1WY8A

Solution structure of the n-terminal ubiquitin-like domain in human np95/icbp90-like ring finger protein (nirf)
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
89
structure length
89
Chain Sequence
GSSGSSGMWIQVRTIDGSKTCTIEDVSRKATIEELRERVWALFDVRPECQRLFYRGKQLENGYTLFDYDVGLNDIIQLLVRPDSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution Structure of the N-terminal Ubiquitin-like Domain in Human Np95/ICBP90-like Ring Finger Protein (NIRF)
rcsb
source organism Homo sapiens
molecule tags Ligase
molecule keywords Np95-like ring finger protein, isoform a
total genus 12
structure length 89
sequence length 89
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2005-02-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00240 ubiquitin Ubiquitin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 1wy8A00
1WE7A 4GN1A 2DAJA 4MELA 2FCMA 2NPTB 4W9FA 1V81A 1SE9A 2KQSA 4GSWA 5CX3A 3ZRCA 5EDSA 3WA0A 2XK5B 5LXIB 4K7SA 1J8CA 3N3KB 2ZVOA 4NJ6A 4XC2A 2JXXA 2ZZPB 4BFRA 3DCGA 4LJOB 3IFWB 4DHZE 3NOBA 3HM3A 3B1LX 2GBRA 2FNJB 2PJHA 4BVUC 4DDGD 2ZVNA 4GU2A 5AZGA 2RSUA 1WR1A 2NBWB 3ZUNA 4WJOA 2KQ7A 3QC8B 2DYBA 1ISNA 2WYQA 3K9PB 2DYOA 5LLIA 3VUYA 3K9OB 4AJWA 1WJNA 2KHWB 5E6NA 2VRRB 2DZIA 1E8YA 3ZNGC 1V86A 3DVNU 2MQJA 4NQKE 4OVUA 4AOFA 1V49A 2LVQA 3PSEB 3WALA 2PEAA 4ANXA 3AU4A 3ZRFA 2OJRA 3KH0A 3M63B 5GMVA 3V61A 1WX7A 1WXVA 4AJYB 5AZFA 2L0TA 3H6NA 2LD9A 4NNJB 5G55A 4FN2A 3ZW3A 2NVUI 4ZDVA 2JZ3B 2O6VD 1LXDA 5DPTA 3WIMA 2D07B 2BYEA 3BINA 2RGFA 4MGYE 4F1SA 2M1MA 1WGGA 3V62A 1UH6A 4IM3A 4IG7B 2R2OA 1CMXB 2KWVB 3JVZX 4TUUA 4B9KA 4J6IA 4TV3A 4W9KA 2C60A 4E71A 4IM2A 3PHWB 1C1YB 1HE8A 3M62B 2GBKA 4BKTA 4MSMB 2FCQA 2MP2A 2L3ZA 2DYMA 4GOCA 1R4MI 2GOWA 2UWQA 4II3B 4WWPA 3ZNID 2LI5A 2KD0A 3DBLI 4RM9A 2MBQA 2REXA 5C23A 4EZJA 2JF5A 3RZFA 1V5OA 2KO3A 4HPMB 4WJNA 4K7UA 3HHMA 2FCSA 2KFKB 3TCAA 2MCNB 1I35A 2C5LC 3UIOB 3V60A 2KJ6A 2L0FA 3RD2A 3ZIMA 3JSVA 2KWCA 2GBNA 3X0WA 1E8ZA 1PQSA 1UD7A 2RD0A 3ONSA 5CHVC 5BO4B 4WWNA 4EZLA 2LRWA 2UYZB 2KJHB 4I6LB 5LXHA 4EUTA 3B0AA 3A1QA 3RYTA 5J17A 4PS7A 2JVCA 5IAAC 3AXCA 3ZVVA 2KLGA 5E6OA 2YLMA 3S2AA 4KDLB 4NAWB 3R7QA 1AARA 4E74A 4MH0E 3DBSA 2C7NB 4JL9A 4HDOA 1P1AA 2CKHB 3AU5A 4WJPA 3DVGY 4GMVA 2PE9A 4CYEA 2KOXA 3AI5A 4DHJD 1E7VA 4JIOU 3MTNB 3H7PB 2FIFA 3UIPB 3VH4B 2ZPYA 2XEWA 1BT0A 3AULA 3JW0X 1H8CA 1OEYJ 5AZHA 3QIJA 1GC7A 2KZRA 3PLVA 3IBEA 3UQBA 1WZ0A 2A4ZA 2KX0A 4XX5A 3V6EB 2Z0EB 3VQIA 3R7RA 1RAXA 2LVPA 2MWSB 1EUVB 3WAOA 1IP9A 2N7EA 3VUWA 1F9JA 2IY0B 3VXWA 1KJTA 1EF1A 3T8MA 3WAMA 4FJYA 4WJQA 2K6DB 1WGRA 1S3SG 4BBNC 2BGFA 1YIWA 2JY6A 3CSFA 4N9F4 4GDLA 3VFKA 4KDIC 2NCNA 1P3QU 4W9LA 4ASWC 3UQAA 3A4RA 1XD3B 4FHKA 2EMSA 2Y5BB 4HK2A 1WGDA 3APCA 4IUMB 4LCDE 2KWUB 3R3MA 4W9CA 3QJZA 2M17A 2MRPA 1UBQA 2DENB 4W9IA 4B6WA 4W9HA 2G4SA 3SD5A 1GJZA 3A9KA 2IO3B 3GOEA 3ML8A 1IYFA 1EF5A 3KUCB 5L95C 2KK8A 4M8MA 3QWZB 3ZTCA 3PRZA 1Z2MA 5KHQA 2CS4A 4G11A 5L83A 1IPGA 3VUXA 2PE6B 3DPDA 2KFKA 5DPRA 1NDDA 2N7DA 4JQWC 3APDA 3VVWB 4HPLB 1GUAB 4KSLC 2KNBA 2KC1A 1ZGUB 4RM8A 3HM6X 3PTFC 2NPTA 3L17A 5D6JB 4LDTD 2KDEB 2D2QA 2GBMA 4ZYNA 2L7RA 3D32A 3PPAA 4X57B 2DZKA 1WXMA 5G2NA 3H1UA 3IHPC 2FIDA 2KTRA 1Y8RC 2GMIC 3M95A 4FHJA 3A9JA 2AL3A 2BF8B 3A4SC 3PT2B 4KVGB 3SHQA 2BYVE 2N9EB 3Q3JA 4FJZA 4IC7B 1RRBA 1WGYA 3RT3B 4ICVA 1E5WA 1E8XA 1S1QB 4MSQB 1RLFA 2BKRB 2DZJA 1WM3A 4MJSB 3P2BA 2QHOA 1R4NI 1WH3A 3U30A 2LGYA 2LASA 1OEYA 2CU1A 4EZKA 4F7ZA 3EC8A 2D11A 5HKHA 3OLMD 2G4DB 3H7SA 2LWPA 3QX1A 3TBLD 2IZVB 4B95A 1XQQA 1V5TA 1V9JA 2DX5B 4BKGA 1WMHA 2O2VA 4AUQC 1TTNA 3DVNV 3PREA 3PS6A 4FULA 2C7MB 3UGBB 2ASQA 2K1FA 4URKA 2N9PC 2IO2B 3A9KB 3O65B 1WIAA 2KLCA 1J0GA 1WJ4A 3N32A 2L8JA 3VDZA 3MHSD 1WM2A 1OQYA 3QAQA 5JHAA 4JLCA 2KDBA 2KDFB 2M8SA 3KUZA 3PGEA 4GB9A 4IWOA 4KIKB 2D10A 3KYCD 2W9NA 2MP2B 1V2YA 1GC6A 4IM0A 1JRUA 1NI2A 3DBRI 2EKEC 2BKFA 2LVOA 3L54A 4IW0A 3LDZE 3OJ3A 3A9JB 2MBHA 4JGHB 1WY8A 2WDTB 2AYOB 5AEKB 1WI0A 2NBUA 4EKUA 3HK0A 2Z59B 3H7PA 2LGXA 1FXTB 5D94A 2MX2A 1RFAA 4MJSA 4W9DA 5IA7A 2J0MA 2NS5A 1QZEA 3ZTDA 4EFOA 2HTHA 2KVRA 4AP4C 5JZEB 4II2B 3SDLC 3TIXA 3ZO5B 4KZ0A 3PLUA 1T0YA 1UGMA 1L7YA 2CHZA 2KANA 4GDKB 2G3QB 2LUEA 2LXCA 2KTFA 1XT9B 2CHXA 2B3AA 3CMMB 3KVFB 4P7IA 2K25A 2KMCA 2JT4B 3A1QB 4FADA 3B08A 2XBBC 2ZCCA 3EHVA 3IG3A 4NAWA 4A3PA 5JHBA 3KYDD 2MA9B 1GG3A 4PS8A 1C3TA 3MJWA 4CHKA 4MDKE 3W1YA 4LDTB 3W1SA 1GNUA 3ZKJC 3PHXB 2KXJA 2KN5A 3U8ZA 4EOYA 5CHFA 3A33B 2I1JA 2EMTA 1NBFC 3NZSA 2K39A 3GZNI 2RR9A 2G45B 3BY4B 2O6VA 4DBGA 4CO7A 1E8WA 2IO1B 4BOZB 3L0WB 2MSED 2NR2A 2JZZA 4ANWA 3LJ3A 5DCNA 2XK5A 2HJ8A 1WR6E 2ZCBA 1VCBA 3ALBA 4G50A 4DHJB 1Z5SB 2A5UA 2WWZA 3QHTA 4IWPA 4ANVA 3SU8X 2K6QA 2J0JA 3NZUA 4HXDA 3ENEA 3L16A 4GGQA 4OVVA 4ZRKA 4MM3A 1WRDB 1WX9A 2KC2A 1EO6A 4HDQA 1WXAA 3RUIB 2RPQA 2ZPNA 4W9GA 2BWFA 3IVFA 5TR5A 5CHWA 4A20A 1VD2A 2J0KA 4NPNA 3APFA 4FA6A 4KZCA 2C7HA 3UINB 3VTVA 2MBBB 4DWFA 5D7GA 3C0RB 3V6CB 3OAWA 1P98A 3TMPB 3CF6E 2L00B 3KW5B 2K8BA 4A3OA 1UZXB 2M4NA 4BKSD 4PS3A 3WAPA 1WJ6A 3PV1A 4FJVB 2ZNVB 1WYWB 4BKSA 4DXAB 2DAFA 2LXAA 3TL5A 1ZKHA 2BYFA 2M0XA 1A5RA 1Q0WB 2AL6A 3PRMB 1WE6A 4NY0A 1LFDA 4WQOB 3ML9A 2I1KA 1WX8A 3Q3FA 4W9EA 4W9JA 3JSVB 2JPHA 3H9DA 4I6NB 4M8NA 4EEWA 3VTUA 4XZ4A 1WFYA 3RCZA 3PRPB 4TKNA 2V1YA 3I3TB 2BPSA 3ZNHB 2JUOA 2KX3A 1YJ1A 2KTRB 4PYZA 4FBJB 3NHEB 3ZDMC 4BBNF 1U4AA 2AWTA 2DHZA 1K8RB 4K7WA 3OJ4B 2KKCA 4PYUA 1UBIA 2L76A 4I6PA 4M0WB 2JRIB 2WX1A 4KV2A 4DK5A 3DOWA 1P9DU 1YQBA 2Z0DB 4WWOA 2ZNVC 5E6PA 2N9XA 3ZDTA 2WX0A 1YX5B 1J19A 2O6VB 1WJUA 4HLEA 1LM8B 4GXBA 1I42A 3L13A 1OGWA 4NJ7A 2LJ5A 2IO0B 2MBEA 2GBJA 3HIZA 1WF9A 3ZLZA 4F8CB 4MGIE 2R2QA 4HWIB 5FR6A 1V80A 3DBHI 4E3CA 4LJPB 2OOBB 1WMHB 2O2VB 3QA8A 5J18A 2DZMA 1X1MA 4GDLB 4YL8A 1Q5WB 2ZEQA 3RULA 2JWZA 2CHWA 4HCPB 1E90A 2MBOA 2N4FA 3QARA 4MGZE 1KLVA 2K8CA 2MLBA 2HD5B 1WGHA 5JH5C 2MW5A 4GIVA 2FAZA 3ZNZB 2K8HA 3R66C 2CR5A 1LQBA 3QQ8B 4RMAA 3WANA 2V3SA 2KJRA 5D2MB 4G3XB 1UELA 3CSTA 1TZ1A 3JYUA 4MGKE 2AEHA 2D3GA 5DPWA 1G6JA 5KHOA 2IYDB 2NBVB 1Q1OA 2N1VA 2C9WB 3NS8A 3T9LA 2FCNA 5J2RA 3TJPA 4BOSC 3NY5A 2LGDA 2HE7A 1TGZB 3M3JA 1YD8U 4WAAA 1WXSA 1P0RA 3VH3B 3EECA 3U7DA 2IY1B 2FUHB 4KIKA 3W1SC 3DVGX 1V6EA 3ECIA 4FLHA 2IBIB 1H4RA 1MG8A 2BWES 2LZ6A 4ZRIA 2YVCA 3EFUA 1TBEA 1OTRB 3VHTC 4ANUA 2KFJA 2KDIA 1D3ZA 3QCAA 4NQLB 3RZWC 2V4LA 5C1ZA 4DDID 4KSKC 4K81A 1E7UA 3VAWA 4AWJA 4TQ1A 2KMAA 1WZ3A 1SGHA 2J7QB 2L05A 1ZW7A 4MEMA 4HCNB 3N30A 1SIFA 1KOTA 4TQ0A 2N1WA 3QK0A 4IWQA 4G0NB 3PZDA 3X23A 1L2NA 1YX6B 3DDCB 3L10B 2ZJDA 4ZRJA 3UF8A 5DPSA 3DQVA 3L08A 2LRUA 4K1RB 1KM7A 4HVBA 4ICUA 2JRHA 4GDKA 2PPHA 4HJKA 5CTRC 3KUDB 1M94A 4DHZB 3VTWA 3PVLA
chains in the Genus database with same CATH superfamily
2DAJA 3MC8A 2FCMA 1ET6A 1VJKA 1F2RI 2ZVOA 3Q8CA 2ZZPB 2PW9A 3DCGA 4DHZE 2KQ4X 3MJ5A 2PJHA 2ZVNA 2NBWB 3ZUNA 2KQ7A 2HDEA 1JRPA 5H8YE 5MPOA 4O1NA 4NJCA 3FC4A 4AJWA 5HG2A 4JE3B 2GB1A 1WWTA 2HTME 2LVQA 4ZRQA 2DNFA 3VR9B 4ANXA 1EWYC 3M63B 3V61A 1WXVA 4AJYB 2L0TA 3H6NA 2LD9A 5G55A 1XXGA 3ZW3A 3U2SC 3AECB 3WIMA 2BYEA 4MGYE 1J7CA 3V62A 1LO5D 4IM3A 2WLBA 3JVZX 2Y3AA 4AQ7A 3P4QB 5LNK1 2C60A 1QOFA 1VLBA 1XLOA 4IM2A 3M62B 2GBKA 3EGRA 1LGRA 1QOAA 3AEAB 2MP2A 4GOCA 1RM6C 3DHGC 2LI5A 4RM9A 2MBQA 5D3IB 1V5OA 4HPMB 2AQ3B 3HHMA 1I35A 1F1HA 3UIOB 2KJ6A 3AEDB 3RD2A 4KKJA 5CHVC 3ONSA 5BO4B 2LRWA 2UYZB 3OWEB 4EUTA 2JVCA 3ZVVA 2BS2B 2YLMA 2BTEA 4NAWB 3FKYA 4HDOA 1P1AA 2CKHB 1L6UA 3AN1A 2PE9A 4DHJD 4JIOU 2FIFA 1TJEA 2XEWA 3QIJA 3UQBA 2A4ZA 2KX0A 1WXQA 4N6EB 3VUWA 1F9JA 1SBBB 1KJTA 4XWWA 4FJYA 1WGRA 2Q5WD 3CIRB 4XDCA 4N9F4 3VFKA 2V3PA 2NCNA 1P3QU 1XD3B 3MC0B 4IUMB 3APCA 2CJNA 2KWUB 2M17A 2RDGA 2DENB 2G4SA 1GJZA 4YTPB 4CQNA 3HRDD 1IYFA 1EF5A 3KUCB 2KK8A 1YMHE 4L23A 1Z2MA 3P42A 5L83A 1IPGA 2PE6B 3DPDA 2KFKA 5DPRA 2MJDA 2BVCA 4JQWC 3O13A 3HM6X 2D2QA 2L7RA 3D32A 1KH0A 2DZKA 1DGJA 3A4SC 1M4VA 1I4QA 1AWDA 3SHQA 4FJZA 1S1QB 3Q8AA 1RLFA 1WM3A 3P2BA 1K51A 1DOYA 3U30A 1OEYA 2CU1A 5HKHA 1DYQA 2G4DB 3QX1A 4WAFA 2IZVB 1XQQA 3EUB2 1WMHA 1TTNA 2PVOD 2KLCA 1WJ4A 2L8JA 2WXQA 1WM2A 2W55A 3QAQA 1L6VA 3IXSA 2KDBA 4JLCA 4YSXB 1L0XB 2M8SA 4IWOA 4KIKB 3KYCD 2W9NA 1GC6A 4IM0A 4OZBA 1NI2A 1FO4A 1YJJA 3OJ3A 2MHJA 4JGHB 2AYOB 3NS1A 1WI0A 2XN9C 4RH6A 3H7PA 2INNE 5D94A 2MX2A 1XEEA 4MJSA 3OG5A 2NS5A 5IA7A 5TSSA 3SFEB 3ZTDA 3ZXRA 2HTHA 4ZRPA 4AP4C 4II2B 3TUOA 4KZ0A 2G3QB 1V8CA 2KTFA 1XT9B 2WDQB 2K25A 4FADA 1MVKA 3B08A 3EHVA 1B9RA 2RDHA 1ZP0B 4XE0A 2ONQA 4C7YA 4PS8A 3W1YA 4K3CA 3W1SA 2W3RA 2KXJA 1HQRD 2KN5A 1FCLA 2D5GA 2AQ1B 3Q3OC 1C4CA 3BY4B 4DBGA 1QT9A 2IO1B 3L0WB 2MSED 4ANWA 1OQRA 2IGHA 3MHZA 1JMLA 1Z5SB 3RNAC 3L16A 4LLGM 2FBWB 2KC2A 2ZPNA 2WDVB 2J52A 5HHDG 3IVFA 2RDBC 4A20A 1TS5A 3APFA 1NEKB 4DWFA 1PGBA 5D7GA 3OAWA 3Q69A 4XYCA 3TMPB 5IO9A 2E3TA 4A3OA 1UZXB 1XF5L 4PS3A 1ZUD2 2ZNVB 3BIID 3HUIA 4DXAB 2M0XA 2JQRB 4WQOB 3BVMA 2I1KA 3Q3FA 1XLPA 4W9JA 1VZ7A 4OHJA 4EEWA 3PRPB 3I3TB 1I4XA 3KWLA 4RGNA 1D5XC 2JUOA 2KX3A 4FBJB 4YWGG 3RI7C 4ZHOA 1WYGA 2KKCA 2L76A 2N9KA 2LFIA 2NTTA 2VH1A 2JRIB 1V97A 1MG4A 2LGIA 2Z0DB 5E6PA 1NVID 1J19A 4S17A 3L13A 1OGWA 4NJ7A 1JWMD 2IO0B 2JSVX 2K5PA 1WF9A 4RGTA 5FR6A 1V80A 3AEBB 2OOBB 5J18A 3AEGB 4YL8A 1SXTA 2R61A 3H8HA 2MLBA 2HD5B 4FXCA 3AMZA 2MW5A 2FAZA 3GB1A 4US8A 2V3SA 2INDC 4G3XB 1TZ1A 1C76A 1G6JA 5T8IA 4B0MA 4PK1A 2NBVB 1Q1OA 3T9LA 2AQ2B 1F52A 5FR3A 5J2RA 3M3JA 1NENB 2W54A 2IY1B 4KIKA 3W1SC 1ZDVA 5BMIA 1H4RA 3MP9A 4M02A 1PUTA 4KKIA 2YVCA 1TBEA 3GS2A 1XLQA 1ET9A 2KDIA 1I4GA 3RZWC 3AE7B 2V4LA 5C1ZA 5EE9A 1E7UA 1SGHA 4RNAA 2L05A 1FD6A 1OFFA 1ZW7A 4MEMA 4HCNB 1FRDA 2IGGA 1KOTA 3QK0A 2NTSA 4P1BC 4G0NB 4IWQA 1L2NA 1NYRA 1TZOA 2VH2A 3DDCB 4ZRJA 1K50A 3UF8A 2L32A 1MPEA 2JRHA 2PPHA 5CTRC 2QSDA 3KUDB 1YQ4B 1WE7A 1IGCA 4W9FA 1SE9A 2KQSA 3ZRCA 4RF1A 2JXXA 1GAQB 2FNJB 3TEXA 4GU2A 3T3NA 3QC8B 3B2FA 4JWSC 3AM9A 3VUYA 1UUPA 1E8YA 3ZNGC 1FRRA 3DVNU 2MQJA 4NQKE 4RFBA 4OVUA 4AOFA 1V49A 3AU4A 3ZRFA 2OJRA 3KH0A 5GMVA 1FXIA 3RNFC 3ZGZA 2YEPB 2NVUI 1NI3A 2MJEA 5DPTA 1TKGA 2M1MA 4TUUA 1VR9A 5BMGA 1C1YB 3TEWA 2OJWA 4BKTA 4MSMB 2DYMA 1SE2A 2UWQA 4II3B 2M19A 3DBLI 1T3QA 3BVZA 1F77A 3IAS1 1KFYB 3TCAA 2C5LC 1MJDA 4HRSA 1I4RA 2PVGC 3JSVA 1E9MA 1E8ZA 1UD7A 2LJIA 4WWNA 3ABVB 2B76B 4EZLA 2VZKD 4EE2A 5LXHA 2V9HA 3B0AA 3Q6BA 1YNTE 3SFDB 2I38A 4YSYB 1SE3A 2QILA 4PS7A 3RMKC 4PT5A 2QIEB 4TMAB 1GOZA 5E6OA 1C78A 3NJTA 4KDLB 4MACA 1AARA 3Q8BA 2KACA 2C7NB 4GMVA 4A9AA 3NUHB 5G5GA 3AI5A 3VRAB 3MTNB 3H7PB 1FXAA 2PMVA 3VH4B 1PFDA 1OEYJ 2L83A 5AZHA 3IBEA 1WZ0A 4XX5A 2N7JA 3VQIA 3R7RA 1ZXIA 3BYYB 2MWSB 2QC8A 1IP9A 1FNVA 2IGDA 2IY0B 1QF6A 3T8MA 4HPPA 3WAMA 4REZA 4WJQA 1YIWA 2JY6A 3CSFA 4KDIC 3RPFC 3A4RA 2Y5BB 4HK2A 1WGDA 1HZ5A 1TKEA 1T0QC 4WQMA 1BUIC 1UBQA 1HTQA 2WXGA 4W9IA 4B6WA 4W9HA 1C79A 2IO3B 4M8MA 2WXRA 1YN3A 5KHQA 1L0VB 4G11A 3VUXA 1MHHE 1NDDA 4A6QA 2G1EA 4HPLB 4KSLC 5BYQA 1IBXA 2KC1A 1ZGUB 3PTFC 3L17A 4LDTD 1HXYD 2GBMA 3U7ZA 4P1CC 2KMMA 3IHPC 4JWUC 1YN5A 2AL3A 1RFKA 3AB5A 1E5WA 2K3UA 2WXFA 4MSQB 4YT0B 2V4IB 2BKRB 3N20C 1WH3A 3RNBC 2LGYA 2D3AA 4WH4A 3EC8A 2LWPA 3AE3B 1V5TA 1V9JA 2WP9B 4A55A 3IAM1 4MH8A 5BYRA 2C7MB 3UGBB 4URKA 2D3CA 2KYWA 2Y5PA 1A70A 5JHAA 3DHIC 4P6VF 3KUZA 4GB9A 4ITKA 3MC9A 1JRUA 2BKFA 2EKEC 3L54A 3LDZE 1N63A 3A9JB 1WY8A 4EKUA 2Z59B 1FXTB 2N9LA 2J0MA 1L5PA 2EELA 5FK9C 2KVRA 5JZEB 3SDLC 3ZO5B 1L7YA 1UGMA 4GDKB 2LUEA 1DOIA 2CHXA 4M01A 3A1QB 2Y5CA 3MFGA 4A3PA 4NAWA 2MA9B 1UNSA 4L1BA 1C3TA 3MJWA 1AW7A 1GNUA 1HEZE 3AE1B 3ZKJC 3NVYA 1C77A 2PLPA 3A33B 2EMTA 3DWGC 3P1MA 3ZQ4A 2G45B 4CO7A 2LMCA 4HEA1 2J42A 3PZ8A 2JZZA 2PKOA 2V0GA 2XK5A 2BQQA 3Q2AC 4BAXA 3ALBA 1FFUA 4G50A 4DHJB 1I4PA 4ZOHC 2K9XA 3QHTA 4IWPA 4ANVA 3SU8X 2K6QA 4GGQA 3BK1A 3VR8B 1WRDB 2WU5B 1WX9A 1WXAA 4W9GA 2BWFA 1VD2A 4NPNA 4FA6A 1TS3A 1L4ZB 3LXFA 3UINB 1KF6B 3AH7A 3PV1A 4BKSA 5IKCM 2LXAA 1A5RA 2JXTA 1Q0WB 2AL6A 2W82A 3N1XC 1WE6A 1WX8A 3JSVB 4M8NA 2K0PA 1WFYA 3RCZA 2V1YA 4C56C 4ZHPA 1MFWA 3Q8EA 4BBNF 1U4AA 2DHZA 4KGRA 4A90A 1I7HA 1K53A 1T0RC 1P7EA 4KV2A 4DK5A 2JX5A 1YQBA 1EU3A 2N9XA 5H92C 2WX0A 2PTLA 4HLEA 4GXBA 1I42A 1ESFA 3W9CB 4MGIE 2R2QA 4HWIB 1WMHB 3I5JC 4HKZE 3I57A 1RYJA 4HCPB 1E90A 4MGZE 1KLVA 1SB3C 1HZ6A 4NZLB 3R66C 4RMAA 2KJRA 1UELA 3DBLB 3I63C 5I4DA 2ON8A 4ACFA 4DXGA 2KDMA 1IUEA 3TJPA 1R4MB 2I2YA 1YD8U 2JWUA 1L4DB 3EECA 3U7DA 4FLHA 3ECIA 2WXJA 4LK0M 4JX1C 3VRBB 4ANUA 1D3ZA 2MEKA 4NQLB 4DDID 2WXNA 4KSKC 4K81A 1WZ3A 4XDDA 1SIFA 4WURA 3ZXVA 2N1WA 2LHDA 3IT6B 2BB6A 1TY2A 3L10B 5DPSA 4M00A 2LRUA 3LYYA 4GDKA 3NRZA 1M94A 1GPXA 3PVLA 1GB4A 4GN1A 1V81A 3V3XA 5EDSA 4NJ6A 2BB5A 3R2IA 4BFRA 1I4HA 1UWMA 3NOBA 3HM3A 2GBRA 4BVUC 3U4EG 5AZGA 2FUG1 4WJOA 2DYBA 2X8XX 4R3DA 1ISNA 3K9PB 5LLIA 3K9OB 2KHWB 5E6NA 3TEYA 2OHFA 3AE4B 2ZW1A 1MI0A 3PSEB 4P16A 2VZKB 1WX7A 3ZJTA 1OQQA 5AZFA 4NNJB 3U52E 3TEZA 2JZ3B 1TKYA 4JPSA 2DWQA 2SEBD 2WDRB 4MM3B 4F1SA 2NMQA 2WNMA 2R2OA 1F0ZA 3BWUD 2KWVB 1SEBD 1N6ZA 3PHWB 1HE8A 4DXFA 2N0SB 1N5WA 3RN9C 1T5XD 1R4MI 2GOWA 3ZNID 4EZJA 2KD0A 3RZFA 1JROA 2KO3A 4LNKA 4WJNA 2K22A 3AEEB 4K7UA 2FCSA 1FPYA 2L0FA 3ZIMA 2KWCA 1PQSA 2RD0A 4RGOS 2KJHB 4I6LB 2MJ3A 3HVZA 3L4PA 3RYTA 2BYTA 2KAJA 3R7QA 4E74A 2IDYA 5IN7A 1WSPA 3DBSA 4JL9A 4YSZB 3AU5A 4WJPA 5AUKA 3DVGY 2LEKA 2KOXA 4IOIE 3UIPB 4M0WA 1BT0A 3AULA 3JW0X 1H8CA 1E0ZA 2KZRA 4C00A 1YQ3B 1RAXA 2LVPA 1EUVB 4USAA 5HI1A 1EF1A 2MH7A 1DOXA 4LNIA 2K6DB 4BBNC 2BBCA 3AE2B 4GDLA 4OZCA 1E10A 4WIPA 3UQAA 5C2TB 4LCDE 4W9CA 3QJZA 3PO0A 1TS4A 3A9KA 3P63A 1STEA 3GOEA 3C19A 2OEDA 5L95C 1QILA 3QWZB 2ZW0A 3CWIA 2CS4A 1T0SC 1ZE3D 3N9YC 3Q3NC 3NVVA 2N7DA 3APDA 1UWXA 3VVWB 1GUAB 2NPTA 2KDEB 3PPAA 3H1UA 4LTUA 2FIDA 3B9JA 2KTRA 4FHJA 4KVGB 2BYVE 2N9EB 3Q3JA 1RRBA 4ICVA 2J4XA 1PYWD 4A8XC 4MJSB 1R4NI 3RNEC 4F7ZA 3OLMD 3H7SA 2ICIA 2PIAA 2O2VA 3NVWA 3DVNV 3PREA 4FULA 1CZPA 2N9PC 1WIAA 3N32A 3RNGC 1OQYA 1SE4A 5EE3A 2CJOA 1JWBD 5BYSA 3PGEA 3ZJUA 2X38A 1V2YA 4C4VB 2WXLA 2LVOA 4DQOC 2JZPA 5AEKB 5E6JA 2JYTA 2GI9A 3HK0A 1TY0A 2LGXA 4YXDB 1RFAA 1F2RC 1XLNA 4J3OD 1QZEA 1TS2A 4EFOA 5EE1A 3PLUA 1T0YA 2KANA 2CHZA 2LXCA 3CMMB 2JT4B 2XBBC 3IG3A 5JHBA 3KYDD 1GG3A 1VRAB 4ZYSA 5FKAC 1PGAA 3PHXB 1ZDXA 1ACCA 4EOYA 1B1ZA 2I1JA 3NZSA 1MHXA 3GZNI 2O6VA 1E8WA 4LNNA 3P4SB 1WRIA 1V1PA 2NR2A 3E56A 3LJ3A 5DCNA 1SF0A 1WR6E 1C4PA 5BMHA 2ZCBA 2RMMA 2A5UA 2WWZA 2J0JA 4HXDA 3ENEA 4ZRKA 1XO3A 4MM3A 1PDXA 4HDQA 4OZAA 3RUIB 2RPQA 3Q14C 1K52A 1N61A 1CQVA 5CHWA 5TR5A 2IPKD 2J0KA 3KLSX 4KZCA 4KGSA 1ZPSA 2C7HA 1D4BA 2HJ1A 3V6CB 3C0RB 1E7PB 1P98A 3CF6E 1T6BX 4XWTA 3KW5B 2M4NA 4BKSD 1WJ6A 4FJVB 1WYWB 1FEHA 2DAFA 2BYFA 2FE8A 4NY0A 1LFDA 3ML9A 4RF0A 1GB1A 2JPHA 2JU6X 3AE9B 3H9DA 2D3BA 4OW0A 3ZNHB 2KTRB 4PYZA 3KQ4A 2AWTA 3BK2A 1K8RB 3OJ4B 1RWSA 2LGSA 1JWSD 1J7BA 4WWOA 2ZNVC 1YX5B 2MBEA 2GBJA 3ZLZA 2BS3B 3SR6A 2KN4A 3R2TA 2KWDA 2RPVA 3LB8C 3DBHI 2Z8LA 4YTNB 4LJPB 4E3CA 2DZMA 1X1MA 1Q5WB 2DBYA 1UF0A 2N4FA 3QARA 1ZXHA 1KRHA 1WGHA 5JH5C 4GIVA 3ZNZB 2K8HA 2CR5A 1LQBA 4HJGE 3WANA 5D2MB 2WXMA 5HFYA 3JYUA 4MGKE 4ARIA 1FCCC 5DPWA 2IYDB 2N1VA 3NS8A 2BS4B 2LGDA 1JCKB 1TGZB 2H88B 2HE7A 4NAMA 5G5HA 4WAAA 3RNCC 1WXSA 1P0RA 2FUHB 2IBIB 2BWES 4ARCA 1OTRB 3FILA 2KFJA 3NVZA 2WXIA 4AWJA 1AN8A 3B2GA 3PZDA 1EM7A 3X23A 1YX6B 3HVDA 5IP4D 3DQVA 4K1RB 4LNFA 1ENFA 4Q2JA 4DHZB 3VTWA 4HKQA 4MELA 2NPTB 5CX3A 4GSWA 3WA0A 2XK5B 5LXIB 4K7SA 1J8CA 3N3KB 4XC2A 3ZJVA 4LJOB 3IFWB 3B1LX 4DDGD 2RSUA 1WR1A 2WYQA 2DYOA 3NG0A 1ROEA 1WJNA 4LNOA 2VRRB 2DZIA 1EWCA 4QAYA 1V86A 1YN4A 3AEFB 4YTMB 4KX6B 3ETRA 3WALA 2PEAA 2KT7A 3I9V1 3J9CA 4FN2A 1TYGB 4ZDVA 2O6VD 1LXDA 2D07B 2J53A 3BINA 2RGFA 1WGGA 2WGSA 1UH6A 3N1YC 4IG7B 1CMXB 4B9KA 4KGTA 4J6IA 4TV3A 4XGAB 4W9KA 3V05A 4E71A 4B0EA 3P4RB 2FCQA 2L3ZA 5IOIA 4WWPA 1V1OA 1ZOYB 3NZ3A 1AYFA 5C23A 2REXA 1XCQL 2WHIA 2JF5A 3FAHA 1IBXB 1V1PB 1L0YB 2KFKB 2MCNB 3PZ7A 2DLBA 3V60A 2E6XA 1R4NB 2GBNA 3X0WA 2AX5A 4HROA 3Q8FA 1SSNA 3SEBA 4IKGA 2M0AA 2GLSA 3A1QA 5J17A 3R8BA 5IAAC 3AXCA 2KLGA 1C4AA 3S2AA 1KTKA 1JQ4A 4MH0E 1CJEA 4MT5A 2CU3A 4CYEA 2INCC 1E7VA 2G9HD 1C9FA 2ZPYA 3AE5B 1GC7A 3PLVA 3V6EB 2Z0EB 1D5ZC 1JW9D 3WAOA 2N7EA 1Q10A 3VXWA 3GE8C 2UU7A 1S3SG 3C8YA 4C4VA 2BGFA 3EA6A 2V3NA 1FMAD 4W9LA 1YJIA 4ASWC 5JXVA 3W2DA 4FHKA 2XNAC 2EMSA 3GE3C 3R3MA 2MRPA 3SD5A 3ML8A 3W5UB 1HA5A 3ZTCA 3PRZA 2WU2B 1FM0D 2WS3B 1N5XA 1HTOA 2KNBA 4RM8A 3AE8B 4H2AA 5D6JB 4ZYNA 4X57B 1WXMA 5G2NA 2WQYB 1Y8RC 2GMIC 2YEPF 3M95A 3PT2B 3A9JA 2BF8B 3EFCA 1D6EC 3RFZB 4IC7B 4WWMA 1WGYA 3RT3B 2WXOA 1E8XA 4L2YA 2DZJA 2QHOA 4OVZA 5GXGB 2LASA 4EZKA 2D11A 1YOVB 3TBLD 4B95A 4BKGA 3N1ZC 2DX5B 4AUQC 3PS6A 2ASQA 2K1FA 2IO2B 1WGKA 3A9KB 3O65B 1J0GA 1EU4A 3VDZA 3MHSD 2KDFB 2D10A 3FILB 3Q3MC 1BXTA 3ZYYX 2EKIA 2MP2B 3BVGA 1CK1A 3DBRI 2H89B 4IW0A 3T3OA 1FNUA 3IT4B 1VZ8A 2MBHA 5D3DA 3AE6B 2WDTB 4BZAA 1E6EB 1QLBB 2QDFA 2NBUA 2SAKA 1SIJA 1JALA 4W9DA 3DBHB 2BT6A 4GLSC 3TIXA 2M56B 1N62A 4P7IA 3KVFB 2B3AA 4C80A 2KMCA 2ZCCA 4RGMA 4C7ZA 4CHKA 4MDKE 4LDTB 3U8ZA 1J7AA 5CHFA 4RCOA 1VZ6A 1NBFC 2K39A 2RR9A 5AUIA 3DBRB 4BOZB 1JWAD 5C3JB 2HJ8A 2QEJC 1VCBA 3DWMA 2BW2A 1R7SA 3W5VB 3NZUA 2TSSA 4OVVA 2W3SA 1SJHD 2LHEA 1EO6A 2WXHA 3BZDB 1SJED 1TT5B 3GP7A 3VTVA 2MBBB 2L00B 2K8BA 3WAPA 4N59A 3TL5A 1ZKHA 4K3BA 3PRMB 4S0RA 1QKZA 4W9EA 4I6NB 3VTUA 4XZ4A 2ACZB 4TKNA 2QCZA 2BPSA 2GRIA 1JWUD 1YJ1A 1FIQA 3NHEB 3KWVA 3ZDMC 2INPE 1VDVA 2IJ0A 4K7WA 1PGXA 4PYUA 1FFVA 1UBIA 4US9A 4IDIA 4I6PA 2LUMA 1BMLC 2WXPA 4M0WB 2WX1A 3DOWA 1P9DU 3E9SA 3ZDTA 2O6VB 1WJUA 2L1AA 1LM8B 2LJ5A 3HIZA 4F8CB 2QMTA 1IGDA 5EE0A 2O2VB 3QA8A 4GDLB 1QOBA 2ZEQA 3RULA 1TIFA 2CHWA 1P7FA 2JWZA 2MBOA 3WCQA 3GZNB 2K8CA 1FNWA 1QOGA 1KLGD 2KVZA 3UI3A 3QQ8B 1XCTL 3CSTA 2AEHA 2D3GA 3URYA 5KHOA 2C9WB 1Y56A 2FCNA 4BOSC 3NY5A 4N58A 3DHHC 1NYQA 3VH3B 1N60A 4TSSA 3DVGX 1V6EA 1MG8A 2LZ6A 4ZRIA 3EFUA 3AV8A 4AS1A 3VHTC 3QCAA 3BYTB 2QJLA 3VAWA 1UGJA 2KMAA 4TQ1A 2JYEA 1D5MC 2J7QB 3N30A 4TQ0A 1KLUD 4UDUC 3P4PB 1QQRA 2ZJDA 3L08A 3TSSA 4D2KA 1KM7A 4HVBA 4ICUA 4HJKA 2WXKA 2L52A
chains in the Genus database with same CATH topology
1WE7A 4GN1A 2DAJA 4MELA 2FCMA 2NPTB 4W9FA 1V81A 1SE9A 2KQSA 4GSWA 5CX3A 3ZRCA 5EDSA 3WA0A 2XK5B 5LXIB 4K7SA 1J8CA 3N3KB 2ZVOA 4NJ6A 4XC2A 2JXXA 2ZZPB 4BFRA 3DCGA 4LJOB 3IFWB 4DHZE 3NOBA 3HM3A 3B1LX 2GBRA 2FNJB 2PJHA 4BVUC 4DDGD 2ZVNA 4GU2A 5AZGA 2RSUA 1WR1A 2NBWB 3ZUNA 4WJOA 2KQ7A 3QC8B 2DYBA 1ISNA 2WYQA 3K9PB 2DYOA 5LLIA 3VUYA 3K9OB 4AJWA 1WJNA 2KHWB 5E6NA 2VRRB 2DZIA 1E8YA 3ZNGC 1V86A 3DVNU 2MQJA 4NQKE 4OVUA 4AOFA 1V49A 2LVQA 3PSEB 3WALA 2PEAA 4ANXA 3AU4A 3ZRFA 2OJRA 3KH0A 3M63B 5GMVA 3V61A 1WX7A 1WXVA 4AJYB 5AZFA 2L0TA 3H6NA 2LD9A 4NNJB 5G55A 4FN2A 3ZW3A 2NVUI 4ZDVA 2JZ3B 2O6VD 1LXDA 5DPTA 3WIMA 2D07B 2BYEA 3BINA 2RGFA 4MGYE 4F1SA 2M1MA 1WGGA 3V62A 1UH6A 4IM3A 4IG7B 2R2OA 1CMXB 2KWVB 3JVZX 4TUUA 4B9KA 4J6IA 4TV3A 4W9KA 2C60A 4E71A 4IM2A 3PHWB 1C1YB 1HE8A 3M62B 2GBKA 4BKTA 4MSMB 2FCQA 2MP2A 2L3ZA 2DYMA 4GOCA 1R4MI 2GOWA 2UWQA 4II3B 4WWPA 3ZNID 2LI5A 2KD0A 3DBLI 4RM9A 2MBQA 2REXA 5C23A 4EZJA 2JF5A 3RZFA 1V5OA 2KO3A 4HPMB 4WJNA 4K7UA 3HHMA 2FCSA 2KFKB 3TCAA 2MCNB 1I35A 2C5LC 3UIOB 3V60A 2KJ6A 2L0FA 3RD2A 3ZIMA 3JSVA 2KWCA 2GBNA 3X0WA 1E8ZA 1PQSA 1UD7A 2RD0A 3ONSA 5CHVC 5BO4B 4WWNA 4EZLA 2LRWA 2UYZB 2KJHB 4I6LB 5LXHA 4EUTA 3B0AA 3A1QA 3RYTA 5J17A 4PS7A 2JVCA 5IAAC 3AXCA 3ZVVA 2KLGA 5E6OA 2YLMA 3S2AA 4KDLB 4NAWB 3R7QA 1AARA 4E74A 4MH0E 3DBSA 2C7NB 4JL9A 4HDOA 1P1AA 2CKHB 3AU5A 4WJPA 3DVGY 4GMVA 2PE9A 4CYEA 2KOXA 3AI5A 4DHJD 1E7VA 4JIOU 3MTNB 3H7PB 2FIFA 3UIPB 3VH4B 2ZPYA 2XEWA 1BT0A 3AULA 3JW0X 1H8CA 1OEYJ 5AZHA 3QIJA 1GC7A 2KZRA 3PLVA 3IBEA 3UQBA 1WZ0A 2A4ZA 2KX0A 4XX5A 3V6EB 2Z0EB 3VQIA 3R7RA 1RAXA 2LVPA 2MWSB 1EUVB 3WAOA 1IP9A 2N7EA 3VUWA 1F9JA 2IY0B 3VXWA 1KJTA 1EF1A 3T8MA 3WAMA 4FJYA 4WJQA 2K6DB 1WGRA 1S3SG 4BBNC 2BGFA 1YIWA 2JY6A 3CSFA 4N9F4 4GDLA 3VFKA 4KDIC 2NCNA 1P3QU 4W9LA 4ASWC 3UQAA 3A4RA 1XD3B 4FHKA 2EMSA 2Y5BB 4HK2A 1WGDA 3APCA 4IUMB 4LCDE 2KWUB 3R3MA 4W9CA 3QJZA 2M17A 2MRPA 1UBQA 2DENB 4W9IA 4B6WA 4W9HA 2G4SA 3SD5A 1GJZA 3A9KA 2IO3B 3GOEA 3ML8A 1IYFA 1EF5A 3KUCB 5L95C 2KK8A 4M8MA 3QWZB 3ZTCA 3PRZA 1Z2MA 5KHQA 2CS4A 4G11A 5L83A 1IPGA 3VUXA 2PE6B 3DPDA 2KFKA 5DPRA 1NDDA 2N7DA 4JQWC 3APDA 3VVWB 4HPLB 1GUAB 4KSLC 2KNBA 2KC1A 1ZGUB 4RM8A 3HM6X 3PTFC 2NPTA 3L17A 5D6JB 4LDTD 2KDEB 2D2QA 2GBMA 4ZYNA 2L7RA 3D32A 3PPAA 4X57B 2DZKA 1WXMA 5G2NA 3H1UA 3IHPC 2FIDA 2KTRA 1Y8RC 2GMIC 3M95A 4FHJA 3A9JA 2AL3A 2BF8B 3A4SC 3PT2B 4KVGB 3SHQA 2BYVE 2N9EB 3Q3JA 4FJZA 4IC7B 1RRBA 1WGYA 3RT3B 4ICVA 1E5WA 1E8XA 1S1QB 4MSQB 1RLFA 2BKRB 2DZJA 1WM3A 4MJSB 3P2BA 2QHOA 1R4NI 1WH3A 3U30A 2LGYA 2LASA 1OEYA 2CU1A 4EZKA 4F7ZA 3EC8A 2D11A 5HKHA 3OLMD 2G4DB 3H7SA 2LWPA 3QX1A 3TBLD 2IZVB 4B95A 1XQQA 1V5TA 1V9JA 2DX5B 4BKGA 1WMHA 2O2VA 4AUQC 1TTNA 3DVNV 3PREA 3PS6A 4FULA 2C7MB 3UGBB 2ASQA 2K1FA 4URKA 2N9PC 2IO2B 3A9KB 3O65B 1WIAA 2KLCA 1J0GA 1WJ4A 3N32A 2L8JA 3VDZA 3MHSD 1WM2A 1OQYA 3QAQA 5JHAA 4JLCA 2KDBA 2KDFB 2M8SA 3KUZA 3PGEA 4GB9A 4IWOA 4KIKB 2D10A 3KYCD 2W9NA 2MP2B 1V2YA 1GC6A 4IM0A 1JRUA 1NI2A 3DBRI 2EKEC 2BKFA 2LVOA 3L54A 4IW0A 3LDZE 3OJ3A 3A9JB 2MBHA 4JGHB 1WY8A 2WDTB 2AYOB 5AEKB 1WI0A 2NBUA 4EKUA 3HK0A 2Z59B 3H7PA 2LGXA 1FXTB 5D94A 2MX2A 1RFAA 4MJSA 4W9DA 5IA7A 2J0MA 2NS5A 1QZEA 3ZTDA 4EFOA 2HTHA 2KVRA 4AP4C 5JZEB 4II2B 3SDLC 3TIXA 3ZO5B 4KZ0A 3PLUA 1T0YA 1UGMA 1L7YA 2CHZA 2KANA 4GDKB 2G3QB 2LUEA 2LXCA 2KTFA 1XT9B 2CHXA 2B3AA 3CMMB 3KVFB 4P7IA 2K25A 2KMCA 2JT4B 3A1QB 4FADA 3B08A 2XBBC 2ZCCA 3EHVA 3IG3A 4NAWA 4A3PA 5JHBA 3KYDD 2MA9B 1GG3A 4PS8A 1C3TA 3MJWA 4CHKA 4MDKE 3W1YA 4LDTB 3W1SA 1GNUA 3ZKJC 3PHXB 2KXJA 2KN5A 3U8ZA 4EOYA 5CHFA 3A33B 2I1JA 2EMTA 1NBFC 3NZSA 2K39A 3GZNI 2RR9A 2G45B 3BY4B 2O6VA 4DBGA 4CO7A 1E8WA 2IO1B 4BOZB 3L0WB 2MSED 2NR2A 2JZZA 4ANWA 3LJ3A 5DCNA 2XK5A 2HJ8A 1WR6E 2ZCBA 1VCBA 3ALBA 4G50A 4DHJB 1Z5SB 2A5UA 2WWZA 3QHTA 4IWPA 4ANVA 3SU8X 2K6QA 2J0JA 3NZUA 4HXDA 3ENEA 3L16A 4GGQA 4OVVA 4ZRKA 4MM3A 1WRDB 1WX9A 2KC2A 1EO6A 4HDQA 1WXAA 3RUIB 2RPQA 2ZPNA 4W9GA 2BWFA 3IVFA 5TR5A 5CHWA 4A20A 1VD2A 2J0KA 4NPNA 3APFA 4FA6A 4KZCA 2C7HA 3UINB 3VTVA 2MBBB 4DWFA 5D7GA 3C0RB 3V6CB 3OAWA 1P98A 3TMPB 3CF6E 2L00B 3KW5B 2K8BA 4A3OA 1UZXB 2M4NA 4BKSD 4PS3A 3WAPA 1WJ6A 3PV1A 4FJVB 2ZNVB 1WYWB 4BKSA 4DXAB 2DAFA 2LXAA 3TL5A 1ZKHA 2BYFA 2M0XA 1A5RA 1Q0WB 2AL6A 3PRMB 1WE6A 4NY0A 1LFDA 4WQOB 3ML9A 2I1KA 1WX8A 3Q3FA 4W9EA 4W9JA 3JSVB 2JPHA 3H9DA 4I6NB 4M8NA 4EEWA 3VTUA 4XZ4A 1WFYA 3RCZA 3PRPB 4TKNA 2V1YA 3I3TB 2BPSA 3ZNHB 2JUOA 2KX3A 1YJ1A 2KTRB 4PYZA 4FBJB 3NHEB 3ZDMC 4BBNF 1U4AA 2AWTA 2DHZA 1K8RB 4K7WA 3OJ4B 2KKCA 4PYUA 1UBIA 2L76A 4I6PA 4M0WB 2JRIB 2WX1A 4KV2A 4DK5A 3DOWA 1P9DU 1YQBA 2Z0DB 4WWOA 2ZNVC 5E6PA 2N9XA 3ZDTA 2WX0A 1YX5B 1J19A 2O6VB 1WJUA 4HLEA 1LM8B 4GXBA 1I42A 3L13A 1OGWA 4NJ7A 2LJ5A 2IO0B 2MBEA 2GBJA 3HIZA 1WF9A 3ZLZA 4F8CB 4MGIE 2R2QA 4HWIB 5FR6A 1V80A 3DBHI 4E3CA 4LJPB 2OOBB 1WMHB 2O2VB 3QA8A 5J18A 2DZMA 1X1MA 4GDLB 4YL8A 1Q5WB 2ZEQA 3RULA 2JWZA 2CHWA 4HCPB 1E90A 2MBOA 2N4FA 3QARA 4MGZE 1KLVA 2K8CA 2MLBA 2HD5B 1WGHA 5JH5C 2MW5A 4GIVA 2FAZA 3ZNZB 2K8HA 3R66C 2CR5A 1LQBA 3QQ8B 4RMAA 3WANA 2V3SA 2KJRA 5D2MB 4G3XB 1UELA 3CSTA 1TZ1A 3JYUA 4MGKE 2AEHA 2D3GA 5DPWA 1G6JA 5KHOA 2IYDB 2NBVB 1Q1OA 2N1VA 2C9WB 3NS8A 3T9LA 2FCNA 5J2RA 3TJPA 4BOSC 3NY5A 2LGDA 2HE7A 1TGZB 3M3JA 1YD8U 4WAAA 1WXSA 1P0RA 3VH3B 3EECA 3U7DA 2IY1B 2FUHB 4KIKA 3W1SC 3DVGX 1V6EA 3ECIA 4FLHA 2IBIB 1H4RA 1MG8A 2BWES 2LZ6A 4ZRIA 2YVCA 3EFUA 1TBEA 1OTRB 3VHTC 4ANUA 2KFJA 2KDIA 1D3ZA 3QCAA 4NQLB 3RZWC 2V4LA 5C1ZA 4DDID 4KSKC 4K81A 1E7UA 3VAWA 4AWJA 4TQ1A 2KMAA 1WZ3A 1SGHA 2J7QB 2L05A 1ZW7A 4MEMA 4HCNB 3N30A 1SIFA 1KOTA 4TQ0A 2N1WA 3QK0A 4IWQA 4G0NB 3PZDA 3X23A 1L2NA 1YX6B 3DDCB 3L10B 2ZJDA 4ZRJA 3UF8A 5DPSA 3DQVA 3L08A 2LRUA 4K1RB 1KM7A 4HVBA 4ICUA 2JRHA 4GDKA 2PPHA 4HJKA 5CTRC 3KUDB 1M94A 4DHZB 3VTWA 3PVLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WE7 A;  4GN1 A;  2DAJ A;  4MEL A;  2FCM A;  2NPT B;  4W9F A;  1V81 A;  1SE9 A;  2KQS A;  4GSW A;  5CX3 A;  3ZRC A;  5EDS A;  3WA0 A;  2XK5 B;  5LXI B;  4K7S A;  1J8C A;  3N3K B;  2ZVO A;  4NJ6 A;  4XC2 A;  2JXX A;  2ZZP B;  4BFR A;  3DCG A;  4LJO B;  3IFW B;  4DHZ E;  3NOB A;  3HM3 A;  3B1L X;  2GBR A;  2FNJ B;  2PJH A;  4BVU C;  4DDG D;  2ZVN A;  4GU2 A;  5AZG A;  2RSU A;  1WR1 A;  2NBW B;  3ZUN A;  4WJO A;  2KQ7 A;  3QC8 B;  2DYB A;  1ISN A;  2WYQ A;  3K9P B;  2DYO A;  5LLI A;  3VUY A;  3K9O B;  4AJW A;  1WJN A;  2KHW B;  5E6N A;  2VRR B;  2DZI A;  1E8Y A;  3ZNG C;  1V86 A;  3DVN U;  2MQJ A;  4NQK E;  4OVU A;  4AOF A;  1V49 A;  2LVQ A;  3PSE B;  3WAL A;  2PEA A;  4ANX A;  3AU4 A;  3ZRF A;  2OJR A;  3KH0 A;  3M63 B;  5GMV A;  3V61 A;  1WX7 A;  1WXV A;  4AJY B;  5AZF A;  2L0T A;  3H6N A;  2LD9 A;  4NNJ B;  5G55 A;  4FN2 A;  3ZW3 A;  2NVU I;  4ZDV A;  2JZ3 B;  2O6V D;  1LXD A;  5DPT A;  3WIM A;  2D07 B;  2BYE A;  3BIN A;  2RGF A;  4MGY E;  4F1S A;  2M1M A;  1WGG A;  3V62 A;  1UH6 A;  4IM3 A;  4IG7 B;  2R2O A;  1CMX B;  2KWV B;  3JVZ X;  4TUU A;  4B9K A;  4J6I A;  4TV3 A;  4W9K A;  2C60 A;  4E71 A;  4IM2 A;  3PHW B;  1C1Y B;  1HE8 A;  3M62 B;  2GBK A;  4BKT A;  4MSM B;  2FCQ A;  2MP2 A;  2L3Z A;  2DYM A;  4GOC A;  1R4M I;  2GOW A;  2UWQ A;  4II3 B;  4WWP A;  3ZNI D;  2LI5 A;  2KD0 A;  3DBL I;  4RM9 A;  2MBQ A;  2REX A;  5C23 A;  4EZJ A;  2JF5 A;  3RZF A;  1V5O A;  2KO3 A;  4HPM B;  4WJN A;  4K7U A;  3HHM A;  2FCS A;  2KFK B;  3TCA A;  2MCN B;  1I35 A;  2C5L C;  3UIO B;  3V60 A;  2KJ6 A;  2L0F A;  3RD2 A;  3ZIM A;  3JSV A;  2KWC A;  2GBN A;  3X0W A;  1E8Z A;  1PQS A;  1UD7 A;  2RD0 A;  3ONS A;  5CHV C;  5BO4 B;  4WWN A;  4EZL A;  2LRW A;  2UYZ B;  2KJH B;  4I6L B;  5LXH A;  4EUT A;  3B0A A;  3A1Q A;  3RYT A;  5J17 A;  4PS7 A;  2JVC A;  5IAA C;  3AXC A;  3ZVV A;  2KLG A;  5E6O A;  2YLM A;  3S2A A;  4KDL B;  4NAW B;  3R7Q A;  1AAR A;  4E74 A;  4MH0 E;  3DBS A;  2C7N B;  4JL9 A;  4HDO A;  1P1A A;  2CKH B;  3AU5 A;  4WJP A;  3DVG Y;  4GMV A;  2PE9 A;  4CYE A;  2KOX A;  3AI5 A;  4DHJ D;  1E7V A;  4JIO U;  3MTN B;  3H7P B;  2FIF A;  3UIP B;  3VH4 B;  2ZPY A;  2XEW A;  1BT0 A;  3AUL A;  3JW0 X;  1H8C A;  1OEY J;  5AZH A;  3QIJ A;  1GC7 A;  2KZR A;  3PLV A;  3IBE A;  3UQB A;  1WZ0 A;  2A4Z A;  2KX0 A;  4XX5 A;  3V6E B;  2Z0E B;  3VQI A;  3R7R A;  1RAX A;  2LVP A;  2MWS B;  1EUV B;  3WAO A;  1IP9 A;  2N7E A;  3VUW A;  1F9J A;  2IY0 B;  3VXW A;  1KJT A;  1EF1 A;  3T8M A;  3WAM A;  4FJY A;  4WJQ A;  2K6D B;  1WGR A;  1S3S G;  4BBN C;  2BGF A;  1YIW A;  2JY6 A;  3CSF A;  4N9F 4;  4GDL A;  3VFK A;  4KDI C;  2NCN A;  1P3Q U;  4W9L A;  4ASW C;  3UQA A;  3A4R A;  1XD3 B;  4FHK A;  2EMS A;  2Y5B B;  4HK2 A;  1WGD A;  3APC A;  4IUM B;  4LCD E;  2KWU B;  3R3M A;  4W9C A;  3QJZ A;  2M17 A;  2MRP A;  1UBQ A;  2DEN B;  4W9I A;  4B6W A;  4W9H A;  2G4S A;  3SD5 A;  1GJZ A;  3A9K A;  2IO3 B;  3GOE A;  3ML8 A;  1IYF A;  1EF5 A;  3KUC B;  5L95 C;  2KK8 A;  4M8M A;  3QWZ B;  3ZTC A;  3PRZ A;  1Z2M A;  5KHQ A;  2CS4 A;  4G11 A;  5L83 A;  1IPG A;  3VUX A;  2PE6 B;  3DPD A;  2KFK A;  5DPR A;  1NDD A;  2N7D A;  4JQW C;  3APD A;  3VVW B;  4HPL B;  1GUA B;  4KSL C;  2KNB A;  2KC1 A;  1ZGU B;  4RM8 A;  3HM6 X;  3PTF C;  2NPT A;  3L17 A;  5D6J B;  4LDT D;  2KDE B;  2D2Q A;  2GBM A;  4ZYN A;  2L7R A;  3D32 A;  3PPA A;  4X57 B;  2DZK A;  1WXM A;  5G2N A;  3H1U A;  3IHP C;  2FID A;  2KTR A;  1Y8R C;  2GMI C;  3M95 A;  4FHJ A;  3A9J A;  2AL3 A;  2BF8 B;  3A4S C;  3PT2 B;  4KVG B;  3SHQ A;  2BYV E;  2N9E B;  3Q3J A;  4FJZ A;  4IC7 B;  1RRB A;  1WGY A;  3RT3 B;  4ICV A;  1E5W A;  1E8X A;  1S1Q B;  4MSQ B;  1RLF A;  2BKR B;  2DZJ A;  1WM3 A;  4MJS B;  3P2B A;  2QHO A;  1R4N I;  1WH3 A;  3U30 A;  2LGY A;  2LAS A;  1OEY A;  2CU1 A;  4EZK A;  4F7Z A;  3EC8 A;  2D11 A;  5HKH A;  3OLM D;  2G4D B;  3H7S A;  2LWP A;  3QX1 A;  3TBL D;  2IZV B;  4B95 A;  1XQQ A;  1V5T A;  1V9J A;  2DX5 B;  4BKG A;  1WMH A;  2O2V A;  4AUQ C;  1TTN A;  3DVN V;  3PRE A;  3PS6 A;  4FUL A;  2C7M B;  3UGB B;  2ASQ A;  2K1F A;  4URK A;  2N9P C;  2IO2 B;  3A9K B;  3O65 B;  1WIA A;  2KLC A;  1J0G A;  1WJ4 A;  3N32 A;  2L8J A;  3VDZ A;  3MHS D;  1WM2 A;  1OQY A;  3QAQ A;  5JHA A;  4JLC A;  2KDB A;  2KDF B;  2M8S A;  3KUZ A;  3PGE A;  4GB9 A;  4IWO A;  4KIK B;  2D10 A;  3KYC D;  2W9N A;  2MP2 B;  1V2Y A;  1GC6 A;  4IM0 A;  1JRU A;  1NI2 A;  3DBR I;  2EKE C;  2BKF A;  2LVO A;  3L54 A;  4IW0 A;  3LDZ E;  3OJ3 A;  3A9J B;  2MBH A;  4JGH B;  1WY8 A;  2WDT B;  2AYO B;  5AEK B;  1WI0 A;  2NBU A;  4EKU A;  3HK0 A;  2Z59 B;  3H7P A;  2LGX A;  1FXT B;  5D94 A;  2MX2 A;  1RFA A;  4MJS A;  4W9D A;  5IA7 A;  2J0M A;  2NS5 A;  1QZE A;  3ZTD A;  4EFO A;  2HTH A;  2KVR A;  4AP4 C;  5JZE B;  4II2 B;  3SDL C;  3TIX A;  3ZO5 B;  4KZ0 A;  3PLU A;  1T0Y A;  1UGM A;  1L7Y A;  2CHZ A;  2KAN A;  4GDK B;  2G3Q B;  2LUE A;  2LXC A;  2KTF A;  1XT9 B;  2CHX A;  2B3A A;  3CMM B;  3KVF B;  4P7I A;  2K25 A;  2KMC A;  2JT4 B;  3A1Q B;  4FAD A;  3B08 A;  2XBB C;  2ZCC A;  3EHV A;  3IG3 A;  4NAW A;  4A3P A;  5JHB A;  3KYD D;  2MA9 B;  1GG3 A;  4PS8 A;  1C3T A;  3MJW A;  4CHK A;  4MDK E;  3W1Y A;  4LDT B;  3W1S A;  1GNU A;  3ZKJ C;  3PHX B;  2KXJ A;  2KN5 A;  3U8Z A;  4EOY A;  5CHF A;  3A33 B;  2I1J A;  2EMT A;  1NBF C;  3NZS A;  2K39 A;  3GZN I;  2RR9 A;  2G45 B;  3BY4 B;  2O6V A;  4DBG A;  4CO7 A;  1E8W A;  2IO1 B;  4BOZ B;  3L0W B;  2MSE D;  2NR2 A;  2JZZ A;  4ANW A;  3LJ3 A;  5DCN A;  2XK5 A;  2HJ8 A;  1WR6 E;  2ZCB A;  1VCB A;  3ALB A;  4G50 A;  4DHJ B;  1Z5S B;  2A5U A;  2WWZ A;  3QHT A;  4IWP A;  4ANV A;  3SU8 X;  2K6Q A;  2J0J A;  3NZU A;  4HXD A;  3ENE A;  3L16 A;  4GGQ A;  4OVV A;  4ZRK A;  4MM3 A;  1WRD B;  1WX9 A;  2KC2 A;  1EO6 A;  4HDQ A;  1WXA A;  3RUI B;  2RPQ A;  2ZPN A;  4W9G A;  2BWF A;  3IVF A;  5TR5 A;  5CHW A;  4A20 A;  1VD2 A;  2J0K A;  4NPN A;  3APF A;  4FA6 A;  4KZC A;  2C7H A;  3UIN B;  3VTV A;  2MBB B;  4DWF A;  5D7G A;  3C0R B;  3V6C B;  3OAW A;  1P98 A;  3TMP B;  3CF6 E;  2L00 B;  3KW5 B;  2K8B A;  4A3O A;  1UZX B;  2M4N A;  4BKS D;  4PS3 A;  3WAP A;  1WJ6 A;  3PV1 A;  4FJV B;  2ZNV B;  1WYW B;  4BKS A;  4DXA B;  2DAF A;  2LXA A;  3TL5 A;  1ZKH A;  2BYF A;  2M0X A;  1A5R A;  1Q0W B;  2AL6 A;  3PRM B;  1WE6 A;  4NY0 A;  1LFD A;  4WQO B;  3ML9 A;  2I1K A;  1WX8 A;  3Q3F A;  4W9E A;  4W9J A;  3JSV B;  2JPH A;  3H9D A;  4I6N B;  4M8N A;  4EEW A;  3VTU A;  4XZ4 A;  1WFY A;  3RCZ A;  3PRP B;  4TKN A;  2V1Y A;  3I3T B;  2BPS A;  3ZNH B;  2JUO A;  2KX3 A;  1YJ1 A;  2KTR B;  4PYZ A;  4FBJ B;  3NHE B;  3ZDM C;  4BBN F;  1U4A A;  2AWT A;  2DHZ A;  1K8R B;  4K7W A;  3OJ4 B;  2KKC A;  4PYU A;  1UBI A;  2L76 A;  4I6P A;  4M0W B;  2JRI B;  2WX1 A;  4KV2 A;  4DK5 A;  3DOW A;  1P9D U;  1YQB A;  2Z0D B;  4WWO A;  2ZNV C;  5E6P A;  2N9X A;  3ZDT A;  2WX0 A;  1YX5 B;  1J19 A;  2O6V B;  1WJU A;  4HLE A;  1LM8 B;  4GXB A;  1I42 A;  3L13 A;  1OGW A;  4NJ7 A;  2LJ5 A;  2IO0 B;  2MBE A;  2GBJ A;  3HIZ A;  1WF9 A;  3ZLZ A;  4F8C B;  4MGI E;  2R2Q A;  4HWI B;  5FR6 A;  1V80 A;  3DBH I;  4E3C A;  4LJP B;  2OOB B;  1WMH B;  2O2V B;  3QA8 A;  5J18 A;  2DZM A;  1X1M A;  4GDL B;  4YL8 A;  1Q5W B;  2ZEQ A;  3RUL A;  2JWZ A;  2CHW A;  4HCP B;  1E90 A;  2MBO A;  2N4F A;  3QAR A;  4MGZ E;  1KLV A;  2K8C A;  2MLB A;  2HD5 B;  1WGH A;  5JH5 C;  2MW5 A;  4GIV A;  2FAZ A;  3ZNZ B;  2K8H A;  3R66 C;  2CR5 A;  1LQB A;  3QQ8 B;  4RMA A;  3WAN A;  2V3S A;  2KJR A;  5D2M B;  4G3X B;  1UEL A;  3CST A;  1TZ1 A;  3JYU A;  4MGK E;  2AEH A;  2D3G A;  5DPW A;  1G6J A;  5KHO A;  2IYD B;  2NBV B;  1Q1O A;  2N1V A;  2C9W B;  3NS8 A;  3T9L A;  2FCN A;  5J2R A;  3TJP A;  4BOS C;  3NY5 A;  2LGD A;  2HE7 A;  1TGZ B;  3M3J A;  1YD8 U;  4WAA A;  1WXS A;  1P0R A;  3VH3 B;  3EEC A;  3U7D A;  2IY1 B;  2FUH B;  4KIK A;  3W1S C;  3DVG X;  1V6E A;  3ECI A;  4FLH A;  2IBI B;  1H4R A;  1MG8 A;  2BWE S;  2LZ6 A;  4ZRI A;  2YVC A;  3EFU A;  1TBE A;  1OTR B;  3VHT C;  4ANU A;  2KFJ A;  2KDI A;  1D3Z A;  3QCA A;  4NQL B;  3RZW C;  2V4L A;  5C1Z A;  4DDI D;  4KSK C;  4K81 A;  1E7U A;  3VAW A;  4AWJ A;  4TQ1 A;  2KMA A;  1WZ3 A;  1SGH A;  2J7Q B;  2L05 A;  1ZW7 A;  4MEM A;  4HCN B;  3N30 A;  1SIF A;  1KOT A;  4TQ0 A;  2N1W A;  3QK0 A;  4IWQ A;  4G0N B;  3PZD A;  3X23 A;  1L2N A;  1YX6 B;  3DDC B;  3L10 B;  2ZJD A;  4ZRJ A;  3UF8 A;  5DPS A;  3DQV A;  3L08 A;  2LRU A;  4K1R B;  1KM7 A;  4HVB A;  4ICU A;  2JRH A;  4GDK A;  2PPH A;  4HJK A;  5CTR C;  3KUD B;  1M94 A;  4DHZ B;  3VTW A;  3PVL A; 
#chains in the Genus database with same CATH topology
 2DAJ A;  3MC8 A;  2FCM A;  1ET6 A;  1VJK A;  1F2R I;  2ZVO A;  3Q8C A;  2ZZP B;  2PW9 A;  3DCG A;  4DHZ E;  2KQ4 X;  3MJ5 A;  2PJH A;  2ZVN A;  2NBW B;  3ZUN A;  2KQ7 A;  2HDE A;  1JRP A;  5H8Y E;  5MPO A;  4O1N A;  4NJC A;  3FC4 A;  4AJW A;  5HG2 A;  4JE3 B;  2GB1 A;  1WWT A;  2HTM E;  2LVQ A;  4ZRQ A;  2DNF A;  3VR9 B;  4ANX A;  1EWY C;  3M63 B;  3V61 A;  1WXV A;  4AJY B;  2L0T A;  3H6N A;  2LD9 A;  5G55 A;  1XXG A;  3ZW3 A;  3U2S C;  3AEC B;  3WIM A;  2BYE A;  4MGY E;  1J7C A;  3V62 A;  1LO5 D;  4IM3 A;  2WLB A;  3JVZ X;  2Y3A A;  4AQ7 A;  3P4Q B;  5LNK 1;  2C60 A;  1QOF A;  1VLB A;  1XLO A;  4IM2 A;  3M62 B;  2GBK A;  3EGR A;  1LGR A;  1QOA A;  3AEA B;  2MP2 A;  4GOC A;  1RM6 C;  3DHG C;  2LI5 A;  4RM9 A;  2MBQ A;  5D3I B;  1V5O A;  4HPM B;  2AQ3 B;  3HHM A;  1I35 A;  1F1H A;  3UIO B;  2KJ6 A;  3AED B;  3RD2 A;  4KKJ A;  5CHV C;  3ONS A;  5BO4 B;  2LRW A;  2UYZ B;  3OWE B;  4EUT A;  2JVC A;  3ZVV A;  2BS2 B;  2YLM A;  2BTE A;  4NAW B;  3FKY A;  4HDO A;  1P1A A;  2CKH B;  1L6U A;  3AN1 A;  2PE9 A;  4DHJ D;  4JIO U;  2FIF A;  1TJE A;  2XEW A;  3QIJ A;  3UQB A;  2A4Z A;  2KX0 A;  1WXQ A;  4N6E B;  3VUW A;  1F9J A;  1SBB B;  1KJT A;  4XWW A;  4FJY A;  1WGR A;  2Q5W D;  3CIR B;  4XDC A;  4N9F 4;  3VFK A;  2V3P A;  2NCN A;  1P3Q U;  1XD3 B;  3MC0 B;  4IUM B;  3APC A;  2CJN A;  2KWU B;  2M17 A;  2RDG A;  2DEN B;  2G4S A;  1GJZ A;  4YTP B;  4CQN A;  3HRD D;  1IYF A;  1EF5 A;  3KUC B;  2KK8 A;  1YMH E;  4L23 A;  1Z2M A;  3P42 A;  5L83 A;  1IPG A;  2PE6 B;  3DPD A;  2KFK A;  5DPR A;  2MJD A;  2BVC A;  4JQW C;  3O13 A;  3HM6 X;  2D2Q A;  2L7R A;  3D32 A;  1KH0 A;  2DZK A;  1DGJ A;  3A4S C;  1M4V A;  1I4Q A;  1AWD A;  3SHQ A;  4FJZ A;  1S1Q B;  3Q8A A;  1RLF A;  1WM3 A;  3P2B A;  1K51 A;  1DOY A;  3U30 A;  1OEY A;  2CU1 A;  5HKH A;  1DYQ A;  2G4D B;  3QX1 A;  4WAF A;  2IZV B;  1XQQ A;  3EUB 2;  1WMH A;  1TTN A;  2PVO D;  2KLC A;  1WJ4 A;  2L8J A;  2WXQ A;  1WM2 A;  2W55 A;  3QAQ A;  1L6V A;  3IXS A;  2KDB A;  4JLC A;  4YSX B;  1L0X B;  2M8S A;  4IWO A;  4KIK B;  3KYC D;  2W9N A;  1GC6 A;  4IM0 A;  4OZB A;  1NI2 A;  1FO4 A;  1YJJ A;  3OJ3 A;  2MHJ A;  4JGH B;  2AYO B;  3NS1 A;  1WI0 A;  2XN9 C;  4RH6 A;  3H7P A;  2INN E;  5D94 A;  2MX2 A;  1XEE A;  4MJS A;  3OG5 A;  2NS5 A;  5IA7 A;  5TSS A;  3SFE B;  3ZTD A;  3ZXR A;  2HTH A;  4ZRP A;  4AP4 C;  4II2 B;  3TUO A;  4KZ0 A;  2G3Q B;  1V8C A;  2KTF A;  1XT9 B;  2WDQ B;  2K25 A;  4FAD A;  1MVK A;  3B08 A;  3EHV A;  1B9R A;  2RDH A;  1ZP0 B;  4XE0 A;  2ONQ A;  4C7Y A;  4PS8 A;  3W1Y A;  4K3C A;  3W1S A;  2W3R A;  2KXJ A;  1HQR D;  2KN5 A;  1FCL A;  2D5G A;  2AQ1 B;  3Q3O C;  1C4C A;  3BY4 B;  4DBG A;  1QT9 A;  2IO1 B;  3L0W B;  2MSE D;  4ANW A;  1OQR A;  2IGH A;  3MHZ A;  1JML A;  1Z5S B;  3RNA C;  3L16 A;  4LLG M;  2FBW B;  2KC2 A;  2ZPN A;  2WDV B;  2J52 A;  5HHD G;  3IVF A;  2RDB C;  4A20 A;  1TS5 A;  3APF A;  1NEK B;  4DWF A;  1PGB A;  5D7G A;  3OAW A;  3Q69 A;  4XYC A;  3TMP B;  5IO9 A;  2E3T A;  4A3O A;  1UZX B;  1XF5 L;  4PS3 A;  1ZUD 2;  2ZNV B;  3BII D;  3HUI A;  4DXA B;  2M0X A;  2JQR B;  4WQO B;  3BVM A;  2I1K A;  3Q3F A;  1XLP A;  4W9J A;  1VZ7 A;  4OHJ A;  4EEW A;  3PRP B;  3I3T B;  1I4X A;  3KWL A;  4RGN A;  1D5X C;  2JUO A;  2KX3 A;  4FBJ B;  4YWG G;  3RI7 C;  4ZHO A;  1WYG A;  2KKC A;  2L76 A;  2N9K A;  2LFI A;  2NTT A;  2VH1 A;  2JRI B;  1V97 A;  1MG4 A;  2LGI A;  2Z0D B;  5E6P A;  1NVI D;  1J19 A;  4S17 A;  3L13 A;  1OGW A;  4NJ7 A;  1JWM D;  2IO0 B;  2JSV X;  2K5P A;  1WF9 A;  4RGT A;  5FR6 A;  1V80 A;  3AEB B;  2OOB B;  5J18 A;  3AEG B;  4YL8 A;  1SXT A;  2R61 A;  3H8H A;  2MLB A;  2HD5 B;  4FXC A;  3AMZ A;  2MW5 A;  2FAZ A;  3GB1 A;  4US8 A;  2V3S A;  2IND C;  4G3X B;  1TZ1 A;  1C76 A;  1G6J A;  5T8I A;  4B0M A;  4PK1 A;  2NBV B;  1Q1O A;  3T9L A;  2AQ2 B;  1F52 A;  5FR3 A;  5J2R A;  3M3J A;  1NEN B;  2W54 A;  2IY1 B;  4KIK A;  3W1S C;  1ZDV A;  5BMI A;  1H4R A;  3MP9 A;  4M02 A;  1PUT A;  4KKI A;  2YVC A;  1TBE A;  3GS2 A;  1XLQ A;  1ET9 A;  2KDI A;  1I4G A;  3RZW C;  3AE7 B;  2V4L A;  5C1Z A;  5EE9 A;  1E7U A;  1SGH A;  4RNA A;  2L05 A;  1FD6 A;  1OFF A;  1ZW7 A;  4MEM A;  4HCN B;  1FRD A;  2IGG A;  1KOT A;  3QK0 A;  2NTS A;  4P1B C;  4G0N B;  4IWQ A;  1L2N A;  1NYR A;  1TZO A;  2VH2 A;  3DDC B;  4ZRJ A;  1K50 A;  3UF8 A;  2L32 A;  1MPE A;  2JRH A;  2PPH A;  5CTR C;  2QSD A;  3KUD B;  1YQ4 B;  1WE7 A;  1IGC A;  4W9F A;  1SE9 A;  2KQS A;  3ZRC A;  4RF1 A;  2JXX A;  1GAQ B;  2FNJ B;  3TEX A;  4GU2 A;  3T3N A;  3QC8 B;  3B2F A;  4JWS C;  3AM9 A;  3VUY A;  1UUP A;  1E8Y A;  3ZNG C;  1FRR A;  3DVN U;  2MQJ A;  4NQK E;  4RFB A;  4OVU A;  4AOF A;  1V49 A;  3AU4 A;  3ZRF A;  2OJR A;  3KH0 A;  5GMV A;  1FXI A;  3RNF C;  3ZGZ A;  2YEP B;  2NVU I;  1NI3 A;  2MJE A;  5DPT A;  1TKG A;  2M1M A;  4TUU A;  1VR9 A;  5BMG A;  1C1Y B;  3TEW A;  2OJW A;  4BKT A;  4MSM B;  2DYM A;  1SE2 A;  2UWQ A;  4II3 B;  2M19 A;  3DBL I;  1T3Q A;  3BVZ A;  1F77 A;  3IAS 1;  1KFY B;  3TCA A;  2C5L C;  1MJD A;  4HRS A;  1I4R A;  2PVG C;  3JSV A;  1E9M A;  1E8Z A;  1UD7 A;  2LJI A;  4WWN A;  3ABV B;  2B76 B;  4EZL A;  2VZK D;  4EE2 A;  5LXH A;  2V9H A;  3B0A A;  3Q6B A;  1YNT E;  3SFD B;  2I38 A;  4YSY B;  1SE3 A;  2QIL A;  4PS7 A;  3RMK C;  4PT5 A;  2QIE B;  4TMA B;  1GOZ A;  5E6O A;  1C78 A;  3NJT A;  4KDL B;  4MAC A;  1AAR A;  3Q8B A;  2KAC A;  2C7N B;  4GMV A;  4A9A A;  3NUH B;  5G5G A;  3AI5 A;  3VRA B;  3MTN B;  3H7P B;  1FXA A;  2PMV A;  3VH4 B;  1PFD A;  1OEY J;  2L83 A;  5AZH A;  3IBE A;  1WZ0 A;  4XX5 A;  2N7J A;  3VQI A;  3R7R A;  1ZXI A;  3BYY B;  2MWS B;  2QC8 A;  1IP9 A;  1FNV A;  2IGD A;  2IY0 B;  1QF6 A;  3T8M A;  4HPP A;  3WAM A;  4REZ A;  4WJQ A;  1YIW A;  2JY6 A;  3CSF A;  4KDI C;  3RPF C;  3A4R A;  2Y5B B;  4HK2 A;  1WGD A;  1HZ5 A;  1TKE A;  1T0Q C;  4WQM A;  1BUI C;  1UBQ A;  1HTQ A;  2WXG A;  4W9I A;  4B6W A;  4W9H A;  1C79 A;  2IO3 B;  4M8M A;  2WXR A;  1YN3 A;  5KHQ A;  1L0V B;  4G11 A;  3VUX A;  1MHH E;  1NDD A;  4A6Q A;  2G1E A;  4HPL B;  4KSL C;  5BYQ A;  1IBX A;  2KC1 A;  1ZGU B;  3PTF C;  3L17 A;  4LDT D;  1HXY D;  2GBM A;  3U7Z A;  4P1C C;  2KMM A;  3IHP C;  4JWU C;  1YN5 A;  2AL3 A;  1RFK A;  3AB5 A;  1E5W A;  2K3U A;  2WXF A;  4MSQ B;  4YT0 B;  2V4I B;  2BKR B;  3N20 C;  1WH3 A;  3RNB C;  2LGY A;  2D3A A;  4WH4 A;  3EC8 A;  2LWP A;  3AE3 B;  1V5T A;  1V9J A;  2WP9 B;  4A55 A;  3IAM 1;  4MH8 A;  5BYR A;  2C7M B;  3UGB B;  4URK A;  2D3C A;  2KYW A;  2Y5P A;  1A70 A;  5JHA A;  3DHI C;  4P6V F;  3KUZ A;  4GB9 A;  4ITK A;  3MC9 A;  1JRU A;  2BKF A;  2EKE C;  3L54 A;  3LDZ E;  1N63 A;  3A9J B;  1WY8 A;  4EKU A;  2Z59 B;  1FXT B;  2N9L A;  2J0M A;  1L5P A;  2EEL A;  5FK9 C;  2KVR A;  5JZE B;  3SDL C;  3ZO5 B;  1L7Y A;  1UGM A;  4GDK B;  2LUE A;  1DOI A;  2CHX A;  4M01 A;  3A1Q B;  2Y5C A;  3MFG A;  4A3P A;  4NAW A;  2MA9 B;  1UNS A;  4L1B A;  1C3T A;  3MJW A;  1AW7 A;  1GNU A;  1HEZ E;  3AE1 B;  3ZKJ C;  3NVY A;  1C77 A;  2PLP A;  3A33 B;  2EMT A;  3DWG C;  3P1M A;  3ZQ4 A;  2G45 B;  4CO7 A;  2LMC A;  4HEA 1;  2J42 A;  3PZ8 A;  2JZZ A;  2PKO A;  2V0G A;  2XK5 A;  2BQQ A;  3Q2A C;  4BAX A;  3ALB A;  1FFU A;  4G50 A;  4DHJ B;  1I4P A;  4ZOH C;  2K9X A;  3QHT A;  4IWP A;  4ANV A;  3SU8 X;  2K6Q A;  4GGQ A;  3BK1 A;  3VR8 B;  1WRD B;  2WU5 B;  1WX9 A;  1WXA A;  4W9G A;  2BWF A;  1VD2 A;  4NPN A;  4FA6 A;  1TS3 A;  1L4Z B;  3LXF A;  3UIN B;  1KF6 B;  3AH7 A;  3PV1 A;  4BKS A;  5IKC M;  2LXA A;  1A5R A;  2JXT A;  1Q0W B;  2AL6 A;  2W82 A;  3N1X C;  1WE6 A;  1WX8 A;  3JSV B;  4M8N A;  2K0P A;  1WFY A;  3RCZ A;  2V1Y A;  4C56 C;  4ZHP A;  1MFW A;  3Q8E A;  4BBN F;  1U4A A;  2DHZ A;  4KGR A;  4A90 A;  1I7H A;  1K53 A;  1T0R C;  1P7E A;  4KV2 A;  4DK5 A;  2JX5 A;  1YQB A;  1EU3 A;  2N9X A;  5H92 C;  2WX0 A;  2PTL A;  4HLE A;  4GXB A;  1I42 A;  1ESF A;  3W9C B;  4MGI E;  2R2Q A;  4HWI B;  1WMH B;  3I5J C;  4HKZ E;  3I57 A;  1RYJ A;  4HCP B;  1E90 A;  4MGZ E;  1KLV A;  1SB3 C;  1HZ6 A;  4NZL B;  3R66 C;  4RMA A;  2KJR A;  1UEL A;  3DBL B;  3I63 C;  5I4D A;  2ON8 A;  4ACF A;  4DXG A;  2KDM A;  1IUE A;  3TJP A;  1R4M B;  2I2Y A;  1YD8 U;  2JWU A;  1L4D B;  3EEC A;  3U7D A;  4FLH A;  3ECI A;  2WXJ A;  4LK0 M;  4JX1 C;  3VRB B;  4ANU A;  1D3Z A;  2MEK A;  4NQL B;  4DDI D;  2WXN A;  4KSK C;  4K81 A;  1WZ3 A;  4XDD A;  1SIF A;  4WUR A;  3ZXV A;  2N1W A;  2LHD A;  3IT6 B;  2BB6 A;  1TY2 A;  3L10 B;  5DPS A;  4M00 A;  2LRU A;  3LYY A;  4GDK A;  3NRZ A;  1M94 A;  1GPX A;  3PVL A;  1GB4 A;  4GN1 A;  1V81 A;  3V3X A;  5EDS A;  4NJ6 A;  2BB5 A;  3R2I A;  4BFR A;  1I4H A;  1UWM A;  3NOB A;  3HM3 A;  2GBR A;  4BVU C;  3U4E G;  5AZG A;  2FUG 1;  4WJO A;  2DYB A;  2X8X X;  4R3D A;  1ISN A;  3K9P B;  5LLI A;  3K9O B;  2KHW B;  5E6N A;  3TEY A;  2OHF A;  3AE4 B;  2ZW1 A;  1MI0 A;  3PSE B;  4P16 A;  2VZK B;  1WX7 A;  3ZJT A;  1OQQ A;  5AZF A;  4NNJ B;  3U52 E;  3TEZ A;  2JZ3 B;  1TKY A;  4JPS A;  2DWQ A;  2SEB D;  2WDR B;  4MM3 B;  4F1S A;  2NMQ A;  2WNM A;  2R2O A;  1F0Z A;  3BWU D;  2KWV B;  1SEB D;  1N6Z A;  3PHW B;  1HE8 A;  4DXF A;  2N0S B;  1N5W A;  3RN9 C;  1T5X D;  1R4M I;  2GOW A;  3ZNI D;  4EZJ A;  2KD0 A;  3RZF A;  1JRO A;  2KO3 A;  4LNK A;  4WJN A;  2K22 A;  3AEE B;  4K7U A;  2FCS A;  1FPY A;  2L0F A;  3ZIM A;  2KWC A;  1PQS A;  2RD0 A;  4RGO S;  2KJH B;  4I6L B;  2MJ3 A;  3HVZ A;  3L4P A;  3RYT A;  2BYT A;  2KAJ A;  3R7Q A;  4E74 A;  2IDY A;  5IN7 A;  1WSP A;  3DBS A;  4JL9 A;  4YSZ B;  3AU5 A;  4WJP A;  5AUK A;  3DVG Y;  2LEK A;  2KOX A;  4IOI E;  3UIP B;  4M0W A;  1BT0 A;  3AUL A;  3JW0 X;  1H8C A;  1E0Z A;  2KZR A;  4C00 A;  1YQ3 B;  1RAX A;  2LVP A;  1EUV B;  4USA A;  5HI1 A;  1EF1 A;  2MH7 A;  1DOX A;  4LNI A;  2K6D B;  4BBN C;  2BBC A;  3AE2 B;  4GDL A;  4OZC A;  1E10 A;  4WIP A;  3UQA A;  5C2T B;  4LCD E;  4W9C A;  3QJZ A;  3PO0 A;  1TS4 A;  3A9K A;  3P63 A;  1STE A;  3GOE A;  3C19 A;  2OED A;  5L95 C;  1QIL A;  3QWZ B;  2ZW0 A;  3CWI A;  2CS4 A;  1T0S C;  1ZE3 D;  3N9Y C;  3Q3N C;  3NVV A;  2N7D A;  3APD A;  1UWX A;  3VVW B;  1GUA B;  2NPT A;  2KDE B;  3PPA A;  3H1U A;  4LTU A;  2FID A;  3B9J A;  2KTR A;  4FHJ A;  4KVG B;  2BYV E;  2N9E B;  3Q3J A;  1RRB A;  4ICV A;  2J4X A;  1PYW D;  4A8X C;  4MJS B;  1R4N I;  3RNE C;  4F7Z A;  3OLM D;  3H7S A;  2ICI A;  2PIA A;  2O2V A;  3NVW A;  3DVN V;  3PRE A;  4FUL A;  1CZP A;  2N9P C;  1WIA A;  3N32 A;  3RNG C;  1OQY A;  1SE4 A;  5EE3 A;  2CJO A;  1JWB D;  5BYS A;  3PGE A;  3ZJU A;  2X38 A;  1V2Y A;  4C4V B;  2WXL A;  2LVO A;  4DQO C;  2JZP A;  5AEK B;  5E6J A;  2JYT A;  2GI9 A;  3HK0 A;  1TY0 A;  2LGX A;  4YXD B;  1RFA A;  1F2R C;  1XLN A;  4J3O D;  1QZE A;  1TS2 A;  4EFO A;  5EE1 A;  3PLU A;  1T0Y A;  2KAN A;  2CHZ A;  2LXC A;  3CMM B;  2JT4 B;  2XBB C;  3IG3 A;  5JHB A;  3KYD D;  1GG3 A;  1VRA B;  4ZYS A;  5FKA C;  1PGA A;  3PHX B;  1ZDX A;  1ACC A;  4EOY A;  1B1Z A;  2I1J A;  3NZS A;  1MHX A;  3GZN I;  2O6V A;  1E8W A;  4LNN A;  3P4S B;  1WRI A;  1V1P A;  2NR2 A;  3E56 A;  3LJ3 A;  5DCN A;  1SF0 A;  1WR6 E;  1C4P A;  5BMH A;  2ZCB A;  2RMM A;  2A5U A;  2WWZ A;  2J0J A;  4HXD A;  3ENE A;  4ZRK A;  1XO3 A;  4MM3 A;  1PDX A;  4HDQ A;  4OZA A;  3RUI B;  2RPQ A;  3Q14 C;  1K52 A;  1N61 A;  1CQV A;  5CHW A;  5TR5 A;  2IPK D;  2J0K A;  3KLS X;  4KZC A;  4KGS A;  1ZPS A;  2C7H A;  1D4B A;  2HJ1 A;  3V6C B;  3C0R B;  1E7P B;  1P98 A;  3CF6 E;  1T6B X;  4XWT A;  3KW5 B;  2M4N A;  4BKS D;  1WJ6 A;  4FJV B;  1WYW B;  1FEH A;  2DAF A;  2BYF A;  2FE8 A;  4NY0 A;  1LFD A;  3ML9 A;  4RF0 A;  1GB1 A;  2JPH A;  2JU6 X;  3AE9 B;  3H9D A;  2D3B A;  4OW0 A;  3ZNH B;  2KTR B;  4PYZ A;  3KQ4 A;  2AWT A;  3BK2 A;  1K8R B;  3OJ4 B;  1RWS A;  2LGS A;  1JWS D;  1J7B A;  4WWO A;  2ZNV C;  1YX5 B;  2MBE A;  2GBJ A;  3ZLZ A;  2BS3 B;  3SR6 A;  2KN4 A;  3R2T A;  2KWD A;  2RPV A;  3LB8 C;  3DBH I;  2Z8L A;  4YTN B;  4LJP B;  4E3C A;  2DZM A;  1X1M A;  1Q5W B;  2DBY A;  1UF0 A;  2N4F A;  3QAR A;  1ZXH A;  1KRH A;  1WGH A;  5JH5 C;  4GIV A;  3ZNZ B;  2K8H A;  2CR5 A;  1LQB A;  4HJG E;  3WAN A;  5D2M B;  2WXM A;  5HFY A;  3JYU A;  4MGK E;  4ARI A;  1FCC C;  5DPW A;  2IYD B;  2N1V A;  3NS8 A;  2BS4 B;  2LGD A;  1JCK B;  1TGZ B;  2H88 B;  2HE7 A;  4NAM A;  5G5H A;  4WAA A;  3RNC C;  1WXS A;  1P0R A;  2FUH B;  2IBI B;  2BWE S;  4ARC A;  1OTR B;  3FIL A;  2KFJ A;  3NVZ A;  2WXI A;  4AWJ A;  1AN8 A;  3B2G A;  3PZD A;  1EM7 A;  3X23 A;  1YX6 B;  3HVD A;  5IP4 D;  3DQV A;  4K1R B;  4LNF A;  1ENF A;  4Q2J A;  4DHZ B;  3VTW A;  4HKQ A;  4MEL A;  2NPT B;  5CX3 A;  4GSW A;  3WA0 A;  2XK5 B;  5LXI B;  4K7S A;  1J8C A;  3N3K B;  4XC2 A;  3ZJV A;  4LJO B;  3IFW B;  3B1L X;  4DDG D;  2RSU A;  1WR1 A;  2WYQ A;  2DYO A;  3NG0 A;  1ROE A;  1WJN A;  4LNO A;  2VRR B;  2DZI A;  1EWC A;  4QAY A;  1V86 A;  1YN4 A;  3AEF B;  4YTM B;  4KX6 B;  3ETR A;  3WAL A;  2PEA A;  2KT7 A;  3I9V 1;  3J9C A;  4FN2 A;  1TYG B;  4ZDV A;  2O6V D;  1LXD A;  2D07 B;  2J53 A;  3BIN A;  2RGF A;  1WGG A;  2WGS A;  1UH6 A;  3N1Y C;  4IG7 B;  1CMX B;  4B9K A;  4KGT A;  4J6I A;  4TV3 A;  4XGA B;  4W9K A;  3V05 A;  4E71 A;  4B0E A;  3P4R B;  2FCQ A;  2L3Z A;  5IOI A;  4WWP A;  1V1O A;  1ZOY B;  3NZ3 A;  1AYF A;  5C23 A;  2REX A;  1XCQ L;  2WHI A;  2JF5 A;  3FAH A;  1IBX B;  1V1P B;  1L0Y B;  2KFK B;  2MCN B;  3PZ7 A;  2DLB A;  3V60 A;  2E6X A;  1R4N B;  2GBN A;  3X0W A;  2AX5 A;  4HRO A;  3Q8F A;  1SSN A;  3SEB A;  4IKG A;  2M0A A;  2GLS A;  3A1Q A;  5J17 A;  3R8B A;  5IAA C;  3AXC A;  2KLG A;  1C4A A;  3S2A A;  1KTK A;  1JQ4 A;  4MH0 E;  1CJE A;  4MT5 A;  2CU3 A;  4CYE A;  2INC C;  1E7V A;  2G9H D;  1C9F A;  2ZPY A;  3AE5 B;  1GC7 A;  3PLV A;  3V6E B;  2Z0E B;  1D5Z C;  1JW9 D;  3WAO A;  2N7E A;  1Q10 A;  3VXW A;  3GE8 C;  2UU7 A;  1S3S G;  3C8Y A;  4C4V A;  2BGF A;  3EA6 A;  2V3N A;  1FMA D;  4W9L A;  1YJI A;  4ASW C;  5JXV A;  3W2D A;  4FHK A;  2XNA C;  2EMS A;  3GE3 C;  3R3M A;  2MRP A;  3SD5 A;  3ML8 A;  3W5U B;  1HA5 A;  3ZTC A;  3PRZ A;  2WU2 B;  1FM0 D;  2WS3 B;  1N5X A;  1HTO A;  2KNB A;  4RM8 A;  3AE8 B;  4H2A A;  5D6J B;  4ZYN A;  4X57 B;  1WXM A;  5G2N A;  2WQY B;  1Y8R C;  2GMI C;  2YEP F;  3M95 A;  3PT2 B;  3A9J A;  2BF8 B;  3EFC A;  1D6E C;  3RFZ B;  4IC7 B;  4WWM A;  1WGY A;  3RT3 B;  2WXO A;  1E8X A;  4L2Y A;  2DZJ A;  2QHO A;  4OVZ A;  5GXG B;  2LAS A;  4EZK A;  2D11 A;  1YOV B;  3TBL D;  4B95 A;  4BKG A;  3N1Z C;  2DX5 B;  4AUQ C;  3PS6 A;  2ASQ A;  2K1F A;  2IO2 B;  1WGK A;  3A9K B;  3O65 B;  1J0G A;  1EU4 A;  3VDZ A;  3MHS D;  2KDF B;  2D10 A;  3FIL B;  3Q3M C;  1BXT A;  3ZYY X;  2EKI A;  2MP2 B;  3BVG A;  1CK1 A;  3DBR I;  2H89 B;  4IW0 A;  3T3O A;  1FNU A;  3IT4 B;  1VZ8 A;  2MBH A;  5D3D A;  3AE6 B;  2WDT B;  4BZA A;  1E6E B;  1QLB B;  2QDF A;  2NBU A;  2SAK A;  1SIJ A;  1JAL A;  4W9D A;  3DBH B;  2BT6 A;  4GLS C;  3TIX A;  2M56 B;  1N62 A;  4P7I A;  3KVF B;  2B3A A;  4C80 A;  2KMC A;  2ZCC A;  4RGM A;  4C7Z A;  4CHK A;  4MDK E;  4LDT B;  3U8Z A;  1J7A A;  5CHF A;  4RCO A;  1VZ6 A;  1NBF C;  2K39 A;  2RR9 A;  5AUI A;  3DBR B;  4BOZ B;  1JWA D;  5C3J B;  2HJ8 A;  2QEJ C;  1VCB A;  3DWM A;  2BW2 A;  1R7S A;  3W5V B;  3NZU A;  2TSS A;  4OVV A;  2W3S A;  1SJH D;  2LHE A;  1EO6 A;  2WXH A;  3BZD B;  1SJE D;  1TT5 B;  3GP7 A;  3VTV A;  2MBB B;  2L00 B;  2K8B A;  3WAP A;  4N59 A;  3TL5 A;  1ZKH A;  4K3B A;  3PRM B;  4S0R A;  1QKZ A;  4W9E A;  4I6N B;  3VTU A;  4XZ4 A;  2ACZ B;  4TKN A;  2QCZ A;  2BPS A;  2GRI A;  1JWU D;  1YJ1 A;  1FIQ A;  3NHE B;  3KWV A;  3ZDM C;  2INP E;  1VDV A;  2IJ0 A;  4K7W A;  1PGX A;  4PYU A;  1FFV A;  1UBI A;  4US9 A;  4IDI A;  4I6P A;  2LUM A;  1BML C;  2WXP A;  4M0W B;  2WX1 A;  3DOW A;  1P9D U;  3E9S A;  3ZDT A;  2O6V B;  1WJU A;  2L1A A;  1LM8 B;  2LJ5 A;  3HIZ A;  4F8C B;  2QMT A;  1IGD A;  5EE0 A;  2O2V B;  3QA8 A;  4GDL B;  1QOB A;  2ZEQ A;  3RUL A;  1TIF A;  2CHW A;  1P7F A;  2JWZ A;  2MBO A;  3WCQ A;  3GZN B;  2K8C A;  1FNW A;  1QOG A;  1KLG D;  2KVZ A;  3UI3 A;  3QQ8 B;  1XCT L;  3CST A;  2AEH A;  2D3G A;  3URY A;  5KHO A;  2C9W B;  1Y56 A;  2FCN A;  4BOS C;  3NY5 A;  4N58 A;  3DHH C;  1NYQ A;  3VH3 B;  1N60 A;  4TSS A;  3DVG X;  1V6E A;  1MG8 A;  2LZ6 A;  4ZRI A;  3EFU A;  3AV8 A;  4AS1 A;  3VHT C;  3QCA A;  3BYT B;  2QJL A;  3VAW A;  1UGJ A;  2KMA A;  4TQ1 A;  2JYE A;  1D5M C;  2J7Q B;  3N30 A;  4TQ0 A;  1KLU D;  4UDU C;  3P4P B;  1QQR A;  2ZJD A;  3L08 A;  3TSS A;  4D2K A;  1KM7 A;  4HVB A;  4ICU A;  4HJK A;  2WXK A;  2L52 A; 
#chains in the Genus database with same CATH homology
 1WE7 A;  4GN1 A;  2DAJ A;  4MEL A;  2FCM A;  2NPT B;  4W9F A;  1V81 A;  1SE9 A;  2KQS A;  4GSW A;  5CX3 A;  3ZRC A;  5EDS A;  3WA0 A;  2XK5 B;  5LXI B;  4K7S A;  1J8C A;  3N3K B;  2ZVO A;  4NJ6 A;  4XC2 A;  2JXX A;  2ZZP B;  4BFR A;  3DCG A;  4LJO B;  3IFW B;  4DHZ E;  3NOB A;  3HM3 A;  3B1L X;  2GBR A;  2FNJ B;  2PJH A;  4BVU C;  4DDG D;  2ZVN A;  4GU2 A;  5AZG A;  2RSU A;  1WR1 A;  2NBW B;  3ZUN A;  4WJO A;  2KQ7 A;  3QC8 B;  2DYB A;  1ISN A;  2WYQ A;  3K9P B;  2DYO A;  5LLI A;  3VUY A;  3K9O B;  4AJW A;  1WJN A;  2KHW B;  5E6N A;  2VRR B;  2DZI A;  1E8Y A;  3ZNG C;  1V86 A;  3DVN U;  2MQJ A;  4NQK E;  4OVU A;  4AOF A;  1V49 A;  2LVQ A;  3PSE B;  3WAL A;  2PEA A;  4ANX A;  3AU4 A;  3ZRF A;  2OJR A;  3KH0 A;  3M63 B;  5GMV A;  3V61 A;  1WX7 A;  1WXV A;  4AJY B;  5AZF A;  2L0T A;  3H6N A;  2LD9 A;  4NNJ B;  5G55 A;  4FN2 A;  3ZW3 A;  2NVU I;  4ZDV A;  2JZ3 B;  2O6V D;  1LXD A;  5DPT A;  3WIM A;  2D07 B;  2BYE A;  3BIN A;  2RGF A;  4MGY E;  4F1S A;  2M1M A;  1WGG A;  3V62 A;  1UH6 A;  4IM3 A;  4IG7 B;  2R2O A;  1CMX B;  2KWV B;  3JVZ X;  4TUU A;  4B9K A;  4J6I A;  4TV3 A;  4W9K A;  2C60 A;  4E71 A;  4IM2 A;  3PHW B;  1C1Y B;  1HE8 A;  3M62 B;  2GBK A;  4BKT A;  4MSM B;  2FCQ A;  2MP2 A;  2L3Z A;  2DYM A;  4GOC A;  1R4M I;  2GOW A;  2UWQ A;  4II3 B;  4WWP A;  3ZNI D;  2LI5 A;  2KD0 A;  3DBL I;  4RM9 A;  2MBQ A;  2REX A;  5C23 A;  4EZJ A;  2JF5 A;  3RZF A;  1V5O A;  2KO3 A;  4HPM B;  4WJN A;  4K7U A;  3HHM A;  2FCS A;  2KFK B;  3TCA A;  2MCN B;  1I35 A;  2C5L C;  3UIO B;  3V60 A;  2KJ6 A;  2L0F A;  3RD2 A;  3ZIM A;  3JSV A;  2KWC A;  2GBN A;  3X0W A;  1E8Z A;  1PQS A;  1UD7 A;  2RD0 A;  3ONS A;  5CHV C;  5BO4 B;  4WWN A;  4EZL A;  2LRW A;  2UYZ B;  2KJH B;  4I6L B;  5LXH A;  4EUT A;  3B0A A;  3A1Q A;  3RYT A;  5J17 A;  4PS7 A;  2JVC A;  5IAA C;  3AXC A;  3ZVV A;  2KLG A;  5E6O A;  2YLM A;  3S2A A;  4KDL B;  4NAW B;  3R7Q A;  1AAR A;  4E74 A;  4MH0 E;  3DBS A;  2C7N B;  4JL9 A;  4HDO A;  1P1A A;  2CKH B;  3AU5 A;  4WJP A;  3DVG Y;  4GMV A;  2PE9 A;  4CYE A;  2KOX A;  3AI5 A;  4DHJ D;  1E7V A;  4JIO U;  3MTN B;  3H7P B;  2FIF A;  3UIP B;  3VH4 B;  2ZPY A;  2XEW A;  1BT0 A;  3AUL A;  3JW0 X;  1H8C A;  1OEY J;  5AZH A;  3QIJ A;  1GC7 A;  2KZR A;  3PLV A;  3IBE A;  3UQB A;  1WZ0 A;  2A4Z A;  2KX0 A;  4XX5 A;  3V6E B;  2Z0E B;  3VQI A;  3R7R A;  1RAX A;  2LVP A;  2MWS B;  1EUV B;  3WAO A;  1IP9 A;  2N7E A;  3VUW A;  1F9J A;  2IY0 B;  3VXW A;  1KJT A;  1EF1 A;  3T8M A;  3WAM A;  4FJY A;  4WJQ A;  2K6D B;  1WGR A;  1S3S G;  4BBN C;  2BGF A;  1YIW A;  2JY6 A;  3CSF A;  4N9F 4;  4GDL A;  3VFK A;  4KDI C;  2NCN A;  1P3Q U;  4W9L A;  4ASW C;  3UQA A;  3A4R A;  1XD3 B;  4FHK A;  2EMS A;  2Y5B B;  4HK2 A;  1WGD A;  3APC A;  4IUM B;  4LCD E;  2KWU B;  3R3M A;  4W9C A;  3QJZ A;  2M17 A;  2MRP A;  1UBQ A;  2DEN B;  4W9I A;  4B6W A;  4W9H A;  2G4S A;  3SD5 A;  1GJZ A;  3A9K A;  2IO3 B;  3GOE A;  3ML8 A;  1IYF A;  1EF5 A;  3KUC B;  5L95 C;  2KK8 A;  4M8M A;  3QWZ B;  3ZTC A;  3PRZ A;  1Z2M A;  5KHQ A;  2CS4 A;  4G11 A;  5L83 A;  1IPG A;  3VUX A;  2PE6 B;  3DPD A;  2KFK A;  5DPR A;  1NDD A;  2N7D A;  4JQW C;  3APD A;  3VVW B;  4HPL B;  1GUA B;  4KSL C;  2KNB A;  2KC1 A;  1ZGU B;  4RM8 A;  3HM6 X;  3PTF C;  2NPT A;  3L17 A;  5D6J B;  4LDT D;  2KDE B;  2D2Q A;  2GBM A;  4ZYN A;  2L7R A;  3D32 A;  3PPA A;  4X57 B;  2DZK A;  1WXM A;  5G2N A;  3H1U A;  3IHP C;  2FID A;  2KTR A;  1Y8R C;  2GMI C;  3M95 A;  4FHJ A;  3A9J A;  2AL3 A;  2BF8 B;  3A4S C;  3PT2 B;  4KVG B;  3SHQ A;  2BYV E;  2N9E B;  3Q3J A;  4FJZ A;  4IC7 B;  1RRB A;  1WGY A;  3RT3 B;  4ICV A;  1E5W A;  1E8X A;  1S1Q B;  4MSQ B;  1RLF A;  2BKR B;  2DZJ A;  1WM3 A;  4MJS B;  3P2B A;  2QHO A;  1R4N I;  1WH3 A;  3U30 A;  2LGY A;  2LAS A;  1OEY A;  2CU1 A;  4EZK A;  4F7Z A;  3EC8 A;  2D11 A;  5HKH A;  3OLM D;  2G4D B;  3H7S A;  2LWP A;  3QX1 A;  3TBL D;  2IZV B;  4B95 A;  1XQQ A;  1V5T A;  1V9J A;  2DX5 B;  4BKG A;  1WMH A;  2O2V A;  4AUQ C;  1TTN A;  3DVN V;  3PRE A;  3PS6 A;  4FUL A;  2C7M B;  3UGB B;  2ASQ A;  2K1F A;  4URK A;  2N9P C;  2IO2 B;  3A9K B;  3O65 B;  1WIA A;  2KLC A;  1J0G A;  1WJ4 A;  3N32 A;  2L8J A;  3VDZ A;  3MHS D;  1WM2 A;  1OQY A;  3QAQ A;  5JHA A;  4JLC A;  2KDB A;  2KDF B;  2M8S A;  3KUZ A;  3PGE A;  4GB9 A;  4IWO A;  4KIK B;  2D10 A;  3KYC D;  2W9N A;  2MP2 B;  1V2Y A;  1GC6 A;  4IM0 A;  1JRU A;  1NI2 A;  3DBR I;  2EKE C;  2BKF A;  2LVO A;  3L54 A;  4IW0 A;  3LDZ E;  3OJ3 A;  3A9J B;  2MBH A;  4JGH B;  1WY8 A;  2WDT B;  2AYO B;  5AEK B;  1WI0 A;  2NBU A;  4EKU A;  3HK0 A;  2Z59 B;  3H7P A;  2LGX A;  1FXT B;  5D94 A;  2MX2 A;  1RFA A;  4MJS A;  4W9D A;  5IA7 A;  2J0M A;  2NS5 A;  1QZE A;  3ZTD A;  4EFO A;  2HTH A;  2KVR A;  4AP4 C;  5JZE B;  4II2 B;  3SDL C;  3TIX A;  3ZO5 B;  4KZ0 A;  3PLU A;  1T0Y A;  1UGM A;  1L7Y A;  2CHZ A;  2KAN A;  4GDK B;  2G3Q B;  2LUE A;  2LXC A;  2KTF A;  1XT9 B;  2CHX A;  2B3A A;  3CMM B;  3KVF B;  4P7I A;  2K25 A;  2KMC A;  2JT4 B;  3A1Q B;  4FAD A;  3B08 A;  2XBB C;  2ZCC A;  3EHV A;  3IG3 A;  4NAW A;  4A3P A;  5JHB A;  3KYD D;  2MA9 B;  1GG3 A;  4PS8 A;  1C3T A;  3MJW A;  4CHK A;  4MDK E;  3W1Y A;  4LDT B;  3W1S A;  1GNU A;  3ZKJ C;  3PHX B;  2KXJ A;  2KN5 A;  3U8Z A;  4EOY A;  5CHF A;  3A33 B;  2I1J A;  2EMT A;  1NBF C;  3NZS A;  2K39 A;  3GZN I;  2RR9 A;  2G45 B;  3BY4 B;  2O6V A;  4DBG A;  4CO7 A;  1E8W A;  2IO1 B;  4BOZ B;  3L0W B;  2MSE D;  2NR2 A;  2JZZ A;  4ANW A;  3LJ3 A;  5DCN A;  2XK5 A;  2HJ8 A;  1WR6 E;  2ZCB A;  1VCB A;  3ALB A;  4G50 A;  4DHJ B;  1Z5S B;  2A5U A;  2WWZ A;  3QHT A;  4IWP A;  4ANV A;  3SU8 X;  2K6Q A;  2J0J A;  3NZU A;  4HXD A;  3ENE A;  3L16 A;  4GGQ A;  4OVV A;  4ZRK A;  4MM3 A;  1WRD B;  1WX9 A;  2KC2 A;  1EO6 A;  4HDQ A;  1WXA A;  3RUI B;  2RPQ A;  2ZPN A;  4W9G A;  2BWF A;  3IVF A;  5TR5 A;  5CHW A;  4A20 A;  1VD2 A;  2J0K A;  4NPN A;  3APF A;  4FA6 A;  4KZC A;  2C7H A;  3UIN B;  3VTV A;  2MBB B;  4DWF A;  5D7G A;  3C0R B;  3V6C B;  3OAW A;  1P98 A;  3TMP B;  3CF6 E;  2L00 B;  3KW5 B;  2K8B A;  4A3O A;  1UZX B;  2M4N A;  4BKS D;  4PS3 A;  3WAP A;  1WJ6 A;  3PV1 A;  4FJV B;  2ZNV B;  1WYW B;  4BKS A;  4DXA B;  2DAF A;  2LXA A;  3TL5 A;  1ZKH A;  2BYF A;  2M0X A;  1A5R A;  1Q0W B;  2AL6 A;  3PRM B;  1WE6 A;  4NY0 A;  1LFD A;  4WQO B;  3ML9 A;  2I1K A;  1WX8 A;  3Q3F A;  4W9E A;  4W9J A;  3JSV B;  2JPH A;  3H9D A;  4I6N B;  4M8N A;  4EEW A;  3VTU A;  4XZ4 A;  1WFY A;  3RCZ A;  3PRP B;  4TKN A;  2V1Y A;  3I3T B;  2BPS A;  3ZNH B;  2JUO A;  2KX3 A;  1YJ1 A;  2KTR B;  4PYZ A;  4FBJ B;  3NHE B;  3ZDM C;  4BBN F;  1U4A A;  2AWT A;  2DHZ A;  1K8R B;  4K7W A;  3OJ4 B;  2KKC A;  4PYU A;  1UBI A;  2L76 A;  4I6P A;  4M0W B;  2JRI B;  2WX1 A;  4KV2 A;  4DK5 A;  3DOW A;  1P9D U;  1YQB A;  2Z0D B;  4WWO A;  2ZNV C;  5E6P A;  2N9X A;  3ZDT A;  2WX0 A;  1YX5 B;  1J19 A;  2O6V B;  1WJU A;  4HLE A;  1LM8 B;  4GXB A;  1I42 A;  3L13 A;  1OGW A;  4NJ7 A;  2LJ5 A;  2IO0 B;  2MBE A;  2GBJ A;  3HIZ A;  1WF9 A;  3ZLZ A;  4F8C B;  4MGI E;  2R2Q A;  4HWI B;  5FR6 A;  1V80 A;  3DBH I;  4E3C A;  4LJP B;  2OOB B;  1WMH B;  2O2V B;  3QA8 A;  5J18 A;  2DZM A;  1X1M A;  4GDL B;  4YL8 A;  1Q5W B;  2ZEQ A;  3RUL A;  2JWZ A;  2CHW A;  4HCP B;  1E90 A;  2MBO A;  2N4F A;  3QAR A;  4MGZ E;  1KLV A;  2K8C A;  2MLB A;  2HD5 B;  1WGH A;  5JH5 C;  2MW5 A;  4GIV A;  2FAZ A;  3ZNZ B;  2K8H A;  3R66 C;  2CR5 A;  1LQB A;  3QQ8 B;  4RMA A;  3WAN A;  2V3S A;  2KJR A;  5D2M B;  4G3X B;  1UEL A;  3CST A;  1TZ1 A;  3JYU A;  4MGK E;  2AEH A;  2D3G A;  5DPW A;  1G6J A;  5KHO A;  2IYD B;  2NBV B;  1Q1O A;  2N1V A;  2C9W B;  3NS8 A;  3T9L A;  2FCN A;  5J2R A;  3TJP A;  4BOS C;  3NY5 A;  2LGD A;  2HE7 A;  1TGZ B;  3M3J A;  1YD8 U;  4WAA A;  1WXS A;  1P0R A;  3VH3 B;  3EEC A;  3U7D A;  2IY1 B;  2FUH B;  4KIK A;  3W1S C;  3DVG X;  1V6E A;  3ECI A;  4FLH A;  2IBI B;  1H4R A;  1MG8 A;  2BWE S;  2LZ6 A;  4ZRI A;  2YVC A;  3EFU A;  1TBE A;  1OTR B;  3VHT C;  4ANU A;  2KFJ A;  2KDI A;  1D3Z A;  3QCA A;  4NQL B;  3RZW C;  2V4L A;  5C1Z A;  4DDI D;  4KSK C;  4K81 A;  1E7U A;  3VAW A;  4AWJ A;  4TQ1 A;  2KMA A;  1WZ3 A;  1SGH A;  2J7Q B;  2L05 A;  1ZW7 A;  4MEM A;  4HCN B;  3N30 A;  1SIF A;  1KOT A;  4TQ0 A;  2N1W A;  3QK0 A;  4IWQ A;  4G0N B;  3PZD A;  3X23 A;  1L2N A;  1YX6 B;  3DDC B;  3L10 B;  2ZJD A;  4ZRJ A;  3UF8 A;  5DPS A;  3DQV A;  3L08 A;  2LRU A;  4K1R B;  1KM7 A;  4HVB A;  4ICU A;  2JRH A;  4GDK A;  2PPH A;  4HJK A;  5CTR C;  3KUD B;  1M94 A;  4DHZ B;  3VTW A;  3PVL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...