1WY8A

Solution structure of the n-terminal ubiquitin-like domain in human np95/icbp90-like ring finger protein (nirf)
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
89
structure length
89
Chain Sequence
GSSGSSGMWIQVRTIDGSKTCTIEDVSRKATIEELRERVWALFDVRPECQRLFYRGKQLENGYTLFDYDVGLNDIIQLLVRPDSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Np95-like ring finger protein, isoform a
publication title Solution Structure of the N-terminal Ubiquitin-like Domain in Human Np95/ICBP90-like Ring Finger Protein (NIRF)
rcsb
source organism Homo sapiens
molecule tags Ligase
total genus 12
structure length 89
sequence length 89
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2005-02-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00240 ubiquitin Ubiquitin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 1wy8A00
2DYBA 3APFA 1H4RA 1P0RA 4GIVA 2GBMA 3VAWA 3ECIA 1YX5B 4BBNC 2GBJA 4W9FA 1EO6A 1SGHA 3BY4B 4FA6A 4G0NB 3VTUA 4TUUA 2KD0A 4K1RB 4IW0A 3TIXA 4HWIB 1OGWA 4BFRA 2XBBC 3DBSA 1KM7A 3HK0A 3ZLZA 4DWFA 2WX1A 4NY0A 3W1SA 1WZ0A 1WX9A 3DVGY 3OJ4B 3ZO5B 2ZCCA 1I42A 4PS8A 2L7RA 1X1MA 3PRPB 4II3B 2MBEA 2J0JA 2JT4B 4GDKB 4HPLB 3ZRFA 1V2YA 4E74A 2KZRA 2LJ5A 4W9GA 5AZFA 3IVFA 2KK8A 1SIFA 4AOFA 2LRWA 2O6VA 2NBWB 1WH3A 4DHJD 1WM2A 3B1LX 2KDEB 1FXTB 3NOBA 3QJZA 4KIKB 2FCNA 1YD8U 2KTFA 4OVVA 4B95A 4A20A 3HM3A 5CHFA 2DENB 2LGYA 1WR6E 3HHMA 4EKUA 4WWPA 3PREA 3W1SC 2PEAA 3VUWA 4W9CA 3QARA 2KMAA 3KUCB 3IFWB 4IUMB 4NNJB 3PPAA 4DDGD 3KYDD 4B9KA 2BF8B 4FN2A 5CHWA 5J18A 2JRHA 1F9JA 4PYZA 1RRBA 5CTRC 4BOZB 5DPSA 2KWUB 4TKNA 1OEYJ 3DOWA 3V60A 5L83A 5LXIB 4IWQA 3ZNID 3U7DA 2LGXA 3L10B 3N3KB 3SHQA 2KN5A 3PRMB 4GN1A 2BPSA 4G3XB 4ASWC 4GOCA 4IM0A 5J17A 3WALA 2R2QA 2WYQA 2JF5A 4KDIC 2KVRA 2CR5A 2KX0A 2KKCA 3ZTDA 4GU2A 2K8BA 1WXVA 2PPHA 4W9JA 3LJ3A 1RAXA 4W9KA 2Z0DB 2LRUA 1TBEA 2FIFA 1WM3A 2C9WB 1R4NI 2L0TA 3UIPB 4MGZE 1YIWA 4MELA 4BBNF 3Q3JA 4GXBA 1WFYA 2MWSB 3DBRI 1T0YA 3A9JA 1GC7A 1WE7A 2PE9A 1V86A 2KDBA 4FHJA 2KTRB 2XK5B 2LGDA 3OAWA 3RCZA 2KQSA 4PS3A 1WMHA 4LCDE 4XZ4A 1XT9B 3ZKJC 1S3SG 5C23A 5KHOA 4CYEA 3KVFB 3H1UA 4BKSA 2M8SA 4ZDVA 2M4NA 2JZZA 1WZ3A 3VQIA 4WJOA 2B3AA 2MLBA 3TBLD 5HKHA 1J0GA 2D3GA 1G6JA 2KMCA 1XD3B 3M3JA 2K8CA 1K8RB 1LXDA 2O6VD 2IO3B 2K39A 4I6PA 1UBQA 3N32A 4NQLB 4KDLB 2FCMA 4URKA 2HD5B 1WXMA 2KHWB 4ICUA 1J8CA 3WAPA 2LASA 2BYFA 1Q1OA 3ZW3A 1XQQA 2DYOA 3OLMD 2BYEA 2GBNA 1I35A 3KUZA 3L0WB 4XC2A 2JVCA 4MGYE 4KV2A 2FIDA 4HDOA 4TQ1A 4HJKA 2KANA 3WAOA 2Z59B 3UGBB 5DCNA 5FR6A 4EEWA 3A4RA 3DPDA 2IYDB 3B08A 4K7SA 2EMSA 4WWNA 2J7QB 3AI5A 4X57B 2FUHB 4RM9A 2EMTA 4GDKA 2CS4A 1WJ4A 3PSEB 3MJWA 2DZMA 4IG7B 4LDTB 1GG3A 2N4FA 4IM2A 4W9IA 5L95C 3L08A 4KZ0A 4MGKE 2KC2A 2W9NA 3PLUA 4WJQA 4WJNA 3A9KB 4KIKA 2M1MA 3X23A 2N1VA 3ZVVA 4AJWA 4ZRIA 4DHJB 4HPMB 3AULA 2ASQA 2C60A 4EZJA 2K25A 2DAFA 2DYMA 2D10A 1Y8RC 1E7UA 3I3TB 2NPTB 1EF5A 4TV3A 4BVUC 2L05A 4DBGA 2JXXA 2L8JA 2L3ZA 3QCAA 2RR9A 4KVGB 3EECA 3QAQA 5EDSA 2BWFA 4EOYA 2MQJA 2N7DA 1S1QB 2OJRA 3QHTA 2NCNA 2CU1A 2DZIA 2QHOA 3VH4B 1V80A 4YL8A 2MCNB 4PYUA 3DDCB 3RD2A 2AYOB 3IG3A 5G2NA 3RYTA 3U8ZA 2ZNVB 2ZNVC 3T8MA 4A3OA 2FCQA 1IPGA 4DDID 2G4SA 2AWTA 2CHXA 1WIAA 2KDIA 3VDZA 3PGEA 1IP9A 5JH5C 3RZWC 1UZXB 3PS6A 1P98A 5E6OA 3K9PB 3SD5A 4ANWA 2JPHA 2G45B 2NBUA 3N30A 3KH0A 3APCA 3WAMA 3NY5A 2K6DB 3SU8X 1Q5WB 1V9JA 2MRPA 3O65B 4FJVB 5GMVA 3PT2B 3VHTC 4ANVA 1E8ZA 2PJHA 5J2RA 1L7YA 1WXAA 3A4SC 1E8WA 1NI2A 5E6PA 3D32A 1MG8A 2PE6B 4JGHB 3QIJA 4TQ0A 4W9DA 2JWZA 2KTRA 2JY6A 2XK5A 2UWQA 3RUIB 3UF8A 3ZNGC 4AWJA 1C3TA 1UD7A 2C7NB 2UYZB 3QK0A 4ANUA 2KQ7A 3GZNI 2LZ6A 3VFKA 1WXSA 3QA8A 4B6WA 3HM6X 3PVLA 3VUYA 4LJOB 1Z2MA 2WX0A 3L16A 3QC8B 4GDLB 2CHZA 4GB9A 2R2OA 3ZDTA 3ZUNA 1WRDB 2REXA 1UELA 1UGMA 3VVWB 1EUVB 1V6EA 2RSUA 2KOXA 5D2MB 1WGHA 3T9LA 1AARA 1KJTA 3PHWB 3MTNB 1R4MI 3EHVA 3PV1A 2BWES 4NAWA 2GMIC 3AU5A 3ML9A 1WJUA 2MSED 4GSWA 3VTWA 3TL5A 2CHWA 2ZVOA 3IHPC 3UINB 4BKGA 3ZNHB 2C7HA 3R3MA 5TR5A 2MBBB 1L2NA 2KFKB 4MSQB 3LDZE 2NS5A 2K1FA 3DVNV 2JUOA 4I6NB 1WX8A 4P7IA 4KSKC 1U4AA 3QWZB 3Q3FA 1C1YB 2DX5B 3BINA 3EC8A 3C0RB 3PRZA 2A5UA 2JZ3B 2Z0EB 2IY1B 4MJSA 2IY0B 2K8HA 4HCNB 3SDLC 3JVZX 4K81A 1Q0WB 2KX3A 2MBOA 2LVPA 1WGGA 1A5RA 3A9KA 4MEMA 3S2AA 4NAWB 3V61A 2L00B 4A3PA 1UBIA 4ZRKA 2ZPYA 2D2QA 4II2B 1J19A 1E8YA 3CMMB 5E6NA 3P2BA 2BKRB 1RFAA 3PTFC 4NJ7A 3PZDA 1OEYA 1NDDA 1TGZB 1E7VA 2LWPA 4OVUA 3V6EB 3W1YA 4AUQC 2RGFA 1WYWB 2NPTA 5KHQA 1WR1A 2KJHB 4I6LB 4ANXA 3M62B 3ZNZB 1WGRA 2KC1A 2FCSA 3EFUA 2BYVE 2ZPNA 3M63B 2V1YA 2MP2B 2N7EA 4K7WA 4ZRJA 5LXHA 2IZVB 4FJZA 4MJSB 1SE9A 2MBHA 2MX2A 5D7GA 4RMAA 1YJ1A 4CO7A 4DK5A 3ZDMC 1BT0A 1WI0A 1V81A 2V4LA 4HCPB 1P1AA 4MSMB 1V49A 4WJPA 2KWVB 1WGDA 2N9XA 2MBQA 1WX7A 2V3SA 2G4DB 2KLCA 3HIZA 2KJRA 5AZGA 2VRRB 4CHKA 3NS8A 2DAJA 1NBFC 2IO2B 2NBVB 4G11A 3X0WA 2HTHA 2G3QB 4IWOA 1OTRB 4ICVA 4E3CA 3B0AA 2J0KA 3KW5B 2KLGA 4IWPA 2L0FA 2MA9B 2N1WA 2N9PC 2L76A 4MDKE 5D94A 1PQSA 5DPRA 3ML8A 3A1QA 3DBLI 3WANA 2RD0A 1Z5SB 3R66C 4BKSD 4FJYA 3QQ8B 2Y5BB 4K7UA 4KSLC 2JRIB 3H7PB 3V6CB 1CMXB 3PHXB 2BKFA 5CX3A 2IO0B 4LDTD 1D3ZA 3CF6E 4GDLA 3ZRCA 4F1SA 2KO3A 4EZLA 1P9DU 2WWZA 1LM8B 1OQYA 4GMVA 3M95A 2ZEQA 4DHZE 4FBJB 2ZJDA 1E5WA 3QX1A 4JIOU 3GOEA 3UQBA 4FHKA 3L13A 4E71A 3A33B 2N9EB 4WWOA 4N9F4 2O2VA 2XEWA 4BKTA 2CKHB 3AU4A 4F7ZA 4MH0E 4EZKA 4JQWC 3DVNU 3TJPA 2IBIB 3A1QB 2KFJA 2YLMA 3IBEA 3JSVA 5DPWA 4GGQA 2I1KA 1UH6A 1YX6B 1IYFA 1YQBA 2KFKA 1GC6A 1EF1A 4HVBA 3L17A 3ZTCA 4WAAA 2DZJA 4M8NA 2DHZA 3V62A 2YVCA 2AEHA 2MW5A 5IA7A 2RPQA 1ZGUB 4LJPB 3DBHI 2HE7A 2ZZPB 1KOTA 1WJNA 1GJZA 4W9HA 3H6NA 4XX5A 2O6VB 5JHBA 2DZKA 3OJ3A 2LVOA 3NZUA 2D07B 5AZHA 4BOSC 2O2VB 1E90A 4G50A 3R7QA 4WQOB 4AP4C 4JLCA 3NZSA 1H8CA 3H9DA 5DPTA 1HE8A 2D11A 3JSVB 3VUXA 1JRUA 4RM8A 5JHAA 2LVQA 2ZCBA 3RT3B 3UIOB 4NQKE 1V5TA 2BGFA 4KZCA 2LD9A 3CSFA 2FNJB 1ISNA 2I1JA 4MM3A 1RLFA 2LUEA 4FLHA 2C5LC 3VH3B 1LFDA 2J0MA 4AJYB 3DQVA 3KYCD 4HXDA 3R7RA 2MP2A 1GUAB 1LQBA 4HLEA 4FULA 4HDQA 3KUDB 4JL9A 1TZ1A 2GBRA 3L54A 1V5OA 2GBKA 4EUTA 4HK2A 3DVGX 1VD2A 2NVUI 4M8MA 4F8CB 3VXWA 2NR2A 2KDFB 4EFOA 3U30A 2HJ8A 4DHZB 3JW0X 1P3QU 2AL3A 3TMPB 1TTNA 4J6IA 3MHSD 2KWCA 2LI5A 1ZKHA 3CSTA 1KLVA 2LXCA 1WE6A 5C1ZA 3K9OB 2KNBA 4NJ6A 4IM3A 3RZFA 3PLVA 2FAZA 4FADA 2ZVNA 5CHVC 2KJ6A 3ENEA 3A9JB 2K6QA 5D6JB 3ZIMA 5JZEB 2AL6A 3APDA 2GOWA 5AEKB 2A4ZA 3DCGA 4NPNA 2KXJA 2EKEC 1GNUA 1WMHB 4MGIE 3VTVA 2OOBB 3JYUA 4IC7B 4W9LA 3RULA 1E8XA 3H7PA 2WDTB 3UQAA 1M94A 5IAAC 1VCBA 4ZYNA 1WF9A 4PS7A 1QZEA 2M17A 3AXCA 3WA0A 1WGYA 4M0WB 3TCAA 3ONSA 5G55A 3WIMA 5LLIA 3ALBA 1WY8A 2LXAA 2M0XA 2IO1B 3H7SA 5BO4B 1ZW7A 3NHEB 1WJ6A 4W9EA 4DXAB 2C7MB
chains in the Genus database with same CATH superfamily
1P0RA 4BBNC 2GBJA 4W9FA 2WP9B 3VTUA 2KD0A 3SFEB 2XBBC 3ZLZA 1KM7A 3FC4A 4NY0A 1FRDA 4PS8A 2L7RA 3ZRFA 2LJ5A 4W9GA 1E10A 5BMHA 2WDQB 3BZDB 5BYQA 3BYYB 3QJZA 2FCNA 4RFBA 3DHHC 4OVVA 1R7SA 3HHMA 3NRZA 3AE6B 3ETRA 2WDVB 4DDGD 4NNJB 1TS3A 1RRBA 3DOWA 1J7AA 2OEDA 4IWQA 3L10B 3SHQA 4RCOA 5J17A 4ASWC 4GOCA 2WYQA 2KVRA 2LGIA 1UWXA 2N9KA 2KKCA 3ZTDA 1YJIA 1WXVA 3MC8A 2BT6A 3LJ3A 4W9KA 4LTUA 1WM3A 2C9WB 1XLOA 3ZJTA 4BBNF 3Q3JA 1WFYA 2MWSB 3DBRI 3ABVB 1WE7A 2PE9A 2J52A 1FEHA 3AEEB 1V86A 1SIJA 2LGSA 1PGBA 3NVWA 3SFDB 4PS3A 4LCDE 3Q69A 2WDRB 1VZ6A 2SEBD 5KHOA 3KVFB 4YTPB 1ESFA 2QDFA 1XF5L 2JZZA 1WZ3A 4WJOA 1C79A 1L6UA 3M3JA 1K8RB 2K8CA 2IO3B 3TEWA 2FCMA 2HD5B 2KHWB 4PT5A 3WAPA 3ZW3A 2BYFA 2QMTA 1XQQA 2DYOA 2KMMA 3L0WB 4MGYE 4HDOA 3OG5A 3WAOA 2BS3B 3UGBB 3A4RA 2IYDB 2WXPA 1L0YB 3PSEB 3MJWA 4LDTB 2N4FA 4HKQA 4ARIA 3Q14C 2VZKD 4HPPA 4P16A 3N1YC 3PZ7A 3A9KB 4KIKA 2AQ1B 3N1XC 4AJWA 1JALA 1KTKA 2D3BA 1NENB 4C7YA 2C60A 1F0ZA 4JE3B 1FFUA 2DYMA 4LNKA 1KLGD 4RNAA 1E7UA 2L8JA 3QCAA 2RR9A 2UU7A 4KVGB 1JWAD 5EDSA 3GE3C 2N7DA 2CJOA 2FCQA 4RGNA 4DDID 1N61A 1MI0A 5FKAC 2LEKA 2KDIA 3VDZA 3PGEA 2V0GA 3R2TA 1IP9A 4WAFA 3RZWC 4YSXB 5E6OA 3K9PB 4ANWA 2NBUA 3NY5A 1T3QA 2BS4B 4C7ZA 2L32A 3SU8X 3ZXRA 2MRPA 3PT2B 3VHTC 3EUB2 5J2RA 5E6PA 2PE6B 2KTRA 4DXGA 1ET9A 2UWQA 2WXFA 3EGRA 2WU2B 2KQ7A 3GZNI 4YWGG 2INDC 3QA8A 4B6WA 2QJLA 5HHDG 1VDVA 1BUIC 2Z8LA 1WRDB 1EWCA 1UELA 1EUVB 2RSUA 2KOXA 2PIAA 3P4SB 3EHVA 2MSED 5FR3A 1SEBD 3UINB 4TMAB 3R3MA 2MBBB 2PLPA 1WX8A 4P7IA 1C1YB 5IN7A 4LK0M 2IY0B 2K0PA 2MBOA 1WGGA 2NMQA 1UWMA 3S2AA 2JXTA 2L00B 3CMMB 1I4QA 1VJKA 2ON8A 1V1OA 1WYWB 5E6JA 1EU4A 1WR1A 4I6LB 4ANXA 3ZNZB 1MJDA 3PO0A 3EFUA 1PYWD 4RGTA 2MP2B 4K7WA 2IZVB 3BK1A 4RMAA 3RMKC 1IGDA 4CO7A 2LHEA 1WI0A 2V4LA 1P1AA 4MSMB 1V49A 2INPE 1XLQA 1WGDA 2WQYB 2N9XA 1VZ8A 2KLCA 3HIZA 5AZGA 3NS8A 3R2IA 2HTHA 3VRBB 2J53A 4KGTA 4ICVA 4E3CA 3B0AA 1Y56A 2J0KA 5D94A 3A1QA 1FIQA 2RD0A 1Z5SB 3EFCA 3GP7A 2JRIB 2N9LA 2LMCA 3AV8A 3PHXB 1N63A 2BKFA 2V3PA 4C80A 3BWUD 1SE2A 4S17A 1LM8B 3L4PA 4IOIE 4GMVA 3M95A 3UQBA 1E5WA 1XCQL 4FHKA 4E71A 2N9EB 2I2YA 2CKHB 3AU4A 3TJPA 3A1QB 2YLMA 3L17A 4RF0A 4WAAA 5T8IA 1DYQA 3V62A 4HKZE 4C56C 2WXIA 1UUPA 1FNWA 2MH7A 2ZZPB 1TS4A 1FPYA 1QLBB 2D3AA 2LHDA 2O6VB 5JHBA 1EWYC 2D07B 4BOSC 4O1NA 3P4RB 3H9DA 3VUXA 1YQ4B 4XDDA 2HTME 1V5TA 2PW9A 2BGFA 2MJEA 3CSFA 1KLUD 2GLSA 4YTNB 2FNJB 4MM3A 1ZE3D 3P42A 2LUEA 1HA5A 1LFDA 2J0MA 4ZYSA 3AE2B 3KYCD 2QCZA 1GUAB 4HLEA 4HDQA 1FXAA 1TZ1A 5BMGA 2RPVA 3U4EG 3URYA 2NVUI 3U30A 3DBHB 4DHZB 1E9MA 2XNAC 2INNE 2WS3B 1PGAA 3CSTA 1UNSA 1I4HA 2ZVNA 2KJ6A 3ENEA 1JCKB 2BBCA 2K6QA 1FM0D 2IGHA 3APDA 2A4ZA 2VH1A 4NPNA 1ROEA 2KXJA 4TSSA 1T0SC 4MGIE 2OOBB 3JYUA 4IC7B 1GAQB 4W9LA 5JXVA 4OZCA 1M94A 5IAAC 1VCBA 4ZRQA 4PS7A 3Q3NC 1IBXA 2KWDA 2IO1B 2E3TA 4M00A 5BO4B 2JU6X 3UI3A 1CZPA 4GIVA 1D5XC 3ECIA 1YX5B 5BYRA 4UDUC 4M02A 1SGHA 3AE5B 4G0NB 1TKEA 3TIXA 4HWIB 1OGWA 1HZ5A 1QT9A 2JQRB 4A55A 5GXGB 2WX1A 3TSSA 3OJ4B 3ZO5B 2KYWA 1JQ4A 2J0JA 2GRIA 4E74A 2KZRA 1N62A 3MC9A 2PKOA 1SF0A 4HRSA 4AOFA 3NJTA 4M01A 1WH3A 5MPOA 3B1LX 2KDEB 3MC0B 3NOBA 3DWGC 1A70A 5CHFA 3NVYA 3VUWA 2KMAA 1C76A 3PPAA 3KYDD 4ZHOA 2BF8B 4FN2A 1K52A 2XN9C 1UF0A 2KWUB 3HVDA 4ACFA 5L83A 3ZNID 1ACCA 3U7DA 4GN1A 2R2QA 2JF5A 4KDIC 5FK9C 2PPHA 1RAXA 4JWSC 1TBEA 4C4VB 3NVVA 1YIWA 1TIFA 1T0YA 1B1ZA 1L5PA 3A9JA 3KWLA 1TS2A 2LGDA 3RI7C 2KQSA 4XZ4A 1WMHA 1XT9B 2Y5CA 1I4GA 3H1UA 3HUIA 2M4NA 2MJ3A 2PVGC 3VQIA 4C00A 1ZUD2 1J0GA 4ZHPA 2D3GA 3CWIA 1G6JA 4S0RA 1AN8A 2H88B 3FKYA 4I6PA 1UBQA 4KDLB 1LGRA 1K51A 3BVMA 4ICUA 2LASA 3OLMD 1SBBB 3NUHB 3KUZA 4XC2A 4KV2A 2HJ1A 2FIDA 2KANA 3AH7A 5DCNA 2QILA 3IAM1 4K7SA 2J7QB 3DBRB 4X57B 4BZAA 4KGSA 2WXRA 2DZMA 1GG3A 4W9IA 5L95C 3L08A 3PLUA 4WJQA 1GOZA 3GS2A 4WQMA 2JYTA 4EZJA 2K25A 3AB5A 2FE8A 2D10A 1F2RC 2NPTB 5EE1A 2L3ZA 2DWQA 1F77A 3QAQA 2BWFA 1FD6A 3RNAC 1S1QB 2L83A 3QHTA 1HQRD 2NCNA 2CU1A 1DOXA 2DZIA 3VH4B 1V80A 4YL8A 2MCNB 4PYUA 3DDCB 2AYOB 4P1CC 5G2NA 1V8CA 3T8MA 1IPGA 4Q2JA 3AE3B 2G4SA 5JH5C 1N5XA 4NZLB 1ZDVA 2G45B 3E56A 3KH0A 3APCA 3WAMA 2K6DB 4XWWA 1V9JA 3O65B 4FJVB 5GMVA 1L7YA 1HEZE 1TYGB 1E8WA 1NI2A 2PVOD 3A4SC 3D32A 1MG8A 4JGHB 4AWJA 4LNFA 2C7NB 2UYZB 4ANUA 1BXTA 1HTOA 2LZ6A 1ZOYB 3HM6X 1I4PA 2WX0A 4GB9A 4GDLB 4ITKA 1FXIA 3DBLB 3ZUNA 4L2YA 4USAA 4FXCA 3TEYA 1KJTA 2V3NA 2BWES 4NAWA 2GMIC 3AU5A 1ZXHA 3TL5A 2CHWA 3ZNHB 2C7HA 1L6VA 2KFKB 4A9AA 4MSQB 3TUOA 2X38A 4A6QA 2K1FA 2JUOA 2B76B 4L1BA 4KSKC 3AN1A 4HJGE 3EC8A 2JZ3B 2Z0EB 3GZNB 3P63A 2K8HA 4RGOS 1C78A 2KX3A 3RNBC 3A9KA 4NAWB 3V61A 4N6EB 4A3PA 4II2B 4AS1A 2VH2A 2RGFA 2KJHB 1T6BX 2V1YA 2N7EA 2KT7A 4FJZA 1QQRA 2KAJA 2BW2A 1MPEA 2MBHA 2MX2A 3MHZA 4HROA 1K50A 1ENFA 3EA6A 1NEKB 1WWTA 2KWVB 5EE0A 1VZ7A 2K22A 2MBQA 1L4DB 4P1BC 2DAJA 2NBVB 4G11A 5BMIA 4RF1A 5C3JB 2KLGA 1D5MC 2N1WA 4MDKE 2MHJA 3AE4B 3DBLI 5IO9A 1E6EB 4BKSD 2ICIA 4FJYA 3QQ8B 1P7FA 2Y5BB 4KSLC 3V6CB 5CX3A 1D3ZA 4H2AA 2DBYA 4YT0B 4IKGA 3T3NA 4FBJB 4WWOA 1J7CA 4N9F4 2XEWA 1FMAD 3P4PB 2QSDA 2KFJA 1FCCC 3JSVA 3Q8AA 1IYFA 1UH6A 1YX6B 3MFGA 2GB1A 2RDHA 2DZJA 4A90A 5IKCM 1SSNA 1KOTA 2DLBA 2KACA 4XX5A 2LJIA 3V3XA 2DZKA 2RDGA 4RH6A 2PMVA 5AZHA 1E90A 1QOBA 3Q2AC 4WQOB 4ARCA 3N9YC 1HE8A 3JSVB 4RM8A 2LVQA 3KWVA 2QEJC 2M0AA 3Q3OC 1FNVA 3ZJUA 2C5LC 3VH3B 4AJYB 3DQVA 1WYGA 2MP2A 5TSSA 1LQBA 1C9FA 4JL9A 2LUMA 2GBRA 2VZKB 3KQ4A 3L54A 3RNEC 3DVGX 1VD2A 4F8CB 5LNK1 4EFOA 2QC8A 1P3QU 2AL3A 2D3CA 3TMPB 4J6IA 1XO3A 2BB5A 2KWCA 2LXCA 4KKJA 2Y3AA 2KNBA 3ZQ4A 1NVID 2FAZA 5HG2A 1L0VB 1XLPA 2AL6A 3NZ3A 2EKEC 1GNUA 4B0MA 1R4NB 4L23A 1WGKA 3E9SA 2G9HD 4ZYNA 3WA0A 2M17A 4M0WB 3ONSA 5G55A 3IT6B 3H7SA 1NYQA 1ZW7A 3TEZA 4DXAB 3APFA 1H4RA 1E7PB 3VAWA 2W82A 4K1RB 3Q3MC 4OVZA 3DBSA 3HK0A 3DVGY 1FRRA 1FNUA 1CQVA 2MBEA 1TS5A 4GDKB 3W5VB 3Q8FA 4BAXA 5AZFA 2KK8A 1SIFA 1WXQA 2IGGA 3AEDB 2LRWA 2O6VA 1B9RA 3I9V1 1OFFA 4DHJD 1WM2A 1FXTB 1YD8U 4A20A 3HM3A 4OHJA 2DENB 4LNIA 4WWPA 2EKIA 2PEAA 3W1SC 1TY0A 3IFWB 4IUMB 4B9KA 1F52A 5CHWA 2I38A 5J18A 1I7HA 1F9JA 4PYZA 4BOZB 5D3IB 1OEYJ 3N20C 3PRMB 2W3SA 2BPSA 2CR5A 1QILA 4GU2A 4W9JA 2Z0DB 2LRUA 2FIFA 5G5GA 1R4NI 2L0TA 3UIPB 1XEEA 2KDBA 2XK5B 1OQRA 1MG4A 3N1ZC 3RCZA 2ONQA 5G5HA 3LYYA 5C23A 4CYEA 4ZDVA 1JRPA 1MHXA 2B3AA 1UGJA 5EE9A 2KMCA 3SEBA 1LXDA 2INCC 2K39A 3N32A 4NQLB 4URKA 1J8CA 2BYEA 1I35A 2OJWA 4N58A 1F1HA 4TQ1A 2Q5WD 4HJKA 5FR6A 2RMMA 4QAYA 4DXFA 1CJEA 4RM9A 4REZA 1IUEA 2CS4A 1WJ4A 1EU3A 4IG7B 5BYSA 1KH0A 4IM2A 4KZ0A 4MGKE 2KC2A 3X23A 3ZVVA 2M1MA 3Q8EA 3AEAB 2WGSA 4ZRIA 4DHJB 3AULA 1SE3A 2DAFA 1FCLA 1C4PA 1EF5A 4DBGA 2JXXA 3AM9A 4CQNA 2R61A 4EOYA 2MQJA 2QIEB 2OJRA 1D4BA 4IDIA 3RYTA 3U8ZA 2ZNVC 4LNNA 3AEBB 1DGJA 2AWTA 2BS2B 1WIAA 2CHXA 2GI9A 3AE8B 4D2KA 3PS6A 3SD5A 2JPHA 3LXFA 5H8YE 4C4VA 2V9HA 1Q5WB 4ANVA 1V1PB 4TQ0A 3QIJA 1QF6A 4W9DA 2JY6A 1C3TA 3UF8A 1GPXA 3O13A 1UD7A 4LLGM 3VFKA 1RFKA 3L16A 3QC8B 2CHZA 3ZDTA 3DHGC 1UGMA 4XE0A 1V6EA 1SJED 5D2MB 1WGHA 3T9LA 3PHWB 1R4MI 3PV1A 1P7EA 4GSWA 3VTWA 2NTTA 3TEXA 2ZVOA 4BKGA 5HFYA 1L2NA 5AUIA 2RDBC 3LDZE 2NS5A 1VLBA 2N7JA 3QWZB 2DX5B 3C0RB 3PRZA 3SDLC 4MJSA 4P6VF 3JVZX 2L52A 2J4XA 1F2RI 3IAS1 1A5RA 4MEMA 1PGXA 3NVZA 1UBIA 4ZRKA 2D2QA 1J19A 4WWMA 3AECB 5E6NA 2WNMA 3P2BA 2BKRB 1TJEA 5IOIA 1RFAA 1SB3C 3PTFC 4NJ7A 1NDDA 1TGZB 2LWPA 2M56B 3V6EB 3W1YA 4AUQC 5KHQA 2NPTA 2KC1A 3FILB 3U52E 2BYVE 2G1EA 2X8XX 5HI1A 3Q8CA 5LXHA 4N59A 2H89B 4MJSB 1IGCA 1ZXIA 1SE9A 5D7GA 1YJ1A 3RFZB 2CU3A 2WHIA 4HCPB 2IDYA 4WJPA 4WIPA 1VRAB 1WX7A 4WURA 2VRRB 3ZYYX 4CHKA 3X0WA 1N5WA 1OTRB 4ZRPA 4IWPA 1TKYA 2MA9B 3BYTB 2N9PC 2L76A 5DPRA 3R8BA 2JWUA 1L4ZB 3H7PB 2AX5A 2IO0B 1KFYB 4LDTD 3CF6E 4GDLA 4F1SA 2KO3A 4EZLA 1P9DU 1QOGA 1OQYA 3KLSX 1YN5A 3QX1A 4JIOU 2D5GA 3C8YA 3L13A 4JWUC 1JWUD 2O2VA 4F7ZA 4MH0E 1OQQA 1C77A 1D6EC 4GGQA 1YQBA 2KFKA 1EF1A 4HVBA 1YNTE 1N60A 3ZTCA 4M8NA 5I4DA 2DHZA 2YVCA 2AEHA 5IA7A 1YN4A 3B2FA 4LJPB 2YEPB 4W9HA 1YMHE 3DWMA 2OHFA 1LO5D 1C4AA 3W2DA 2J42A 2O2VB 3R7QA 4G50A 2IJ0A 3NZSA 3T3OA 5DPTA 1H8CA 2D11A 3HRDD 1JRUA 2ZCBA 3UIOB 4KZCA 2LD9A 2PTLA 2WLBA 1RLFA 4YSZB 5EE3A 2K5PA 4FULA 2K3UA 3VR8B 2M19A 1NI3A 3VR9B 4HK2A 4M8MA 3VXWA 5IP4D 2NR2A 2KDFB 1HTQA 2HJ8A 3Q8BA 3JW0X 4YSYB 3MHSD 4RGMA 1ZKHA 1WRIA 1WE6A 5C1ZA 4KX6B 4NJ6A 4IM3A 3RZFA 4FADA 1AW7A 1RWSA 1V97A 1I4RA 3ZIMA 5JZEB 1T0QC 5AEKB 3DCGA 3RNCC 1E8XA 1YJJA 1DOYA 2WDTB 1SE4A 1WF9A 1QZEA 3AXCA 1WGYA 1TT5B 3TCAA 3J9CA 1PFDA 3WIMA 3ALBA 1WY8A 2JX5A 2LXAA 3VRAB 1SXTA 1C4CA 3WCQA 1S3SG 2DYBA 2GBMA 1EO6A 3BY4B 4FA6A 3W5UB 1I4XA 4TUUA 4IW0A 1XXGA 4BFRA 3OWEB 4DWFA 3W1SA 3NS1A 3ZGZA 1WZ0A 1WX9A 2ZCCA 1I42A 3P4QB 1X1MA 3PRPB 4II3B 2JT4B 2WXOA 1D5ZC 4HPLB 4XDCA 1PUTA 1V2YA 1E0ZA 1EM7A 2K9XA 3IVFA 2NBWB 2NTSA 5AUKA 4KIKB 3NG0A 2BB6A 2KTFA 4B95A 4US8A 4GLSC 3I57A 1KRHA 2LGYA 1WR6E 4EKUA 3PREA 2BTEA 2CJNA 4W9CA 3QARA 3KUCB 1JROA 2SAKA 3PZ8A 1M4VA 2JRHA 1QKZA 5CTRC 5DPSA 1T5XD 4TKNA 3V60A 3AEGB 5LXIB 1RYJA 1TZOA 2HDEA 2KDMA 2LGXA 3N3KB 2KN5A 3P1MA 4B0EA 4G3XB 4IM0A 4ZOHC 3WALA 2FBWB 2KX0A 3CIRB 2K8BA 1JW9D 3AEFB 2BVCA 2BQQA 4MGZE 4MELA 4GXBA 1GC7A 4FHJA 2KTRB 3RPFC 3MP9A 3OAWA 3GE8C 2MEKA 1T0RC 3ZKJC 1NYRA 4WH4A 4BKSA 2TSSA 2M8SA 3GB1A 1MHHE 2MLBA 3TBLD 4M0WA 5HKHA 1XD3B 3AE1B 2O6VD 2W3RA 4XYCA 1WXMA 3W9CB 1Q1OA 1DOIA 2GBNA 4JX1C 2JVCA 2Z59B 4EEWA 3DPDA 3B08A 4WWNA 2EMSA 3AI5A 1FO4A 2FUHB 2EMTA 4GDKA 4MT5A 1SJHD 2YEPF 4US9A 2BYTA 4DQOC 2E6XA 1JWSD 4XWTA 2W9NA 1ZPSA 4WJNA 2N1VA 4HPMB 2ASQA 1VR9A 2EELA 1QOAA 3I63C 1Y8RC 3I3TB 4TV3A 4BVUC 2IGDA 2L05A 3FAHA 3IXSA 3BVZA 3EECA 2WXNA 2QHOA 3U2SC 2LFIA 4KKIA 3RD2A 3IG3A 2ZNVB 2W54A 4A3OA 2WXJA 3AE7B 1UZXB 3LB8C 1P98A 2WXHA 2WXLA 1CK1A 3Q6BA 3N30A 1JWBD 4R3DA 1E8ZA 2PJHA 1WXAA 1MVKA 3RUIB 2JWZA 2XK5A 3ZNGC 3QK0A 1HXYD 1WXSA 1ET6A 3PVLA 3V05A 3VUYA 1J7BA 4LJOB 1Z2MA 2R2OA 1YN3A 1XLNA 2REXA 3VVWB 1RM6C 3RN9C 4EE2A 2KN4A 1YQ3B 1AARA 2V4IB 3MTNB 1PDXA 3ML9A 1WJUA 3AMZA 3IHPC 2WXGA 5TR5A 2IPKD 4MACA 4K3CA 1KF6B 3DVNV 4I6NB 1U4AA 3Q3FA 3BINA 1AWDA 1HZ6A 2A5UA 2IY1B 4HCNB 4LNOA 4K81A 1Q0WB 2LVPA 3H8HA 1BMLC 4JPSA 3DHIC 1ZDXA 2ZPYA 2JSVX 1E8YA 2KVZA 4YXDB 1GB1A 2KQ4X 3PZDA 1OEYA 1E7VA 4OVUA 1R4MB 1GB4A 2FUG1 3M62B 1WGRA 4MM3B 2FCSA 2ZPNA 3M63B 4ZRJA 4DK5A 4J3OD 3ZDMC 1BT0A 1V81A 4OW0A 3AE9B 4K3BA 2V3SA 2G4DB 2KJRA 3IT4B 2IO2B 1NBFC 2WU5B 1FFVA 2G3QB 4IWOA 1QOFA 1V1PA 3KW5B 2L0FA 3RNFC 1PQSA 3ML8A 4MH8A 3WANA 4OZBA 3R66C 1JWMD 4K7UA 1CMXB 3BK2A 3C19A 3BVGA 1N6ZA 1Q10A 3ZRCA 1IBXB 5H92C 2WWZA 4DHZE 2ZEQA 4KGRA 2N0SB 2ZJDA 3GOEA 1TY2A 3A33B 2ACZB 4NJCA 1JMLA 3B9JA 5C2TB 4BKTA 2W55A 4EZKA 4JQWC 1XCTL 3DVNU 2IBIB 3IBEA 5DPWA 2I1KA 2JYEA 3BIID 1GC6A 3U7ZA 3B2GA 3ZJVA 1K53A 2MW5A 3HVZA 1YOVB 2ZW0A 2RPQA 1ZGUB 3I5JC 4A8XC 3DBHI 2HE7A 2DNFA 1WJNA 1GJZA 1ZP0B 3H6NA 5D3DA 2WXQA 3OJ3A 2LVOA 3NZUA 4AP4C 4JLCA 2AQ2B 5JHAA 3MJ5A 3RT3B 4NQKE 3SR6A 1MFWA 4NAMA 1ISNA 3RNGC 2I1JA 1TKGA 3FILA 4AQ7A 4FLHA 4PK1A 4HXDA 3R7RA 4YTMB 3KUDB 4EUTA 1V5OA 2GBKA 2L1AA 1AYFA 1TTNA 2WXKA 2LI5A 1KLVA 4XGAB 3K9OB 2AQ3B 2MJDA 3PLVA 5CHVC 2ZW1A 3A9JB 5D6JB 1WSPA 2WXMA 2GOWA 4HEA1 1STEA 1WMHB 3ZXVA 3VTVA 3RULA 2JZPA 3H7PA 3UQAA 2Y5PA 5LLIA 2M0XA 4OZAA 3NHEB 1WJ6A 4W9EA 1L0XB 2C7MB
chains in the Genus database with same CATH topology
2DYBA 3APFA 1H4RA 1P0RA 4GIVA 2GBMA 3VAWA 3ECIA 1YX5B 4BBNC 2GBJA 4W9FA 1EO6A 1SGHA 3BY4B 4FA6A 4G0NB 3VTUA 4TUUA 2KD0A 4K1RB 4IW0A 3TIXA 4HWIB 1OGWA 4BFRA 2XBBC 3DBSA 1KM7A 3HK0A 3ZLZA 4DWFA 2WX1A 4NY0A 3W1SA 1WZ0A 1WX9A 3DVGY 3OJ4B 3ZO5B 2ZCCA 1I42A 4PS8A 2L7RA 1X1MA 3PRPB 4II3B 2MBEA 2J0JA 2JT4B 4GDKB 4HPLB 3ZRFA 1V2YA 4E74A 2KZRA 2LJ5A 4W9GA 5AZFA 3IVFA 2KK8A 1SIFA 4AOFA 2LRWA 2O6VA 2NBWB 1WH3A 4DHJD 1WM2A 3B1LX 2KDEB 1FXTB 3NOBA 3QJZA 4KIKB 2FCNA 1YD8U 2KTFA 4OVVA 4B95A 4A20A 3HM3A 5CHFA 2DENB 2LGYA 1WR6E 3HHMA 4EKUA 4WWPA 3PREA 3W1SC 2PEAA 3VUWA 4W9CA 3QARA 2KMAA 3KUCB 3IFWB 4IUMB 4NNJB 3PPAA 4DDGD 3KYDD 4B9KA 2BF8B 4FN2A 5CHWA 5J18A 2JRHA 1F9JA 4PYZA 1RRBA 5CTRC 4BOZB 5DPSA 2KWUB 4TKNA 1OEYJ 3DOWA 3V60A 5L83A 5LXIB 4IWQA 3ZNID 3U7DA 2LGXA 3L10B 3N3KB 3SHQA 2KN5A 3PRMB 4GN1A 2BPSA 4G3XB 4ASWC 4GOCA 4IM0A 5J17A 3WALA 2R2QA 2WYQA 2JF5A 4KDIC 2KVRA 2CR5A 2KX0A 2KKCA 3ZTDA 4GU2A 2K8BA 1WXVA 2PPHA 4W9JA 3LJ3A 1RAXA 4W9KA 2Z0DB 2LRUA 1TBEA 2FIFA 1WM3A 2C9WB 1R4NI 2L0TA 3UIPB 4MGZE 1YIWA 4MELA 4BBNF 3Q3JA 4GXBA 1WFYA 2MWSB 3DBRI 1T0YA 3A9JA 1GC7A 1WE7A 2PE9A 1V86A 2KDBA 4FHJA 2KTRB 2XK5B 2LGDA 3OAWA 3RCZA 2KQSA 4PS3A 1WMHA 4LCDE 4XZ4A 1XT9B 3ZKJC 1S3SG 5C23A 5KHOA 4CYEA 3KVFB 3H1UA 4BKSA 2M8SA 4ZDVA 2M4NA 2JZZA 1WZ3A 3VQIA 4WJOA 2B3AA 2MLBA 3TBLD 5HKHA 1J0GA 2D3GA 1G6JA 2KMCA 1XD3B 3M3JA 2K8CA 1K8RB 1LXDA 2O6VD 2IO3B 2K39A 4I6PA 1UBQA 3N32A 4NQLB 4KDLB 2FCMA 4URKA 2HD5B 1WXMA 2KHWB 4ICUA 1J8CA 3WAPA 2LASA 2BYFA 1Q1OA 3ZW3A 1XQQA 2DYOA 3OLMD 2BYEA 2GBNA 1I35A 3KUZA 3L0WB 4XC2A 2JVCA 4MGYE 4KV2A 2FIDA 4HDOA 4TQ1A 4HJKA 2KANA 3WAOA 2Z59B 3UGBB 5DCNA 5FR6A 4EEWA 3A4RA 3DPDA 2IYDB 3B08A 4K7SA 2EMSA 4WWNA 2J7QB 3AI5A 4X57B 2FUHB 4RM9A 2EMTA 4GDKA 2CS4A 1WJ4A 3PSEB 3MJWA 2DZMA 4IG7B 4LDTB 1GG3A 2N4FA 4IM2A 4W9IA 5L95C 3L08A 4KZ0A 4MGKE 2KC2A 2W9NA 3PLUA 4WJQA 4WJNA 3A9KB 4KIKA 2M1MA 3X23A 2N1VA 3ZVVA 4AJWA 4ZRIA 4DHJB 4HPMB 3AULA 2ASQA 2C60A 4EZJA 2K25A 2DAFA 2DYMA 2D10A 1Y8RC 1E7UA 3I3TB 2NPTB 1EF5A 4TV3A 4BVUC 2L05A 4DBGA 2JXXA 2L8JA 2L3ZA 3QCAA 2RR9A 4KVGB 3EECA 3QAQA 5EDSA 2BWFA 4EOYA 2MQJA 2N7DA 1S1QB 2OJRA 3QHTA 2NCNA 2CU1A 2DZIA 2QHOA 3VH4B 1V80A 4YL8A 2MCNB 4PYUA 3DDCB 3RD2A 2AYOB 3IG3A 5G2NA 3RYTA 3U8ZA 2ZNVB 2ZNVC 3T8MA 4A3OA 2FCQA 1IPGA 4DDID 2G4SA 2AWTA 2CHXA 1WIAA 2KDIA 3VDZA 3PGEA 1IP9A 5JH5C 3RZWC 1UZXB 3PS6A 1P98A 5E6OA 3K9PB 3SD5A 4ANWA 2JPHA 2G45B 2NBUA 3N30A 3KH0A 3APCA 3WAMA 3NY5A 2K6DB 3SU8X 1Q5WB 1V9JA 2MRPA 3O65B 4FJVB 5GMVA 3PT2B 3VHTC 4ANVA 1E8ZA 2PJHA 5J2RA 1L7YA 1WXAA 3A4SC 1E8WA 1NI2A 5E6PA 3D32A 1MG8A 2PE6B 4JGHB 3QIJA 4TQ0A 4W9DA 2JWZA 2KTRA 2JY6A 2XK5A 2UWQA 3RUIB 3UF8A 3ZNGC 4AWJA 1C3TA 1UD7A 2C7NB 2UYZB 3QK0A 4ANUA 2KQ7A 3GZNI 2LZ6A 3VFKA 1WXSA 3QA8A 4B6WA 3HM6X 3PVLA 3VUYA 4LJOB 1Z2MA 2WX0A 3L16A 3QC8B 4GDLB 2CHZA 4GB9A 2R2OA 3ZDTA 3ZUNA 1WRDB 2REXA 1UELA 1UGMA 3VVWB 1EUVB 1V6EA 2RSUA 2KOXA 5D2MB 1WGHA 3T9LA 1AARA 1KJTA 3PHWB 3MTNB 1R4MI 3EHVA 3PV1A 2BWES 4NAWA 2GMIC 3AU5A 3ML9A 1WJUA 2MSED 4GSWA 3VTWA 3TL5A 2CHWA 2ZVOA 3IHPC 3UINB 4BKGA 3ZNHB 2C7HA 3R3MA 5TR5A 2MBBB 1L2NA 2KFKB 4MSQB 3LDZE 2NS5A 2K1FA 3DVNV 2JUOA 4I6NB 1WX8A 4P7IA 4KSKC 1U4AA 3QWZB 3Q3FA 1C1YB 2DX5B 3BINA 3EC8A 3C0RB 3PRZA 2A5UA 2JZ3B 2Z0EB 2IY1B 4MJSA 2IY0B 2K8HA 4HCNB 3SDLC 3JVZX 4K81A 1Q0WB 2KX3A 2MBOA 2LVPA 1WGGA 1A5RA 3A9KA 4MEMA 3S2AA 4NAWB 3V61A 2L00B 4A3PA 1UBIA 4ZRKA 2ZPYA 2D2QA 4II2B 1J19A 1E8YA 3CMMB 5E6NA 3P2BA 2BKRB 1RFAA 3PTFC 4NJ7A 3PZDA 1OEYA 1NDDA 1TGZB 1E7VA 2LWPA 4OVUA 3V6EB 3W1YA 4AUQC 2RGFA 1WYWB 2NPTA 5KHQA 1WR1A 2KJHB 4I6LB 4ANXA 3M62B 3ZNZB 1WGRA 2KC1A 2FCSA 3EFUA 2BYVE 2ZPNA 3M63B 2V1YA 2MP2B 2N7EA 4K7WA 4ZRJA 5LXHA 2IZVB 4FJZA 4MJSB 1SE9A 2MBHA 2MX2A 5D7GA 4RMAA 1YJ1A 4CO7A 4DK5A 3ZDMC 1BT0A 1WI0A 1V81A 2V4LA 4HCPB 1P1AA 4MSMB 1V49A 4WJPA 2KWVB 1WGDA 2N9XA 2MBQA 1WX7A 2V3SA 2G4DB 2KLCA 3HIZA 2KJRA 5AZGA 2VRRB 4CHKA 3NS8A 2DAJA 1NBFC 2IO2B 2NBVB 4G11A 3X0WA 2HTHA 2G3QB 4IWOA 1OTRB 4ICVA 4E3CA 3B0AA 2J0KA 3KW5B 2KLGA 4IWPA 2L0FA 2MA9B 2N1WA 2N9PC 2L76A 4MDKE 5D94A 1PQSA 5DPRA 3ML8A 3A1QA 3DBLI 3WANA 2RD0A 1Z5SB 3R66C 4BKSD 4FJYA 3QQ8B 2Y5BB 4K7UA 4KSLC 2JRIB 3H7PB 3V6CB 1CMXB 3PHXB 2BKFA 5CX3A 2IO0B 4LDTD 1D3ZA 3CF6E 4GDLA 3ZRCA 4F1SA 2KO3A 4EZLA 1P9DU 2WWZA 1LM8B 1OQYA 4GMVA 3M95A 2ZEQA 4DHZE 4FBJB 2ZJDA 1E5WA 3QX1A 4JIOU 3GOEA 3UQBA 4FHKA 3L13A 4E71A 3A33B 2N9EB 4WWOA 4N9F4 2O2VA 2XEWA 4BKTA 2CKHB 3AU4A 4F7ZA 4MH0E 4EZKA 4JQWC 3DVNU 3TJPA 2IBIB 3A1QB 2KFJA 2YLMA 3IBEA 3JSVA 5DPWA 4GGQA 2I1KA 1UH6A 1YX6B 1IYFA 1YQBA 2KFKA 1GC6A 1EF1A 4HVBA 3L17A 3ZTCA 4WAAA 2DZJA 4M8NA 2DHZA 3V62A 2YVCA 2AEHA 2MW5A 5IA7A 2RPQA 1ZGUB 4LJPB 3DBHI 2HE7A 2ZZPB 1KOTA 1WJNA 1GJZA 4W9HA 3H6NA 4XX5A 2O6VB 5JHBA 2DZKA 3OJ3A 2LVOA 3NZUA 2D07B 5AZHA 4BOSC 2O2VB 1E90A 4G50A 3R7QA 4WQOB 4AP4C 4JLCA 3NZSA 1H8CA 3H9DA 5DPTA 1HE8A 2D11A 3JSVB 3VUXA 1JRUA 4RM8A 5JHAA 2LVQA 2ZCBA 3RT3B 3UIOB 4NQKE 1V5TA 2BGFA 4KZCA 2LD9A 3CSFA 2FNJB 1ISNA 2I1JA 4MM3A 1RLFA 2LUEA 4FLHA 2C5LC 3VH3B 1LFDA 2J0MA 4AJYB 3DQVA 3KYCD 4HXDA 3R7RA 2MP2A 1GUAB 1LQBA 4HLEA 4FULA 4HDQA 3KUDB 4JL9A 1TZ1A 2GBRA 3L54A 1V5OA 2GBKA 4EUTA 4HK2A 3DVGX 1VD2A 2NVUI 4M8MA 4F8CB 3VXWA 2NR2A 2KDFB 4EFOA 3U30A 2HJ8A 4DHZB 3JW0X 1P3QU 2AL3A 3TMPB 1TTNA 4J6IA 3MHSD 2KWCA 2LI5A 1ZKHA 3CSTA 1KLVA 2LXCA 1WE6A 5C1ZA 3K9OB 2KNBA 4NJ6A 4IM3A 3RZFA 3PLVA 2FAZA 4FADA 2ZVNA 5CHVC 2KJ6A 3ENEA 3A9JB 2K6QA 5D6JB 3ZIMA 5JZEB 2AL6A 3APDA 2GOWA 5AEKB 2A4ZA 3DCGA 4NPNA 2KXJA 2EKEC 1GNUA 1WMHB 4MGIE 3VTVA 2OOBB 3JYUA 4IC7B 4W9LA 3RULA 1E8XA 3H7PA 2WDTB 3UQAA 1M94A 5IAAC 1VCBA 4ZYNA 1WF9A 4PS7A 1QZEA 2M17A 3AXCA 3WA0A 1WGYA 4M0WB 3TCAA 3ONSA 5G55A 3WIMA 5LLIA 3ALBA 1WY8A 2LXAA 2M0XA 2IO1B 3H7SA 5BO4B 1ZW7A 3NHEB 1WJ6A 4W9EA 4DXAB 2C7MB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DYB A;  3APF A;  1H4R A;  1P0R A;  4GIV A;  2GBM A;  3VAW A;  3ECI A;  1YX5 B;  4BBN C;  2GBJ A;  4W9F A;  1EO6 A;  1SGH A;  3BY4 B;  4FA6 A;  4G0N B;  3VTU A;  4TUU A;  2KD0 A;  4K1R B;  4IW0 A;  3TIX A;  4HWI B;  1OGW A;  4BFR A;  2XBB C;  3DBS A;  1KM7 A;  3HK0 A;  3ZLZ A;  4DWF A;  2WX1 A;  4NY0 A;  3W1S A;  1WZ0 A;  1WX9 A;  3DVG Y;  3OJ4 B;  3ZO5 B;  2ZCC A;  1I42 A;  4PS8 A;  2L7R A;  1X1M A;  3PRP B;  4II3 B;  2MBE A;  2J0J A;  2JT4 B;  4GDK B;  4HPL B;  3ZRF A;  1V2Y A;  4E74 A;  2KZR A;  2LJ5 A;  4W9G A;  5AZF A;  3IVF A;  2KK8 A;  1SIF A;  4AOF A;  2LRW A;  2O6V A;  2NBW B;  1WH3 A;  4DHJ D;  1WM2 A;  3B1L X;  2KDE B;  1FXT B;  3NOB A;  3QJZ A;  4KIK B;  2FCN A;  1YD8 U;  2KTF A;  4OVV A;  4B95 A;  4A20 A;  3HM3 A;  5CHF A;  2DEN B;  2LGY A;  1WR6 E;  3HHM A;  4EKU A;  4WWP A;  3PRE A;  3W1S C;  2PEA A;  3VUW A;  4W9C A;  3QAR A;  2KMA A;  3KUC B;  3IFW B;  4IUM B;  4NNJ B;  3PPA A;  4DDG D;  3KYD D;  4B9K A;  2BF8 B;  4FN2 A;  5CHW A;  5J18 A;  2JRH A;  1F9J A;  4PYZ A;  1RRB A;  5CTR C;  4BOZ B;  5DPS A;  2KWU B;  4TKN A;  1OEY J;  3DOW A;  3V60 A;  5L83 A;  5LXI B;  4IWQ A;  3ZNI D;  3U7D A;  2LGX A;  3L10 B;  3N3K B;  3SHQ A;  2KN5 A;  3PRM B;  4GN1 A;  2BPS A;  4G3X B;  4ASW C;  4GOC A;  4IM0 A;  5J17 A;  3WAL A;  2R2Q A;  2WYQ A;  2JF5 A;  4KDI C;  2KVR A;  2CR5 A;  2KX0 A;  2KKC A;  3ZTD A;  4GU2 A;  2K8B A;  1WXV A;  2PPH A;  4W9J A;  3LJ3 A;  1RAX A;  4W9K A;  2Z0D B;  2LRU A;  1TBE A;  2FIF A;  1WM3 A;  2C9W B;  1R4N I;  2L0T A;  3UIP B;  4MGZ E;  1YIW A;  4MEL A;  4BBN F;  3Q3J A;  4GXB A;  1WFY A;  2MWS B;  3DBR I;  1T0Y A;  3A9J A;  1GC7 A;  1WE7 A;  2PE9 A;  1V86 A;  2KDB A;  4FHJ A;  2KTR B;  2XK5 B;  2LGD A;  3OAW A;  3RCZ A;  2KQS A;  4PS3 A;  1WMH A;  4LCD E;  4XZ4 A;  1XT9 B;  3ZKJ C;  1S3S G;  5C23 A;  5KHO A;  4CYE A;  3KVF B;  3H1U A;  4BKS A;  2M8S A;  4ZDV A;  2M4N A;  2JZZ A;  1WZ3 A;  3VQI A;  4WJO A;  2B3A A;  2MLB A;  3TBL D;  5HKH A;  1J0G A;  2D3G A;  1G6J A;  2KMC A;  1XD3 B;  3M3J A;  2K8C A;  1K8R B;  1LXD A;  2O6V D;  2IO3 B;  2K39 A;  4I6P A;  1UBQ A;  3N32 A;  4NQL B;  4KDL B;  2FCM A;  4URK A;  2HD5 B;  1WXM A;  2KHW B;  4ICU A;  1J8C A;  3WAP A;  2LAS A;  2BYF A;  1Q1O A;  3ZW3 A;  1XQQ A;  2DYO A;  3OLM D;  2BYE A;  2GBN A;  1I35 A;  3KUZ A;  3L0W B;  4XC2 A;  2JVC A;  4MGY E;  4KV2 A;  2FID A;  4HDO A;  4TQ1 A;  4HJK A;  2KAN A;  3WAO A;  2Z59 B;  3UGB B;  5DCN A;  5FR6 A;  4EEW A;  3A4R A;  3DPD A;  2IYD B;  3B08 A;  4K7S A;  2EMS A;  4WWN A;  2J7Q B;  3AI5 A;  4X57 B;  2FUH B;  4RM9 A;  2EMT A;  4GDK A;  2CS4 A;  1WJ4 A;  3PSE B;  3MJW A;  2DZM A;  4IG7 B;  4LDT B;  1GG3 A;  2N4F A;  4IM2 A;  4W9I A;  5L95 C;  3L08 A;  4KZ0 A;  4MGK E;  2KC2 A;  2W9N A;  3PLU A;  4WJQ A;  4WJN A;  3A9K B;  4KIK A;  2M1M A;  3X23 A;  2N1V A;  3ZVV A;  4AJW A;  4ZRI A;  4DHJ B;  4HPM B;  3AUL A;  2ASQ A;  2C60 A;  4EZJ A;  2K25 A;  2DAF A;  2DYM A;  2D10 A;  1Y8R C;  1E7U A;  3I3T B;  2NPT B;  1EF5 A;  4TV3 A;  4BVU C;  2L05 A;  4DBG A;  2JXX A;  2L8J A;  2L3Z A;  3QCA A;  2RR9 A;  4KVG B;  3EEC A;  3QAQ A;  5EDS A;  2BWF A;  4EOY A;  2MQJ A;  2N7D A;  1S1Q B;  2OJR A;  3QHT A;  2NCN A;  2CU1 A;  2DZI A;  2QHO A;  3VH4 B;  1V80 A;  4YL8 A;  2MCN B;  4PYU A;  3DDC B;  3RD2 A;  2AYO B;  3IG3 A;  5G2N A;  3RYT A;  3U8Z A;  2ZNV B;  2ZNV C;  3T8M A;  4A3O A;  2FCQ A;  1IPG A;  4DDI D;  2G4S A;  2AWT A;  2CHX A;  1WIA A;  2KDI A;  3VDZ A;  3PGE A;  1IP9 A;  5JH5 C;  3RZW C;  1UZX B;  3PS6 A;  1P98 A;  5E6O A;  3K9P B;  3SD5 A;  4ANW A;  2JPH A;  2G45 B;  2NBU A;  3N30 A;  3KH0 A;  3APC A;  3WAM A;  3NY5 A;  2K6D B;  3SU8 X;  1Q5W B;  1V9J A;  2MRP A;  3O65 B;  4FJV B;  5GMV A;  3PT2 B;  3VHT C;  4ANV A;  1E8Z A;  2PJH A;  5J2R A;  1L7Y A;  1WXA A;  3A4S C;  1E8W A;  1NI2 A;  5E6P A;  3D32 A;  1MG8 A;  2PE6 B;  4JGH B;  3QIJ A;  4TQ0 A;  4W9D A;  2JWZ A;  2KTR A;  2JY6 A;  2XK5 A;  2UWQ A;  3RUI B;  3UF8 A;  3ZNG C;  4AWJ A;  1C3T A;  1UD7 A;  2C7N B;  2UYZ B;  3QK0 A;  4ANU A;  2KQ7 A;  3GZN I;  2LZ6 A;  3VFK A;  1WXS A;  3QA8 A;  4B6W A;  3HM6 X;  3PVL A;  3VUY A;  4LJO B;  1Z2M A;  2WX0 A;  3L16 A;  3QC8 B;  4GDL B;  2CHZ A;  4GB9 A;  2R2O A;  3ZDT A;  3ZUN A;  1WRD B;  2REX A;  1UEL A;  1UGM A;  3VVW B;  1EUV B;  1V6E A;  2RSU A;  2KOX A;  5D2M B;  1WGH A;  3T9L A;  1AAR A;  1KJT A;  3PHW B;  3MTN B;  1R4M I;  3EHV A;  3PV1 A;  2BWE S;  4NAW A;  2GMI C;  3AU5 A;  3ML9 A;  1WJU A;  2MSE D;  4GSW A;  3VTW A;  3TL5 A;  2CHW A;  2ZVO A;  3IHP C;  3UIN B;  4BKG A;  3ZNH B;  2C7H A;  3R3M A;  5TR5 A;  2MBB B;  1L2N A;  2KFK B;  4MSQ B;  3LDZ E;  2NS5 A;  2K1F A;  3DVN V;  2JUO A;  4I6N B;  1WX8 A;  4P7I A;  4KSK C;  1U4A A;  3QWZ B;  3Q3F A;  1C1Y B;  2DX5 B;  3BIN A;  3EC8 A;  3C0R B;  3PRZ A;  2A5U A;  2JZ3 B;  2Z0E B;  2IY1 B;  4MJS A;  2IY0 B;  2K8H A;  4HCN B;  3SDL C;  3JVZ X;  4K81 A;  1Q0W B;  2KX3 A;  2MBO A;  2LVP A;  1WGG A;  1A5R A;  3A9K A;  4MEM A;  3S2A A;  4NAW B;  3V61 A;  2L00 B;  4A3P A;  1UBI A;  4ZRK A;  2ZPY A;  2D2Q A;  4II2 B;  1J19 A;  1E8Y A;  3CMM B;  5E6N A;  3P2B A;  2BKR B;  1RFA A;  3PTF C;  4NJ7 A;  3PZD A;  1OEY A;  1NDD A;  1TGZ B;  1E7V A;  2LWP A;  4OVU A;  3V6E B;  3W1Y A;  4AUQ C;  2RGF A;  1WYW B;  2NPT A;  5KHQ A;  1WR1 A;  2KJH B;  4I6L B;  4ANX A;  3M62 B;  3ZNZ B;  1WGR A;  2KC1 A;  2FCS A;  3EFU A;  2BYV E;  2ZPN A;  3M63 B;  2V1Y A;  2MP2 B;  2N7E A;  4K7W A;  4ZRJ A;  5LXH A;  2IZV B;  4FJZ A;  4MJS B;  1SE9 A;  2MBH A;  2MX2 A;  5D7G A;  4RMA A;  1YJ1 A;  4CO7 A;  4DK5 A;  3ZDM C;  1BT0 A;  1WI0 A;  1V81 A;  2V4L A;  4HCP B;  1P1A A;  4MSM B;  1V49 A;  4WJP A;  2KWV B;  1WGD A;  2N9X A;  2MBQ A;  1WX7 A;  2V3S A;  2G4D B;  2KLC A;  3HIZ A;  2KJR A;  5AZG A;  2VRR B;  4CHK A;  3NS8 A;  2DAJ A;  1NBF C;  2IO2 B;  2NBV B;  4G11 A;  3X0W A;  2HTH A;  2G3Q B;  4IWO A;  1OTR B;  4ICV A;  4E3C A;  3B0A A;  2J0K A;  3KW5 B;  2KLG A;  4IWP A;  2L0F A;  2MA9 B;  2N1W A;  2N9P C;  2L76 A;  4MDK E;  5D94 A;  1PQS A;  5DPR A;  3ML8 A;  3A1Q A;  3DBL I;  3WAN A;  2RD0 A;  1Z5S B;  3R66 C;  4BKS D;  4FJY A;  3QQ8 B;  2Y5B B;  4K7U A;  4KSL C;  2JRI B;  3H7P B;  3V6C B;  1CMX B;  3PHX B;  2BKF A;  5CX3 A;  2IO0 B;  4LDT D;  1D3Z A;  3CF6 E;  4GDL A;  3ZRC A;  4F1S A;  2KO3 A;  4EZL A;  1P9D U;  2WWZ A;  1LM8 B;  1OQY A;  4GMV A;  3M95 A;  2ZEQ A;  4DHZ E;  4FBJ B;  2ZJD A;  1E5W A;  3QX1 A;  4JIO U;  3GOE A;  3UQB A;  4FHK A;  3L13 A;  4E71 A;  3A33 B;  2N9E B;  4WWO A;  4N9F 4;  2O2V A;  2XEW A;  4BKT A;  2CKH B;  3AU4 A;  4F7Z A;  4MH0 E;  4EZK A;  4JQW C;  3DVN U;  3TJP A;  2IBI B;  3A1Q B;  2KFJ A;  2YLM A;  3IBE A;  3JSV A;  5DPW A;  4GGQ A;  2I1K A;  1UH6 A;  1YX6 B;  1IYF A;  1YQB A;  2KFK A;  1GC6 A;  1EF1 A;  4HVB A;  3L17 A;  3ZTC A;  4WAA A;  2DZJ A;  4M8N A;  2DHZ A;  3V62 A;  2YVC A;  2AEH A;  2MW5 A;  5IA7 A;  2RPQ A;  1ZGU B;  4LJP B;  3DBH I;  2HE7 A;  2ZZP B;  1KOT A;  1WJN A;  1GJZ A;  4W9H A;  3H6N A;  4XX5 A;  2O6V B;  5JHB A;  2DZK A;  3OJ3 A;  2LVO A;  3NZU A;  2D07 B;  5AZH A;  4BOS C;  2O2V B;  1E90 A;  4G50 A;  3R7Q A;  4WQO B;  4AP4 C;  4JLC A;  3NZS A;  1H8C A;  3H9D A;  5DPT A;  1HE8 A;  2D11 A;  3JSV B;  3VUX A;  1JRU A;  4RM8 A;  5JHA A;  2LVQ A;  2ZCB A;  3RT3 B;  3UIO B;  4NQK E;  1V5T A;  2BGF A;  4KZC A;  2LD9 A;  3CSF A;  2FNJ B;  1ISN A;  2I1J A;  4MM3 A;  1RLF A;  2LUE A;  4FLH A;  2C5L C;  3VH3 B;  1LFD A;  2J0M A;  4AJY B;  3DQV A;  3KYC D;  4HXD A;  3R7R A;  2MP2 A;  1GUA B;  1LQB A;  4HLE A;  4FUL A;  4HDQ A;  3KUD B;  4JL9 A;  1TZ1 A;  2GBR A;  3L54 A;  1V5O A;  2GBK A;  4EUT A;  4HK2 A;  3DVG X;  1VD2 A;  2NVU I;  4M8M A;  4F8C B;  3VXW A;  2NR2 A;  2KDF B;  4EFO A;  3U30 A;  2HJ8 A;  4DHZ B;  3JW0 X;  1P3Q U;  2AL3 A;  3TMP B;  1TTN A;  4J6I A;  3MHS D;  2KWC A;  2LI5 A;  1ZKH A;  3CST A;  1KLV A;  2LXC A;  1WE6 A;  5C1Z A;  3K9O B;  2KNB A;  4NJ6 A;  4IM3 A;  3RZF A;  3PLV A;  2FAZ A;  4FAD A;  2ZVN A;  5CHV C;  2KJ6 A;  3ENE A;  3A9J B;  2K6Q A;  5D6J B;  3ZIM A;  5JZE B;  2AL6 A;  3APD A;  2GOW A;  5AEK B;  2A4Z A;  3DCG A;  4NPN A;  2KXJ A;  2EKE C;  1GNU A;  1WMH B;  4MGI E;  3VTV A;  2OOB B;  3JYU A;  4IC7 B;  4W9L A;  3RUL A;  1E8X A;  3H7P A;  2WDT B;  3UQA A;  1M94 A;  5IAA C;  1VCB A;  4ZYN A;  1WF9 A;  4PS7 A;  1QZE A;  2M17 A;  3AXC A;  3WA0 A;  1WGY A;  4M0W B;  3TCA A;  3ONS A;  5G55 A;  3WIM A;  5LLI A;  3ALB A;  1WY8 A;  2LXA A;  2M0X A;  2IO1 B;  3H7S A;  5BO4 B;  1ZW7 A;  3NHE B;  1WJ6 A;  4W9E A;  4DXA B;  2C7M B; 
#chains in the Genus database with same CATH topology
 1P0R A;  4BBN C;  2GBJ A;  4W9F A;  2WP9 B;  3VTU A;  2KD0 A;  3SFE B;  2XBB C;  3ZLZ A;  1KM7 A;  3FC4 A;  4NY0 A;  1FRD A;  4PS8 A;  2L7R A;  3ZRF A;  2LJ5 A;  4W9G A;  1E10 A;  5BMH A;  2WDQ B;  3BZD B;  5BYQ A;  3BYY B;  3QJZ A;  2FCN A;  4RFB A;  3DHH C;  4OVV A;  1R7S A;  3HHM A;  3NRZ A;  3AE6 B;  3ETR A;  2WDV B;  4DDG D;  4NNJ B;  1TS3 A;  1RRB A;  3DOW A;  1J7A A;  2OED A;  4IWQ A;  3L10 B;  3SHQ A;  4RCO A;  5J17 A;  4ASW C;  4GOC A;  2WYQ A;  2KVR A;  2LGI A;  1UWX A;  2N9K A;  2KKC A;  3ZTD A;  1YJI A;  1WXV A;  3MC8 A;  2BT6 A;  3LJ3 A;  4W9K A;  4LTU A;  1WM3 A;  2C9W B;  1XLO A;  3ZJT A;  4BBN F;  3Q3J A;  1WFY A;  2MWS B;  3DBR I;  3ABV B;  1WE7 A;  2PE9 A;  2J52 A;  1FEH A;  3AEE B;  1V86 A;  1SIJ A;  2LGS A;  1PGB A;  3NVW A;  3SFD B;  4PS3 A;  4LCD E;  3Q69 A;  2WDR B;  1VZ6 A;  2SEB D;  5KHO A;  3KVF B;  4YTP B;  1ESF A;  2QDF A;  1XF5 L;  2JZZ A;  1WZ3 A;  4WJO A;  1C79 A;  1L6U A;  3M3J A;  1K8R B;  2K8C A;  2IO3 B;  3TEW A;  2FCM A;  2HD5 B;  2KHW B;  4PT5 A;  3WAP A;  3ZW3 A;  2BYF A;  2QMT A;  1XQQ A;  2DYO A;  2KMM A;  3L0W B;  4MGY E;  4HDO A;  3OG5 A;  3WAO A;  2BS3 B;  3UGB B;  3A4R A;  2IYD B;  2WXP A;  1L0Y B;  3PSE B;  3MJW A;  4LDT B;  2N4F A;  4HKQ A;  4ARI A;  3Q14 C;  2VZK D;  4HPP A;  4P16 A;  3N1Y C;  3PZ7 A;  3A9K B;  4KIK A;  2AQ1 B;  3N1X C;  4AJW A;  1JAL A;  1KTK A;  2D3B A;  1NEN B;  4C7Y A;  2C60 A;  1F0Z A;  4JE3 B;  1FFU A;  2DYM A;  4LNK A;  1KLG D;  4RNA A;  1E7U A;  2L8J A;  3QCA A;  2RR9 A;  2UU7 A;  4KVG B;  1JWA D;  5EDS A;  3GE3 C;  2N7D A;  2CJO A;  2FCQ A;  4RGN A;  4DDI D;  1N61 A;  1MI0 A;  5FKA C;  2LEK A;  2KDI A;  3VDZ A;  3PGE A;  2V0G A;  3R2T A;  1IP9 A;  4WAF A;  3RZW C;  4YSX B;  5E6O A;  3K9P B;  4ANW A;  2NBU A;  3NY5 A;  1T3Q A;  2BS4 B;  4C7Z A;  2L32 A;  3SU8 X;  3ZXR A;  2MRP A;  3PT2 B;  3VHT C;  3EUB 2;  5J2R A;  5E6P A;  2PE6 B;  2KTR A;  4DXG A;  1ET9 A;  2UWQ A;  2WXF A;  3EGR A;  2WU2 B;  2KQ7 A;  3GZN I;  4YWG G;  2IND C;  3QA8 A;  4B6W A;  2QJL A;  5HHD G;  1VDV A;  1BUI C;  2Z8L A;  1WRD B;  1EWC A;  1UEL A;  1EUV B;  2RSU A;  2KOX A;  2PIA A;  3P4S B;  3EHV A;  2MSE D;  5FR3 A;  1SEB D;  3UIN B;  4TMA B;  3R3M A;  2MBB B;  2PLP A;  1WX8 A;  4P7I A;  1C1Y B;  5IN7 A;  4LK0 M;  2IY0 B;  2K0P A;  2MBO A;  1WGG A;  2NMQ A;  1UWM A;  3S2A A;  2JXT A;  2L00 B;  3CMM B;  1I4Q A;  1VJK A;  2ON8 A;  1V1O A;  1WYW B;  5E6J A;  1EU4 A;  1WR1 A;  4I6L B;  4ANX A;  3ZNZ B;  1MJD A;  3PO0 A;  3EFU A;  1PYW D;  4RGT A;  2MP2 B;  4K7W A;  2IZV B;  3BK1 A;  4RMA A;  3RMK C;  1IGD A;  4CO7 A;  2LHE A;  1WI0 A;  2V4L A;  1P1A A;  4MSM B;  1V49 A;  2INP E;  1XLQ A;  1WGD A;  2WQY B;  2N9X A;  1VZ8 A;  2KLC A;  3HIZ A;  5AZG A;  3NS8 A;  3R2I A;  2HTH A;  3VRB B;  2J53 A;  4KGT A;  4ICV A;  4E3C A;  3B0A A;  1Y56 A;  2J0K A;  5D94 A;  3A1Q A;  1FIQ A;  2RD0 A;  1Z5S B;  3EFC A;  3GP7 A;  2JRI B;  2N9L A;  2LMC A;  3AV8 A;  3PHX B;  1N63 A;  2BKF A;  2V3P A;  4C80 A;  3BWU D;  1SE2 A;  4S17 A;  1LM8 B;  3L4P A;  4IOI E;  4GMV A;  3M95 A;  3UQB A;  1E5W A;  1XCQ L;  4FHK A;  4E71 A;  2N9E B;  2I2Y A;  2CKH B;  3AU4 A;  3TJP A;  3A1Q B;  2YLM A;  3L17 A;  4RF0 A;  4WAA A;  5T8I A;  1DYQ A;  3V62 A;  4HKZ E;  4C56 C;  2WXI A;  1UUP A;  1FNW A;  2MH7 A;  2ZZP B;  1TS4 A;  1FPY A;  1QLB B;  2D3A A;  2LHD A;  2O6V B;  5JHB A;  1EWY C;  2D07 B;  4BOS C;  4O1N A;  3P4R B;  3H9D A;  3VUX A;  1YQ4 B;  4XDD A;  2HTM E;  1V5T A;  2PW9 A;  2BGF A;  2MJE A;  3CSF A;  1KLU D;  2GLS A;  4YTN B;  2FNJ B;  4MM3 A;  1ZE3 D;  3P42 A;  2LUE A;  1HA5 A;  1LFD A;  2J0M A;  4ZYS A;  3AE2 B;  3KYC D;  2QCZ A;  1GUA B;  4HLE A;  4HDQ A;  1FXA A;  1TZ1 A;  5BMG A;  2RPV A;  3U4E G;  3URY A;  2NVU I;  3U30 A;  3DBH B;  4DHZ B;  1E9M A;  2XNA C;  2INN E;  2WS3 B;  1PGA A;  3CST A;  1UNS A;  1I4H A;  2ZVN A;  2KJ6 A;  3ENE A;  1JCK B;  2BBC A;  2K6Q A;  1FM0 D;  2IGH A;  3APD A;  2A4Z A;  2VH1 A;  4NPN A;  1ROE A;  2KXJ A;  4TSS A;  1T0S C;  4MGI E;  2OOB B;  3JYU A;  4IC7 B;  1GAQ B;  4W9L A;  5JXV A;  4OZC A;  1M94 A;  5IAA C;  1VCB A;  4ZRQ A;  4PS7 A;  3Q3N C;  1IBX A;  2KWD A;  2IO1 B;  2E3T A;  4M00 A;  5BO4 B;  2JU6 X;  3UI3 A;  1CZP A;  4GIV A;  1D5X C;  3ECI A;  1YX5 B;  5BYR A;  4UDU C;  4M02 A;  1SGH A;  3AE5 B;  4G0N B;  1TKE A;  3TIX A;  4HWI B;  1OGW A;  1HZ5 A;  1QT9 A;  2JQR B;  4A55 A;  5GXG B;  2WX1 A;  3TSS A;  3OJ4 B;  3ZO5 B;  2KYW A;  1JQ4 A;  2J0J A;  2GRI A;  4E74 A;  2KZR A;  1N62 A;  3MC9 A;  2PKO A;  1SF0 A;  4HRS A;  4AOF A;  3NJT A;  4M01 A;  1WH3 A;  5MPO A;  3B1L X;  2KDE B;  3MC0 B;  3NOB A;  3DWG C;  1A70 A;  5CHF A;  3NVY A;  3VUW A;  2KMA A;  1C76 A;  3PPA A;  3KYD D;  4ZHO A;  2BF8 B;  4FN2 A;  1K52 A;  2XN9 C;  1UF0 A;  2KWU B;  3HVD A;  4ACF A;  5L83 A;  3ZNI D;  1ACC A;  3U7D A;  4GN1 A;  2R2Q A;  2JF5 A;  4KDI C;  5FK9 C;  2PPH A;  1RAX A;  4JWS C;  1TBE A;  4C4V B;  3NVV A;  1YIW A;  1TIF A;  1T0Y A;  1B1Z A;  1L5P A;  3A9J A;  3KWL A;  1TS2 A;  2LGD A;  3RI7 C;  2KQS A;  4XZ4 A;  1WMH A;  1XT9 B;  2Y5C A;  1I4G A;  3H1U A;  3HUI A;  2M4N A;  2MJ3 A;  2PVG C;  3VQI A;  4C00 A;  1ZUD 2;  1J0G A;  4ZHP A;  2D3G A;  3CWI A;  1G6J A;  4S0R A;  1AN8 A;  2H88 B;  3FKY A;  4I6P A;  1UBQ A;  4KDL B;  1LGR A;  1K51 A;  3BVM A;  4ICU A;  2LAS A;  3OLM D;  1SBB B;  3NUH B;  3KUZ A;  4XC2 A;  4KV2 A;  2HJ1 A;  2FID A;  2KAN A;  3AH7 A;  5DCN A;  2QIL A;  3IAM 1;  4K7S A;  2J7Q B;  3DBR B;  4X57 B;  4BZA A;  4KGS A;  2WXR A;  2DZM A;  1GG3 A;  4W9I A;  5L95 C;  3L08 A;  3PLU A;  4WJQ A;  1GOZ A;  3GS2 A;  4WQM A;  2JYT A;  4EZJ A;  2K25 A;  3AB5 A;  2FE8 A;  2D10 A;  1F2R C;  2NPT B;  5EE1 A;  2L3Z A;  2DWQ A;  1F77 A;  3QAQ A;  2BWF A;  1FD6 A;  3RNA C;  1S1Q B;  2L83 A;  3QHT A;  1HQR D;  2NCN A;  2CU1 A;  1DOX A;  2DZI A;  3VH4 B;  1V80 A;  4YL8 A;  2MCN B;  4PYU A;  3DDC B;  2AYO B;  4P1C C;  5G2N A;  1V8C A;  3T8M A;  1IPG A;  4Q2J A;  3AE3 B;  2G4S A;  5JH5 C;  1N5X A;  4NZL B;  1ZDV A;  2G45 B;  3E56 A;  3KH0 A;  3APC A;  3WAM A;  2K6D B;  4XWW A;  1V9J A;  3O65 B;  4FJV B;  5GMV A;  1L7Y A;  1HEZ E;  1TYG B;  1E8W A;  1NI2 A;  2PVO D;  3A4S C;  3D32 A;  1MG8 A;  4JGH B;  4AWJ A;  4LNF A;  2C7N B;  2UYZ B;  4ANU A;  1BXT A;  1HTO A;  2LZ6 A;  1ZOY B;  3HM6 X;  1I4P A;  2WX0 A;  4GB9 A;  4GDL B;  4ITK A;  1FXI A;  3DBL B;  3ZUN A;  4L2Y A;  4USA A;  4FXC A;  3TEY A;  1KJT A;  2V3N A;  2BWE S;  4NAW A;  2GMI C;  3AU5 A;  1ZXH A;  3TL5 A;  2CHW A;  3ZNH B;  2C7H A;  1L6V A;  2KFK B;  4A9A A;  4MSQ B;  3TUO A;  2X38 A;  4A6Q A;  2K1F A;  2JUO A;  2B76 B;  4L1B A;  4KSK C;  3AN1 A;  4HJG E;  3EC8 A;  2JZ3 B;  2Z0E B;  3GZN B;  3P63 A;  2K8H A;  4RGO S;  1C78 A;  2KX3 A;  3RNB C;  3A9K A;  4NAW B;  3V61 A;  4N6E B;  4A3P A;  4II2 B;  4AS1 A;  2VH2 A;  2RGF A;  2KJH B;  1T6B X;  2V1Y A;  2N7E A;  2KT7 A;  4FJZ A;  1QQR A;  2KAJ A;  2BW2 A;  1MPE A;  2MBH A;  2MX2 A;  3MHZ A;  4HRO A;  1K50 A;  1ENF A;  3EA6 A;  1NEK B;  1WWT A;  2KWV B;  5EE0 A;  1VZ7 A;  2K22 A;  2MBQ A;  1L4D B;  4P1B C;  2DAJ A;  2NBV B;  4G11 A;  5BMI A;  4RF1 A;  5C3J B;  2KLG A;  1D5M C;  2N1W A;  4MDK E;  2MHJ A;  3AE4 B;  3DBL I;  5IO9 A;  1E6E B;  4BKS D;  2ICI A;  4FJY A;  3QQ8 B;  1P7F A;  2Y5B B;  4KSL C;  3V6C B;  5CX3 A;  1D3Z A;  4H2A A;  2DBY A;  4YT0 B;  4IKG A;  3T3N A;  4FBJ B;  4WWO A;  1J7C A;  4N9F 4;  2XEW A;  1FMA D;  3P4P B;  2QSD A;  2KFJ A;  1FCC C;  3JSV A;  3Q8A A;  1IYF A;  1UH6 A;  1YX6 B;  3MFG A;  2GB1 A;  2RDH A;  2DZJ A;  4A90 A;  5IKC M;  1SSN A;  1KOT A;  2DLB A;  2KAC A;  4XX5 A;  2LJI A;  3V3X A;  2DZK A;  2RDG A;  4RH6 A;  2PMV A;  5AZH A;  1E90 A;  1QOB A;  3Q2A C;  4WQO B;  4ARC A;  3N9Y C;  1HE8 A;  3JSV B;  4RM8 A;  2LVQ A;  3KWV A;  2QEJ C;  2M0A A;  3Q3O C;  1FNV A;  3ZJU A;  2C5L C;  3VH3 B;  4AJY B;  3DQV A;  1WYG A;  2MP2 A;  5TSS A;  1LQB A;  1C9F A;  4JL9 A;  2LUM A;  2GBR A;  2VZK B;  3KQ4 A;  3L54 A;  3RNE C;  3DVG X;  1VD2 A;  4F8C B;  5LNK 1;  4EFO A;  2QC8 A;  1P3Q U;  2AL3 A;  2D3C A;  3TMP B;  4J6I A;  1XO3 A;  2BB5 A;  2KWC A;  2LXC A;  4KKJ A;  2Y3A A;  2KNB A;  3ZQ4 A;  1NVI D;  2FAZ A;  5HG2 A;  1L0V B;  1XLP A;  2AL6 A;  3NZ3 A;  2EKE C;  1GNU A;  4B0M A;  1R4N B;  4L23 A;  1WGK A;  3E9S A;  2G9H D;  4ZYN A;  3WA0 A;  2M17 A;  4M0W B;  3ONS A;  5G55 A;  3IT6 B;  3H7S A;  1NYQ A;  1ZW7 A;  3TEZ A;  4DXA B;  3APF A;  1H4R A;  1E7P B;  3VAW A;  2W82 A;  4K1R B;  3Q3M C;  4OVZ A;  3DBS A;  3HK0 A;  3DVG Y;  1FRR A;  1FNU A;  1CQV A;  2MBE A;  1TS5 A;  4GDK B;  3W5V B;  3Q8F A;  4BAX A;  5AZF A;  2KK8 A;  1SIF A;  1WXQ A;  2IGG A;  3AED B;  2LRW A;  2O6V A;  1B9R A;  3I9V 1;  1OFF A;  4DHJ D;  1WM2 A;  1FXT B;  1YD8 U;  4A20 A;  3HM3 A;  4OHJ A;  2DEN B;  4LNI A;  4WWP A;  2EKI A;  2PEA A;  3W1S C;  1TY0 A;  3IFW B;  4IUM B;  4B9K A;  1F52 A;  5CHW A;  2I38 A;  5J18 A;  1I7H A;  1F9J A;  4PYZ A;  4BOZ B;  5D3I B;  1OEY J;  3N20 C;  3PRM B;  2W3S A;  2BPS A;  2CR5 A;  1QIL A;  4GU2 A;  4W9J A;  2Z0D B;  2LRU A;  2FIF A;  5G5G A;  1R4N I;  2L0T A;  3UIP B;  1XEE A;  2KDB A;  2XK5 B;  1OQR A;  1MG4 A;  3N1Z C;  3RCZ A;  2ONQ A;  5G5H A;  3LYY A;  5C23 A;  4CYE A;  4ZDV A;  1JRP A;  1MHX A;  2B3A A;  1UGJ A;  5EE9 A;  2KMC A;  3SEB A;  1LXD A;  2INC C;  2K39 A;  3N32 A;  4NQL B;  4URK A;  1J8C A;  2BYE A;  1I35 A;  2OJW A;  4N58 A;  1F1H A;  4TQ1 A;  2Q5W D;  4HJK A;  5FR6 A;  2RMM A;  4QAY A;  4DXF A;  1CJE A;  4RM9 A;  4REZ A;  1IUE A;  2CS4 A;  1WJ4 A;  1EU3 A;  4IG7 B;  5BYS A;  1KH0 A;  4IM2 A;  4KZ0 A;  4MGK E;  2KC2 A;  3X23 A;  3ZVV A;  2M1M A;  3Q8E A;  3AEA B;  2WGS A;  4ZRI A;  4DHJ B;  3AUL A;  1SE3 A;  2DAF A;  1FCL A;  1C4P A;  1EF5 A;  4DBG A;  2JXX A;  3AM9 A;  4CQN A;  2R61 A;  4EOY A;  2MQJ A;  2QIE B;  2OJR A;  1D4B A;  4IDI A;  3RYT A;  3U8Z A;  2ZNV C;  4LNN A;  3AEB B;  1DGJ A;  2AWT A;  2BS2 B;  1WIA A;  2CHX A;  2GI9 A;  3AE8 B;  4D2K A;  3PS6 A;  3SD5 A;  2JPH A;  3LXF A;  5H8Y E;  4C4V A;  2V9H A;  1Q5W B;  4ANV A;  1V1P B;  4TQ0 A;  3QIJ A;  1QF6 A;  4W9D A;  2JY6 A;  1C3T A;  3UF8 A;  1GPX A;  3O13 A;  1UD7 A;  4LLG M;  3VFK A;  1RFK A;  3L16 A;  3QC8 B;  2CHZ A;  3ZDT A;  3DHG C;  1UGM A;  4XE0 A;  1V6E A;  1SJE D;  5D2M B;  1WGH A;  3T9L A;  3PHW B;  1R4M I;  3PV1 A;  1P7E A;  4GSW A;  3VTW A;  2NTT A;  3TEX A;  2ZVO A;  4BKG A;  5HFY A;  1L2N A;  5AUI A;  2RDB C;  3LDZ E;  2NS5 A;  1VLB A;  2N7J A;  3QWZ B;  2DX5 B;  3C0R B;  3PRZ A;  3SDL C;  4MJS A;  4P6V F;  3JVZ X;  2L52 A;  2J4X A;  1F2R I;  3IAS 1;  1A5R A;  4MEM A;  1PGX A;  3NVZ A;  1UBI A;  4ZRK A;  2D2Q A;  1J19 A;  4WWM A;  3AEC B;  5E6N A;  2WNM A;  3P2B A;  2BKR B;  1TJE A;  5IOI A;  1RFA A;  1SB3 C;  3PTF C;  4NJ7 A;  1NDD A;  1TGZ B;  2LWP A;  2M56 B;  3V6E B;  3W1Y A;  4AUQ C;  5KHQ A;  2NPT A;  2KC1 A;  3FIL B;  3U52 E;  2BYV E;  2G1E A;  2X8X X;  5HI1 A;  3Q8C A;  5LXH A;  4N59 A;  2H89 B;  4MJS B;  1IGC A;  1ZXI A;  1SE9 A;  5D7G A;  1YJ1 A;  3RFZ B;  2CU3 A;  2WHI A;  4HCP B;  2IDY A;  4WJP A;  4WIP A;  1VRA B;  1WX7 A;  4WUR A;  2VRR B;  3ZYY X;  4CHK A;  3X0W A;  1N5W A;  1OTR B;  4ZRP A;  4IWP A;  1TKY A;  2MA9 B;  3BYT B;  2N9P C;  2L76 A;  5DPR A;  3R8B A;  2JWU A;  1L4Z B;  3H7P B;  2AX5 A;  2IO0 B;  1KFY B;  4LDT D;  3CF6 E;  4GDL A;  4F1S A;  2KO3 A;  4EZL A;  1P9D U;  1QOG A;  1OQY A;  3KLS X;  1YN5 A;  3QX1 A;  4JIO U;  2D5G A;  3C8Y A;  3L13 A;  4JWU C;  1JWU D;  2O2V A;  4F7Z A;  4MH0 E;  1OQQ A;  1C77 A;  1D6E C;  4GGQ A;  1YQB A;  2KFK A;  1EF1 A;  4HVB A;  1YNT E;  1N60 A;  3ZTC A;  4M8N A;  5I4D A;  2DHZ A;  2YVC A;  2AEH A;  5IA7 A;  1YN4 A;  3B2F A;  4LJP B;  2YEP B;  4W9H A;  1YMH E;  3DWM A;  2OHF A;  1LO5 D;  1C4A A;  3W2D A;  2J42 A;  2O2V B;  3R7Q A;  4G50 A;  2IJ0 A;  3NZS A;  3T3O A;  5DPT A;  1H8C A;  2D11 A;  3HRD D;  1JRU A;  2ZCB A;  3UIO B;  4KZC A;  2LD9 A;  2PTL A;  2WLB A;  1RLF A;  4YSZ B;  5EE3 A;  2K5P A;  4FUL A;  2K3U A;  3VR8 B;  2M19 A;  1NI3 A;  3VR9 B;  4HK2 A;  4M8M A;  3VXW A;  5IP4 D;  2NR2 A;  2KDF B;  1HTQ A;  2HJ8 A;  3Q8B A;  3JW0 X;  4YSY B;  3MHS D;  4RGM A;  1ZKH A;  1WRI A;  1WE6 A;  5C1Z A;  4KX6 B;  4NJ6 A;  4IM3 A;  3RZF A;  4FAD A;  1AW7 A;  1RWS A;  1V97 A;  1I4R A;  3ZIM A;  5JZE B;  1T0Q C;  5AEK B;  3DCG A;  3RNC C;  1E8X A;  1YJJ A;  1DOY A;  2WDT B;  1SE4 A;  1WF9 A;  1QZE A;  3AXC A;  1WGY A;  1TT5 B;  3TCA A;  3J9C A;  1PFD A;  3WIM A;  3ALB A;  1WY8 A;  2JX5 A;  2LXA A;  3VRA B;  1SXT A;  1C4C A;  3WCQ A;  1S3S G;  2DYB A;  2GBM A;  1EO6 A;  3BY4 B;  4FA6 A;  3W5U B;  1I4X A;  4TUU A;  4IW0 A;  1XXG A;  4BFR A;  3OWE B;  4DWF A;  3W1S A;  3NS1 A;  3ZGZ A;  1WZ0 A;  1WX9 A;  2ZCC A;  1I42 A;  3P4Q B;  1X1M A;  3PRP B;  4II3 B;  2JT4 B;  2WXO A;  1D5Z C;  4HPL B;  4XDC A;  1PUT A;  1V2Y A;  1E0Z A;  1EM7 A;  2K9X A;  3IVF A;  2NBW B;  2NTS A;  5AUK A;  4KIK B;  3NG0 A;  2BB6 A;  2KTF A;  4B95 A;  4US8 A;  4GLS C;  3I57 A;  1KRH A;  2LGY A;  1WR6 E;  4EKU A;  3PRE A;  2BTE A;  2CJN A;  4W9C A;  3QAR A;  3KUC B;  1JRO A;  2SAK A;  3PZ8 A;  1M4V A;  2JRH A;  1QKZ A;  5CTR C;  5DPS A;  1T5X D;  4TKN A;  3V60 A;  3AEG B;  5LXI B;  1RYJ A;  1TZO A;  2HDE A;  2KDM A;  2LGX A;  3N3K B;  2KN5 A;  3P1M A;  4B0E A;  4G3X B;  4IM0 A;  4ZOH C;  3WAL A;  2FBW B;  2KX0 A;  3CIR B;  2K8B A;  1JW9 D;  3AEF B;  2BVC A;  2BQQ A;  4MGZ E;  4MEL A;  4GXB A;  1GC7 A;  4FHJ A;  2KTR B;  3RPF C;  3MP9 A;  3OAW A;  3GE8 C;  2MEK A;  1T0R C;  3ZKJ C;  1NYR A;  4WH4 A;  4BKS A;  2TSS A;  2M8S A;  3GB1 A;  1MHH E;  2MLB A;  3TBL D;  4M0W A;  5HKH A;  1XD3 B;  3AE1 B;  2O6V D;  2W3R A;  4XYC A;  1WXM A;  3W9C B;  1Q1O A;  1DOI A;  2GBN A;  4JX1 C;  2JVC A;  2Z59 B;  4EEW A;  3DPD A;  3B08 A;  4WWN A;  2EMS A;  3AI5 A;  1FO4 A;  2FUH B;  2EMT A;  4GDK A;  4MT5 A;  1SJH D;  2YEP F;  4US9 A;  2BYT A;  4DQO C;  2E6X A;  1JWS D;  4XWT A;  2W9N A;  1ZPS A;  4WJN A;  2N1V A;  4HPM B;  2ASQ A;  1VR9 A;  2EEL A;  1QOA A;  3I63 C;  1Y8R C;  3I3T B;  4TV3 A;  4BVU C;  2IGD A;  2L05 A;  3FAH A;  3IXS A;  3BVZ A;  3EEC A;  2WXN A;  2QHO A;  3U2S C;  2LFI A;  4KKI A;  3RD2 A;  3IG3 A;  2ZNV B;  2W54 A;  4A3O A;  2WXJ A;  3AE7 B;  1UZX B;  3LB8 C;  1P98 A;  2WXH A;  2WXL A;  1CK1 A;  3Q6B A;  3N30 A;  1JWB D;  4R3D A;  1E8Z A;  2PJH A;  1WXA A;  1MVK A;  3RUI B;  2JWZ A;  2XK5 A;  3ZNG C;  3QK0 A;  1HXY D;  1WXS A;  1ET6 A;  3PVL A;  3V05 A;  3VUY A;  1J7B A;  4LJO B;  1Z2M A;  2R2O A;  1YN3 A;  1XLN A;  2REX A;  3VVW B;  1RM6 C;  3RN9 C;  4EE2 A;  2KN4 A;  1YQ3 B;  1AAR A;  2V4I B;  3MTN B;  1PDX A;  3ML9 A;  1WJU A;  3AMZ A;  3IHP C;  2WXG A;  5TR5 A;  2IPK D;  4MAC A;  4K3C A;  1KF6 B;  3DVN V;  4I6N B;  1U4A A;  3Q3F A;  3BIN A;  1AWD A;  1HZ6 A;  2A5U A;  2IY1 B;  4HCN B;  4LNO A;  4K81 A;  1Q0W B;  2LVP A;  3H8H A;  1BML C;  4JPS A;  3DHI C;  1ZDX A;  2ZPY A;  2JSV X;  1E8Y A;  2KVZ A;  4YXD B;  1GB1 A;  2KQ4 X;  3PZD A;  1OEY A;  1E7V A;  4OVU A;  1R4M B;  1GB4 A;  2FUG 1;  3M62 B;  1WGR A;  4MM3 B;  2FCS A;  2ZPN A;  3M63 B;  4ZRJ A;  4DK5 A;  4J3O D;  3ZDM C;  1BT0 A;  1V81 A;  4OW0 A;  3AE9 B;  4K3B A;  2V3S A;  2G4D B;  2KJR A;  3IT4 B;  2IO2 B;  1NBF C;  2WU5 B;  1FFV A;  2G3Q B;  4IWO A;  1QOF A;  1V1P A;  3KW5 B;  2L0F A;  3RNF C;  1PQS A;  3ML8 A;  4MH8 A;  3WAN A;  4OZB A;  3R66 C;  1JWM D;  4K7U A;  1CMX B;  3BK2 A;  3C19 A;  3BVG A;  1N6Z A;  1Q10 A;  3ZRC A;  1IBX B;  5H92 C;  2WWZ A;  4DHZ E;  2ZEQ A;  4KGR A;  2N0S B;  2ZJD A;  3GOE A;  1TY2 A;  3A33 B;  2ACZ B;  4NJC A;  1JML A;  3B9J A;  5C2T B;  4BKT A;  2W55 A;  4EZK A;  4JQW C;  1XCT L;  3DVN U;  2IBI B;  3IBE A;  5DPW A;  2I1K A;  2JYE A;  3BII D;  1GC6 A;  3U7Z A;  3B2G A;  3ZJV A;  1K53 A;  2MW5 A;  3HVZ A;  1YOV B;  2ZW0 A;  2RPQ A;  1ZGU B;  3I5J C;  4A8X C;  3DBH I;  2HE7 A;  2DNF A;  1WJN A;  1GJZ A;  1ZP0 B;  3H6N A;  5D3D A;  2WXQ A;  3OJ3 A;  2LVO A;  3NZU A;  4AP4 C;  4JLC A;  2AQ2 B;  5JHA A;  3MJ5 A;  3RT3 B;  4NQK E;  3SR6 A;  1MFW A;  4NAM A;  1ISN A;  3RNG C;  2I1J A;  1TKG A;  3FIL A;  4AQ7 A;  4FLH A;  4PK1 A;  4HXD A;  3R7R A;  4YTM B;  3KUD B;  4EUT A;  1V5O A;  2GBK A;  2L1A A;  1AYF A;  1TTN A;  2WXK A;  2LI5 A;  1KLV A;  4XGA B;  3K9O B;  2AQ3 B;  2MJD A;  3PLV A;  5CHV C;  2ZW1 A;  3A9J B;  5D6J B;  1WSP A;  2WXM A;  2GOW A;  4HEA 1;  1STE A;  1WMH B;  3ZXV A;  3VTV A;  3RUL A;  2JZP A;  3H7P A;  3UQA A;  2Y5P A;  5LLI A;  2M0X A;  4OZA A;  3NHE B;  1WJ6 A;  4W9E A;  1L0X B;  2C7M B; 
#chains in the Genus database with same CATH homology
 2DYB A;  3APF A;  1H4R A;  1P0R A;  4GIV A;  2GBM A;  3VAW A;  3ECI A;  1YX5 B;  4BBN C;  2GBJ A;  4W9F A;  1EO6 A;  1SGH A;  3BY4 B;  4FA6 A;  4G0N B;  3VTU A;  4TUU A;  2KD0 A;  4K1R B;  4IW0 A;  3TIX A;  4HWI B;  1OGW A;  4BFR A;  2XBB C;  3DBS A;  1KM7 A;  3HK0 A;  3ZLZ A;  4DWF A;  2WX1 A;  4NY0 A;  3W1S A;  1WZ0 A;  1WX9 A;  3DVG Y;  3OJ4 B;  3ZO5 B;  2ZCC A;  1I42 A;  4PS8 A;  2L7R A;  1X1M A;  3PRP B;  4II3 B;  2MBE A;  2J0J A;  2JT4 B;  4GDK B;  4HPL B;  3ZRF A;  1V2Y A;  4E74 A;  2KZR A;  2LJ5 A;  4W9G A;  5AZF A;  3IVF A;  2KK8 A;  1SIF A;  4AOF A;  2LRW A;  2O6V A;  2NBW B;  1WH3 A;  4DHJ D;  1WM2 A;  3B1L X;  2KDE B;  1FXT B;  3NOB A;  3QJZ A;  4KIK B;  2FCN A;  1YD8 U;  2KTF A;  4OVV A;  4B95 A;  4A20 A;  3HM3 A;  5CHF A;  2DEN B;  2LGY A;  1WR6 E;  3HHM A;  4EKU A;  4WWP A;  3PRE A;  3W1S C;  2PEA A;  3VUW A;  4W9C A;  3QAR A;  2KMA A;  3KUC B;  3IFW B;  4IUM B;  4NNJ B;  3PPA A;  4DDG D;  3KYD D;  4B9K A;  2BF8 B;  4FN2 A;  5CHW A;  5J18 A;  2JRH A;  1F9J A;  4PYZ A;  1RRB A;  5CTR C;  4BOZ B;  5DPS A;  2KWU B;  4TKN A;  1OEY J;  3DOW A;  3V60 A;  5L83 A;  5LXI B;  4IWQ A;  3ZNI D;  3U7D A;  2LGX A;  3L10 B;  3N3K B;  3SHQ A;  2KN5 A;  3PRM B;  4GN1 A;  2BPS A;  4G3X B;  4ASW C;  4GOC A;  4IM0 A;  5J17 A;  3WAL A;  2R2Q A;  2WYQ A;  2JF5 A;  4KDI C;  2KVR A;  2CR5 A;  2KX0 A;  2KKC A;  3ZTD A;  4GU2 A;  2K8B A;  1WXV A;  2PPH A;  4W9J A;  3LJ3 A;  1RAX A;  4W9K A;  2Z0D B;  2LRU A;  1TBE A;  2FIF A;  1WM3 A;  2C9W B;  1R4N I;  2L0T A;  3UIP B;  4MGZ E;  1YIW A;  4MEL A;  4BBN F;  3Q3J A;  4GXB A;  1WFY A;  2MWS B;  3DBR I;  1T0Y A;  3A9J A;  1GC7 A;  1WE7 A;  2PE9 A;  1V86 A;  2KDB A;  4FHJ A;  2KTR B;  2XK5 B;  2LGD A;  3OAW A;  3RCZ A;  2KQS A;  4PS3 A;  1WMH A;  4LCD E;  4XZ4 A;  1XT9 B;  3ZKJ C;  1S3S G;  5C23 A;  5KHO A;  4CYE A;  3KVF B;  3H1U A;  4BKS A;  2M8S A;  4ZDV A;  2M4N A;  2JZZ A;  1WZ3 A;  3VQI A;  4WJO A;  2B3A A;  2MLB A;  3TBL D;  5HKH A;  1J0G A;  2D3G A;  1G6J A;  2KMC A;  1XD3 B;  3M3J A;  2K8C A;  1K8R B;  1LXD A;  2O6V D;  2IO3 B;  2K39 A;  4I6P A;  1UBQ A;  3N32 A;  4NQL B;  4KDL B;  2FCM A;  4URK A;  2HD5 B;  1WXM A;  2KHW B;  4ICU A;  1J8C A;  3WAP A;  2LAS A;  2BYF A;  1Q1O A;  3ZW3 A;  1XQQ A;  2DYO A;  3OLM D;  2BYE A;  2GBN A;  1I35 A;  3KUZ A;  3L0W B;  4XC2 A;  2JVC A;  4MGY E;  4KV2 A;  2FID A;  4HDO A;  4TQ1 A;  4HJK A;  2KAN A;  3WAO A;  2Z59 B;  3UGB B;  5DCN A;  5FR6 A;  4EEW A;  3A4R A;  3DPD A;  2IYD B;  3B08 A;  4K7S A;  2EMS A;  4WWN A;  2J7Q B;  3AI5 A;  4X57 B;  2FUH B;  4RM9 A;  2EMT A;  4GDK A;  2CS4 A;  1WJ4 A;  3PSE B;  3MJW A;  2DZM A;  4IG7 B;  4LDT B;  1GG3 A;  2N4F A;  4IM2 A;  4W9I A;  5L95 C;  3L08 A;  4KZ0 A;  4MGK E;  2KC2 A;  2W9N A;  3PLU A;  4WJQ A;  4WJN A;  3A9K B;  4KIK A;  2M1M A;  3X23 A;  2N1V A;  3ZVV A;  4AJW A;  4ZRI A;  4DHJ B;  4HPM B;  3AUL A;  2ASQ A;  2C60 A;  4EZJ A;  2K25 A;  2DAF A;  2DYM A;  2D10 A;  1Y8R C;  1E7U A;  3I3T B;  2NPT B;  1EF5 A;  4TV3 A;  4BVU C;  2L05 A;  4DBG A;  2JXX A;  2L8J A;  2L3Z A;  3QCA A;  2RR9 A;  4KVG B;  3EEC A;  3QAQ A;  5EDS A;  2BWF A;  4EOY A;  2MQJ A;  2N7D A;  1S1Q B;  2OJR A;  3QHT A;  2NCN A;  2CU1 A;  2DZI A;  2QHO A;  3VH4 B;  1V80 A;  4YL8 A;  2MCN B;  4PYU A;  3DDC B;  3RD2 A;  2AYO B;  3IG3 A;  5G2N A;  3RYT A;  3U8Z A;  2ZNV B;  2ZNV C;  3T8M A;  4A3O A;  2FCQ A;  1IPG A;  4DDI D;  2G4S A;  2AWT A;  2CHX A;  1WIA A;  2KDI A;  3VDZ A;  3PGE A;  1IP9 A;  5JH5 C;  3RZW C;  1UZX B;  3PS6 A;  1P98 A;  5E6O A;  3K9P B;  3SD5 A;  4ANW A;  2JPH A;  2G45 B;  2NBU A;  3N30 A;  3KH0 A;  3APC A;  3WAM A;  3NY5 A;  2K6D B;  3SU8 X;  1Q5W B;  1V9J A;  2MRP A;  3O65 B;  4FJV B;  5GMV A;  3PT2 B;  3VHT C;  4ANV A;  1E8Z A;  2PJH A;  5J2R A;  1L7Y A;  1WXA A;  3A4S C;  1E8W A;  1NI2 A;  5E6P A;  3D32 A;  1MG8 A;  2PE6 B;  4JGH B;  3QIJ A;  4TQ0 A;  4W9D A;  2JWZ A;  2KTR A;  2JY6 A;  2XK5 A;  2UWQ A;  3RUI B;  3UF8 A;  3ZNG C;  4AWJ A;  1C3T A;  1UD7 A;  2C7N B;  2UYZ B;  3QK0 A;  4ANU A;  2KQ7 A;  3GZN I;  2LZ6 A;  3VFK A;  1WXS A;  3QA8 A;  4B6W A;  3HM6 X;  3PVL A;  3VUY A;  4LJO B;  1Z2M A;  2WX0 A;  3L16 A;  3QC8 B;  4GDL B;  2CHZ A;  4GB9 A;  2R2O A;  3ZDT A;  3ZUN A;  1WRD B;  2REX A;  1UEL A;  1UGM A;  3VVW B;  1EUV B;  1V6E A;  2RSU A;  2KOX A;  5D2M B;  1WGH A;  3T9L A;  1AAR A;  1KJT A;  3PHW B;  3MTN B;  1R4M I;  3EHV A;  3PV1 A;  2BWE S;  4NAW A;  2GMI C;  3AU5 A;  3ML9 A;  1WJU A;  2MSE D;  4GSW A;  3VTW A;  3TL5 A;  2CHW A;  2ZVO A;  3IHP C;  3UIN B;  4BKG A;  3ZNH B;  2C7H A;  3R3M A;  5TR5 A;  2MBB B;  1L2N A;  2KFK B;  4MSQ B;  3LDZ E;  2NS5 A;  2K1F A;  3DVN V;  2JUO A;  4I6N B;  1WX8 A;  4P7I A;  4KSK C;  1U4A A;  3QWZ B;  3Q3F A;  1C1Y B;  2DX5 B;  3BIN A;  3EC8 A;  3C0R B;  3PRZ A;  2A5U A;  2JZ3 B;  2Z0E B;  2IY1 B;  4MJS A;  2IY0 B;  2K8H A;  4HCN B;  3SDL C;  3JVZ X;  4K81 A;  1Q0W B;  2KX3 A;  2MBO A;  2LVP A;  1WGG A;  1A5R A;  3A9K A;  4MEM A;  3S2A A;  4NAW B;  3V61 A;  2L00 B;  4A3P A;  1UBI A;  4ZRK A;  2ZPY A;  2D2Q A;  4II2 B;  1J19 A;  1E8Y A;  3CMM B;  5E6N A;  3P2B A;  2BKR B;  1RFA A;  3PTF C;  4NJ7 A;  3PZD A;  1OEY A;  1NDD A;  1TGZ B;  1E7V A;  2LWP A;  4OVU A;  3V6E B;  3W1Y A;  4AUQ C;  2RGF A;  1WYW B;  2NPT A;  5KHQ A;  1WR1 A;  2KJH B;  4I6L B;  4ANX A;  3M62 B;  3ZNZ B;  1WGR A;  2KC1 A;  2FCS A;  3EFU A;  2BYV E;  2ZPN A;  3M63 B;  2V1Y A;  2MP2 B;  2N7E A;  4K7W A;  4ZRJ A;  5LXH A;  2IZV B;  4FJZ A;  4MJS B;  1SE9 A;  2MBH A;  2MX2 A;  5D7G A;  4RMA A;  1YJ1 A;  4CO7 A;  4DK5 A;  3ZDM C;  1BT0 A;  1WI0 A;  1V81 A;  2V4L A;  4HCP B;  1P1A A;  4MSM B;  1V49 A;  4WJP A;  2KWV B;  1WGD A;  2N9X A;  2MBQ A;  1WX7 A;  2V3S A;  2G4D B;  2KLC A;  3HIZ A;  2KJR A;  5AZG A;  2VRR B;  4CHK A;  3NS8 A;  2DAJ A;  1NBF C;  2IO2 B;  2NBV B;  4G11 A;  3X0W A;  2HTH A;  2G3Q B;  4IWO A;  1OTR B;  4ICV A;  4E3C A;  3B0A A;  2J0K A;  3KW5 B;  2KLG A;  4IWP A;  2L0F A;  2MA9 B;  2N1W A;  2N9P C;  2L76 A;  4MDK E;  5D94 A;  1PQS A;  5DPR A;  3ML8 A;  3A1Q A;  3DBL I;  3WAN A;  2RD0 A;  1Z5S B;  3R66 C;  4BKS D;  4FJY A;  3QQ8 B;  2Y5B B;  4K7U A;  4KSL C;  2JRI B;  3H7P B;  3V6C B;  1CMX B;  3PHX B;  2BKF A;  5CX3 A;  2IO0 B;  4LDT D;  1D3Z A;  3CF6 E;  4GDL A;  3ZRC A;  4F1S A;  2KO3 A;  4EZL A;  1P9D U;  2WWZ A;  1LM8 B;  1OQY A;  4GMV A;  3M95 A;  2ZEQ A;  4DHZ E;  4FBJ B;  2ZJD A;  1E5W A;  3QX1 A;  4JIO U;  3GOE A;  3UQB A;  4FHK A;  3L13 A;  4E71 A;  3A33 B;  2N9E B;  4WWO A;  4N9F 4;  2O2V A;  2XEW A;  4BKT A;  2CKH B;  3AU4 A;  4F7Z A;  4MH0 E;  4EZK A;  4JQW C;  3DVN U;  3TJP A;  2IBI B;  3A1Q B;  2KFJ A;  2YLM A;  3IBE A;  3JSV A;  5DPW A;  4GGQ A;  2I1K A;  1UH6 A;  1YX6 B;  1IYF A;  1YQB A;  2KFK A;  1GC6 A;  1EF1 A;  4HVB A;  3L17 A;  3ZTC A;  4WAA A;  2DZJ A;  4M8N A;  2DHZ A;  3V62 A;  2YVC A;  2AEH A;  2MW5 A;  5IA7 A;  2RPQ A;  1ZGU B;  4LJP B;  3DBH I;  2HE7 A;  2ZZP B;  1KOT A;  1WJN A;  1GJZ A;  4W9H A;  3H6N A;  4XX5 A;  2O6V B;  5JHB A;  2DZK A;  3OJ3 A;  2LVO A;  3NZU A;  2D07 B;  5AZH A;  4BOS C;  2O2V B;  1E90 A;  4G50 A;  3R7Q A;  4WQO B;  4AP4 C;  4JLC A;  3NZS A;  1H8C A;  3H9D A;  5DPT A;  1HE8 A;  2D11 A;  3JSV B;  3VUX A;  1JRU A;  4RM8 A;  5JHA A;  2LVQ A;  2ZCB A;  3RT3 B;  3UIO B;  4NQK E;  1V5T A;  2BGF A;  4KZC A;  2LD9 A;  3CSF A;  2FNJ B;  1ISN A;  2I1J A;  4MM3 A;  1RLF A;  2LUE A;  4FLH A;  2C5L C;  3VH3 B;  1LFD A;  2J0M A;  4AJY B;  3DQV A;  3KYC D;  4HXD A;  3R7R A;  2MP2 A;  1GUA B;  1LQB A;  4HLE A;  4FUL A;  4HDQ A;  3KUD B;  4JL9 A;  1TZ1 A;  2GBR A;  3L54 A;  1V5O A;  2GBK A;  4EUT A;  4HK2 A;  3DVG X;  1VD2 A;  2NVU I;  4M8M A;  4F8C B;  3VXW A;  2NR2 A;  2KDF B;  4EFO A;  3U30 A;  2HJ8 A;  4DHZ B;  3JW0 X;  1P3Q U;  2AL3 A;  3TMP B;  1TTN A;  4J6I A;  3MHS D;  2KWC A;  2LI5 A;  1ZKH A;  3CST A;  1KLV A;  2LXC A;  1WE6 A;  5C1Z A;  3K9O B;  2KNB A;  4NJ6 A;  4IM3 A;  3RZF A;  3PLV A;  2FAZ A;  4FAD A;  2ZVN A;  5CHV C;  2KJ6 A;  3ENE A;  3A9J B;  2K6Q A;  5D6J B;  3ZIM A;  5JZE B;  2AL6 A;  3APD A;  2GOW A;  5AEK B;  2A4Z A;  3DCG A;  4NPN A;  2KXJ A;  2EKE C;  1GNU A;  1WMH B;  4MGI E;  3VTV A;  2OOB B;  3JYU A;  4IC7 B;  4W9L A;  3RUL A;  1E8X A;  3H7P A;  2WDT B;  3UQA A;  1M94 A;  5IAA C;  1VCB A;  4ZYN A;  1WF9 A;  4PS7 A;  1QZE A;  2M17 A;  3AXC A;  3WA0 A;  1WGY A;  4M0W B;  3TCA A;  3ONS A;  5G55 A;  3WIM A;  5LLI A;  3ALB A;  1WY8 A;  2LXA A;  2M0X A;  2IO1 B;  3H7S A;  5BO4 B;  1ZW7 A;  3NHE B;  1WJ6 A;  4W9E A;  4DXA B;  2C7M B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...