1WYZA

X-ray structure of the putative methyltransferase from bacteroides thetaiotaomicron vpi-5482 at the resolution 2.5 a. norteast structural genomics consortium target btr28
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
233
structure length
223
Chain Sequence
b'ETALYLLPVTLGDTPLEQVLPSYNTEIIRGIRHFIVEDVRSARRFLKKVDREIDIDSLTFYPLNKHTSPEDISGYLKPLAGGASMGVISEDPGADVVAIAQRQKLKVIPLVGPSSIILSVMASGFNGQSFAFHGYLPIEPGERAKKLKTLEQRVYAESQTQLFIETPYRNHKMIEDILQNCRPQTKLCIAANITCEGEFIQTRTVKDWKGHIPKIPCIFLLYK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords putative S-adenosylmethionine-dependent methyltransferase
publication title X-Ray structure of the putative methyltransferase from Bacteroides thetaiotaomicron VPI-5482 at the resolution 2.5 A. Norteast Structural Genomics Consortium target Btr28
rcsb
source organism Bacteroides thetaiotaomicron
molecule tags Transferase
total genus 63
structure length 223
sequence length 233
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2005-02-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.950.10 Alpha Beta 2-Layer Sandwich Methyltransferase, Cobalt-precorrin-4 Transmethylase; Domain 2 Methyltransferase, Cobalt-precorrin-4 Transmethylase; Domain 2 1wyzA02
3.40.1010.10 Alpha Beta 3-Layer(aba) Sandwich Cobalt-precorrin-4 Transmethylase; domain 1 Cobalt-precorrin-4 Transmethylase; Domain 1 1wyzA01
1PJQA 2ED5A 2HR8A 2E4NA 2P6KA 2EMRA 2PCMA 2E4RA 2P9DA 3NDCA 2DV7A 1WDEA 2DXVA 1WYZA 2EL1A 2NPNA 2P6DA 1V9AA 2PB6A 1CBFA 2P2XA 1PJSA 2DEKA 2E16A 2EK2A 2EJZA 2PCIA 2EK7A 2EGBA 2E08A 2EL2A 2P5FA 2EH2A 1PJTA 2PB5A 2QBUA 2DXXA 2HUTA 3FQ6A 2DSHA 2Z6RA 1VE2A 2E07A 2EGLA 4E16A 2E15A 1S4DA 2EH4A 2HUXA 2CBFA 2EK4A 2EN5A 2ZVCA 3ND1A 2EL3A 1VCEA 2P5CA 2OWUA 2E17A 2DV5A 2DSGA 2YBOA 2E8RA 1VHVA 2E0KA 2OWFA 2PB4A 3I4TA 2EHLA 2DV4A 2PCHA 2ED3A 2DV3A 2OWKA 2E0NA 2OWGA 2DXWA 3KWPA 2PCAA 2HUVA 3NUTA 2PCKA 5HW4A 2HUQA 1WNGA 2BB3A 2PCGA 2EL0A 2DSIA 2ELEA 3HH1A 2ELDA 3NEIA 2ZVBA 2EKAA 2EK3A 2EEQA 2EJKA 2P6IA 2E8QA 2EGSA 2YBQA 2E8HA 2E8SA 2EJJA 1VA0A 2EMUA 3FFYA 2ENIA 2E7RA 2P6LA 2OWVA 2EH5A 2EHCA
chains in the Genus database with same CATH superfamily
1PJQA 2ED5A 2HR8A 2E4NA 2KYYA 2EMRA 2P6KA 2PCMA 2E4RA 2P9DA 3NDCA 2DV7A 1WDEA 2DXVA 1WYZA 2EL1A 4H4CA 2NPNA 2P6DA 3TIXB 1V9AA 2PB6A 1CBFA 2P2XA 1PJSA 2DEKA 2E16A 2EK2A 2EJZA 2PCIA 2EK7A 2EGBA 2E08A 2EL2A 2P5FA 2EH2A 1PJTA 3KE9A 3T0GA 2PB5A 2QBUA 3UTCA 2DXXA 2HUTA 3FQ6A 2DSHA 2Z6RA 1VE2A 2E07A 3UV7A 2EGLA 4E16A 2E15A 3SZLA 3KEMA 1S4DA 2EH4A 2HUXA 2CBFA 2EK4A 2EN5A 2ZVCA 3ND1A 4H4DA 2EL3A 1VCEA 2P5CA 2OWUA 4MUXA 2E17A 2DV5A 2DSGA 2YBOA 2E8RA 1VHVA 2E0KA 2OWFA 2PB4A 3I4TA 2EHLA 2DV4A 2PCHA 4MV0A 2ED3A 3UTDA 3DNFA 2DV3A 2OWKA 2E0NA 2OWGA 2DXWA 3KEFA 3KWPA 2PCAA 3T0FA 2HUVA 3NUTA 2PCKA 5HW4A 2HUQA 3SZOA 1WNGA 2BB3A 2PCGA 3UWMA 4H4EA 2EL0A 3URKA 2DSIA 3SZUA 2ELEA 3HH1A 2ELDA 3UV6A 3NEIA 4N7BA 2ZVBA 3ZGLA 3ZGNA 2EKAA 2EK3A 2EEQA 4MUYA 4MV5A 2EJKA 2P6IA 3LMMA 4EB3A 2E8QA 2EGSA 3KE8A 2YBQA 2E8HA 2E8SA 2EJJA 1VA0A 2EMUA 3FFYA 3F7TA 2ENIA 2E7RA 2P6LA 2OWVA 2EH5A 3KELA 2EHCA 3UV3A
chains in the Genus database with same CATH topology
1PJQA 2ED5A 2HR8A 2E4NA 2KYYA 2EMRA 2P6KA 2PCMA 2E4RA 2P9DA 3NDCA 2DV7A 1WDEA 2DXVA 1WYZA 2EL1A 4H4CA 2NPNA 2P6DA 3TIXB 1V9AA 2PB6A 1CBFA 2P2XA 1PJSA 2DEKA 2E16A 2EK2A 2EJZA 2PCIA 2EK7A 2EGBA 2E08A 2EL2A 2P5FA 2EH2A 1PJTA 3KE9A 3T0GA 2PB5A 2QBUA 3UTCA 2DXXA 2HUTA 3FQ6A 2DSHA 2Z6RA 1VE2A 2E07A 3UV7A 2EGLA 4E16A 2E15A 3SZLA 3KEMA 1S4DA 2EH4A 2HUXA 2CBFA 2EK4A 2EN5A 2ZVCA 3ND1A 4H4DA 2EL3A 1VCEA 2P5CA 2OWUA 4MUXA 2E17A 2DV5A 2DSGA 2YBOA 2E8RA 1VHVA 2E0KA 2OWFA 2PB4A 3I4TA 2EHLA 2DV4A 2PCHA 4MV0A 2ED3A 3UTDA 3DNFA 2DV3A 2OWKA 2E0NA 2OWGA 2DXWA 3KEFA 3KWPA 2PCAA 3T0FA 2HUVA 3NUTA 2PCKA 5HW4A 2HUQA 3SZOA 1WNGA 2BB3A 2PCGA 3UWMA 4H4EA 2EL0A 3URKA 2DSIA 3SZUA 2ELEA 3HH1A 2ELDA 3UV6A 3NEIA 4N7BA 2ZVBA 3ZGLA 3ZGNA 2EKAA 2EK3A 2EEQA 4MUYA 4MV5A 2EJKA 2P6IA 3LMMA 4EB3A 2E8QA 2EGSA 3KE8A 2YBQA 2E8HA 2E8SA 2EJJA 1VA0A 2EMUA 3FFYA 3F7TA 2ENIA 2E7RA 2P6LA 2OWVA 2EH5A 3KELA 2EHCA 3UV3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1PJQ A;  2ED5 A;  2HR8 A;  2E4N A;  2P6K A;  2EMR A;  2PCM A;  2E4R A;  2P9D A;  3NDC A;  2DV7 A;  1WDE A;  2DXV A;  1WYZ A;  2EL1 A;  2NPN A;  2P6D A;  1V9A A;  2PB6 A;  1CBF A;  2P2X A;  1PJS A;  2DEK A;  2E16 A;  2EK2 A;  2EJZ A;  2PCI A;  2EK7 A;  2EGB A;  2E08 A;  2EL2 A;  2P5F A;  2EH2 A;  1PJT A;  2PB5 A;  2QBU A;  2DXX A;  2HUT A;  3FQ6 A;  2DSH A;  2Z6R A;  1VE2 A;  2E07 A;  2EGL A;  4E16 A;  2E15 A;  1S4D A;  2EH4 A;  2HUX A;  2CBF A;  2EK4 A;  2EN5 A;  2ZVC A;  3ND1 A;  2EL3 A;  1VCE A;  2P5C A;  2OWU A;  2E17 A;  2DV5 A;  2DSG A;  2YBO A;  2E8R A;  1VHV A;  2E0K A;  2OWF A;  2PB4 A;  3I4T A;  2EHL A;  2DV4 A;  2PCH A;  2ED3 A;  2DV3 A;  2OWK A;  2E0N A;  2OWG A;  2DXW A;  3KWP A;  2PCA A;  2HUV A;  3NUT A;  2PCK A;  5HW4 A;  2HUQ A;  1WNG A;  2BB3 A;  2PCG A;  2EL0 A;  2DSI A;  2ELE A;  3HH1 A;  2ELD A;  3NEI A;  2ZVB A;  2EKA A;  2EK3 A;  2EEQ A;  2EJK A;  2P6I A;  2E8Q A;  2EGS A;  2YBQ A;  2E8H A;  2E8S A;  2EJJ A;  1VA0 A;  2EMU A;  3FFY A;  2ENI A;  2E7R A;  2P6L A;  2OWV A;  2EH5 A;  2EHC A; 
#chains in the Genus database with same CATH topology
 1PJQ A;  2ED5 A;  2HR8 A;  2E4N A;  2KYY A;  2EMR A;  2P6K A;  2PCM A;  2E4R A;  2P9D A;  3NDC A;  2DV7 A;  1WDE A;  2DXV A;  1WYZ A;  2EL1 A;  4H4C A;  2NPN A;  2P6D A;  3TIX B;  1V9A A;  2PB6 A;  1CBF A;  2P2X A;  1PJS A;  2DEK A;  2E16 A;  2EK2 A;  2EJZ A;  2PCI A;  2EK7 A;  2EGB A;  2E08 A;  2EL2 A;  2P5F A;  2EH2 A;  1PJT A;  3KE9 A;  3T0G A;  2PB5 A;  2QBU A;  3UTC A;  2DXX A;  2HUT A;  3FQ6 A;  2DSH A;  2Z6R A;  1VE2 A;  2E07 A;  3UV7 A;  2EGL A;  4E16 A;  2E15 A;  3SZL A;  3KEM A;  1S4D A;  2EH4 A;  2HUX A;  2CBF A;  2EK4 A;  2EN5 A;  2ZVC A;  3ND1 A;  4H4D A;  2EL3 A;  1VCE A;  2P5C A;  2OWU A;  4MUX A;  2E17 A;  2DV5 A;  2DSG A;  2YBO A;  2E8R A;  1VHV A;  2E0K A;  2OWF A;  2PB4 A;  3I4T A;  2EHL A;  2DV4 A;  2PCH A;  4MV0 A;  2ED3 A;  3UTD A;  3DNF A;  2DV3 A;  2OWK A;  2E0N A;  2OWG A;  2DXW A;  3KEF A;  3KWP A;  2PCA A;  3T0F A;  2HUV A;  3NUT A;  2PCK A;  5HW4 A;  2HUQ A;  3SZO A;  1WNG A;  2BB3 A;  2PCG A;  3UWM A;  4H4E A;  2EL0 A;  3URK A;  2DSI A;  3SZU A;  2ELE A;  3HH1 A;  2ELD A;  3UV6 A;  3NEI A;  4N7B A;  2ZVB A;  3ZGL A;  3ZGN A;  2EKA A;  2EK3 A;  2EEQ A;  4MUY A;  4MV5 A;  2EJK A;  2P6I A;  3LMM A;  4EB3 A;  2E8Q A;  2EGS A;  3KE8 A;  2YBQ A;  2E8H A;  2E8S A;  2EJJ A;  1VA0 A;  2EMU A;  3FFY A;  3F7T A;  2ENI A;  2E7R A;  2P6L A;  2OWV A;  2EH5 A;  3KEL A;  2EHC A;  3UV3 A; 
#chains in the Genus database with same CATH homology
 1PJQ A;  2ED5 A;  2HR8 A;  2E4N A;  2KYY A;  2EMR A;  2P6K A;  2PCM A;  2E4R A;  2P9D A;  3NDC A;  2DV7 A;  1WDE A;  2DXV A;  1WYZ A;  2EL1 A;  4H4C A;  2NPN A;  2P6D A;  3TIX B;  1V9A A;  2PB6 A;  1CBF A;  2P2X A;  1PJS A;  2DEK A;  2E16 A;  2EK2 A;  2EJZ A;  2PCI A;  2EK7 A;  2EGB A;  2E08 A;  2EL2 A;  2P5F A;  2EH2 A;  1PJT A;  3KE9 A;  3T0G A;  2PB5 A;  2QBU A;  3UTC A;  2DXX A;  2HUT A;  3FQ6 A;  2DSH A;  2Z6R A;  1VE2 A;  2E07 A;  3UV7 A;  2EGL A;  4E16 A;  2E15 A;  3SZL A;  3KEM A;  1S4D A;  2EH4 A;  2HUX A;  2CBF A;  2EK4 A;  2EN5 A;  2ZVC A;  3ND1 A;  4H4D A;  2EL3 A;  1VCE A;  2P5C A;  2OWU A;  4MUX A;  2E17 A;  2DV5 A;  2DSG A;  2YBO A;  2E8R A;  1VHV A;  2E0K A;  2OWF A;  2PB4 A;  3I4T A;  2EHL A;  2DV4 A;  2PCH A;  4MV0 A;  2ED3 A;  3UTD A;  3DNF A;  2DV3 A;  2OWK A;  2E0N A;  2OWG A;  2DXW A;  3KEF A;  3KWP A;  2PCA A;  3T0F A;  2HUV A;  3NUT A;  2PCK A;  5HW4 A;  2HUQ A;  3SZO A;  1WNG A;  2BB3 A;  2PCG A;  3UWM A;  4H4E A;  2EL0 A;  3URK A;  2DSI A;  3SZU A;  2ELE A;  3HH1 A;  2ELD A;  3UV6 A;  3NEI A;  4N7B A;  2ZVB A;  3ZGL A;  3ZGN A;  2EKA A;  2EK3 A;  2EEQ A;  4MUY A;  4MV5 A;  2EJK A;  2P6I A;  3LMM A;  4EB3 A;  2E8Q A;  2EGS A;  3KE8 A;  2YBQ A;  2E8H A;  2E8S A;  2EJJ A;  1VA0 A;  2EMU A;  3FFY A;  3F7T A;  2ENI A;  2E7R A;  2P6L A;  2OWV A;  2EH5 A;  3KEL A;  2EHC A;  3UV3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...