1WYOA

Solution structure of the ch domain of human microtubule-associated protein rp/eb family member 3
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
159
structure length
159
Chain Sequence
GSSGSSGMAVNVYSTSVTSENLSRHDMLAWVNDSLHLNYTKIEQLCSGAAYCQFMDMLFPGCVHLRKVKFQAKLEHEYIHNFKVLQAAFKKMGVDKIIPVEKLVKGKFQDNFEFIQWFKKFFDANYDGKDYNPLLARQGQDVAPPPNPGDQIFSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Microtubule-associated protein RP/EB family member 3
publication title Solution structure of the CH domain of human microtubule-associated protein RP/EB family member 3
rcsb
source organism Homo sapiens
molecule tags Structural protein
total genus 25
structure length 159
sequence length 159
ec nomenclature
pdb deposition date 2005-02-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00307 CH Calponin homology (CH) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.418.10 Mainly Alpha Orthogonal Bundle Actin-binding Protein, T-fimbrin; domain 1 Calponin-like domain 1wyoA01
2E9KA 1PA7A 2WA6A 3JAKM 4Q58A 1WJOA 5L0OA 2WA5A 5A38A 2K3SA 1WIXA 2WFNA 1P2XA 2D89A 2QJXA 2D86A 3KMUB 3HOCA 4TXIA 1AOAA 4TXKA 2RR8A 2L3GA 1BHDA 1UJOA 1WYQA 1BKRA 2QJZA 2K2RA 5A4BA 2DK9A 2EYIA 4EDMA 1V5KA 2D88A 2EE7A 1DXXA 3JARM 5BVRA 2D87A 5J8EA 1VKAA 2VZDA 1WYNA 3HORA 2EYNA 1H67A 3CO1A 3KY9A 1WYLA 1TJTA 1SH5A 2VZCA 1WYRA 1MB8A 1RT8A 3KMWB 2R8UA 4EDNA 2D85A 2R0OA 1WYPA 3HOPA 1QAGA 4EDLA 1WKUA 2YRNA 1WYOA 1UEGA 1PXYA 3JALM 1P5SA 3REPB 3FERA 3I6XA 2WA7A 1WYMA 4Q59A 1AA2A 2VZGB 5A36A 4B7LA 5A37A 2VZIB 1SH6A 2JV9A 3F7PA 4Q57B
chains in the Genus database with same CATH superfamily
2E9KA 1PA7A 2WA6A 3JAKM 4Q58A 1WJOA 5L0OA 2WA5A 5A38A 2VE7A 2K3SA 1WIXA 2WE6A 2WFNA 1P2XA 2D89A 2QJXA 2D86A 4DDPA 3KMUB 3HOCA 4TXIA 1AOAA 4TXKA 2RR8A 2L3GA 1BHDA 1UJOA 1WYQA 2HL9A 1BKRA 2QJZA 2K2RA 2IGPA 5A4BA 2DK9A 4LVPA 2EYIA 2WDTA 4EDMA 1V5KA 2D88A 2EE7A 1DXXA 3EAYA 1EUVA 3JARM 5BVRA 2D87A 5J8EA 1VKAA 2VZDA 1WYNA 2HKPA 3HORA 2EYNA 5FMTA 1H67A 3CO1A 2VE7C 3KY9A 1WYLA 1TJTA 1SH5A 2VZCA 1WYRA 1MB8A 1RT8A 4LVRA 3KMWB 2R8UA 4EDNA 2D85A 2R0OA 1WYPA 3HOPA 1QAGA 4EDLA 1WKUA 3VP7A 2YRNA 2HL8A 1WYOA 1UEGA 1PXYA 3JALM 2EQOA 1P5SA 3REPB 3FERA 3I6XA 2WA7A 1WYMA 4Q59A 5FMUA 1AA2A 2VZGB 5A36A 4B7LA 5A37A 2VZIB 1SH6A 2JV9A 3F7PA 4Q57B
chains in the Genus database with same CATH topology
2E9KA 1PA7A 2WA6A 3JAKM 4Q58A 1WJOA 5L0OA 2WA5A 5A38A 2K3SA 1WIXA 2WFNA 1P2XA 2D89A 2QJXA 2D86A 3KMUB 3HOCA 4TXIA 1AOAA 4TXKA 2RR8A 2L3GA 1BHDA 1UJOA 1WYQA 1BKRA 2QJZA 2K2RA 5A4BA 2DK9A 2EYIA 4EDMA 1V5KA 2D88A 2EE7A 1DXXA 3JARM 5BVRA 2D87A 5J8EA 1VKAA 2VZDA 1WYNA 3HORA 2EYNA 1H67A 3CO1A 3KY9A 1WYLA 1TJTA 1SH5A 2VZCA 1WYRA 1MB8A 1RT8A 3KMWB 2R8UA 4EDNA 2D85A 2R0OA 1WYPA 3HOPA 1QAGA 4EDLA 1WKUA 2YRNA 1WYOA 1UEGA 1PXYA 3JALM 1P5SA 3REPB 3FERA 3I6XA 2WA7A 1WYMA 4Q59A 1AA2A 2VZGB 5A36A 4B7LA 5A37A 2VZIB 1SH6A 2JV9A 3F7PA 4Q57B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2E9K A;  1PA7 A;  2WA6 A;  3JAK M;  4Q58 A;  1WJO A;  5L0O A;  2WA5 A;  5A38 A;  2K3S A;  1WIX A;  2WFN A;  1P2X A;  2D89 A;  2QJX A;  2D86 A;  3KMU B;  3HOC A;  4TXI A;  1AOA A;  4TXK A;  2RR8 A;  2L3G A;  1BHD A;  1UJO A;  1WYQ A;  1BKR A;  2QJZ A;  2K2R A;  5A4B A;  2DK9 A;  2EYI A;  4EDM A;  1V5K A;  2D88 A;  2EE7 A;  1DXX A;  3JAR M;  5BVR A;  2D87 A;  5J8E A;  1VKA A;  2VZD A;  1WYN A;  3HOR A;  2EYN A;  1H67 A;  3CO1 A;  3KY9 A;  1WYL A;  1TJT A;  1SH5 A;  2VZC A;  1WYR A;  1MB8 A;  1RT8 A;  3KMW B;  2R8U A;  4EDN A;  2D85 A;  2R0O A;  1WYP A;  3HOP A;  1QAG A;  4EDL A;  1WKU A;  2YRN A;  1WYO A;  1UEG A;  1PXY A;  3JAL M;  1P5S A;  3REP B;  3FER A;  3I6X A;  2WA7 A;  1WYM A;  4Q59 A;  1AA2 A;  2VZG B;  5A36 A;  4B7L A;  5A37 A;  2VZI B;  1SH6 A;  2JV9 A;  3F7P A;  4Q57 B; 
#chains in the Genus database with same CATH topology
 2E9K A;  1PA7 A;  2WA6 A;  3JAK M;  4Q58 A;  1WJO A;  5L0O A;  2WA5 A;  5A38 A;  2VE7 A;  2K3S A;  1WIX A;  2WE6 A;  2WFN A;  1P2X A;  2D89 A;  2QJX A;  2D86 A;  4DDP A;  3KMU B;  3HOC A;  4TXI A;  1AOA A;  4TXK A;  2RR8 A;  2L3G A;  1BHD A;  1UJO A;  1WYQ A;  2HL9 A;  1BKR A;  2QJZ A;  2K2R A;  2IGP A;  5A4B A;  2DK9 A;  4LVP A;  2EYI A;  2WDT A;  4EDM A;  1V5K A;  2D88 A;  2EE7 A;  1DXX A;  3EAY A;  1EUV A;  3JAR M;  5BVR A;  2D87 A;  5J8E A;  1VKA A;  2VZD A;  1WYN A;  2HKP A;  3HOR A;  2EYN A;  5FMT A;  1H67 A;  3CO1 A;  2VE7 C;  3KY9 A;  1WYL A;  1TJT A;  1SH5 A;  2VZC A;  1WYR A;  1MB8 A;  1RT8 A;  4LVR A;  3KMW B;  2R8U A;  4EDN A;  2D85 A;  2R0O A;  1WYP A;  3HOP A;  1QAG A;  4EDL A;  1WKU A;  3VP7 A;  2YRN A;  2HL8 A;  1WYO A;  1UEG A;  1PXY A;  3JAL M;  2EQO A;  1P5S A;  3REP B;  3FER A;  3I6X A;  2WA7 A;  1WYM A;  4Q59 A;  5FMU A;  1AA2 A;  2VZG B;  5A36 A;  4B7L A;  5A37 A;  2VZI B;  1SH6 A;  2JV9 A;  3F7P A;  4Q57 B; 
#chains in the Genus database with same CATH homology
 2E9K A;  1PA7 A;  2WA6 A;  3JAK M;  4Q58 A;  1WJO A;  5L0O A;  2WA5 A;  5A38 A;  2K3S A;  1WIX A;  2WFN A;  1P2X A;  2D89 A;  2QJX A;  2D86 A;  3KMU B;  3HOC A;  4TXI A;  1AOA A;  4TXK A;  2RR8 A;  2L3G A;  1BHD A;  1UJO A;  1WYQ A;  1BKR A;  2QJZ A;  2K2R A;  5A4B A;  2DK9 A;  2EYI A;  4EDM A;  1V5K A;  2D88 A;  2EE7 A;  1DXX A;  3JAR M;  5BVR A;  2D87 A;  5J8E A;  1VKA A;  2VZD A;  1WYN A;  3HOR A;  2EYN A;  1H67 A;  3CO1 A;  3KY9 A;  1WYL A;  1TJT A;  1SH5 A;  2VZC A;  1WYR A;  1MB8 A;  1RT8 A;  3KMW B;  2R8U A;  4EDN A;  2D85 A;  2R0O A;  1WYP A;  3HOP A;  1QAG A;  4EDL A;  1WKU A;  2YRN A;  1WYO A;  1UEG A;  1PXY A;  3JAL M;  1P5S A;  3REP B;  3FER A;  3I6X A;  2WA7 A;  1WYM A;  4Q59 A;  1AA2 A;  2VZG B;  5A36 A;  4B7L A;  5A37 A;  2VZI B;  1SH6 A;  2JV9 A;  3F7P A;  4Q57 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...