1WYRA

Solution structure of the ch domain of human rho guanine nucleotide exchange factor 6
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
121
structure length
121
Chain Sequence
GSSGSSGEEQIVTWLISLGVLESPKKTICDPEEFLKSSLKNGVVLCKLINRLMPGSVEKFCLDPQTEADCINNINDFLKGCATLQVEIFDPDDLYSGVNFSKVLSTLLAVNKATESGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Rho guanine nucleotide exchange factor 6
publication title Solution structure of the CH domain of human Rho guanine nucleotide exchange factor 6
rcsb
source organism Homo sapiens
molecule tags Structural protein
total genus 24
structure length 121
sequence length 121
ec nomenclature
pdb deposition date 2005-02-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.418.10 Mainly Alpha Orthogonal Bundle Actin-binding Protein, T-fimbrin; domain 1 Calponin-like domain 1wyrA00
2R8UA 3KY9A 2L3GA 2DK9A 2WFNA 3HOPA 5J8EA 2D86A 5A4BA 1DXXA 1SH5A 1WYPA 1P5SA 1PXYA 1WYQA 4EDMA 1RT8A 1H67A 5A37A 4Q59A 2VZDA 4Q58A 5BVRA 5A38A 1AA2A 2D85A 2WA5A 2WA7A 1TJTA 2WA6A 3I6XA 1BHDA 3REPB 1SH6A 1VKAA 2VZGB 2K3SA 2VZIB 3CO1A 2RR8A 1WYOA 4Q57B 4EDLA 3KMWB 5L0OA 2EYIA 2QJXA 1QAGA 1WYLA 1WJOA 2E9KA 2D89A 3JARM 2QJZA 2EE7A 4TXKA 1UJOA 1WKUA 5A36A 3F7PA 2R0OA 4TXIA 1WYMA 3JALM 1PA7A 1V5KA 1UEGA 2JV9A 1AOAA 2D88A 1WYRA 2K2RA 1P2XA 3HOCA 1WYNA 1MB8A 2VZCA 4B7LA 4EDNA 3HORA 1WIXA 2YRNA 2EYNA 2D87A 3KMUB 3JAKM 3FERA 1BKRA
chains in the Genus database with same CATH superfamily
2R8UA 3KY9A 2L3GA 2VE7A 2DK9A 2WFNA 3EAYA 3HOPA 2HL9A 5J8EA 2D86A 5A4BA 1DXXA 1SH5A 1WYPA 2WDTA 1P5SA 1PXYA 1WYQA 4EDMA 1RT8A 1H67A 5FMUA 5A37A 4Q59A 2VZDA 4Q58A 5BVRA 5A38A 1AA2A 2D85A 2IGPA 2WA5A 2WA7A 1TJTA 2WA6A 3I6XA 1BHDA 3REPB 2WE6A 4LVRA 1SH6A 1VKAA 2VZGB 2K3SA 2VZIB 3CO1A 2RR8A 1WYOA 4Q57B 4EDLA 3KMWB 5L0OA 2EQOA 2EYIA 2QJXA 1QAGA 1WYLA 1WJOA 2E9KA 2VE7C 5FMTA 2HKPA 2D89A 3JARM 2QJZA 2EE7A 4TXKA 4DDPA 1UJOA 1WKUA 4LVPA 5A36A 3F7PA 2R0OA 1WYMA 4TXIA 3JALM 1PA7A 1V5KA 1UEGA 2JV9A 1AOAA 2D88A 1WYRA 2K2RA 1P2XA 3HOCA 1WYNA 1MB8A 2VZCA 4B7LA 4EDNA 3HORA 1WIXA 2YRNA 2HL8A 3VP7A 2EYNA 2D87A 3KMUB 3JAKM 3FERA 1BKRA 1EUVA
chains in the Genus database with same CATH topology
2R8UA 3KY9A 2L3GA 2DK9A 2WFNA 3HOPA 5J8EA 2D86A 5A4BA 1DXXA 1SH5A 1WYPA 1P5SA 1PXYA 1WYQA 4EDMA 1RT8A 1H67A 5A37A 4Q59A 2VZDA 4Q58A 5BVRA 5A38A 1AA2A 2D85A 2WA5A 2WA7A 1TJTA 2WA6A 3I6XA 1BHDA 3REPB 1SH6A 1VKAA 2VZGB 2K3SA 2VZIB 3CO1A 2RR8A 1WYOA 4Q57B 4EDLA 3KMWB 5L0OA 2EYIA 2QJXA 1QAGA 1WYLA 1WJOA 2E9KA 2D89A 3JARM 2QJZA 2EE7A 4TXKA 1UJOA 1WKUA 5A36A 3F7PA 2R0OA 4TXIA 1WYMA 3JALM 1PA7A 1V5KA 1UEGA 2JV9A 1AOAA 2D88A 1WYRA 2K2RA 1P2XA 3HOCA 1WYNA 1MB8A 2VZCA 4B7LA 4EDNA 3HORA 1WIXA 2YRNA 2EYNA 2D87A 3KMUB 3JAKM 3FERA 1BKRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2R8U A;  3KY9 A;  2L3G A;  2DK9 A;  2WFN A;  3HOP A;  5J8E A;  2D86 A;  5A4B A;  1DXX A;  1SH5 A;  1WYP A;  1P5S A;  1PXY A;  1WYQ A;  4EDM A;  1RT8 A;  1H67 A;  5A37 A;  4Q59 A;  2VZD A;  4Q58 A;  5BVR A;  5A38 A;  1AA2 A;  2D85 A;  2WA5 A;  2WA7 A;  1TJT A;  2WA6 A;  3I6X A;  1BHD A;  3REP B;  1SH6 A;  1VKA A;  2VZG B;  2K3S A;  2VZI B;  3CO1 A;  2RR8 A;  1WYO A;  4Q57 B;  4EDL A;  3KMW B;  5L0O A;  2EYI A;  2QJX A;  1QAG A;  1WYL A;  1WJO A;  2E9K A;  2D89 A;  3JAR M;  2QJZ A;  2EE7 A;  4TXK A;  1UJO A;  1WKU A;  5A36 A;  3F7P A;  2R0O A;  4TXI A;  1WYM A;  3JAL M;  1PA7 A;  1V5K A;  1UEG A;  2JV9 A;  1AOA A;  2D88 A;  1WYR A;  2K2R A;  1P2X A;  3HOC A;  1WYN A;  1MB8 A;  2VZC A;  4B7L A;  4EDN A;  3HOR A;  1WIX A;  2YRN A;  2EYN A;  2D87 A;  3KMU B;  3JAK M;  3FER A;  1BKR A; 
#chains in the Genus database with same CATH topology
 2R8U A;  3KY9 A;  2L3G A;  2VE7 A;  2DK9 A;  2WFN A;  3EAY A;  3HOP A;  2HL9 A;  5J8E A;  2D86 A;  5A4B A;  1DXX A;  1SH5 A;  1WYP A;  2WDT A;  1P5S A;  1PXY A;  1WYQ A;  4EDM A;  1RT8 A;  1H67 A;  5FMU A;  5A37 A;  4Q59 A;  2VZD A;  4Q58 A;  5BVR A;  5A38 A;  1AA2 A;  2D85 A;  2IGP A;  2WA5 A;  2WA7 A;  1TJT A;  2WA6 A;  3I6X A;  1BHD A;  3REP B;  2WE6 A;  4LVR A;  1SH6 A;  1VKA A;  2VZG B;  2K3S A;  2VZI B;  3CO1 A;  2RR8 A;  1WYO A;  4Q57 B;  4EDL A;  3KMW B;  5L0O A;  2EQO A;  2EYI A;  2QJX A;  1QAG A;  1WYL A;  1WJO A;  2E9K A;  2VE7 C;  5FMT A;  2HKP A;  2D89 A;  3JAR M;  2QJZ A;  2EE7 A;  4TXK A;  4DDP A;  1UJO A;  1WKU A;  4LVP A;  5A36 A;  3F7P A;  2R0O A;  1WYM A;  4TXI A;  3JAL M;  1PA7 A;  1V5K A;  1UEG A;  2JV9 A;  1AOA A;  2D88 A;  1WYR A;  2K2R A;  1P2X A;  3HOC A;  1WYN A;  1MB8 A;  2VZC A;  4B7L A;  4EDN A;  3HOR A;  1WIX A;  2YRN A;  2HL8 A;  3VP7 A;  2EYN A;  2D87 A;  3KMU B;  3JAK M;  3FER A;  1BKR A;  1EUV A; 
#chains in the Genus database with same CATH homology
 2R8U A;  3KY9 A;  2L3G A;  2DK9 A;  2WFN A;  3HOP A;  5J8E A;  2D86 A;  5A4B A;  1DXX A;  1SH5 A;  1WYP A;  1P5S A;  1PXY A;  1WYQ A;  4EDM A;  1RT8 A;  1H67 A;  5A37 A;  4Q59 A;  2VZD A;  4Q58 A;  5BVR A;  5A38 A;  1AA2 A;  2D85 A;  2WA5 A;  2WA7 A;  1TJT A;  2WA6 A;  3I6X A;  1BHD A;  3REP B;  1SH6 A;  1VKA A;  2VZG B;  2K3S A;  2VZI B;  3CO1 A;  2RR8 A;  1WYO A;  4Q57 B;  4EDL A;  3KMW B;  5L0O A;  2EYI A;  2QJX A;  1QAG A;  1WYL A;  1WJO A;  2E9K A;  2D89 A;  3JAR M;  2QJZ A;  2EE7 A;  4TXK A;  1UJO A;  1WKU A;  5A36 A;  3F7P A;  2R0O A;  4TXI A;  1WYM A;  3JAL M;  1PA7 A;  1V5K A;  1UEG A;  2JV9 A;  1AOA A;  2D88 A;  1WYR A;  2K2R A;  1P2X A;  3HOC A;  1WYN A;  1MB8 A;  2VZC A;  4B7L A;  4EDN A;  3HOR A;  1WIX A;  2YRN A;  2EYN A;  2D87 A;  3KMU B;  3JAK M;  3FER A;  1BKR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...