1WYEA

Crystal structure of 2-keto-3-deoxygluconate kinase (form 1) from sulfolobus tokodaii
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
309
structure length
309
Chain Sequence
AKLITLGEILIEFNALSPGPLRHVSYFEKHVAGSEANYCVAFIKQGNECGIIAKVGDDEFGYNAIEWLRGQGVDVSHMKIDPSAPTGIFFIQRHYPVPLKSESIYYRKGSAGSKLSPEDVDEEYVKSADLVHSSGITLAISSTAKEAVYKAFEIASNRSFDTNIRLKLWSAEEAKREILKLLSKFHLKFLITDTDDSKIILGESDPDKAAKAFSDYAEIIVMKLGPKGAIVYYDGKKYYSSGYQVPVEDVTGAGDALGGTFLSLYYKGFEMEKALDYAIVASTLNVMIRGDQENLPTTKDIETFLREMK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of 2-keto-3-deoxygluconate kinase from Sulfolobus Tokodaii
rcsb
source organism Sulfolobus tokodaii
molecule tags Transferase
molecule keywords 2-keto-3-deoxygluconate kinase
total genus 108
structure length 309
sequence length 309
chains with identical sequence B, C, D, E, F
ec nomenclature ec 2.7.1.45: 2-dehydro-3-deoxygluconokinase.
pdb deposition date 2005-02-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00294 PfkB pfkB family carbohydrate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.1190.20 Alpha Beta 3-Layer(aba) Sandwich UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase 1wyeA00
3FHXA 3IN1A 4C5NA 4PVVA 4S1MA 1V1SA 4GM6A 4YL5A 5C40A 3I3YA 2PKMA 1LHRA 1EKKA 2I6BA 2AWDA 2DCNA 3RY7A 4B8RA 4KANA 3IE7A 1WYEA 1LHPA 3VASA 1L2LA 3RT7A 5BYDA 2VARA 4S1IB 4E8YA 1YGJA 3BF5A 3RREA 3DZVA 3NL5A 4E3AA 3RPHA 1UA4A 5C3ZA 2DDMA 4LC4A 3H49A 3RO4A 1TZ6A 3KEUA 4K8KA 4C5LA 3IBQA 1JXIA 3N1CA 3HPDA 2QCVA 3B1QA 3RSGA 1U2XA 3H74A 3RRJA 4O1GA 1BX4A 1YHJA 2F7KA 3GO7A 3NM1A 2JG5A 4JKUA 2AX3A 3RQXA 3LHXA 3RRBA 1RKSA 3RS9A 3B1OA 3NL6A 3RTEA 3UQ6A 4X8FA 4WJMA 5BYEA 4C5MA 2AFBA 5COJA 3RTCA 4C5KA 5B6AA 1TYYA 3B1PA 1V1BA 2JGVA 4DU5A 3RSQA 3HICA 3KZHA 2HW1A 4EN4A 5TQIA 2QHPA 1GQTA 3B3LA 3KTNA 1RFTA 4UBEA 5CM5A 2A9ZA 3NL3A 4E69A 3UMPA 2I6AA 4B8SA 5C3YA 3RS8A 2F02A 2AA0A 3ZS7A 1KYHA 3RRFA 3MBJA 1C3QA 3RT9A 1RFVA 4XCKA 3W4SA 4K9IA 5CGEA 3NC2A 5BYCA 1RKAA 3FHYA 3RQ8A 2AJPA 5BYFA 4YWRA 3BGKA 1RFUA 3UBOA 2AJRA 3IQ0A 1EKQA 3RQQA 3UQ9A 4DC3A 2PKKA 1VK4A 3HYOA 1V19A 3QAIA 2ABSA 2ABQA 2DDWA 4S1HA 3NC9A 2A9YA 4KBEA 1VI9A 3RQ5A 3PL2A 4E84A 5CGAA 3QA2A 3UMOA 3VAQA 3RTDA 3NCAA 3UQEA 2I5BA 3IKHA 4LBGA 5EYNA 1LIOA 4K8TA 3IH0A 1V1AA 4U7XA 4C5JA 5TRWA 2RBCA 3Q1YA 3RQHA 4XDAA 2AB8A 4K8CA 1LIIA 1DGMA 3LOOA 4K93A 4EUMA 2C49A 2C4EA 1RKDA 1YGKA 3OTXA 3NL2A 1GC5A 2PKFA 2DDOA 4LBXA 3UQDA 3RSFA 3RM5A 3B1RA 4N08A 4JJPA 1ESQA 2R3EA 4S1IA 4XF7A 3RSSA 4KALA 5F11A 1RK2A 2R3BA 3NBVA 5C41A 3PZSA 3KD6A 2YXTA 1UB0A 3NBWA 3RTAA 3RTBA 3RQ6A 1VM7A 3NM3A 3GO6A 2NWHA 3CQDA 1ESJA 3GBUA 2V78A 1JXHA 4KADA 5F0ZA 4E8WA 3LJSA 3MBHA 4O1LA 4K8PA 5EY7A 3RU3A 1TZ3A 4XF6A 2HQQA 4EOHA 1LIJA 3Q92A 3K9EA 2HLZA 3JULA 2FV7A 4N09A 4EBUA 4E8ZA 4LCAA 3DRWA 3K5WA 3LKIA 1TD2A 4JKSA 3B1NA 4K9CA 3RU2A 2PKNA 2YXUA 3RTGA 3RQ2A 3RPZA 2JG1A 2XTBA 1LIKA 3EWMA 4KAHA 2Q5RA
chains in the Genus database with same CATH superfamily
4CVKA 3FHXA 3IN1A 4C5NA 4PVVA 4S1MA 1V1SA 4GM6A 4YL5A 5C40A 3I3YA 2PKMA 1LHRA 1EKKA 4C5LA 2VORA 2I6BA 2AWDA 4C13A 2DCNA 3RY7A 4B8RA 4KANA 3IE7A 1WYEA 1LHPA 3VASA 4E8YA 3LK7A 1L2LA 3RT7A 5BYDA 3UAGA 2VARA 4S1IB 3PYZA 3ZM6A 1YGJA 3BF5A 3RREA 3DZVA 4QDIA 3NL5A 4BUBA 2F00A 4E3AA 1GG4A 1UA4A 3RPHA 2DDMA 1W78A 3H49A 4LC4A 1TZ6A 3KEUA 4K8KA 3RO4A 3IBQA 1JXIA 3N1CA 1E0DA 2QCVA 3B1QA 3HPDA 3RSGA 1U2XA 3H74A 3ZM5A 2UAGA 3RRJA 4O1GA 1BX4A 1YHJA 2F7KA 3GO7A 3NM1A 2JG5A 4JKUA 2AX3A 3RQXA 2XPCA 5A5EA 3LHXA 3RRBA 1RKSA 3RS9A 1E8CA 3B1OA 3NL6A 3RTEA 3UQ6A 3QCZA 1GQQA 4X8FA 4WJMA 5BYEA 2JFGA 4C5MA 1JBVA 2AFBA 5COJA 3RTCA 4C5KA 1TYYA 5B6AA 3B1PA 1V1BA 2JGVA 3ZL8A 4DU5A 3RSQA 3HICA 3HN7A 3KZHA 2HW1A 4EN4A 5TQIA 2QHPA 1J6UA 1GQTA 3B3LA 2WJPA 4CVMA 3KTNA 1RFTA 4UBEA 5CM5A 2A9ZA 3NL3A 4BUCA 4DC3A 3UMPA 2I6AA 4B8SA 4E69A 5A5FA 5C3YA 5F0ZA 3RS8A 2F02A 2AA0A 3ZS7A 1KYHA 3RRFA 2X5OA 1C3QA 3MBJA 1RFVA 4XCKA 2VOSA 3RT9A 3W4SA 2WTZA 4K9IA 2Y68A 5CGEA 4C12A 3NC2A 5BYCA 1RKAA 2JFFA 3FHYA 3RQ8A 2AJPA 2GC5A 5BYFA 4YWRA 3BGKA 1EEHA 1RFUA 2AJRA 3IQ0A 1EKQA 4ZIYA 3RQQA 3HJ6A 1JBWA 1P3DA 1VK4A 2PKKA 2JFHA 3UQ9A 4HV4A 5C3ZA 3HYOA 1V19A 2GC6A 3QAIA 2ABSA 2ABQA 2DDWA 4S1HA 2AM2A 3NC9A 2A9YA 4KBEA 1VI9A 2GCAA 3RQ5A 3PL2A 4E84A 5CGAA 3QA2A 2UUPA 3UMOA 3VAQA 3RTDA 4UAGA 3NCAA 3UQEA 2I5BA 3IKHA 4LBGA 5EYNA 1LIOA 4K8TA 3IH0A 1V1AA 1P31A 4U7XA 1O5ZA 1FGSA 4C5JA 5TRWA 2RBCA 3Q1YA 3RQHA 4XDAA 2AB8A 4K8CA 1LIIA 1DGMA 3LOOA 2Y67A 4K93A 2C49A 2C4EA 1RKDA 1YGKA 3OTXA 4CVLA 4EUMA 3NL2A 2AM1A 1GC5A 2DDOA 2PKFA 4LBXA 3UBOA 3UQDA 3RSFA 3RM5A 3B1RA 4N08A 4JJPA 1ESQA 2R3EA 4S1IA 4XF7A 3RSSA 4KALA 5F11A 3N2AA 1RK2A 2R3BA 3NBVA 5C41A 3PZSA 3KD6A 2YXTA 1UB0A 3NBWA 3RTAA 3RTBA 3RQ6A 2GCBA 1VM7A 3NM3A 3GO6A 2NWHA 3CQDA 1ESJA 3GBUA 1JXHA 2V78A 2Y1OA 4KADA 1GQYA 2VTDA 4E8WA 1W7KA 3LJSA 3MBHA 2VTEA 4K8PA 4O1LA 5EY7A 3RU3A 1TZ3A 4XF6A 2HQQA 4EOHA 1LIJA 3NRSA 3K9EA 3Q92A 2HLZA 3JULA 2FV7A 4N09A 4EBUA 2UUOA 4E8ZA 4LCAA 3DRWA 3K5WA 3LKIA 1TD2A 4JKSA 3B1NA 4K9CA 2XJAA 3EAGA 3RU2A 2PKNA 2YXUA 2Y66A 3RTGA 3RQ2A 3RPZA 2JG1A 2XTBA 1LIKA 3EWMA 4KAHA 4QF5A 1UAGA 2Q5RA
chains in the Genus database with same CATH topology
3FHXA 3IN1A 4C5NA 4PVVA 4S1MA 1V1SA 4GM6A 4YL5A 5C40A 3I3YA 2PKMA 1LHRA 1EKKA 2I6BA 2AWDA 2DCNA 3RY7A 4B8RA 4KANA 3IE7A 1WYEA 1LHPA 3VASA 1L2LA 3RT7A 5BYDA 2VARA 4S1IB 4E8YA 1YGJA 3BF5A 3RREA 3DZVA 3NL5A 4E3AA 3RPHA 1UA4A 5C3ZA 2DDMA 4LC4A 3H49A 3RO4A 1TZ6A 3KEUA 4K8KA 4C5LA 3IBQA 1JXIA 3N1CA 3HPDA 2QCVA 3B1QA 3RSGA 1U2XA 3H74A 3RRJA 4O1GA 1BX4A 1YHJA 2F7KA 3GO7A 3NM1A 2JG5A 4JKUA 2AX3A 3RQXA 3LHXA 3RRBA 1RKSA 3RS9A 3B1OA 3NL6A 3RTEA 3UQ6A 4X8FA 4WJMA 5BYEA 4C5MA 2AFBA 5COJA 3RTCA 4C5KA 5B6AA 1TYYA 3B1PA 1V1BA 2JGVA 4DU5A 3RSQA 3HICA 3KZHA 2HW1A 4EN4A 5TQIA 2QHPA 1GQTA 3B3LA 3KTNA 1RFTA 4UBEA 5CM5A 2A9ZA 3NL3A 4DC3A 4E69A 3UMPA 2I6AA 4B8SA 5C3YA 3RS8A 2F02A 2AA0A 3ZS7A 1KYHA 3RRFA 3MBJA 1C3QA 3RT9A 1RFVA 4XCKA 3W4SA 4K9IA 5CGEA 3NC2A 5BYCA 1RKAA 3FHYA 3RQ8A 2AJPA 5BYFA 4YWRA 3BGKA 1RFUA 3UBOA 2AJRA 3IQ0A 1EKQA 3RQQA 3UQ9A 3HJ6A 2PKKA 1VK4A 3HYOA 1V19A 3QAIA 2ABSA 2ABQA 2DDWA 4S1HA 3NC9A 2A9YA 4KBEA 1VI9A 3RQ5A 3PL2A 4E84A 5CGAA 3QA2A 3UMOA 3VAQA 3RTDA 3NCAA 3UQEA 2I5BA 3IKHA 4LBGA 5EYNA 1LIOA 4K8TA 3IH0A 1V1AA 4U7XA 4C5JA 5TRWA 2RBCA 3Q1YA 3RQHA 4XDAA 2AB8A 4K8CA 1LIIA 1DGMA 3LOOA 4K93A 4EUMA 2C49A 2C4EA 1RKDA 1YGKA 3OTXA 3NL2A 1GC5A 2PKFA 2DDOA 4LBXA 3UQDA 3RSFA 3RM5A 3B1RA 4N08A 4JJPA 1ESQA 2R3EA 4S1IA 4XF7A 3RSSA 4KALA 5F11A 1RK2A 2R3BA 3NBVA 5C41A 3PZSA 3KD6A 2YXTA 1UB0A 3NBWA 3RTAA 3RTBA 3RQ6A 1VM7A 3NM3A 3GO6A 2NWHA 3CQDA 1ESJA 3GBUA 2V78A 1JXHA 4KADA 5F0ZA 4E8WA 3LJSA 3MBHA 4O1LA 4K8PA 5EY7A 3RU3A 1TZ3A 4XF6A 2HQQA 4EOHA 1LIJA 3Q92A 3K9EA 2HLZA 3JULA 2FV7A 4N09A 4EBUA 4E8ZA 4LCAA 3DRWA 3K5WA 3LKIA 1TD2A 4JKSA 3B1NA 4K9CA 3RU2A 2PKNA 2YXUA 3RTGA 3RQ2A 3RPZA 2JG1A 2XTBA 1LIKA 3EWMA 4KAHA 2Q5RA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3FHX A;  3IN1 A;  4C5N A;  4PVV A;  4S1M A;  1V1S A;  4GM6 A;  4YL5 A;  5C40 A;  3I3Y A;  2PKM A;  1LHR A;  1EKK A;  2I6B A;  2AWD A;  2DCN A;  3RY7 A;  4B8R A;  4KAN A;  3IE7 A;  1WYE A;  1LHP A;  3VAS A;  1L2L A;  3RT7 A;  5BYD A;  2VAR A;  4S1I B;  4E8Y A;  1YGJ A;  3BF5 A;  3RRE A;  3DZV A;  3NL5 A;  4E3A A;  3RPH A;  1UA4 A;  5C3Z A;  2DDM A;  4LC4 A;  3H49 A;  3RO4 A;  1TZ6 A;  3KEU A;  4K8K A;  4C5L A;  3IBQ A;  1JXI A;  3N1C A;  3HPD A;  2QCV A;  3B1Q A;  3RSG A;  1U2X A;  3H74 A;  3RRJ A;  4O1G A;  1BX4 A;  1YHJ A;  2F7K A;  3GO7 A;  3NM1 A;  2JG5 A;  4JKU A;  2AX3 A;  3RQX A;  3LHX A;  3RRB A;  1RKS A;  3RS9 A;  3B1O A;  3NL6 A;  3RTE A;  3UQ6 A;  4X8F A;  4WJM A;  5BYE A;  4C5M A;  2AFB A;  5COJ A;  3RTC A;  4C5K A;  5B6A A;  1TYY A;  3B1P A;  1V1B A;  2JGV A;  4DU5 A;  3RSQ A;  3HIC A;  3KZH A;  2HW1 A;  4EN4 A;  5TQI A;  2QHP A;  1GQT A;  3B3L A;  3KTN A;  1RFT A;  4UBE A;  5CM5 A;  2A9Z A;  3NL3 A;  4E69 A;  3UMP A;  2I6A A;  4B8S A;  5C3Y A;  3RS8 A;  2F02 A;  2AA0 A;  3ZS7 A;  1KYH A;  3RRF A;  3MBJ A;  1C3Q A;  3RT9 A;  1RFV A;  4XCK A;  3W4S A;  4K9I A;  5CGE A;  3NC2 A;  5BYC A;  1RKA A;  3FHY A;  3RQ8 A;  2AJP A;  5BYF A;  4YWR A;  3BGK A;  1RFU A;  3UBO A;  2AJR A;  3IQ0 A;  1EKQ A;  3RQQ A;  3UQ9 A;  4DC3 A;  2PKK A;  1VK4 A;  3HYO A;  1V19 A;  3QAI A;  2ABS A;  2ABQ A;  2DDW A;  4S1H A;  3NC9 A;  2A9Y A;  4KBE A;  1VI9 A;  3RQ5 A;  3PL2 A;  4E84 A;  5CGA A;  3QA2 A;  3UMO A;  3VAQ A;  3RTD A;  3NCA A;  3UQE A;  2I5B A;  3IKH A;  4LBG A;  5EYN A;  1LIO A;  4K8T A;  3IH0 A;  1V1A A;  4U7X A;  4C5J A;  5TRW A;  2RBC A;  3Q1Y A;  3RQH A;  4XDA A;  2AB8 A;  4K8C A;  1LII A;  1DGM A;  3LOO A;  4K93 A;  4EUM A;  2C49 A;  2C4E A;  1RKD A;  1YGK A;  3OTX A;  3NL2 A;  1GC5 A;  2PKF A;  2DDO A;  4LBX A;  3UQD A;  3RSF A;  3RM5 A;  3B1R A;  4N08 A;  4JJP A;  1ESQ A;  2R3E A;  4S1I A;  4XF7 A;  3RSS A;  4KAL A;  5F11 A;  1RK2 A;  2R3B A;  3NBV A;  5C41 A;  3PZS A;  3KD6 A;  2YXT A;  1UB0 A;  3NBW A;  3RTA A;  3RTB A;  3RQ6 A;  1VM7 A;  3NM3 A;  3GO6 A;  2NWH A;  3CQD A;  1ESJ A;  3GBU A;  2V78 A;  1JXH A;  4KAD A;  5F0Z A;  4E8W A;  3LJS A;  3MBH A;  4O1L A;  4K8P A;  5EY7 A;  3RU3 A;  1TZ3 A;  4XF6 A;  2HQQ A;  4EOH A;  1LIJ A;  3Q92 A;  3K9E A;  2HLZ A;  3JUL A;  2FV7 A;  4N09 A;  4EBU A;  4E8Z A;  4LCA A;  3DRW A;  3K5W A;  3LKI A;  1TD2 A;  4JKS A;  3B1N A;  4K9C A;  3RU2 A;  2PKN A;  2YXU A;  3RTG A;  3RQ2 A;  3RPZ A;  2JG1 A;  2XTB A;  1LIK A;  3EWM A;  4KAH A;  2Q5R A; 
#chains in the Genus database with same CATH topology
 4CVK A;  3FHX A;  3IN1 A;  4C5N A;  4PVV A;  4S1M A;  1V1S A;  4GM6 A;  4YL5 A;  5C40 A;  3I3Y A;  2PKM A;  1LHR A;  1EKK A;  4C5L A;  2VOR A;  2I6B A;  2AWD A;  4C13 A;  2DCN A;  3RY7 A;  4B8R A;  4KAN A;  3IE7 A;  1WYE A;  1LHP A;  3VAS A;  4E8Y A;  3LK7 A;  1L2L A;  3RT7 A;  5BYD A;  3UAG A;  2VAR A;  4S1I B;  3PYZ A;  3ZM6 A;  1YGJ A;  3BF5 A;  3RRE A;  3DZV A;  4QDI A;  3NL5 A;  4BUB A;  2F00 A;  4E3A A;  1GG4 A;  1UA4 A;  3RPH A;  2DDM A;  1W78 A;  3H49 A;  4LC4 A;  1TZ6 A;  3KEU A;  4K8K A;  3RO4 A;  3IBQ A;  1JXI A;  3N1C A;  1E0D A;  2QCV A;  3B1Q A;  3HPD A;  3RSG A;  1U2X A;  3H74 A;  3ZM5 A;  2UAG A;  3RRJ A;  4O1G A;  1BX4 A;  1YHJ A;  2F7K A;  3GO7 A;  3NM1 A;  2JG5 A;  4JKU A;  2AX3 A;  3RQX A;  2XPC A;  5A5E A;  3LHX A;  3RRB A;  1RKS A;  3RS9 A;  1E8C A;  3B1O A;  3NL6 A;  3RTE A;  3UQ6 A;  3QCZ A;  1GQQ A;  4X8F A;  4WJM A;  5BYE A;  2JFG A;  4C5M A;  1JBV A;  2AFB A;  5COJ A;  3RTC A;  4C5K A;  1TYY A;  5B6A A;  3B1P A;  1V1B A;  2JGV A;  3ZL8 A;  4DU5 A;  3RSQ A;  3HIC A;  3HN7 A;  3KZH A;  2HW1 A;  4EN4 A;  5TQI A;  2QHP A;  1J6U A;  1GQT A;  3B3L A;  2WJP A;  4CVM A;  3KTN A;  1RFT A;  4UBE A;  5CM5 A;  2A9Z A;  3NL3 A;  4BUC A;  4DC3 A;  3UMP A;  2I6A A;  4B8S A;  4E69 A;  5A5F A;  5C3Y A;  5F0Z A;  3RS8 A;  2F02 A;  2AA0 A;  3ZS7 A;  1KYH A;  3RRF A;  2X5O A;  1C3Q A;  3MBJ A;  1RFV A;  4XCK A;  2VOS A;  3RT9 A;  3W4S A;  2WTZ A;  4K9I A;  2Y68 A;  5CGE A;  4C12 A;  3NC2 A;  5BYC A;  1RKA A;  2JFF A;  3FHY A;  3RQ8 A;  2AJP A;  2GC5 A;  5BYF A;  4YWR A;  3BGK A;  1EEH A;  1RFU A;  2AJR A;  3IQ0 A;  1EKQ A;  4ZIY A;  3RQQ A;  3HJ6 A;  1JBW A;  1P3D A;  1VK4 A;  2PKK A;  2JFH A;  3UQ9 A;  4HV4 A;  5C3Z A;  3HYO A;  1V19 A;  2GC6 A;  3QAI A;  2ABS A;  2ABQ A;  2DDW A;  4S1H A;  2AM2 A;  3NC9 A;  2A9Y A;  4KBE A;  1VI9 A;  2GCA A;  3RQ5 A;  3PL2 A;  4E84 A;  5CGA A;  3QA2 A;  2UUP A;  3UMO A;  3VAQ A;  3RTD A;  4UAG A;  3NCA A;  3UQE A;  2I5B A;  3IKH A;  4LBG A;  5EYN A;  1LIO A;  4K8T A;  3IH0 A;  1V1A A;  1P31 A;  4U7X A;  1O5Z A;  1FGS A;  4C5J A;  5TRW A;  2RBC A;  3Q1Y A;  3RQH A;  4XDA A;  2AB8 A;  4K8C A;  1LII A;  1DGM A;  3LOO A;  2Y67 A;  4K93 A;  2C49 A;  2C4E A;  1RKD A;  1YGK A;  3OTX A;  4CVL A;  4EUM A;  3NL2 A;  2AM1 A;  1GC5 A;  2DDO A;  2PKF A;  4LBX A;  3UBO A;  3UQD A;  3RSF A;  3RM5 A;  3B1R A;  4N08 A;  4JJP A;  1ESQ A;  2R3E A;  4S1I A;  4XF7 A;  3RSS A;  4KAL A;  5F11 A;  3N2A A;  1RK2 A;  2R3B A;  3NBV A;  5C41 A;  3PZS A;  3KD6 A;  2YXT A;  1UB0 A;  3NBW A;  3RTA A;  3RTB A;  3RQ6 A;  2GCB A;  1VM7 A;  3NM3 A;  3GO6 A;  2NWH A;  3CQD A;  1ESJ A;  3GBU A;  1JXH A;  2V78 A;  2Y1O A;  4KAD A;  1GQY A;  2VTD A;  4E8W A;  1W7K A;  3LJS A;  3MBH A;  2VTE A;  4K8P A;  4O1L A;  5EY7 A;  3RU3 A;  1TZ3 A;  4XF6 A;  2HQQ A;  4EOH A;  1LIJ A;  3NRS A;  3K9E A;  3Q92 A;  2HLZ A;  3JUL A;  2FV7 A;  4N09 A;  4EBU A;  2UUO A;  4E8Z A;  4LCA A;  3DRW A;  3K5W A;  3LKI A;  1TD2 A;  4JKS A;  3B1N A;  4K9C A;  2XJA A;  3EAG A;  3RU2 A;  2PKN A;  2YXU A;  2Y66 A;  3RTG A;  3RQ2 A;  3RPZ A;  2JG1 A;  2XTB A;  1LIK A;  3EWM A;  4KAH A;  4QF5 A;  1UAG A;  2Q5R A; 
#chains in the Genus database with same CATH homology
 3FHX A;  3IN1 A;  4C5N A;  4PVV A;  4S1M A;  1V1S A;  4GM6 A;  4YL5 A;  5C40 A;  3I3Y A;  2PKM A;  1LHR A;  1EKK A;  2I6B A;  2AWD A;  2DCN A;  3RY7 A;  4B8R A;  4KAN A;  3IE7 A;  1WYE A;  1LHP A;  3VAS A;  1L2L A;  3RT7 A;  5BYD A;  2VAR A;  4S1I B;  4E8Y A;  1YGJ A;  3BF5 A;  3RRE A;  3DZV A;  3NL5 A;  4E3A A;  3RPH A;  1UA4 A;  5C3Z A;  2DDM A;  4LC4 A;  3H49 A;  3RO4 A;  1TZ6 A;  3KEU A;  4K8K A;  4C5L A;  3IBQ A;  1JXI A;  3N1C A;  3HPD A;  2QCV A;  3B1Q A;  3RSG A;  1U2X A;  3H74 A;  3RRJ A;  4O1G A;  1BX4 A;  1YHJ A;  2F7K A;  3GO7 A;  3NM1 A;  2JG5 A;  4JKU A;  2AX3 A;  3RQX A;  3LHX A;  3RRB A;  1RKS A;  3RS9 A;  3B1O A;  3NL6 A;  3RTE A;  3UQ6 A;  4X8F A;  4WJM A;  5BYE A;  4C5M A;  2AFB A;  5COJ A;  3RTC A;  4C5K A;  5B6A A;  1TYY A;  3B1P A;  1V1B A;  2JGV A;  4DU5 A;  3RSQ A;  3HIC A;  3KZH A;  2HW1 A;  4EN4 A;  5TQI A;  2QHP A;  1GQT A;  3B3L A;  3KTN A;  1RFT A;  4UBE A;  5CM5 A;  2A9Z A;  3NL3 A;  4DC3 A;  4E69 A;  3UMP A;  2I6A A;  4B8S A;  5C3Y A;  3RS8 A;  2F02 A;  2AA0 A;  3ZS7 A;  1KYH A;  3RRF A;  3MBJ A;  1C3Q A;  3RT9 A;  1RFV A;  4XCK A;  3W4S A;  4K9I A;  5CGE A;  3NC2 A;  5BYC A;  1RKA A;  3FHY A;  3RQ8 A;  2AJP A;  5BYF A;  4YWR A;  3BGK A;  1RFU A;  3UBO A;  2AJR A;  3IQ0 A;  1EKQ A;  3RQQ A;  3UQ9 A;  3HJ6 A;  2PKK A;  1VK4 A;  3HYO A;  1V19 A;  3QAI A;  2ABS A;  2ABQ A;  2DDW A;  4S1H A;  3NC9 A;  2A9Y A;  4KBE A;  1VI9 A;  3RQ5 A;  3PL2 A;  4E84 A;  5CGA A;  3QA2 A;  3UMO A;  3VAQ A;  3RTD A;  3NCA A;  3UQE A;  2I5B A;  3IKH A;  4LBG A;  5EYN A;  1LIO A;  4K8T A;  3IH0 A;  1V1A A;  4U7X A;  4C5J A;  5TRW A;  2RBC A;  3Q1Y A;  3RQH A;  4XDA A;  2AB8 A;  4K8C A;  1LII A;  1DGM A;  3LOO A;  4K93 A;  4EUM A;  2C49 A;  2C4E A;  1RKD A;  1YGK A;  3OTX A;  3NL2 A;  1GC5 A;  2PKF A;  2DDO A;  4LBX A;  3UQD A;  3RSF A;  3RM5 A;  3B1R A;  4N08 A;  4JJP A;  1ESQ A;  2R3E A;  4S1I A;  4XF7 A;  3RSS A;  4KAL A;  5F11 A;  1RK2 A;  2R3B A;  3NBV A;  5C41 A;  3PZS A;  3KD6 A;  2YXT A;  1UB0 A;  3NBW A;  3RTA A;  3RTB A;  3RQ6 A;  1VM7 A;  3NM3 A;  3GO6 A;  2NWH A;  3CQD A;  1ESJ A;  3GBU A;  2V78 A;  1JXH A;  4KAD A;  5F0Z A;  4E8W A;  3LJS A;  3MBH A;  4O1L A;  4K8P A;  5EY7 A;  3RU3 A;  1TZ3 A;  4XF6 A;  2HQQ A;  4EOH A;  1LIJ A;  3Q92 A;  3K9E A;  2HLZ A;  3JUL A;  2FV7 A;  4N09 A;  4EBU A;  4E8Z A;  4LCA A;  3DRW A;  3K5W A;  3LKI A;  1TD2 A;  4JKS A;  3B1N A;  4K9C A;  3RU2 A;  2PKN A;  2YXU A;  3RTG A;  3RQ2 A;  3RPZ A;  2JG1 A;  2XTB A;  1LIK A;  3EWM A;  4KAH A;  2Q5R A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...