;  3UIO B;  1ZGU B;  2LAS A;  2MBO A;  3A9K B;  4ICU A;  2DYO A;  4WWO A;  3PTF C;  2DZM A;  3LDZ E;  4TQ0 A;  2RGF A;  1OEY J;  1UBQ A;  2ZJD A;  5IAA C;  5LXI B;  3KUC B;  4M8N A;  3DVG X;  2KX3 A;  1RAX A;  1WR6 E;  2KZR A;  1I42 A;  2O2V B;  2A4Z A;  2JUO A;  3W1S C;  4HPL B;  1E90 A;  4ASW C;  2G4S A;  2NR2 A;  3RYT A;  1VCB A;  4NQL B;  2CKH B;  2O6V A;  4F1S A;  3HHM A;  2I1K A;  2KVR A;  1WMH B;  3TBL D;  1UEL A;  4PYZ A;  3QC8 B;  2D2Q A;  2C7H A;  2NCN A;  1X1M A;  3RUI B;  1P9D U;  4A3P A;  2CR5 A;  5TR5 A;  2BYV E;  4WJN A;  2KJH B;  3ML8 A;  2LZ6 A;  3PRE A;  3SDL C;  4HCP B;  3T8M A;  3ZNH B;  2FCS A;  4AUQ C;  2GBN A;  3HM6 X;  5KHQ A;  2DHZ A;  3VH3 B;  3KW5 B;  2DYM A;  3IG3 A;  5L95 C;  4KV2 A;  2GMI C;  4WWN A;  4IM0 A;  1RRB A;  3QQ8 B;  2AL3 A;  4FHJ A;  4KDL B;  4GIV A;  2KMC A;  4LCD E;  3VXW A;  1Q1O A;  4CHK A;  3NOB A;  3NY5 A;  2MX2 A;  4K81 A;  2FCM A;  2WYQ A;  2KFK A;  3SU8 X;  5AZG A;  1LFD A;  2BPS A;  2KJ6 A;  4HDO A;  5L83 A;  4DDI D;  3DBS A;  3TJP A;  1E8X A;  1WRD B;  2EKE C;  3RZW C;  2EMT A;  3L10 B;  5DPS A;  3BIN A;  4W9J A;  2FAZ A;  2LXA A;  2CHX A;  3ZIM A;  4DHZ B;  4EZK A;  1G6J A;  1WI0 A;  3R7R A;  2JRI B;  5DPR A;  2N9E B;  3QCA A;  4AP4 C;  2HE7 A;  3W1S A;  3WAP A;  2D11 A;  2D10 A;  3L0W B;  3L54 A;  5AEK B;  3RT3 B;  2MSE D;  3PVL A;  1GC6 A;  2L7R A;  4WJP A;  3V60 A;  2B3A A;  2J7Q B;  2K8B A;  3ZKJ C;  2LI5 A;  2LXC A;  2RPQ A;  1GJZ A;  1TGZ B;  4E71 A;  1EUV B;  4G50 A;  4EZL A;  2MRP A;  5CHF A;  1V2Y A;  2KQS A;  3H7S A;  3JW0 X;  2O2V A;  2R2O A;  2IO0 B;  2MBB B;  3RCZ A;  2M1M A;  1H4R A;  3ALB A;  1NBF C;  2DAF A;  3ZLZ A;  1WE7 A;  1FXT B;  3PRP B;  4PYU A;  2UYZ B;  3TIX A;  2RD0 A;  2C5L C;  2DZK A;  4GXB A;  4B95 A;  1OGW A;  1UBI A;  2MQJ A;  3B1L X;  3IFW B;  3VVW B;  3V62 A;  4J6I A;  2NBU A;  4JL9 A;  2DZI A;  2FCN A;  4NY0 A;  3RZF A;  1V9J A;  3A1Q B;  4OVV A;  3KYD D;  1M94 A;  3QAQ A;  3L08 A;  3UIN B;  4ZRJ A;  2RR9 A;  2DX5 B;  3DPD A;  4YL8 A;  1KOT A;  3M95 A;  4GB9 A;  4KSL C;  2WX0 A;  3CST A;  4XZ4 A;  3ZNG C;  4K7S A;  1WYW B;  1T0Y A;  2OJR A;  1L7Y A;  1EF1 A;  5J18 A;  3W1Y A;  3OLM D;  1P0R A;  3K9O B;  3R66 C;  4PS8 A;  2LRU A;  2GBR A;  3M62 B;  1MG8 A;  3ZW3 A;  3V6C B;  2NBW B;  1Z5S B;  3QWZ B;  2MBQ A;  2K6D B;  2J0M A;  2KFK B;  1WJ6 A;  2FUH B;  2NPT A;  4LJO B;  4IM2 A;  4K7U A;  4W9I A;  1L2N A;  2KJR A;  3DOW A;  2YLM A;  3PGE A;  2KWV B;  4ZYN A;  2KDI A;  2KN5 A;  5AZF A;  2FIF A;  4BKG A;  2KMA A;  1E8Y A;  1V81 A;  1Y8R C;  3U8Z A;  2KD0 A;  2BYF A;  4ZRI A;  2IZV B;  2BWE S;  3EC8 A;  2XK5 B;  3TMP B;  3AI5 A;  1H8C A;  2KDF B;  5FR6 A;  4FAD A;  3OAW A;  1K8R B;  5D94 A;  2N4F A;  2ZZP B;  4JGH B;  3UGB B;  2C60 A;  2KLG A;  5D6J B;  5CTR C;  3GOE A;  3PZD A;  1E7U A;  3ENE A;  4MDK E;  4EEW A;  1YX5 B;  3MJW A;  4FUL A;  3ZVV A;  4KVG B;  1S1Q B;  4NAW A;  1OTR B;  4EZJ A;  4HXD A;  4HLE A;  1GNU A;  1ZKH A;  3JSV B;  4TUU A;  4EFO A;  3ECI A;  4GGQ A;  4II3 B;  1R4N I;  1UGM A;  3A1Q A;  2C7M B;  4GSW A;  4MH0 E;  5LLI A;  2KK8 A;  2N9X A;  5E6P A;  1NI2 A;  1P98 A;  1XD3 B;  3Q3F A;  4NJ6 A;  5CHW A;  1E7V A;  4DHJ B;  4B6W A;  5E6O A;  4CO7 A;  1EF5 A;  2GBJ A;  3JYU A;  2Z59 B;  3WAN A;  3QX1 A;  3EHV A;  2HTH A;  5G55 A;  1WZ0 A;  2KAN A;  2LD9 A;  4W9K A;  4BVU C;  2ASQ A;  2J0K A;  3A4R A;  3ML9 A;  2LWP A;  5KHO A;  3WAM A;  3T9L A;  3APD A;  3R7Q A;  3TCA A;  1S3S G;  3DVG Y;  2XEW A;  3OJ3 A;  2QHO A;  4HJK A;  3NHE B;  4ANW A;  1WIA A;  1Q0W B;  2M17 A;  4GDL A;  3DCG A;  1TTN A;  4N9F 4;  3QAR A;  2NVU I;  5CX3 A;  2MW5 A;  4IWQ A;  5JZE B;  3VTU A;  4AWJ A;  3AU4 A;  4MEL A;  5DPT A;  3X0W A;  2KC1 A;  2BYE A;  2D3G A;  4NJ7 A;  3PHX B;  4FJZ A;  5D7G A;  3AUL A;  2XK5 A;  2K6Q A;  3M63 B;  3UQA A;  3I3T B;  2NPT B;  2MLB A;  3QIJ A;  3PV1 A;  4DHJ D;  1V5T A;  3DBH I;  2KXJ A;  1OEY A;  2K39 A;  4W9C A;  2N1V A;  2KX0 A;  2RSU A;  4EUT A;  2M4N A;  2YVC A;  4GMV A;  4FN2 A;  1WH3 A;  1WR1 A;  2ZPY A;  5J2R A;  2IO2 B;  2KO3 A;  4M0W B;  1Z2M A;  5CHV C;  4GOC A;  3WA0 A;  4BFR A;  1E8W A;  2CHW A;  3JSV A;  3PRM B;  3P2B A;  3KUZ A;  4MM3 A;  3VTW A;  5G2N A;  3KVF B;  1WM3 A;  4FLH A;  1YJ1 A;  1ISN A;  1AAR A;  3H9D A;  3RUL A;  2Z0E B;  4FBJ B;  1WE6 A;  4EOY A;  5JH5 C;  1GUA B;  4CYE A;  2ZEQ A;  4XX5 A;  1KLV A;  4AJW A;  2ZNV C;  3O65 B;  4NAW B;  3TL5 A;  2IO1 B;  2LVP A;  4IUM B;  4KIK A;  1WJU A;  4FJY A;  3MHS D;  1CMX B;  2UWQ A;  2LJ5 A;  3DBR I;  3L16 A;  3M3J A;  4P7I A;  1SIF A;  2BF8 B;  2G45 B;  2MP2 A;  2JRH A;  3A33 B;  1HE8 A;  2N9P C;  5DPW A;  2KTR A;  3EEC A;  3EFU A;  3DDC B;  1WGG A;  3H1U A;  2JZ3 B;  2VRR B;  1WGY A;  4G11 A;  3HM3 A; 
#chains in the Genus database with same CATH topology
 1QQR A;  3ZRC A;  2CS4 A;  1QKZ A;  4DBG A;  2BKF A;  3AMZ A;  1DYQ A;  3KUD B;  1V49 A;  1P1A A;  4DWF A;  4HWI B;  1CZP A;  2JT4 B;  3Q8E A;  4GDL B;  4LK0 M;  1N62 A;  2ZVO A;  4HK2 A;  3CMM B;  4XWW A;  2XBB C;  2Z8L A;  4DDG D;  3ZTC A;  4ANX A;  5EDS A;  1YD8 U;  4URK A;  2KC2 A;  2ZW1 A;  4TKN A;  3ETR A;  5JXV A;  1RYJ A;  5HG2 A;  1YJJ A;  4RM8 A;  4WJQ A;  4DQO C;  3W9C B;  4TV3 A;  2JZZ A;  2BW2 A;  4MSM B;  1UNS A;  1LM8 B;  1VZ6 A;  2JXX A;  4BBN C;  2G3Q B;  1VD2 A;  4JQW C;  3N3K B;  4A20 A;  2AYO B;  1TS5 A;  1PQS A;  4IG7 B;  2W54 A;  1BUI C;  2IY0 B;  1SE3 A;  3GE8 C;  2IO3 B;  4C00 A;  3VQI A;  4YSX B;  3VHT C;  2BT6 A;  2LVQ A;  1YQB A;  1QOB A;  2JPH A;  2BGF A;  1FXA A;  4I6N B;  5LXH A;  4N6E B;  3BYT B;  2R2Q A;  1FD6 A;  3VFK A;  4MEM A;  2N7E A;  4ZOH C;  5MPO A;  2DNF A;  2WDV B;  5JHA A;  1IPG A;  1WZ3 A;  2DAJ A;  1WX9 A;  1TY2 A;  2IY1 B;  2GBM A;  5BYR A;  2PJH A;  3QJZ A;  3K9P B;  4CQN A;  2IGH A;  3VAW A;  5LNK 1;  2BVC A;  3H7P A;  3N1Z C;  1NVI D;  4W9H A;  2WDQ B;  2X8X X;  2KQ4 X;  4L2Y A;  4HDQ A;  3BZD B;  2ZCB A;  4RF1 A;  2KDE B;  4IM3 A;  1C77 A;  1XO3 A;  2K8H A;  5E6N A;  2KVZ A;  1V80 A;  1RWS A;  4R3D A;  3ZDM C;  4B9K A;  2J52 A;  4RGO S;  1SB3 C;  1I4P A;  2PTL A;  2GRI A;  4KSK C;  1BT0 A;  3V6E B;  1ZW7 A;  2WGS A;  2JWZ A;  3VUY A;  2KTF A;  1SEB D;  4RH6 A;  2LJI A;  3E56 A;  2O6V B;  2UU7 A;  1TKE A;  1GAQ B;  2B76 B;  1K51 A;  3ZDT A;  2DYB A;  2TSS A;  2PVO D;  1IP9 A;  4HCN B;  1WWT A;  5EE0 A;  2KAJ A;  3H6N A;  3ZNI D;  1YX6 B;  2Z0D B;  3NVY A;  1LXD A;  2KNB A;  2L00 B;  2WXR A;  4MAC A;  1F52 A;  3S2A A;  2INC C;  4BZA A;  2E3T A;  4O1N A;  4HKQ A;  1AN8 A;  2LRW A;  2O6V D;  1R4N B;  1VZ8 A;  1WF9 A;  5FR3 A;  2LFI A;  1SGH A;  1KJT A;  1WSP A;  2EMS A;  2K9X A;  2DYO A;  2LMC A;  2PIA A;  4TQ0 A;  2RGF A;  1UBQ A;  5IAA C;  1UUP A;  3KUC B;  3HVZ A;  3NUH B;  2OJW A;  1WR6 E;  4A6Q A;  2LEK A;  4OHJ A;  4HPL B;  3ZXV A;  1B1Z A;  4RGM A;  1TJE A;  2IGG A;  4WWM A;  5H8Y E;  3TBL D;  5AUI A;  1K52 A;  3TUO A;  3NJT A;  3MHZ A;  1ROE A;  1TKY A;  2NCN A;  1X1M A;  2NTT A;  1P9D U;  2BYV E;  3ZNH B;  1WYG A;  2L32 A;  4AUQ C;  2WXP A;  3DBH B;  3HM6 X;  5L95 C;  4IM0 A;  2WS3 B;  1RRB A;  3QQ8 B;  2AL3 A;  3VXW A;  3VR9 B;  1Q1O A;  4K81 A;  5L83 A;  4HDO A;  3PO0 A;  3TJP A;  1WRD B;  1KFY B;  1F77 A;  3L10 B;  5DPS A;  3BIN A;  1KH0 A;  4EZK A;  1WI0 A;  5DPR A;  1M4V A;  1C78 A;  2N9E B;  3AE9 B;  4AP4 C;  5BMH A;  2N9K A;  2J7Q B;  3ZKJ C;  2RPQ A;  1EUV B;  3P4P B;  3MC0 B;  2KQS A;  2O2V A;  2IO0 B;  1UGJ A;  3RCZ A;  3MC9 A;  5D3I B;  1JCK B;  1QIL A;  2M0A A;  1FCC C;  4REZ A;  3GP7 A;  3PRP B;  4PYU A;  3TIX A;  1EWC A;  2YEP F;  4B95 A;  1XLO A;  3B1L X;  3IFW B;  1L0Y B;  3VVW B;  4J6I A;  3T3N A;  1N63 A;  2QCZ A;  4OVV A;  2I38 A;  2GB1 A;  1FRD A;  4YL8 A;  1I4Q A;  5FKA C;  2CJN A;  1I4R A;  3ZQ4 A;  3OLM D;  3R66 C;  3AEE B;  3FIL A;  3FC4 A;  2MBQ A;  1T0R C;  2K6D B;  2J0M A;  4K3C A;  2NPT A;  4K7U A;  1L2N A;  2YLM A;  2KMA A;  1Y8R C;  2ONQ A;  2IZV B;  5IKC M;  4RGN A;  1H8C A;  3Q8F A;  1C79 A;  1K8R B;  2ZZP B;  3RI7 C;  2BB5 A;  1MHH E;  1GPX A;  3GOE A;  1E7U A;  4EEW A;  3O13 A;  3MJW A;  4FUL A;  3ZVV A;  4HXD A;  2MJE A;  1ZKH A;  4TUU A;  4EFO A;  4GGQ A;  2JX5 A;  1SF0 A;  3A1Q A;  4GSW A;  4MH0 E;  1NI2 A;  3Q3F A;  1VR9 A;  1E7V A;  3LB8 C;  4AS1 A;  2Z59 B;  3WAN A;  1T6B X;  3QX1 A;  2GI9 A;  1FFU A;  5G55 A;  1C76 A;  1WZ0 A;  4XWT A;  2ASQ A;  1TS2 A;  1YQ4 B;  3IAS 1;  3T9L A;  3TCA A;  2QC8 A;  2XEW A;  4ANW A;  4GDL A;  2JYT A;  1IBX B;  1P7F A;  3X0W A;  2Y5P A;  2BS3 B;  1XXG A;  3AUL A;  2XK5 A;  4YSZ B;  3QIJ A;  2WXI A;  3B9J A;  1SJE D;  2ZW0 A;  3Q8A A;  4US9 A;  4YXD B;  1VRA B;  4LNN A;  4A55 A;  2K39 A;  2ACZ B;  2KX0 A;  2N1V A;  2M4N A;  2YVC A;  2ZPY A;  2M56 B;  4M0W B;  1DOI A;  1Z2M A;  3VRA B;  1MI0 A;  4YTP B;  1QF6 A;  4C4V A;  1YOV B;  1TYG B;  3URY A;  4FLH A;  3R8B A;  1YJ1 A;  1ISN A;  3RUL A;  1ET6 A;  5JH5 C;  1FO4 A;  2WXF A;  4XX5 A;  4NAW B;  4RNA A;  2IO1 B;  4HKZ E;  1DOY A;  4FJY A;  4P7I A;  2LJ5 A;  1FFV A;  2N9P C;  3NVZ A;  1WGG A;  1WGY A;  4G11 A;  1C3T A;  3HM3 A;  3B0A A;  1V86 A;  3AN1 A;  2KWU B;  3NRZ A;  4KZC A;  1Y56 A;  4K7W A;  1HQR D;  4LTU A;  3V05 A;  3V3X A;  4DK5 A;  2LVO A;  2MJ3 A;  2ON8 A;  3PLV A;  2OHF A;  3ZJT A;  4FJV B;  3U7D A;  5HFY A;  1FM0 D;  1PFD A;  3P4R B;  4US8 A;  2AEH A;  4PS3 A;  2IYD B;  1LQB A;  4JWU C;  1IGD A;  1D4B A;  5HKH A;  4E3C A;  2RDH A;  3ZUN A;  1TIF A;  1QZE A;  2K5P A;  1NI3 A;  1UD7 A;  2QDF A;  2NTS A;  4EKU A;  2LUE A;  2H89 B;  4B0E A;  1KRH A;  2KTR B;  1IGC A;  2Q5W D;  3QHT A;  2HJ8 A;  3WCQ A;  3U30 A;  3L13 A;  4F8C B;  1HTQ A;  1KF6 B;  3OWE B;  2VZK B;  2M8S A;  4WAA A;  1ACC A;  3LXF A;  4JWS C;  1GB4 A;  1R4M I;  2QIE B;  2W82 A;  3DHH C;  2JZP A;  4W9E A;  1WY8 A;  3J9C A;  1VDV A;  4GDK A;  1AYF A;  3RD2 A;  3HK0 A;  4WAF A;  4YTM B;  4HVB A;  1WX7 A;  1SE2 A;  1TKG A;  1EU3 A;  3IAM 1;  3PZ8 A;  4G0N B;  3DBL I;  4N58 A;  2V3N A;  3ZRF A;  4RFB A;  2HD5 B;  4KKI A;  3W5V B;  2MBH A;  4BKS A;  5EE3 A;  2VZK D;  3AE2 B;  4WWP A;  1A70 A;  2KWC A;  4MGY E;  1Q10 A;  3NZS A;  1JWM D;  2G9H D;  1CQV A;  3IXS A;  1RFA A;  1N6Z A;  1CJE A;  1JML A;  1DOX A;  5JHB A;  2K0P A;  2AWT A;  2KDB A;  1WGD A;  1RLF A;  2J0J A;  2XNA C;  3R3M A;  2L76 A;  2PE6 B;  4HPM B;  2MWS B;  4IDI A;  3ZNZ B;  2ZPN A;  2YEP B;  3L17 A;  1YJI A;  4ZHP A;  1WJN A;  4XDD A;  1XLN A;  2KLC A;  1GB1 A;  1PGB A;  4RMA A;  4M02 A;  3A9J A;  5HHD G;  1J8C A;  4DXF A;  1U4A A;  2ZCC A;  1HZ6 A;  2ZVN A;  1N5W A;  3PPA A;  3UIP B;  1XT9 B;  5H92 C;  2NBV B;  2C9W B;  1V1P B;  2G4D B;  3I57 A;  4ICV A;  4HRO A;  2BWF A;  4IC7 B;  1IYF A;  2GLS A;  1ZGU B;  2LAS A;  3A9K B;  1ZP0 B;  3LDZ E;  4HJG E;  4KGT A;  4J3O D;  2ZJD A;  1I4X A;  1E9M A;  3Q8B A;  1RAX A;  2KZR A;  3W1S C;  1E90 A;  3HUI A;  2G4S A;  2NR2 A;  2CKH B;  4F1S A;  3HHM A;  4TMA B;  2KVR A;  1WMH B;  3AE7 B;  3QC8 B;  3HVD A;  4KKJ A;  3ZYY X;  4C7Z A;  2CR5 A;  3SR6 A;  4WJN A;  2LZ6 A;  1R4M B;  3T8M A;  2FCS A;  2R61 A;  5KHQ A;  4JX1 C;  3VH3 B;  3IG3 A;  2INP E;  4WWN A;  3N20 C;  2BTE A;  3IT4 B;  1RM6 C;  4CHK A;  3MP9 A;  3NY5 A;  4LNO A;  3SU8 X;  5AZG A;  2QEJ C;  3P42 A;  4DDI D;  4NZL B;  2IPK D;  2RPV A;  4ACF A;  3DBL B;  3DWG C;  4W9J A;  2LXA A;  2CJO A;  2WXJ A;  3ZIM A;  2Y5C A;  1JQ4 A;  2D10 A;  1NYQ A;  2MSE D;  4WJP A;  3V60 A;  2LXC A;  1GJZ A;  5GXG B;  4E71 A;  4EZL A;  2WXO A;  1FNW A;  1NEN B;  1WRI A;  1SXT A;  3JW0 X;  2R2O A;  3MFG A;  3Q8C A;  5D3D A;  2M1M A;  2L83 A;  3UI3 A;  3ZLZ A;  1WE7 A;  2N0S B;  2D3A A;  5BMG A;  2RD0 A;  5BMI A;  1OGW A;  5C2T B;  2DBY A;  2FCN A;  3RZF A;  2LHD A;  1QLB B;  3KYD D;  3QAQ A;  3TEY A;  5BYQ A;  3L08 A;  4ZYS A;  4ZRJ A;  4LNK A;  4XZ4 A;  3E9S A;  3ZNG C;  1WYW B;  1L7Y A;  1EF1 A;  1IBX A;  1FRR A;  3RNE C;  2WXN A;  4PK1 A;  2FUH B;  4WQM A;  1TT5 B;  3AEG B;  3DOW A;  3PGE A;  2KWV B;  4ZYN A;  1DGJ A;  2FIF A;  1V81 A;  3U8Z A;  2BYF A;  1HXY D;  2W3R A;  3EC8 A;  3RNF C;  4M0W A;  2WXL A;  2RDG A;  1CK1 A;  5FR6 A;  2L1A A;  3BII D;  3MC8 A;  5D94 A;  2N4F A;  3RN9 C;  4JGH B;  2FBW B;  3PZD A;  2HTM E;  4NAW A;  1OTR B;  1SIJ A;  4EZJ A;  4GLS C;  1MJD A;  1FCL A;  4NAM A;  3H8H A;  3ECI A;  1T3Q A;  1L6U A;  4II3 B;  2C7M B;  2KK8 A;  1XEE A;  5E6P A;  5CHW A;  3BVM A;  4B6W A;  2J4X A;  3AB5 A;  2KAN A;  2LD9 A;  5KHO A;  2LWP A;  1JAL A;  3R7Q A;  1EM7 A;  3B2F A;  1F0Z A;  5CX3 A;  2MW5 A;  5JZE B;  1FPY A;  5EE1 A;  5DPT A;  2KC1 A;  2BYE A;  3PHX B;  4FJZ A;  5D7G A;  3BVZ A;  3P1M A;  3PV1 A;  2KXJ A;  3EUB 2;  1OEY A;  2RDB C;  2RSU A;  1WH3 A;  1WR1 A;  2WXK A;  4L23 A;  4RF0 A;  3WA0 A;  2MHJ A;  1E8W A;  3JSV A;  3P2B A;  1XF5 L;  3KUZ A;  3VTW A;  3EGR A;  3KVF B;  3DHG C;  3H9D A;  3RPF C;  4EOY A;  3ZXR A;  4XE0 A;  1ZPS A;  3Q3N C;  1I4G A;  3Q3O C;  4K3B A;  5I4D A;  4IUM B;  4XYC A;  1R7S A;  2UWQ A;  3M3J A;  3CIR B;  2JRH A;  3A33 B;  1HE8 A;  3P4S B;  3AEA B;  2KTR A;  5DPW A;  3EFU A;  3H1U A;  2PKO A;  2WQY B;  3P63 A;  1J7A A;  1VJK A;  4LNI A;  3IBE A;  1JW9 D;  1WFY A;  2WXG A;  2FUG 1;  3L4P A;  2XN9 C;  1FMA D;  1WGR A;  3Q2A C;  1OQY A;  3KH0 A;  3KWL A;  3RNB C;  3B08 A;  1GG3 A;  4EE2 A;  2M0X A;  4FA6 A;  2I1J A;  1WXM A;  3WAL A;  3WIM A;  4C56 C;  1UZX B;  4ZRP A;  1KM7 A;  4MGZ E;  4JIO U;  4MGI E;  4XDC A;  2K25 A;  2BQQ A;  3AXC A;  1XCQ L;  1AWD A;  3U2S C;  4ANV A;  3MTN B;  2BKR B;  1V5O A;  3FAH A;  2WU2 B;  1FXI A;  3SD5 A;  3U7Z A;  3VR8 B;  2WWZ A;  4GU2 A;  1TBE A;  4PS7 A;  3QK0 A;  2AQ1 B;  2H88 B;  5BO4 B;  3U4E G;  4ZHO A;  3ZGZ A;  2REX A;  1FNU A;  4KIK B;  2N7J A;  4WQO B;  1TZ1 A;  1BML C;  4YWG G;  1MPE A;  3Q3J A;  5C1Z A;  3IVF A;  2KT7 A;  4WJO A;  1YIW A;  1WGK A;  3LJ3 A;  3VDZ A;  4JE3 B;  3UF8 A;  1YN5 A;  3ZJU A;  2MJD A;  4XC2 A;  3P4Q B;  3N1Y C;  3BYY B;  4DXA B;  1WM2 A;  3ZJV A;  1WXV A;  1SE9 A;  2DZJ A;  1JRO A;  4WH4 A;  2C7N B;  1EO6 A;  2FE8 A;  1HA5 A;  2KN4 A;  1WX8 A;  2PPH A;  4MJS B;  2KHW B;  1B9R A;  1V1P A;  1I35 A;  3SHQ A;  4X57 B;  2K1F A;  1D6E C;  2INN E;  3PSE B;  4W9D A;  1SE4 A;  1V1O A;  2BYT A;  3A9K A;  1E8Z A;  4LDT B;  4I6L B;  3VUW A;  3SFD B;  1YN3 A;  2V1Y A;  3R2T A;  1JRP A;  1YNT E;  1J7B A;  3IHP C;  2HJ1 A;  1J19 A;  3ONS A;  2L0T A;  4TQ1 A;  4S0R A;  1EWY C;  3X23 A;  1FEH A;  5IA7 A;  2WDT B;  3GZN I;  3KWV A;  4P1B C;  1WMH A;  4A90 A;  5C23 A;  1F9J A;  5AZH A;  2MEK A;  5DCN A;  4AJY B;  4D2K A;  4IWO A;  1WXA A;  4H2A A;  5AUK A;  3RMK C;  4GN1 A;  1PGX A;  2IND C;  2QSD A;  1C4A A;  1V6E A;  2SAK A;  3AED B;  4LDT D;  2JY6 A;  1F2R I;  2CU1 A;  3N32 A;  2L8J A;  3PLU A;  3JVZ X;  4BBN F;  3IT6 B;  4JLC A;  2W9N A;  4AOF A;  5EE9 A;  4HEA 1;  1ET9 A;  4NQK E;  2JYE A;  3MJ5 A;  2JF5 A;  3NS8 A;  4P1C C;  2EKI A;  4LJP B;  4KDI C;  2KOX A;  4OVU A;  2V4L A;  1WJ4 A;  2D07 B;  2MBE A;  4OZC A;  3AE6 B;  3AH7 A;  3OJ4 B;  3APC A;  1N61 A;  3LYY A;  3KLS X;  2DZM A;  1TS4 A;  2KWD A;  4AQ7 A;  1OEY J;  4DXG A;  1GOZ A;  1I42 A;  2O2V B;  4ARC A;  5C3J B;  1SBB B;  1VCB A;  4NQL B;  1PDX A;  2O6V A;  2I1K A;  5HI1 A;  1UEL A;  4PYZ A;  3Q14 C;  2D2Q A;  2C7H A;  4BAX A;  4A3P A;  1QT9 A;  1XLQ A;  1F1H A;  3ML8 A;  4HCP B;  4C7Y A;  2GBN A;  2DHZ A;  2DYM A;  2MH7 A;  4HPP A;  3TSS A;  4GIV A;  2KMC A;  2MX2 A;  2FCM A;  3AEC B;  2KJ6 A;  3I63 C;  3Q3M C;  3AE8 B;  3FKY A;  1MHX A;  2EKE C;  3RZW C;  1ZOY B;  2FAZ A;  4DHZ B;  1G6J A;  1T0Q C;  2JRI B;  1YQ3 B;  3QCA A;  3WAP A;  3W1S A;  2D11 A;  2QJL A;  2L7R A;  2LHE A;  2K8B A;  2K22 A;  1TGZ B;  4OZB A;  2MRP A;  1V2Y A;  3Q6B A;  2PVG C;  1LO5 D;  2J53 A;  4P16 A;  1TZO A;  1D5Z C;  1STE A;  1H4R A;  2LUM A;  1IUE A;  1NBF C;  2DAF A;  2WU5 B;  2UYZ B;  4GXB A;  5IP4 D;  2LGS A;  4YT0 B;  1UBI A;  3V62 A;  4JL9 A;  1JWS D;  3AE1 B;  1P7E A;  1V9J A;  3A1Q B;  2BS4 B;  4S17 A;  3UIN B;  1KOT A;  2KMM A;  2WX0 A;  4LNF A;  4M00 A;  4OZA A;  1T0Y A;  3HRD D;  5J18 A;  3W1Y A;  1ZE3 D;  1P0R A;  3K9O B;  4PS8 A;  2LRU A;  3M62 B;  1MG8 A;  3ZW3 A;  1L0V B;  3NZ3 A;  2NBW B;  3QWZ B;  1E10 A;  4FXC A;  2KFK B;  1WJ6 A;  4IM2 A;  4W9I A;  1TY0 A;  2KJR A;  5AZF A;  3SEB A;  1OQQ A;  1E7P B;  2KD0 A;  5IO9 A;  2XK5 B;  3TMP B;  3AI5 A;  2KDF B;  3OAW A;  4HRS A;  4PT5 A;  5CTR C;  3TEX A;  3BVG A;  4MDK E;  2JWU A;  1S1Q B;  4HLE A;  4C4V B;  1UGM A;  1R4N I;  5LLI A;  2N9X A;  1XD3 B;  4NJ6 A;  4ARI A;  4CO7 A;  1EF5 A;  2GBJ A;  3JYU A;  3DWM A;  1JWB D;  4BVU C;  2J0K A;  2RMM A;  3APD A;  3OJ3 A;  2QHO A;  1L4D B;  3NHE B;  1Q0W B;  1ZXI A;  4N59 A;  4A8X C;  2M17 A;  3DCG A;  1TTN A;  4N9F 4;  2NVU I;  3VTU A;  3AU4 A;  2D3G A;  4NJ7 A;  4KX6 B;  3C8Y A;  3M63 B;  3UQA A;  3I3T B;  5G5G A;  1V5T A;  3BK2 A;  3DBH I;  4EUT A;  4GMV A;  4FN2 A;  1C4P A;  2WHI A;  2WXM A;  1C4C A;  1K53 A;  3RNG C;  2IO2 B;  5CHV C;  4GOC A;  1XLP A;  2WLB A;  2CHW A;  1BXT A;  3B2G A;  1V97 A;  1WM3 A;  4FBJ B;  1HZ5 A;  1WXQ A;  3N1X C;  2ZEQ A;  2ZNV C;  2KAC A;  1QOG A;  2LVP A;  1ZUD 2;  4KIK A;  1WJU A;  1CMX B;  3DBR I;  3L16 A;  1L0X B;  1SIF A;  2KYW A;  1I4H A;  2JSV X;  4C80 A;  2JZ3 B;  2VRR B;  4ZDV A;  5BYS A;  4ANU A;  3APF A;  1MFW A;  2V3S A;  3RFZ B;  2AL6 A;  1N5X A;  3AM9 A;  4QAY A;  3A4S C;  3DVN V;  4RCO A;  2FNJ B;  3U52 E;  2V3P A;  1XQQ A;  2N1W A;  4NNJ B;  3PRZ A;  4W9F A;  3C19 A;  4UDU C;  2K3U A;  2PE9 A;  3DQV A;  1HTO A;  2VH1 A;  2GBK A;  4W9L A;  1EU4 A;  1I7H A;  4MJS A;  3TEW A;  2L05 A;  1A5R A;  3KQ4 A;  3BY4 B;  4GDK B;  5J17 A;  2AQ2 B;  2X38 A;  2KFJ A;  4P6V F;  2MCN B;  2PEA A;  4MM3 B;  2N7D A;  4MSQ B;  4ZRK A;  4MGK E;  4M8M A;  2FCQ A;  4BOS C;  4NPN A;  5D2M B;  2WP9 B;  1MG4 A;  3AEF B;  1N60 A;  2WDR B;  2MP2 B;  3TEZ A;  1E5W A;  3ZTD A;  4II2 B;  2L0F A;  4IWP A;  4ITK A;  3C0R B;  3V61 A;  3ZO5 B;  3I5J C;  4DHZ E;  3R2I A;  1D3Z A;  3VUX A;  2LGX A;  3NS1 A;  3KYC D;  2GOW A;  4NJC A;  4E74 A;  4BKS D;  3D32 A;  4KZ0 A;  2W3S A;  3VTV A;  1D5M C;  2D3B A;  2NS5 A;  2PLP A;  3BK1 A;  1D5X C;  5FK9 C;  2IDY A;  3DHI C;  4FHK A;  3A9J B;  3WAO A;  1WGH A;  1GC7 A;  2LGD A;  2ZNV B;  2WX1 A;  2G1E A;  2BBC A;  4G3X B;  1ESF A;  2IBI B;  2WNM A;  2KQ7 A;  2Y5B B;  2KKC A;  3DBR B;  1ZXH A;  2LGY A;  3VH4 B;  2V0G A;  3T3O A;  1JRU A;  2M19 A;  2JVC A;  3N30 A;  1NDD A;  1E6E B;  2A5U A;  1OFF A;  1PYW D;  2AQ3 B;  4IW0 A;  3NVV A;  4A3O A;  1UH6 A;  2CHZ A;  1Q5W B;  1L4Z B;  3OG5 A;  3EA6 A;  3NZU A;  3PT2 B;  3UQB A;  3CF6 E;  1VLB A;  4I6P A;  2DLB A;  1FNV A;  2HDE A;  4BOZ B;  2OED A;  3BWU D;  3RNC C;  3W2D A;  2FID A;  4YSY B;  4F7Z A;  3DVN U;  2SEB D;  4WUR A;  2E6X A;  3CSF A;  3NVW A;  4W9G A;  1JWU D;  3PS6 A;  1WXS A;  4RM9 A;  2K8C A;  1QOA A;  1JWA D;  2MA9 B;  3Q69 A;  5GMV A;  1P3Q U;  2J42 A;  1C1Y B;  1K50 A;  2L3Z A;  3AU5 A;  3QA8 A;  3EFC A;  2DEN B;  1J0G A;  3AEB B;  3HIZ A;  3H7P B;  4YTN B;  1V8C A;  3PHW B;  4BKT A;  2OOB B;  4K1R B;  3CWI A;  3UIO B;  4RGT A;  2MBO A;  4ICU A;  4WWO A;  3PTF C;  1ENF A;  3PZ7 A;  2IJ0 A;  5LXI B;  4M8N A;  3DVG X;  2KX3 A;  2A4Z A;  2JUO A;  1PUT A;  4ASW C;  1C9F A;  3RYT A;  2JQR B;  1L5P A;  2AX5 A;  2D3C A;  4WIP A;  3RUI B;  2W55 A;  5TR5 A;  2KJH B;  3PRE A;  3SDL C;  2KDM A;  3KW5 B;  4KV2 A;  2GMI C;  4USA A;  3NG0 A;  4FHJ A;  4KDL B;  2PMV A;  4LCD E;  3NOB A;  3SFE B;  2WYQ A;  2KFK A;  2DWQ A;  1LFD A;  2BPS A;  3DBS A;  5E6J A;  1E8X A;  2EMT A;  1FIQ A;  2CHX A;  4M01 A;  2L52 A;  3R7R A;  1UF0 A;  1J7C A;  1SJH D;  2HE7 A;  3L0W B;  3L54 A;  5AEK B;  3RT3 B;  3PVL A;  1GC6 A;  1PGA A;  2B3A A;  1VZ7 A;  2LI5 A;  3GE3 C;  2ICI A;  2IGD A;  4G50 A;  5CHF A;  1UWM A;  3H7S A;  1HEZ E;  2MBB B;  1KLU D;  1NEK B;  3N9Y C;  3ALB A;  4A9A A;  4ZRQ A;  1OQR A;  3AE3 B;  1FXT B;  1E0Z A;  2C5L C;  2DZK A;  1UWX A;  2MQJ A;  1MVK A;  2NBU A;  4IOI E;  2DZI A;  4NY0 A;  1M94 A;  3AE4 B;  2RR9 A;  2DX5 B;  3DPD A;  2WXQ A;  3RNA C;  3M95 A;  4GB9 A;  4KSL C;  2EEL A;  3CST A;  5G5H A;  4K7S A;  2OJR A;  1F2R C;  1TS3 A;  3W5U B;  4OVZ A;  1SSN A;  2GBR A;  3V6C B;  2PW9 A;  1Z5S B;  2CU3 A;  1YN4 A;  3GS2 A;  3AV8 A;  4LJO B;  2QMT A;  4BKG A;  2KDI A;  2KN5 A;  2V4I B;  1YMH E;  1E8Y A;  1T5X D;  2D5G A;  4Q2J A;  2BWE S;  4FAD A;  3UGB B;  1AW7 A;  2C60 A;  2KLG A;  5D6J B;  3ABV B;  2V9H A;  3ENE A;  1YX5 B;  2BB6 A;  4KVG B;  1GNU A;  3GB1 A;  5IN7 A;  3JSV B;  2Y3A A;  1XCT L;  4L1B A;  2JXT A;  1P98 A;  1KTK A;  5IOI A;  4JPS A;  4DHJ B;  4MT5 A;  4MH8 A;  5E6O A;  1QOF A;  3AE5 B;  3EHV A;  2HTH A;  4IKG A;  4W9K A;  3A4R A;  3ML9 A;  2VH2 A;  3WAM A;  1S3S G;  3DVG Y;  4HJK A;  2LGI A;  1L6V A;  1WIA A;  1ZDV A;  2NMQ A;  4TSS A;  3QAR A;  2BS2 B;  4IWQ A;  4AWJ A;  4MEL A;  2I2Y A;  4KGR A;  3FIL B;  2K6Q A;  3VRB B;  2NPT B;  2MLB A;  4DHJ D;  2N9L A;  1NYR A;  3I9V 1;  4W9C A;  1T0S C;  3GZN B;  5J2R A;  2KO3 A;  4BFR A;  3PRM B;  4MM3 A;  5G2N A;  4LLG M;  1AAR A;  2Z0E B;  1WE6 A;  1GUA B;  4CYE A;  5T8I A;  1ZDX A;  2QIL A;  1KLV A;  4AJW A;  3O65 B;  3TL5 A;  4ZRI A;  3MHS D;  2BF8 B;  1KLG D;  2G45 B;  2MP2 A;  2JU6 X;  4OW0 A;  2WXH A;  1RFK A;  1LGR A;  4XGA B;  3EEC A;  4B0M A;  4KGS A;  5TSS A;  3DDC B; 
#chains in the Genus database with same CATH homology
 4ZDV A;  4ANU A;  3B0A A;  1V86 A;  3ZRC A;  2CS4 A;  3APF A;  2KWU B;  3IBE A;  4DBG A;  2V3S A;  2AL6 A;  4KZC A;  3A4S C;  1WFY A;  3DVN V;  2BKF A;  2FNJ B;  4K7W A;  1WGR A;  3KUD B;  1XQQ A;  2N1W A;  4NNJ B;  1V49 A;  1P1A A;  3PRZ A;  4W9F A;  4DWF A;  4HWI B;  1OQY A;  2JT4 B;  4DK5 A;  2LVO A;  3KH0 A;  4GDL B;  2PE9 A;  3DQV A;  3PLV A;  2GBK A;  2ZVO A;  1GG3 A;  3B08 A;  4HK2 A;  4W9L A;  4FJV B;  3U7D A;  3CMM B;  2M0X A;  4FA6 A;  4MJS A;  2XBB C;  4DDG D;  2I1J A;  3ZTC A;  4ANX A;  1WXM A;  5EDS A;  1YD8 U;  3WAL A;  4URK A;  2KC2 A;  2L05 A;  2AEH A;  3WIM A;  4TKN A;  1A5R A;  4PS3 A;  2IYD B;  1UZX B;  1LQB A;  1KM7 A;  3BY4 B;  4GDK B;  4MGZ E;  4RM8 A;  4JIO U;  4MGI E;  2K25 A;  3AXC A;  4WJQ A;  5J17 A;  4TV3 A;  4ANV A;  3MTN B;  4E3C A;  2BKR B;  2JZZ A;  5HKH A;  1V5O A;  2KFJ A;  4MSM B;  3SD5 A;  1LM8 B;  2JXX A;  2MCN B;  4BBN C;  3ZUN A;  2G3Q B;  1VD2 A;  2WWZ A;  4JQW C;  3N3K B;  4GU2 A;  2PEA A;  4A20 A;  1QZE A;  2AYO B;  1PQS A;  2N7D A;  4IG7 B;  1TBE A;  4PS7 A;  4MSQ B;  4ZRK A;  2IY0 B;  3QK0 A;  4M8M A;  2FCQ A;  4MGK E;  4BOS C;  4NPN A;  1UD7 A;  5BO4 B;  2IO3 B;  3VQI A;  5D2M B;  2REX A;  4KIK B;  2LVQ A;  4WQO B;  1YQB A;  3VHT C;  2LUE A;  4EKU A;  2JPH A;  2BGF A;  1TZ1 A;  4I6N B;  2MP2 B;  1E5W A;  3ZTD A;  4II2 B;  2KTR B;  2L0F A;  3QHT A;  5LXH A;  3Q3J A;  4IWP A;  2HJ8 A;  5C1Z A;  3C0R B;  4F8C B;  3IVF A;  3L13 A;  3U30 A;  2R2Q A;  4WJO A;  1YIW A;  3VFK A;  3V61 A;  3LJ3 A;  3VDZ A;  4MEM A;  3ZO5 B;  2N7E A;  4DHZ E;  3UF8 A;  5JHA A;  3VUX A;  1D3Z A;  2LGX A;  4XC2 A;  1IPG A;  2M8S A;  3KYC D;  4WAA A;  4DXA B;  1WM2 A;  2GOW A;  4E74 A;  1WZ3 A;  2DAJ A;  1WX9 A;  4BKS D;  1WXV A;  1R4M I;  3D32 A;  2IY1 B;  2GBM A;  4KZ0 A;  4W9E A;  1SE9 A;  3VTV A;  1WY8 A;  2DZJ A;  2NS5 A;  2C7N B;  2PJH A;  1EO6 A;  3QJZ A;  3K9P B;  4GDK A;  3RD2 A;  1WX8 A;  3VAW A;  3HK0 A;  2PPH A;  4MJS B;  4HVB A;  2KHW B;  4FHK A;  1WX7 A;  3A9J B;  3H7P A;  3WAO A;  1WGH A;  1GC7 A;  2LGD A;  4X57 B;  3SHQ A;  1I35 A;  2ZNV B;  2WX1 A;  2K1F A;  4G3X B;  4G0N B;  2IBI B;  3DBL I;  3ZRF A;  3PSE B;  4W9D A;  2HD5 B;  2KQ7 A;  2Y5B B;  3A9K A;  2KKC A;  1E8Z A;  4LDT B;  4I6L B;  2MBH A;  4W9H A;  3VUW A;  4BKS A;  1C3T A;  2V1Y A;  4HDQ A;  2LGY A;  2ZCB A;  4WWP A;  3VH4 B;  2KWC A;  4MGY E;  3IHP C;  2KDE B;  1JRU A;  2JVC A;  4IM3 A;  1J19 A;  3NZS A;  2K8H A;  3ONS A;  5E6N A;  3N30 A;  2L0T A;  1NDD A;  4TQ1 A;  3X23 A;  1V80 A;  2A5U A;  5IA7 A;  2WDT B;  4IW0 A;  3ZDM C;  4B9K A;  3GZN I;  4A3O A;  1RFA A;  1UH6 A;  1Q5W B;  2CHZ A;  1WMH A;  5C23 A;  1F9J A;  5JHB A;  2AWT A;  3NZU A;  5DCN A;  2KDB A;  5AZH A;  3PT2 B;  1WGD A;  4KSK C;  4AJY B;  1BT0 A;  3V6E B;  3UQB A;  1ZW7 A;  4IWO A;  1WXA A;  1RLF A;  2J0J A;  2JWZ A;  3CF6 E;  2KTF A;  4GN1 A;  3VUY A;  4I6P A;  1V6E A;  3R3M A;  4BOZ B;  2O6V B;  2L76 A;  2PE6 B;  4LDT D;  3ZDT A;  4HPM B;  2MWS B;  2FID A;  3ZNZ B;  4F7Z A;  2DYB A;  2JY6 A;  2ZPN A;  3DVN U;  3L17 A;  2CU1 A;  3N32 A;  1IP9 A;  4HCN B;  2L8J A;  3CSF A;  3PLU A;  1WJN A;  3JVZ X;  4W9G A;  4BBN F;  2KLC A;  4RMA A;  4JLC A;  3PS6 A;  1WXS A;  3H6N A;  2W9N A;  4RM9 A;  3A9J A;  3ZNI D;  2K8C A;  1YX6 B;  4AOF A;  1J8C A;  2Z0D B;  1U4A A;  4NQK E;  2MA9 B;  2ZCC A;  1LXD A;  2JF5 A;  5GMV A;  2KNB A;  2ZVN A;  3NS8 A;  3PPA A;  1P3Q U;  3UIP B;  4LJP B;  1XT9 B;  2L00 B;  4KDI C;  2NBV B;  2KOX A;  1C1Y B;  2L3Z A;  3AU5 A;  3QA8 A;  4OVU A;  2V4L A;  1WJ4 A;  3S2A A;  2DEN B;  1J0G A;  2C9W B;  2D07 B;  2G4D B;  3H7P B;  3HIZ A;  2MBE A;  2O6V D;  2LRW A;  4ICV A;  2BWF A;  1WF9 A;  4IC7 B;  3OJ4 B;  3APC A;  1IYF A;  3PHW B;  4BKT A;  1SGH A;  1KJT A;  2OOB B;  4K1R B;  2EMS A;  3UIO B;  1ZGU B;  2LAS A;  2MBO A;  3A9K B;  4ICU A;  2DYO A;  4WWO A;  3PTF C;  2DZM A;  3LDZ E;  4TQ0 A;  2RGF A;  1OEY J;  1UBQ A;  2ZJD A;  5IAA C;  5LXI B;  3KUC B;  4M8N A;  3DVG X;  2KX3 A;  1RAX A;  1WR6 E;  2KZR A;  1I42 A;  2O2V B;  2A4Z A;  2JUO A;  3W1S C;  4HPL B;  1E90 A;  4ASW C;  2G4S A;  2NR2 A;  3RYT A;  1VCB A;  4NQL B;  2CKH B;  2O6V A;  4F1S A;  3HHM A;  2I1K A;  2KVR A;  1WMH B;  3TBL D;  1UEL A;  4PYZ A;  3QC8 B;  2D2Q A;  2C7H A;  2NCN A;  1X1M A;  3RUI B;  1P9D U;  4A3P A;  2CR5 A;  5TR5 A;  2BYV E;  4WJN A;  2KJH B;  3ML8 A;  2LZ6 A;  3PRE A;  3SDL C;  4HCP B;  3T8M A;  3ZNH B;  2FCS A;  4AUQ C;  2GBN A;  3HM6 X;  5KHQ A;  2DHZ A;  3VH3 B;  3KW5 B;  2DYM A;  3IG3 A;  5L95 C;  4KV2 A;  2GMI C;  4WWN A;  4IM0 A;  1RRB A;  3QQ8 B;  2AL3 A;  4FHJ A;  4KDL B;  4GIV A;  2KMC A;  4LCD E;  3VXW A;  1Q1O A;  4CHK A;  3NOB A;  3NY5 A;  2MX2 A;  4K81 A;  2FCM A;  2WYQ A;  2KFK A;  3SU8 X;  5AZG A;  1LFD A;  2BPS A;  2KJ6 A;  4HDO A;  5L83 A;  4DDI D;  3DBS A;  3TJP A;  1E8X A;  1WRD B;  2EKE C;  3RZW C;  2EMT A;  3L10 B;  5DPS A;  3BIN A;  4W9J A;  2FAZ A;  2LXA A;  2CHX A;  3ZIM A;  4DHZ B;  4EZK A;  1G6J A;  1WI0 A;  3R7R A;  2JRI B;  5DPR A;  2N9E B;  3QCA A;  4AP4 C;  2HE7 A;  3W1S A;  3WAP A;  2D11 A;  2D10 A;  3L0W B;  3L54 A;  5AEK B;  3RT3 B;  2MSE D;  3PVL A;  1GC6 A;  2L7R A;  4WJP A;  3V60 A;  2B3A A;  2J7Q B;  2K8B A;  3ZKJ C;  2LI5 A;  2LXC A;  2RPQ A;  1GJZ A;  1TGZ B;  4E71 A;  1EUV B;  4G50 A;  4EZL A;  2MRP A;  5CHF A;  1V2Y A;  2KQS A;  3H7S A;  3JW0 X;  2O2V A;  2R2O A;  2IO0 B;  2MBB B;  3RCZ A;  2M1M A;  1H4R A;  3ALB A;  1NBF C;  2DAF A;  3ZLZ A;  1WE7 A;  1FXT B;  3PRP B;  4PYU A;  2UYZ B;  3TIX A;  2RD0 A;  2C5L C;  2DZK A;  4GXB A;  4B95 A;  1OGW A;  1UBI A;  2MQJ A;  3B1L X;  3IFW B;  3VVW B;  3V62 A;  4J6I A;  2NBU A;  4JL9 A;  2DZI A;  2FCN A;  4NY0 A;  3RZF A;  1V9J A;  3A1Q B;  4OVV A;  3KYD D;  1M94 A;  3QAQ A;  3L08 A;  3UIN B;  4ZRJ A;  2RR9 A;  2DX5 B;  3DPD A;  4YL8 A;  1KOT A;  3M95 A;  4GB9 A;  4KSL C;  2WX0 A;  3CST A;  4XZ4 A;  3ZNG C;  4K7S A;  1WYW B;  1T0Y A;  2OJR A;  1L7Y A;  1EF1 A;  5J18 A;  3W1Y A;  3OLM D;  1P0R A;  3K9O B;  3R66 C;  4PS8 A;  2LRU A;  2GBR A;  3M62 B;  1MG8 A;  3ZW3 A;  3V6C B;  2NBW B;  1Z5S B;  3QWZ B;  2MBQ A;  2K6D B;  2J0M A;  2KFK B;  1WJ6 A;  2FUH B;  2NPT A;  4LJO B;  4IM2 A;  4K7U A;  4W9I A;  1L2N A;  2KJR A;  3DOW A;  2YLM A;  3PGE A;  2KWV B;  4ZYN A;  2KDI A;  2KN5 A;  5AZF A;  2FIF A;  4BKG A;  2KMA A;  1E8Y A;  1V81 A;  1Y8R C;  3U8Z A;  2KD0 A;  2BYF A;  4ZRI A;  2IZV B;  2BWE S;  3EC8 A;  2XK5 B;  3TMP B;  3AI5 A;  1H8C A;  2KDF B;  5FR6 A;  4FAD A;  3OAW A;  1K8R B;  5D94 A;  2N4F A;  2ZZP B;  4JGH B;  3UGB B;  2C60 A;  2KLG A;  5D6J B;  5CTR C;  3GOE A;  3PZD A;  1E7U A;  3ENE A;  4MDK E;  4EEW A;  1YX5 B;  3MJW A;  4FUL A;  3ZVV A;  4KVG B;  1S1Q B;  4NAW A;  1OTR B;  4EZJ A;  4HXD A;  4HLE A;  1GNU A;  1ZKH A;  3JSV B;  4TUU A;  4EFO A;  3ECI A;  4GGQ A;  4II3 B;  1R4N I;  1UGM A;  3A1Q A;  2C7M B;  4GSW A;  4MH0 E;  5LLI A;  2KK8 A;  2N9X A;  5E6P A;  1NI2 A;  1P98 A;  1XD3 B;  3Q3F A;  4NJ6 A;  5CHW A;  1E7V A;  4DHJ B;  4B6W A;  5E6O A;  4CO7 A;  1EF5 A;  2GBJ A;  3JYU A;  2Z59 B;  3WAN A;  3QX1 A;  3EHV A;  2HTH A;  5G55 A;  1WZ0 A;  2KAN A;  2LD9 A;  4W9K A;  4BVU C;  2ASQ A;  2J0K A;  3A4R A;  3ML9 A;  2LWP A;  5KHO A;  3WAM A;  3T9L A;  3APD A;  3R7Q A;  3TCA A;  1S3S G;  3DVG Y;  2XEW A;  3OJ3 A;  2QHO A;  4HJK A;  3NHE B;  4ANW A;  1WIA A;  1Q0W B;  2M17 A;  4GDL A;  3DCG A;  1TTN A;  4N9F 4;  3QAR A;  2NVU I;  5CX3 A;  2MW5 A;  4IWQ A;  5JZE B;  3VTU A;  4AWJ A;  3AU4 A;  4MEL A;  5DPT A;  3X0W A;  2KC1 A;  2BYE A;  2D3G A;  4NJ7 A;  3PHX B;  4FJZ A;  5D7G A;  3AUL A;  2XK5 A;  2K6Q A;  3M63 B;  3UQA A;  3I3T B;  2NPT B;  2MLB A;  3QIJ A;  3PV1 A;  4DHJ D;  1V5T A;  3DBH I;  2KXJ A;  1OEY A;  2K39 A;  4W9C A;  2N1V A;  2KX0 A;  2RSU A;  4EUT A;  2M4N A;  2YVC A;  4GMV A;  4FN2 A;  1WH3 A;  1WR1 A;  2ZPY A;  5J2R A;  2IO2 B;  2KO3 A;  4M0W B;  1Z2M A;  5CHV C;  4GOC A;  3WA0 A;  4BFR A;  1E8W A;  2CHW A;  3JSV A;  3PRM B;  3P2B A;  3KUZ A;  4MM3 A;  3VTW A;  5G2N A;  3KVF B;  1WM3 A;  4FLH A;  1YJ1 A;  1ISN A;  1AAR A;  3H9D A;  3RUL A;  2Z0E B;  4FBJ B;  1WE6 A;  4EOY A;  5JH5 C;  1GUA B;  4CYE A;  2ZEQ A;  4XX5 A;  1KLV A;  4AJW A;  2ZNV C;  3O65 B;  4NAW B;  3TL5 A;  2IO1 B;  2LVP A;  4IUM B;  4KIK A;  1WJU A;  4FJY A;  3MHS D;  1CMX B;  2UWQ A;  2LJ5 A;  3DBR I;  3L16 A;  3M3J A;  4P7I A;  1SIF A;  2BF8 B;  2G45 B;  2MP2 A;  2JRH A;  3A33 B;  1HE8 A;  2N9P C;  5DPW A;  2KTR A;  3EEC A;  3EFU A;  3DDC B;  1WGG A;  3H1U A;  2JZ3 B;  2VRR B;  1WGY A;  4G11 A;  3HM3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...