1WZ3A

The crystal structure of plant atg12
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
84
structure length
84
Chain Sequence
b'QKIVVHLRATGGAPILKQSKFKVSGSDKFANVIDFLRRQLHSDSLFVYVNSAFSPNPDESVIDLYNNFGFDGKLVVNYACSMAW'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords autophagy 12b
publication title The crystal structure of plant ATG12 and its biological implication in autophagy.
pubmed rcsb
source organism Arabidopsis thaliana
molecule tags Plant protein
total genus 10
structure length 84
sequence length 84
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04110 APG12 Ubiquitin-like autophagy protein Apg12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 1wz3A01
4AUQC 2V3SA 4MGYE 4WJOA 2D2QA 3AI5A 2O6VA 4G50A 2K8CA 2JVCA 2M4NA 1VD2A 1WJUA 1WXVA 4K81A 3ZDTA 3QCAA 1NI2A 4JLCA 4RMAA 1WH3A 2LVPA 5DCNA 3RYTA 2BGFA 3UGBB 2Z59B 2ZNVB 4OVUA 4J6IA 3HK0A 1T0YA 4AJYB 2MW5A 2NBUA 1GG3A 2D11A 3ZNZB 3ZTCA 3VH4B 5CX3A 3H6NA 1L2NA 2O6VB 2DHZA 5LLIA 1YJ1A 5D6JB 4IG7B 2KMCA 2ZPNA 2W9NA 3K9PB 2KN5A 4M8NA 3HIZA 2KQ7A 4KDLB 2AL6A 3ZVVA 3BY4B 1VCBA 1H8CA 4HXDA 3OJ3A 4EZJA 1KLVA 4CHKA 2KFJA 1S3SG 1WRDB 1OQYA 2ZNVC 5EDSA 3DBRI 3ZNID 3DVNU 4IC7B 3RULA 4HCNB 5AZFA 3MHSD 4FJYA 3CMMB 2B3AA 1WX9A 3QHTA 3QJZA 2MQJA 4GDKA 2REXA 2GBMA 2KANA 4WWPA 2RPQA 2M17A 3U30A 1UD7A 4DDID 1WX7A 3UQAA 3X23A 1WM2A 3SDLC 5IAAC 3VTWA 4F7ZA 4IM0A 4WJPA 3B1LX 3ZTDA 4ZYNA 4FHKA 1PQSA 3VQIA 3PLVA 4GDKB 3RZWC 4DK5A 2K39A 4JQWC 1U4AA 3SHQA 4LCDE 5DPWA 1J8CA 4MGZE 2JXXA 3LDZE 3MJWA 3UINB 3KH0A 1E8XA 3KUDB 4EZLA 2DZKA 1C1YB 3DVGY 4PYUA 2K6DB 3W1YA 2MBQA 2C60A 3V6CB 3RZFA 2KKCA 3ZRCA 3R66C 1ZGUB 3TJPA 2WYQA 3EFUA 3W1SA 1QZEA 3TL5A 3VXWA 4LDTB 3JYUA 5E6NA 3APDA 4AWJA 4HLEA 2K8HA 1I35A 2EKEC 2Y5BB 3WANA 3KVFB 3VUYA 3AULA 1IYFA 4GSWA 4DHZB 2AYOB 4GMVA 1YQBA 1SE9A 4LJPB 1YIWA 3VFKA 4ANWA 2LGXA 3B08A 2AL3A 1R4NI 1WF9A 1FXTB 2V4LA 3QAQA 3ZNGC 1K8RB 3QARA 3PS6A 1WGGA 2UWQA 3VUWA 2KMAA 2ZPYA 3H9DA 5L95C 4K7WA 4KV2A 2WDTB 3VTUA 4BVUC 2LUEA 4G0NB 4ZRJA 2BKRB 3A4RA 4NAWA 1XD3B 2KHWB 4HCPB 3R7QA 3V62A 3W1SC 2KX0A 2LI5A 2L8JA 1GC7A 2HD5B 2N9PC 4NNJB 2FIDA 1LQBA 4E3CA 4IWPA 4URKA 2CHWA 2VRRB 3PT2B 3PTFC 2EMSA 1WX8A 4G11A 1RAXA 3KUCB 2LVQA 4FULA 2IY0B 1BT0A 2FCSA 2DYOA 2G45B 4WAAA 4NAWB 4BOSC 4ZRIA 2CR5A 4IUMB 2C9WB 3QK0A 2LD9A 4KSKC 1WJNA 4W9KA 5LXHA 2C7NB 4GGQA 3DOWA 2PE6B 4KZCA 4B6WA 4K1RB 2FAZA 3KUZA 4DHJD 4AJWA 4OVVA 3DQVA 5JHAA 3QX1A 1D3ZA 4RM9A 3QWZB 3M3JA 3PVLA 1UGMA 2R2OA 1WR1A 3A33B 3ML8A 1F9JA 3IVFA 1NDDA 1Q5WB 4PS8A 4WJNA 5GMVA 3ZW3A 2FCQA 2JPHA 1OEYJ 1E7VA 4BBNF 2C7HA 2GBKA 2KWCA 2PE9A 3A9JA 5CHWA 3WAMA 2CU1A 3ZKJC 1P0RA 2N4FA 2RD0A 3QC8B 2MA9B 1ISNA 1EUVB 3DVNV 3O65B 4PS3A 3WA0A 4FHJA 3ZDMC 2KC2A 4MDKE 2KK8A 2ZZPB 1M94A 2D10A 2MLBA 4TQ1A 2ZCBA 3A4SC 4M0WB 2HTHA 1RFAA 2CHZA 3WAOA 5D2MB 4ANUA 5D94A 2MP2A 5CHVC 3V60A 3APFA 3A9JB 4NJ6A 3U8ZA 1TGZB 3IHPC 2KX3A 3I3TB 5KHOA 3L10B 2Z0DB 4GIVA 1WGRA 1E8YA 2I1KA 4KIKA 5AZHA 2J0MA 1TTNA 4K7UA 4ANXA 4HDQA 5CTRC 2ZVNA 3IFWB 3P2BA 4I6NB 2DAFA 3UQBA 3N3KB 3RT3B 4II2B 4BKTA 3NS8A 3D32A 1I42A 3APCA 4ZDVA 1Z2MA 2L00B 3ENEA 3VVWB 4A3PA 2MBHA 3JSVA 2NBVB 2DX5B 1WJ6A 2PPHA 4KIKB 1P1AA 2KO3A 2RSUA 2KWVB 4MJSA 4BOZB 3H7SA 4AOFA 4MH0E 1WE6A 3AXCA 2KDIA 2KNBA 5L83A 1LM8B 2WX1A 3M95A 2FIFA 1Y8RC 1WIAA 3PREA 4I6LB 4NQKE 3VDZA 2N7EA 1WY8A 2FUHB 3JSVB 3OJ4B 3T8MA 2XK5A 5LXIB 2KFKA 2KQSA 1WJ4A 2KDEB 2PEAA 4MJSB 3L13A 1MG8A 2ASQA 2KVRA 4KDIC 3DCGA 1UZXB 2NR2A 1V9JA 1Q0WB 4IM3A 2M0XA 4PYZA 3L08A 1JRUA 2ZEQA 2YLMA 2OOBB 4GB9A 2CS4A 1L7YA 3V6EB 2IZVB 3OLMD 1V49A 3UF8A 3ZUNA 4FBJB 2PJHA 2JZZA 2XK5B 3H1UA 3NOBA 2AEHA 2KFKB 2JWZA 1UELA 2N9EB 4A3OA 5KHQA 2KOXA 4HVBA 4B95A 2DAJA 3AU4A 4M8MA 2XBBC 4KVGB 1RRBA 2KJRA 5IA7A 4FA6A 5FR6A 2CHXA 2N1VA 2LGDA 1TBEA 5G2NA 4BKGA 2K1FA 2FNJB 3Q3JA 3L17A 1E90A 4ZRKA 5JH5C 2K25A 1EO6A 1UBQA 3ZO5B 3VAWA 1LFDA 1WMHA 1OEYA 3NY5A 3QA8A 4FN2A 2NBWB 4MELA 1YD8U 2IY1B 3X0WA 2L7RA 2DZJA 1KJTA 2XEWA 1P98A 2GBJA 1OTRB 4CO7A 1V86A 3HM6X 1UH6A 2YVCA 3PRZA 3UIPB 4B9KA 2O2VA 4PS7A 4HK2A 4E74A 1J19A 1WMHB 3HM3A 4ICVA 5AEKB 1TZ1A 3IG3A 1E8ZA 4TQ0A 2JF5A 2L0FA 2MX2A 3CSFA 2FCNA 3OAWA 3T9LA 1YX6B 2DZMA 2LGYA 5E6OA 4MGKE 4XZ4A 3KYCD 1IP9A 3CSTA 3Q3FA 4TUUA 1RLFA 4X57B 4FJVB 1WXMA 1WXSA 1WFYA 2LZ6A 4AP4C 2O2VB 1Q1OA 2IBIB 4LJOB 4NY0A 1SGHA 2KZRA 3C0RB 3PHWB 4GU2A 4NQLB 4G3XB 3VHTC 2M1MA 4YL8A 2L76A 2LXCA 3CF6E 2IO1B 1V6EA 2A5UA 3EC8A 3PSEB 2BYEA 3M63B 3ZLZA 2GBNA 4F8CB 5DPSA 2V1YA 2WWZA 3HHMA 4MM3A 1C3TA 1KM7A 3EECA 1J0GA 4DBGA 1V81A 2G3QB 4KSLC 4DDGD 1S1QB 1WZ3A 4MGIE 2KTFA 5JHBA 2BF8B 2GOWA 5HKHA 3A9KA 3WAPA 3R7RA 3MTNB 2HJ8A 1EF1A 3TIXA 4CYEA 2KTRA 3NZUA 3SU8X 4ANVA 2GMIC 3L54A 5JZEB 2NPTA 1V2YA 4ASWC 4MSMB 4RM8A 2BWFA 4W9IA 2JRHA 1A5RA 2NS5A 3PV1A 4K7SA 4W9JA 1X1MA 2QHOA 4JL9A 1V5OA 2KDBA 1OGWA 4W9FA 2LJ5A 3A9KB 2LVOA 2JY6A 2BYVE 2BWES 2KTRB 1WGDA 2IO2B 2BYFA 2NPTB 2D07B 2JRIB 2MP2B 3GOEA 2EMTA 4N9F4 4W9DA 3V61A 3NHEB 4DXAB 4JGHB 3WALA 4EFOA 3RD2A 1E8WA 4BKSD 2G4DB 3PRMB 5DPRA 4GXBA 2NCNA 3PGEA 4WWOA 5J17A 3VTVA 3N30A 2MBBB 3H7PA 1WGYA 4HDOA 4DHZE 1P9DU 4W9GA 2DYBA 2KDFB 3QIJA 3KYDD 4I6PA 2MBOA 2LASA 2LXAA 4II3B 5G55A 2MCNB 1V5TA 2KJHB 2Z0EB 1E7UA 2N7DA 2L3ZA 4MEMA 3PPAA 2KC1A 2O6VD 3DDCB 3WIMA 2KWUB 4FADA 1P3QU 5CHFA 2HE7A 3DBSA 4EUTA 2RGFA 3H7PB 4EZKA 1UBIA 5J2RA 4HPLB 4IWOA 1HE8A 1G6JA 2I1JA 2UYZB 5BO4B 2LRUA 2MBEA 2GBRA 5TR5A 4W9HA 1WYWB 3VUXA 4A20A 1NBFC 4HPMB 4XX5A 1WI0A 1WXAA 2IYDB 3GZNI 1GNUA 2ZCCA 3DBHI 2G4SA 3S2AA 2R2QA 1GUAB 3K9OB 1WR6E 4KZ0A 4NPNA 3NZSA 2DZIA 2BPSA 4TKNA 2N9XA 2MWSB 3KW5B 1ZKHA 2D3GA 3L0WB 4E71A 3SD5A 4W9EA 3DBLI 3EHVA 1GC6A 4BBNC 1KOTA 3PHXB 4WQOB 4FJZA 3ZNHB 2KXJA 1V80A 2DYMA 1WE7A 1R4MI 2AWTA 3JVZX 1WM3A 3PZDA 4WWNA 2JUOA 2J0JA 3BINA 4HJKA 5DPTA 4ICUA 3IBEA 3VH3B 1XQQA 3ML9A 1XT9B 3M62B 5J18A 2K6QA 2MSED 4BFRA 1WZ0A 2C7MB 3TMPB 2RR9A 3R3MA 4IM2A 4F1SA 2A4ZA 4HWIB 3DPDA 4GDLA 3TCAA 2IO0B 3RUIB 2CKHB 2ZVOA 4IWQA 3UIOB 4EEWA 3LJ3A 4GOCA 4DHJB 2OJRA 1E5WA 1ZW7A 4LDTD 2K8BA 4TV3A 3ALBA 5D7GA 2C5LC 1GJZA 2N1WA 4P7IA 4WJQA 1H4RA 1LXDA 2M8SA 4MSQB 5E6PA 3A1QA 3ZRFA 1SIFA 2KLCA 3PRPB 1YX5B 2L05A 2MRPA 4GDLB 2NVUI 3ECIA 2KLGA 1Z5SB 3B0AA 2JT4B 2ZJDA 3AU5A 3QQ8B 3TBLD 4EOYA 3L16A 1AARA 3PLUA 1CMXB 2KD0A 4EKUA 4DWFA 2DENB 3DVGX 4XC2A 3N32A 4FLHA 1IPGA 2IO3B 2JZ3B 3A1QB 4JIOU 2J0KA 4IW0A 5C23A 3RCZA 4BKSA 1EF5A 2WX0A 3JW0X 3U7DA 2KJ6A 4W9CA 4NJ7A 1WGHA 3ZIMA 4GN1A 5C1ZA 2LRWA 3ONSA 5AZGA 2FCMA 2BKFA 2L0TA 2J7QB 2LWPA 4W9LA
chains in the Genus database with same CATH superfamily
4AUQC 1EM7A 4REZA 4G50A 3ZDTA 1NI2A 4JLCA 1FRDA 2LVPA 1SJHD 2BGFA 3UGBB 4J6IA 2L1AA 2MW5A 2NBUA 3MFGA 3Q3NC 1V97A 3GS2A 2PIAA 1CZPA 3ZTCA 3BWUD 5EE0A 4C00A 2ON8A 4ITKA 3Q6BA 2KMCA 1MI0A 4C4VB 1UUPA 2KQ7A 1VCBA 1H8CA 4HXDA 3BVZA 3BVMA 3MC9A 5GXGB 4CHKA 1HTOA 5EDSA 3ZNID 3PZ7A 4YT0B 4HCNB 1YMHE 3CMMB 2UU7A 3QHTA 2INDC 2KANA 4XDDA 1QOBA 1SEBD 1B1ZA 1WX7A 1WM2A 3VTWA 5BYRA 2Y5PA 4IM0A 3ZTDA 3RNGC 4XWWA 4GDKB 2FBWB 1U4AA 2PKOA 3UINB 3KH0A 2WXQA 1E8XA 3V6CB 2J42A 1J7CA 1ZGUB 1JMLA 3R66C 3TJPA 1ET6A 2W3SA 3AE3B 3APDA 4HLEA 1N63A 2HJ1A 2Y5BB 3WANA 1D5ZC 4WURA 3AULA 3BIID 4A55A 4GMVA 1SE9A 1FFUA 1VJKA 2LGXA 1WF9A 2V4LA 3AMZA 1WGGA 1ZOYB 2ZPYA 1XEEA 4K7WA 4KV2A 3VTUA 2LUEA 4G0NB 3DHHC 4NAWA 3A4RA 2N7JA 4AQ7A 2KHWB 3W1SC 2KX0A 2LI5A 2L8JA 4E3CA 4NNJB 2FIDA 3PT2B 3U2SC 2WDVB 4G11A 2LVQA 2IY0B 2FCSA 4WAAA 2CR5A 3QK0A 1WJNA 4B6WA 4K1RB 4ACFA 1SBBB 1SXTA 1D3ZA 2WXPA 3M3JA 3PVLA 1WR1A 1F9JA 3IVFA 4WJNA 3SEBA 2FCQA 2C7HA 3A9JA 2KWCA 4NZLB 2RD0A 3DVNV 4L23A 3WA0A 3TEYA 4MDKE 2ZZPB 4C7YA 1C79A 4M0WB 2HTHA 1RFAA 3V60A 3HUIA 5D3DA 3ZGZA 3PO0A 5KHOA 1E8YA 1TTNA 4ANXA 4HDQA 2ZVNA 2NMQA 4I6NB 2DAFA 3UQBA 1VZ7A 4BKTA 3AE8B 3D32A 1I42A 1SE2A 4ZDVA 1Z2MA 4A3PA 2NTTA 4YSXB 2NBVB 1WJ6A 3AE1B 2KO3A 2RSUA 2OHFA 1C9FA 4MH0E 1ESFA 3GP7A 2KNBA 5L83A 4OZBA 1Y8RC 3BVGA 4H2AA 3TEWA 1HZ6A 3VDZA 1WJ4A 4MJSB 1C4CA 4LLGM 4PYZA 1JRUA 4GB9A 3ZUNA 1F77A 2PJHA 2JZZA 2LGSA 3DBRB 2AEHA 4OHJA 2JWZA 2N9LA 1RRBA 4FA6A 2BT6A 2TSSA 2K1FA 2K5PA 4A9AA 3Q3JA 3HVZA 1LO5D 1UBQA 2W54A 3ZJTA 1XLOA 3QA8A 3H8HA 4ZHPA 2NBWB 4KKJA 2B76B 2DZJA 1KJTA 1FCLA 3IAM1 1N62A 4CO7A 4KKIA 4RGNA 3HM6X 1VR9A 2LHDA 4B9KA 1IUEA 2LFIA 3HM3A 4HJGE 1V1OA 5FK9C 3ZQ4A 2MX2A 3Q8CA 3V05A 3RMKC 1QOGA 1IP9A 3Q3FA 4TUUA 1RLFA 4X57B 3TUOA 4FJVB 1WXMA 1WXSA 1SIJA 1GAQB 2O2VB 3IT6B 4M01A 4AP4C 4NY0A 1SGHA 3C0RB 3PHWB 4NQLB 3U4EG 1N5WA 2M1MA 3AEDB 1HTQA 1V6EA 3EC8A 1V8CA 2IDYA 2PVOD 1FPYA 2V1YA 3NVWA 4DBGA 2AQ3B 4DDGD 1S1QB 4MGIE 4RNAA 2BF8B 3A9KA 3WAPA 3TIXA 4CYEA 2NPTA 3DHIC 4MSMB 2BWFA 1A5RA 3PV1A 4W9JA 3NUHB 2QHOA 2E6XA 4HKZE 3EA6A 1V5OA 2JY6A 3AV8A 5EE3A 1NEKB 1HQRD 2IO2B 3GOEA 4N9F4 3NHEB 3WALA 4HRSA 4EFOA 1E8WA 1CK1A 2LUMA 2JZPA 5J17A 2MBBB 2HTME 4DHZE 4ARIA 2KAJA 4II3B 5G55A 2KJHB 4LNFA 1KLGD 2O6VD 4LTUA 3WIMA 3FAHA 3DBSA 2RGFA 1UBIA 5J2RA 3FC4A 4IWOA 4HKQA 2I1JA 3P63A 5BO4B 1PGBA 2MBEA 1WYWB 4S0RA 4KGTA 4N6EB 3B2FA 4HPMB 2ZCCA 5BYQA 3S2AA 3L4PA 2WXGA 4K3BA 4ARCA 2MWSB 2PMVA 2D3GA 4BBNC 1KOTA 4FJZA 4M02A 1QILA 3PZDA 4WWNA 2JWUA 2BB5A 2PVGC 4OVZA 4BFRA 1I4GA 4IM2A 1WWTA 2N0SB 3TCAA 4GDLA 3HRDD 3LJ3A 4GOCA 4LDTD 2IGDA 2C5LC 2N1WA 4P7IA 2RDBC 4WJQA 1MVKA 2M8SA 5E6PA 3GB1A 2NVUI 3DWGC 2JT4B 1TKYA 3DHGC 1YQ4B 4XC2A 4FLHA 1E7PB 1JWAD 5C23A 2J0KA 3AE4B 3C8YA 1EU4A 3KQ4A 4BKSA 1TS2A 3U7DA 4NJ7A 1PFDA 1IBXB 4GN1A 4JPSA 5MPOA 3ONSA 3PZ8A 4W9LA 1FNVA 1HA5A 4MGYE 4WJOA 2D2QA 2RDHA 2K8CA 2JVCA 2M4NA 1WXVA 1VLBA 4K81A 4RMAA 2BW2A 1WRIA 5DCNA 2Q5WD 1XLNA 3H6NA 1L2NA 2W3RA 2O6VB 1YJ1A 1TJEA 4IKGA 2ZPNA 2W9NA 4M8NA 4JWSC 2MJDA 3ZVVA 3BY4B 2ZW0A 2WXNA 5FR3A 2WQYB 1S3SG 1OQYA 4IC7B 3RULA 2H88B 3MHSD 4FXCA 4FJYA 1WX9A 2GI9A 2WDRB 2WXHA 4ZRPA 3GE3C 4P6VF 2RPQA 2M17A 3UQAA 3SDLC 4WJPA 2D3CA 4RH6A 1L6UA 4ZYNA 4FHKA 1F0ZA 1PQSA 4NJCA 3PLVA 4DK5A 2K39A 4JQWC 3SHQA 5DPWA 1J8CA 3MJWA 1ACCA 4EZLA 4B0MA 2DZKA 1F2RI 4PYUA 2BS2B 2MBQA 2ONQA 3RZFA 1F52A 1FEHA 2KKCA 2K3UA 3Q8FA 5FKAC 4LDTB 3JYUA 2J4XA 5E6NA 2EKEC 3W9CB 1T0QC 3KVFB 3VUYA 4P1BC 4GSWA 1FM0D 4DHZB 5C3JB 3W2DA 1YQBA 2EELA 1L0VB 1MHHE 3QAQA 2AL3A 1R4NI 1K50A 2L52A 1ZE3D 4S17A 1TY2A 3PS6A 2UWQA 3VUWA 3GZNB 4P16A 3WCQA 2WDTB 4BVUC 3AE5B 2BS4B 3ZYYX 3R7QA 3I5JC 1V1PB 4OZCA 1GC7A 1TYGB 2IGHA 2N9PC 3DBLB 2CHWA 1R4MB 1WX8A 2AX5A 4C7ZA 1RAXA 1XCTL 1BT0A 3RNCC 4BOSC 4ZRIA 2C9WB 2LD9A 3ZXRA 5LXHA 1E10A 3DOWA 2PE6B 4DHJD 3E9SA 2BVCA 1JWBD 1JCKB 1STEA 5GMVA 4PS8A 3ML8A 3IAS1 4YSYB 1OEYJ 1E7VA 3ZKJC 1KF6B 2MA9B 1ISNA 4R3DA 3O65B 1UNSA 3ZDMC 2KC2A 3AB5A 3GE8C 3CIRB 2Y3AA 3Q8BA 2ZCBA 2JQRB 2L32A 3A4SC 3VR9B 4ANUA 5D94A 1FNWA 4NJ6A 3U8ZA 1TGZB 3I3TB 4EE2A 3NVVA 1OQRA 4KIKA 2I1KA 5AZHA 2J0MA 4K7UA 2WP9B 3IFWB 4WAFA 3Q8AA 2N9KA 3RT3B 4ZHOA 4OZAA 4O1NA 1DYQA 3APCA 2L00B 3ENEA 3E56A 2MBHA 4L1BA 5EE9A 1QKZA 1A70A 2DX5B 1P1AA 1AN8A 1QOFA 2KWVB 1JROA 3SFEB 1WE6A 1MG4A 4NQKE 3JSVB 3OJ4B 1T5XD 3TEXA 1PGXA 2KQSA 2KDEB 3L13A 1MG8A 1TT5B 3T3NA 1QQRA 4D2KA 1KLUD 1V9JA 1Q0WB 1YN4A 4IM3A 2KQ4X 1PDXA 3V6EB 1V49A 4JX1C 2XK5B 4GLSC 2KFKB 4A8XC 1UELA 3SFDB 4B95A 2DAJA 2HDEA 2XBBC 4KVGB 3URYA 2KJRA 5FR6A 2CHXA 2LGDA 2INNE 2QCZA 3L17A 3AM9A 5C2TB 1E90A 1BMLC 2WS3B 4YWGG 1I4PA 3VAWA 1LFDA 1OEYA 4FN2A 2XEWA 2GBJA 1OTRB 1V86A 1UH6A 3PRZA 4PS7A 4HK2A 1WMHB 1ZXHA 4ICVA 2K0PA 3IG3A 1E8ZA 2JF5A 1XO3A 2NTSA 1YX6B 2DZMA 4MGKE 2KWDA 3CSTA 1WFYA 2IBIB 1WXQA 4GU2A 1AW7A 3R8BA 4YL8A 3CF6E 2IO1B 3PSEB 2BYEA 2GBNA 3HHMA 1PGAA 1SJED 1Q10A 3SR6A 2G3QB 2BS3B 2KTFA 2GOWA 3MTNB 2HJ8A 3AEBB 2KTRA 3L54A 3AEFB 1BUIC 4ASWC 4MM3B 2NS5A 4K7SA 1JQ4A 4JL9A 2LJ5A 1L5PA 2D07B 2MP2B 4W9DA 3V61A 3RD2A 5EE1A 2IPKD 1E0ZA 1P7EA 4QAYA 3TSSA 3VTVA 3H7PA 4HDOA 1P9DU 2KDFB 3QIJA 4USAA 2MBOA 1ENFA 2MCNB 1V5TA 2Z0EB 4MEMA 2N7DA 4YTPB 3MHZA 2KWUB 1P3QU 5CHFA 4EUTA 2DLBA 3RI7C 2WGSA 2GBRA 3VUXA 3AEAB 1NBFC 2K22A 5BMIA 4LK0M 4M00A 1GNUA 2KVZA 3DBHI 2G4SA 5BMHA 3K9OB 1TS3A 4N58A 2R61A 3KW5B 4W9EA 1T0SC 2D3AA 3V3XA 2JXTA 3P4SB 1SSNA 1C78A 2AWTA 3JVZX 3VH3B 2JUOA 3BINA 5DPTA 4ICUA 3IBEA 3EFCA 1XT9B 3RPFC 1WZ0A 2C7MB 4F1SA 2A4ZA 5HG2A 3DPDA 2IO0B 2CKHB 1L0YB 1NYRA 3UIOB 3EUB2 2OJRA 1E5WA 1ZW7A 4TV3A 3VR8B 1I7HA 1GJZA 3RNBC 1TS4A 1SIFA 2KLCA 4LNIA 2MRPA 3P4QB 3QQ8B 4EOYA 1Y56A 4EKUA 2DENB 3DVGX 2JZ3B 1C76A 3A1QB 4IW0A 1FCCC 2WLBA 1EF5A 2G9HD 3JW0X 1WGHA 3RNFC 2L0TA 2BKFA 2WXRA 5IP4D 4K3CA 2FUG1 3FILB 3QCAA 1WH3A 4C4VA 2Z59B 2ZNVB 1T0YA 4AJYB 3RN9C 2D11A 3ZNZB 3VH4B 5CX3A 3KWLA 5D6JB 2WXLA 2LMCA 3R2IA 3K9PB 2WXMA 3HIZA 4KDLB 2AL6A 3OJ3A 4EZJA 3BK1A 2ZNVC 4TSSA 2B3AA 1YQ3B 4GDKA 2GBMA 4WWPA 3LXFA 1N6ZA 4KGRA 3W5VB 3U30A 4DDID 4CQNA 4F7ZA 2WHIA 3B1LX 5H8YE 3VQIA 2BBCA 3RZWC 1ZDVA 4KGSA 3NZ3A 2Z8LA 1KH0A 3DVGY 1T6BX 3W1YA 3ZRCA 2WYQA 2VH1A 2AQ2B 3W1SA 1QZEA 3TL5A 3VXWA 2WDQB 4AWJA 1I35A 4N59A 1DOIA 3N9YC 4A90A 2JYTA 2XN9C 4LNKA 4IOIE 4B0EA 1D5XC 1QLBB 4ANWA 3B08A 3ZNGC 3Q3OC 5HI1A 3AEGB 5JXVA 3BYYB 1MJDA 1C4PA 4WIPA 1J7AA 1ZUD2 1RM6C 3RFZB 3NVZA 2H89B 2WNMA 2HD5B 1LQBA 5G5GA 4IWPA 2W55A 1FD6A 1GPXA 4WWMA 4FULA 4RGTA 4NAWB 4WH4A 3RNEC 1GOZA 4KSKC 4W9KA 4XGAB 2C7NB 1SF0A 3KUZA 1BXTA 2AQ1B 5JHAA 5E6JA 4YTMB 4RM9A 5IKCM 1MPEA 4M0WA 3A33B 1NDDA 4BBNF 5I4DA 2CJOA 1YNTE 2GBKA 2PE9A 3WAMA 2CU1A 1IGCA 1P0RA 2N4FA 4PS3A 3QC8B 1I4XA 2KK8A 4TQ1A 1M94A 2MLBA 3WAOA 2MP2A 5CHVC 3APFA 1YJJA 3A9JB 2V3NA 1M4VA 3P4RB 3IHPC 2KX3A 3L10B 1RWSA 2Z0DB 4OW0A 3LB8C 3P2BA 5D3IB 3Q14C 3N3KB 4II2B 1FXAA 3B2GA 3VVWB 2M56B 1L4DB 4MJSA 3H7SA 3R2TA 2EKIA 3AXCA 2KDIA 1LM8B 2WX1A 2RDGA 5AUKA 1XXGA 3M95A 2D5GA 3PREA 4I6LB 2N7EA 1WY8A 3I63C 1DOYA 5AUIA 5LXIB 3AECB 2PEAA 1NVID 2ASQA 1E9MA 2KVRA 4KDIC 3DCGA 1UZXB 2NR2A 4DQOC 3U52E 2ZEQA 2OOBB 2CS4A 1L7YA 2LHEA 2IZVB 3OLMD 3UF8A 1L0XB 4FBJB 2V9HA 5LNK1 3H1UA 3T3OA 4A3OA 5KHQA 3O13A 3MP9A 2MJEA 3NG0A 2WXFA 3I9V1 1FIQA 1QT9A 5G2NA 2DBYA 4ZRKA 1TKEA 2K25A 1EO6A 3AE2B 1JW9D 3NY5A 1YD8U 3X0WA 2L7RA 3ZJVA 1VZ8A 2BQQA 1P98A 1SE3A 2YVCA 2ACZB 4RF1A 2O2VA 4E74A 1J19A 1TZ1A 4TQ0A 3OG5A 3MC0B 5E6OA 1K51A 4XZ4A 3KYCD 3MC8A 1TS5A 1QF6A 2PTLA 2VZKD 4LJOB 1TZOA 4IDIA 2KZRA 1F2RC 3ABVB 4G3XB 3VHTC 2KN4A 2L76A 2K9XA 1EWCA 1R4NB 4C56C 2A5UA 2KDMA 1YN5A 5DPSA 1NI3A 2WWZA 1C3TA 5TSSA 1J0GA 1V81A 4KSLC 1WZ3A 5JHBA 3R7RA 5IN7A 2IGGA 1UWXA 3NZUA 3SU8X 5JZEB 2RMMA 2JSVX 2JRHA 1GB1A 1X1MA 4XDCA 2BTEA 1B9RA 3Q3MC 1HZ5A 1OGWA 3A9KB 2INCC 2BWES 2BYFA 2NPTB 1XF5L 3NRZA 4LNNA 4ZOHC 4DXAB 4JGHB 1TKGA 4BKSD 3PRMB 5DPRA 4GXBA 4J3OD 2NCNA 3PGEA 4WWOA 4C80A 1YN3A 3N30A 3C19A 1D6EC 3AE7B 3KYDD 4I6PA 3DWMA 2LXAA 3DDCB 4XWTA 1I4HA 4MH8A 1WGKA 2M0AA 4EZKA 1PUTA 4HPLB 1HE8A 1G6JA 2WXKA 3VRAB 5TR5A 3KLSX 1XCQL 1WI0A 2IYDB 4P1CC 1GUAB 2QEJC 3J9CA 3NZSA 4MACA 4TKNA 2N9XA 3SD5A 4DXFA 2WU5B 4WQOB 1C4AA 3ZNHB 1P7FA 1V80A 2DYMA 2J52A 1WM3A 1K52A 1XQQA 3M62B 2K6QA 2MSED 3TMPB 2VH2A 2VZKB 2MJ3A 1SB3C 3RUIB 2X8XX 4DHJB 2PW9A 2V3PA 1I4QA 2K8BA 3ALBA 4XYCA 2GLSA 1LXDA 3ZRFA 2QC8A 3PRPB 4GDLB 1YX5B 2KLGA 1Z5SB 3B0AA 2J53A 1AARA 1AWDA 1IBXA 3IXSA 3Q69A 3P1MA 1IPGA 3W5UB 4JIOU 3ZXVA 2WX0A 2KT7A 2D3BA 3ZIMA 5C1ZA 1ZPSA 3IT4B 2J7QB 2JU6X 2LWPA 2V3SA 4JWUC 3AI5A 2O6VA 1VD2A 1WJUA 1YJIA 1C77A 4ZYSA 2KACA 3RYTA 4BAXA 3ZJUA 4OVUA 5T8IA 3HK0A 1I4RA 5BMGA 1GG3A 1KTKA 1KFYB 1XLQA 2DHZA 5LLIA 4NAMA 4IG7B 2MEKA 2KN5A 4RF0A 3OWEB 4HPPA 2V0GA 1KLVA 2KFJA 1WRDB 3DBRI 3DVNU 5AZFA 3QJZA 2MQJA 2REXA 1N61A 1UD7A 3X23A 5IAAC 1WYGA 1CQVA 3HVDA 4LCDE 4MGZE 2JXXA 2QSDA 3LDZE 2Y5CA 3KUDB 1C1YB 1CJEA 2K6DB 1TY0A 1GB4A 2C60A 3EFUA 1FNUA 4Q2JA 2OEDA 1RYJA 5HFYA 2JX5A 2K8HA 1IYFA 2INPE 4L2YA 1OQQA 1KRHA 2X38A 2AYOB 2WXJA 4LJPB 1YIWA 2GRIA 3VFKA 2QMTA 2JYEA 1FXTB 1K8RB 3QARA 3VRBB 2IJ0A 1DGJA 1V1PA 2KMAA 1J7BA 2QIEB 3DBHB 1FFVA 3H9DA 5L95C 3EGRA 4ZRJA 2BKRB 1XD3B 2PLPA 4HCPB 3V62A 1HEZE 3AEEB 4MT5A 4HROA 4URKA 1NENB 2VRRB 3PTFC 2EMSA 4WQMA 3KUCB 1HXYD 2G45B 2DYOA 2QILA 4IUMB 4RCOA 1DOXA 4TMAB 1PYWD 4KX6B 4GGQA 4KZCA 2FAZA 4AJWA 4OVVA 3DQVA 2SAKA 1E6EB 3QX1A 3QWZB 1YOVB 4RFBA 1UGMA 2R2OA 1AYFA 3ZW3A 3Q2AC 1Q5WB 1VZ6A 2JPHA 5CHWA 1ZXIA 1EUVB 1WSPA 4FHJA 1ZDXA 2OJWA 2D10A 1L4ZB 3AE9B 2YEPB 1NYQA 2CHZA 5D2MB 3UI3A 3AH7A 3N1XC 2FE8A 4YXDB 4GIVA 1WGRA 1F1HA 5CTRC 2I38A 3U7ZA 3NS8A 1OFFA 2LJIA 1UGJA 3BK2A 3JSVA 2PPHA 2LEKA 4KIKB 4BOZB 3TEZA 4AOFA 1MHXA 1VRAB 1IGDA 1D4BA 2FIFA 1WIAA 2FUHB 3T8MA 2XK5A 2KFKA 2DNFA 3AE6B 2L83A 4PT5A 1FMAD 5IO9A 2M0XA 3L08A 2YLMA 2QDFA 3NOBA 3BYTB 2N9EB 2KYWA 2KOXA 4HVBA 3P42A 3AU4A 4M8MA 5IA7A 4BZAA 2N1VA 1TBEA 4BKGA 1JWMD 1XLPA 2FNJB 5JH5C 1N60A 3ZO5B 2E3TA 2W82A 1WMHA 1JALA 4UDUC 4MELA 2IY1B 4DXGA 3UIPB 2YEPF 4RGMA 2CJNA 5AEKB 3CSFA 2L0FA 1JRPA 2LGIA 2FCNA 3OAWA 3T9LA 4AS1A 2LGYA 3LYYA 2I2YA 5HHDG 2MHJA 3RNAC 2LZ6A 1Q1OA 3BZDB 3MJ5A 2LXCA 3M63B 3ZLZA 4F8CB 4MM3A 4RGOS 1KM7A 3EECA 3FKYA 3NVYA 5H92C 5HKHA 2WXIA 1EF1A 2ICIA 4ANVA 2GMIC 3N1YC 1V2YA 5BYSA 4RM8A 1ZP0B 4W9IA 2DWQA 2KDBA 4W9FA 2LVOA 3Q8EA 4YTNB 2BYVE 2RPVA 5G5HA 2KTRB 1WGDA 1FXIA 1UF0A 2JRIB 1VDVA 2EMTA 2BB6A 4US9A 2G4DB 1N5XA 1MFWA 1WGYA 1FRRA 4W9GA 1QOAA 2DYBA 2LASA 1E7UA 3N20C 2L3ZA 3PPAA 2KC1A 2QJLA 3ETRA 4FADA 2G1EA 4LNOA 2HE7A 3H7PB 1D5MC 1T0RC 5IOIA 3NS1A 3KWVA 4ZRQA 4JE3B 2UYZB 2LRUA 1UWMA 1TIFA 4W9HA 2M19A 2CU3A 4A20A 4XX5A 3I57A 1WXAA 1EWYC 3GZNI 4PK1A 2R2QA 4YSZB 3N1ZC 1WR6E 4KZ0A 2WXOA 3AN1A 4NPNA 2DZIA 2BPSA 1ZKHA 1ET9A 3NJTA 3L0WB 4E71A 1JWUD 1L6VA 3DBLI 3EHVA 1GC6A 2V4IB 1SE4A 3PHXB 1JWSD 2KXJA 4A6QA 1WE7A 1R4MI 4HJKA 1RFKA 2J0JA 3ML9A 5J18A 2MH7A 1EU3A 2RR9A 3R3MA 1FO4A 4HWIB 2ZVOA 4IWQA 4EEWA 2KMMA 2XNAC 3P4PB 5D7GA 3B9JA 1R7SA 1H4RA 4MSQB 3A1QA 2WU2B 2L05A 1K53A 3ECIA 2ZJDA 3AU5A 3TBLD 2BYTA 3L16A 3PLUA 1CMXB 2KD0A 3CWIA 4DWFA 1LGRA 2SEBD 4HEA1 3N32A 2IO3B 3RCZA 3FILA 2KJ6A 1ROEA 4W9CA 4XE0A 4US8A 2ZW1A 2LRWA 5AZGA 2FCMA 2GB1A 1T3QA
chains in the Genus database with same CATH topology
4AUQC 2V3SA 4MGYE 4WJOA 2D2QA 3AI5A 2O6VA 4G50A 2K8CA 2JVCA 2M4NA 1VD2A 1WJUA 1WXVA 4K81A 3ZDTA 3QCAA 1NI2A 4JLCA 4RMAA 1WH3A 2LVPA 5DCNA 3RYTA 2BGFA 3UGBB 2Z59B 2ZNVB 4OVUA 4J6IA 3HK0A 1T0YA 4AJYB 2MW5A 2NBUA 1GG3A 2D11A 3ZNZB 3ZTCA 3VH4B 5CX3A 3H6NA 1L2NA 2O6VB 2DHZA 5LLIA 1YJ1A 5D6JB 4IG7B 2KMCA 2ZPNA 2W9NA 3K9PB 2KN5A 4M8NA 3HIZA 2KQ7A 4KDLB 2AL6A 3ZVVA 3BY4B 1VCBA 1H8CA 4HXDA 3OJ3A 4EZJA 1KLVA 4CHKA 2KFJA 1S3SG 1WRDB 1OQYA 2ZNVC 5EDSA 3DBRI 3ZNID 3DVNU 4IC7B 3RULA 4HCNB 5AZFA 3MHSD 4FJYA 3CMMB 2B3AA 1WX9A 3QHTA 3QJZA 2MQJA 4GDKA 2REXA 2GBMA 2KANA 4WWPA 2RPQA 2M17A 3U30A 1UD7A 4DDID 1WX7A 3UQAA 3X23A 1WM2A 3SDLC 5IAAC 3VTWA 4F7ZA 4IM0A 4WJPA 3B1LX 3ZTDA 4ZYNA 4FHKA 1PQSA 3VQIA 3PLVA 4GDKB 3RZWC 4DK5A 2K39A 4JQWC 1U4AA 3SHQA 4LCDE 5DPWA 1J8CA 4MGZE 2JXXA 3LDZE 3MJWA 3UINB 3KH0A 1E8XA 3KUDB 4EZLA 2DZKA 1C1YB 3DVGY 4PYUA 2K6DB 3W1YA 2MBQA 2C60A 3V6CB 3RZFA 2KKCA 3ZRCA 3R66C 1ZGUB 3TJPA 2WYQA 3EFUA 3W1SA 1QZEA 3TL5A 3VXWA 4LDTB 3JYUA 5E6NA 3APDA 4AWJA 4HLEA 2K8HA 1I35A 2EKEC 2Y5BB 3WANA 3KVFB 3VUYA 3AULA 1IYFA 4GSWA 4DHZB 2AYOB 4GMVA 1YQBA 1SE9A 4LJPB 1YIWA 3VFKA 4ANWA 2LGXA 3B08A 2AL3A 1R4NI 1WF9A 1FXTB 2V4LA 3QAQA 3ZNGC 1K8RB 3QARA 3PS6A 1WGGA 2UWQA 3VUWA 2KMAA 2ZPYA 3H9DA 5L95C 4K7WA 4KV2A 2WDTB 3VTUA 4BVUC 2LUEA 4G0NB 4ZRJA 2BKRB 3A4RA 4NAWA 1XD3B 2KHWB 4HCPB 3R7QA 3V62A 3W1SC 2KX0A 2LI5A 2L8JA 1GC7A 2HD5B 2N9PC 4NNJB 2FIDA 1LQBA 4E3CA 4IWPA 4URKA 2CHWA 2VRRB 3PT2B 3PTFC 2EMSA 1WX8A 4G11A 1RAXA 3KUCB 2LVQA 4FULA 2IY0B 1BT0A 2FCSA 2DYOA 2G45B 4WAAA 4NAWB 4BOSC 4ZRIA 2CR5A 4IUMB 2C9WB 3QK0A 2LD9A 4KSKC 1WJNA 4W9KA 5LXHA 2C7NB 4GGQA 3DOWA 2PE6B 4KZCA 4B6WA 4K1RB 2FAZA 3KUZA 4DHJD 4AJWA 4OVVA 3DQVA 5JHAA 3QX1A 1D3ZA 4RM9A 3QWZB 3M3JA 3PVLA 1UGMA 2R2OA 1WR1A 3A33B 3ML8A 1F9JA 3IVFA 1NDDA 1Q5WB 4PS8A 4WJNA 5GMVA 3ZW3A 2FCQA 2JPHA 1OEYJ 1E7VA 4BBNF 2C7HA 2GBKA 2KWCA 2PE9A 3A9JA 5CHWA 3WAMA 2CU1A 3ZKJC 1P0RA 2N4FA 2RD0A 3QC8B 2MA9B 1ISNA 1EUVB 3DVNV 3O65B 4PS3A 3WA0A 4FHJA 3ZDMC 2KC2A 4MDKE 2KK8A 2ZZPB 1M94A 2D10A 2MLBA 4TQ1A 2ZCBA 3A4SC 4M0WB 2HTHA 1RFAA 2CHZA 3WAOA 5D2MB 4ANUA 5D94A 2MP2A 5CHVC 3V60A 3APFA 3A9JB 4NJ6A 3U8ZA 1TGZB 3IHPC 2KX3A 3I3TB 5KHOA 3L10B 2Z0DB 4GIVA 1WGRA 1E8YA 2I1KA 4KIKA 5AZHA 2J0MA 1TTNA 4K7UA 4ANXA 4HDQA 5CTRC 2ZVNA 3IFWB 3P2BA 4I6NB 2DAFA 3UQBA 3N3KB 3RT3B 4II2B 4BKTA 3NS8A 3D32A 1I42A 3APCA 4ZDVA 1Z2MA 2L00B 3ENEA 3VVWB 4A3PA 2MBHA 3JSVA 2NBVB 2DX5B 1WJ6A 2PPHA 4KIKB 1P1AA 2KO3A 2RSUA 2KWVB 4MJSA 4BOZB 3H7SA 4AOFA 4MH0E 1WE6A 3AXCA 2KDIA 2KNBA 5L83A 1LM8B 2WX1A 3M95A 2FIFA 1Y8RC 1WIAA 3PREA 4I6LB 4NQKE 3VDZA 2N7EA 1WY8A 2FUHB 3JSVB 3OJ4B 3T8MA 2XK5A 5LXIB 2KFKA 2KQSA 1WJ4A 2KDEB 2PEAA 4MJSB 3L13A 1MG8A 2ASQA 2KVRA 4KDIC 3DCGA 1UZXB 2NR2A 1V9JA 1Q0WB 4IM3A 2M0XA 4PYZA 3L08A 1JRUA 2ZEQA 2YLMA 2OOBB 4GB9A 2CS4A 1L7YA 3V6EB 2IZVB 3OLMD 1V49A 3UF8A 3ZUNA 4FBJB 2PJHA 2JZZA 2XK5B 3H1UA 3NOBA 2AEHA 2KFKB 2JWZA 1UELA 2N9EB 4A3OA 5KHQA 2KOXA 4HVBA 4B95A 2DAJA 3AU4A 4M8MA 2XBBC 4KVGB 1RRBA 2KJRA 5IA7A 4FA6A 5FR6A 2CHXA 2N1VA 2LGDA 1TBEA 5G2NA 4BKGA 2K1FA 2FNJB 3Q3JA 3L17A 1E90A 4ZRKA 5JH5C 2K25A 1EO6A 1UBQA 3ZO5B 3VAWA 1LFDA 1WMHA 1OEYA 3NY5A 3QA8A 4FN2A 2NBWB 4MELA 1YD8U 2IY1B 3X0WA 2L7RA 2DZJA 1KJTA 2XEWA 1P98A 2GBJA 1OTRB 4CO7A 1V86A 3HM6X 1UH6A 2YVCA 3PRZA 3UIPB 4B9KA 2O2VA 4PS7A 4HK2A 4E74A 1J19A 1WMHB 3HM3A 4ICVA 5AEKB 1TZ1A 3IG3A 1E8ZA 4TQ0A 2JF5A 2L0FA 2MX2A 3CSFA 2FCNA 3OAWA 3T9LA 1YX6B 2DZMA 2LGYA 5E6OA 4MGKE 4XZ4A 3KYCD 1IP9A 3CSTA 3Q3FA 4TUUA 1RLFA 4X57B 4FJVB 1WXMA 1WXSA 1WFYA 2LZ6A 4AP4C 2O2VB 1Q1OA 2IBIB 4LJOB 4NY0A 1SGHA 2KZRA 3C0RB 3PHWB 4GU2A 4NQLB 4G3XB 3VHTC 2M1MA 4YL8A 2L76A 2LXCA 3CF6E 2IO1B 1V6EA 2A5UA 3EC8A 3PSEB 2BYEA 3M63B 3ZLZA 2GBNA 4F8CB 5DPSA 2V1YA 2WWZA 3HHMA 4MM3A 1C3TA 1KM7A 3EECA 1J0GA 4DBGA 1V81A 2G3QB 4KSLC 4DDGD 1S1QB 1WZ3A 4MGIE 2KTFA 5JHBA 2BF8B 2GOWA 5HKHA 3A9KA 3WAPA 3R7RA 3MTNB 2HJ8A 1EF1A 3TIXA 4CYEA 2KTRA 3NZUA 3SU8X 4ANVA 2GMIC 3L54A 5JZEB 2NPTA 1V2YA 4ASWC 4MSMB 4RM8A 2BWFA 4W9IA 2JRHA 1A5RA 2NS5A 3PV1A 4K7SA 4W9JA 1X1MA 2QHOA 4JL9A 1V5OA 2KDBA 1OGWA 4W9FA 2LJ5A 3A9KB 2LVOA 2JY6A 2BYVE 2BWES 2KTRB 1WGDA 2IO2B 2BYFA 2NPTB 2D07B 2JRIB 2MP2B 3GOEA 2EMTA 4N9F4 4W9DA 3V61A 3NHEB 4DXAB 4JGHB 3WALA 4EFOA 3RD2A 1E8WA 4BKSD 2G4DB 3PRMB 5DPRA 4GXBA 2NCNA 3PGEA 4WWOA 5J17A 3VTVA 3N30A 2MBBB 3H7PA 1WGYA 4HDOA 4DHZE 1P9DU 4W9GA 2DYBA 2KDFB 3QIJA 3KYDD 4I6PA 2MBOA 2LASA 2LXAA 4II3B 5G55A 2MCNB 1V5TA 2KJHB 2Z0EB 1E7UA 2N7DA 2L3ZA 4MEMA 3PPAA 2KC1A 2O6VD 3DDCB 3WIMA 2KWUB 4FADA 1P3QU 5CHFA 2HE7A 3DBSA 4EUTA 2RGFA 3H7PB 4EZKA 1UBIA 5J2RA 4HPLB 4IWOA 1HE8A 1G6JA 2I1JA 2UYZB 5BO4B 2LRUA 2MBEA 2GBRA 5TR5A 4W9HA 1WYWB 3VUXA 4A20A 1NBFC 4HPMB 4XX5A 1WI0A 1WXAA 2IYDB 3GZNI 1GNUA 2ZCCA 3DBHI 2G4SA 3S2AA 2R2QA 1GUAB 3K9OB 1WR6E 4KZ0A 4NPNA 3NZSA 2DZIA 2BPSA 4TKNA 2N9XA 2MWSB 3KW5B 1ZKHA 2D3GA 3L0WB 4E71A 3SD5A 4W9EA 3DBLI 3EHVA 1GC6A 4BBNC 1KOTA 3PHXB 4WQOB 4FJZA 3ZNHB 2KXJA 1V80A 2DYMA 1WE7A 1R4MI 2AWTA 3JVZX 1WM3A 3PZDA 4WWNA 2JUOA 2J0JA 3BINA 4HJKA 5DPTA 4ICUA 3IBEA 3VH3B 1XQQA 3ML9A 1XT9B 3M62B 5J18A 2K6QA 2MSED 4BFRA 1WZ0A 2C7MB 3TMPB 2RR9A 3R3MA 4IM2A 4F1SA 2A4ZA 4HWIB 3DPDA 4GDLA 3TCAA 2IO0B 3RUIB 2CKHB 2ZVOA 4IWQA 3UIOB 4EEWA 3LJ3A 4GOCA 4DHJB 2OJRA 1E5WA 1ZW7A 4LDTD 2K8BA 4TV3A 3ALBA 5D7GA 2C5LC 1GJZA 2N1WA 4P7IA 4WJQA 1H4RA 1LXDA 2M8SA 4MSQB 5E6PA 3A1QA 3ZRFA 1SIFA 2KLCA 3PRPB 1YX5B 2L05A 2MRPA 4GDLB 2NVUI 3ECIA 2KLGA 1Z5SB 3B0AA 2JT4B 2ZJDA 3AU5A 3QQ8B 3TBLD 4EOYA 3L16A 1AARA 3PLUA 1CMXB 2KD0A 4EKUA 4DWFA 2DENB 3DVGX 4XC2A 3N32A 4FLHA 1IPGA 2IO3B 2JZ3B 3A1QB 4JIOU 2J0KA 4IW0A 5C23A 3RCZA 4BKSA 1EF5A 2WX0A 3JW0X 3U7DA 2KJ6A 4W9CA 4NJ7A 1WGHA 3ZIMA 4GN1A 5C1ZA 2LRWA 3ONSA 5AZGA 2FCMA 2BKFA 2L0TA 2J7QB 2LWPA 4W9LA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4AUQ C;  2V3S A;  4MGY E;  4WJO A;  2D2Q A;  3AI5 A;  2O6V A;  4G50 A;  2K8C A;  2JVC A;  2M4N A;  1VD2 A;  1WJU A;  1WXV A;  4K81 A;  3ZDT A;  3QCA A;  1NI2 A;  4JLC A;  4RMA A;  1WH3 A;  2LVP A;  5DCN A;  3RYT A;  2BGF A;  3UGB B;  2Z59 B;  2ZNV B;  4OVU A;  4J6I A;  3HK0 A;  1T0Y A;  4AJY B;  2MW5 A;  2NBU A;  1GG3 A;  2D11 A;  3ZNZ B;  3ZTC A;  3VH4 B;  5CX3 A;  3H6N A;  1L2N A;  2O6V B;  2DHZ A;  5LLI A;  1YJ1 A;  5D6J B;  4IG7 B;  2KMC A;  2ZPN A;  2W9N A;  3K9P B;  2KN5 A;  4M8N A;  3HIZ A;  2KQ7 A;  4KDL B;  2AL6 A;  3ZVV A;  3BY4 B;  1VCB A;  1H8C A;  4HXD A;  3OJ3 A;  4EZJ A;  1KLV A;  4CHK A;  2KFJ A;  1S3S G;  1WRD B;  1OQY A;  2ZNV C;  5EDS A;  3DBR I;  3ZNI D;  3DVN U;  4IC7 B;  3RUL A;  4HCN B;  5AZF A;  3MHS D;  4FJY A;  3CMM B;  2B3A A;  1WX9 A;  3QHT A;  3QJZ A;  2MQJ A;  4GDK A;  2REX A;  2GBM A;  2KAN A;  4WWP A;  2RPQ A;  2M17 A;  3U30 A;  1UD7 A;  4DDI D;  1WX7 A;  3UQA A;  3X23 A;  1WM2 A;  3SDL C;  5IAA C;  3VTW A;  4F7Z A;  4IM0 A;  4WJP A;  3B1L X;  3ZTD A;  4ZYN A;  4FHK A;  1PQS A;  3VQI A;  3PLV A;  4GDK B;  3RZW C;  4DK5 A;  2K39 A;  4JQW C;  1U4A A;  3SHQ A;  4LCD E;  5DPW A;  1J8C A;  4MGZ E;  2JXX A;  3LDZ E;  3MJW A;  3UIN B;  3KH0 A;  1E8X A;  3KUD B;  4EZL A;  2DZK A;  1C1Y B;  3DVG Y;  4PYU A;  2K6D B;  3W1Y A;  2MBQ A;  2C60 A;  3V6C B;  3RZF A;  2KKC A;  3ZRC A;  3R66 C;  1ZGU B;  3TJP A;  2WYQ A;  3EFU A;  3W1S A;  1QZE A;  3TL5 A;  3VXW A;  4LDT B;  3JYU A;  5E6N A;  3APD A;  4AWJ A;  4HLE A;  2K8H A;  1I35 A;  2EKE C;  2Y5B B;  3WAN A;  3KVF B;  3VUY A;  3AUL A;  1IYF A;  4GSW A;  4DHZ B;  2AYO B;  4GMV A;  1YQB A;  1SE9 A;  4LJP B;  1YIW A;  3VFK A;  4ANW A;  2LGX A;  3B08 A;  2AL3 A;  1R4N I;  1WF9 A;  1FXT B;  2V4L A;  3QAQ A;  3ZNG C;  1K8R B;  3QAR A;  3PS6 A;  1WGG A;  2UWQ A;  3VUW A;  2KMA A;  2ZPY A;  3H9D A;  5L95 C;  4K7W A;  4KV2 A;  2WDT B;  3VTU A;  4BVU C;  2LUE A;  4G0N B;  4ZRJ A;  2BKR B;  3A4R A;  4NAW A;  1XD3 B;  2KHW B;  4HCP B;  3R7Q A;  3V62 A;  3W1S C;  2KX0 A;  2LI5 A;  2L8J A;  1GC7 A;  2HD5 B;  2N9P C;  4NNJ B;  2FID A;  1LQB A;  4E3C A;  4IWP A;  4URK A;  2CHW A;  2VRR B;  3PT2 B;  3PTF C;  2EMS A;  1WX8 A;  4G11 A;  1RAX A;  3KUC B;  2LVQ A;  4FUL A;  2IY0 B;  1BT0 A;  2FCS A;  2DYO A;  2G45 B;  4WAA A;  4NAW B;  4BOS C;  4ZRI A;  2CR5 A;  4IUM B;  2C9W B;  3QK0 A;  2LD9 A;  4KSK C;  1WJN A;  4W9K A;  5LXH A;  2C7N B;  4GGQ A;  3DOW A;  2PE6 B;  4KZC A;  4B6W A;  4K1R B;  2FAZ A;  3KUZ A;  4DHJ D;  4AJW A;  4OVV A;  3DQV A;  5JHA A;  3QX1 A;  1D3Z A;  4RM9 A;  3QWZ B;  3M3J A;  3PVL A;  1UGM A;  2R2O A;  1WR1 A;  3A33 B;  3ML8 A;  1F9J A;  3IVF A;  1NDD A;  1Q5W B;  4PS8 A;  4WJN A;  5GMV A;  3ZW3 A;  2FCQ A;  2JPH A;  1OEY J;  1E7V A;  4BBN F;  2C7H A;  2GBK A;  2KWC A;  2PE9 A;  3A9J A;  5CHW A;  3WAM A;  2CU1 A;  3ZKJ C;  1P0R A;  2N4F A;  2RD0 A;  3QC8 B;  2MA9 B;  1ISN A;  1EUV B;  3DVN V;  3O65 B;  4PS3 A;  3WA0 A;  4FHJ A;  3ZDM C;  2KC2 A;  4MDK E;  2KK8 A;  2ZZP B;  1M94 A;  2D10 A;  2MLB A;  4TQ1 A;  2ZCB A;  3A4S C;  4M0W B;  2HTH A;  1RFA A;  2CHZ A;  3WAO A;  5D2M B;  4ANU A;  5D94 A;  2MP2 A;  5CHV C;  3V60 A;  3APF A;  3A9J B;  4NJ6 A;  3U8Z A;  1TGZ B;  3IHP C;  2KX3 A;  3I3T B;  5KHO A;  3L10 B;  2Z0D B;  4GIV A;  1WGR A;  1E8Y A;  2I1K A;  4KIK A;  5AZH A;  2J0M A;  1TTN A;  4K7U A;  4ANX A;  4HDQ A;  5CTR C;  2ZVN A;  3IFW B;  3P2B A;  4I6N B;  2DAF A;  3UQB A;  3N3K B;  3RT3 B;  4II2 B;  4BKT A;  3NS8 A;  3D32 A;  1I42 A;  3APC A;  4ZDV A;  1Z2M A;  2L00 B;  3ENE A;  3VVW B;  4A3P A;  2MBH A;  3JSV A;  2NBV B;  2DX5 B;  1WJ6 A;  2PPH A;  4KIK B;  1P1A A;  2KO3 A;  2RSU A;  2KWV B;  4MJS A;  4BOZ B;  3H7S A;  4AOF A;  4MH0 E;  1WE6 A;  3AXC A;  2KDI A;  2KNB A;  5L83 A;  1LM8 B;  2WX1 A;  3M95 A;  2FIF A;  1Y8R C;  1WIA A;  3PRE A;  4I6L B;  4NQK E;  3VDZ A;  2N7E A;  1WY8 A;  2FUH B;  3JSV B;  3OJ4 B;  3T8M A;  2XK5 A;  5LXI B;  2KFK A;  2KQS A;  1WJ4 A;  2KDE B;  2PEA A;  4MJS B;  3L13 A;  1MG8 A;  2ASQ A;  2KVR A;  4KDI C;  3DCG A;  1UZX B;  2NR2 A;  1V9J A;  1Q0W B;  4IM3 A;  2M0X A;  4PYZ A;  3L08 A;  1JRU A;  2ZEQ A;  2YLM A;  2OOB B;  4GB9 A;  2CS4 A;  1L7Y A;  3V6E B;  2IZV B;  3OLM D;  1V49 A;  3UF8 A;  3ZUN A;  4FBJ B;  2PJH A;  2JZZ A;  2XK5 B;  3H1U A;  3NOB A;  2AEH A;  2KFK B;  2JWZ A;  1UEL A;  2N9E B;  4A3O A;  5KHQ A;  2KOX A;  4HVB A;  4B95 A;  2DAJ A;  3AU4 A;  4M8M A;  2XBB C;  4KVG B;  1RRB A;  2KJR A;  5IA7 A;  4FA6 A;  5FR6 A;  2CHX A;  2N1V A;  2LGD A;  1TBE A;  5G2N A;  4BKG A;  2K1F A;  2FNJ B;  3Q3J A;  3L17 A;  1E90 A;  4ZRK A;  5JH5 C;  2K25 A;  1EO6 A;  1UBQ A;  3ZO5 B;  3VAW A;  1LFD A;  1WMH A;  1OEY A;  3NY5 A;  3QA8 A;  4FN2 A;  2NBW B;  4MEL A;  1YD8 U;  2IY1 B;  3X0W A;  2L7R A;  2DZJ A;  1KJT A;  2XEW A;  1P98 A;  2GBJ A;  1OTR B;  4CO7 A;  1V86 A;  3HM6 X;  1UH6 A;  2YVC A;  3PRZ A;  3UIP B;  4B9K A;  2O2V A;  4PS7 A;  4HK2 A;  4E74 A;  1J19 A;  1WMH B;  3HM3 A;  4ICV A;  5AEK B;  1TZ1 A;  3IG3 A;  1E8Z A;  4TQ0 A;  2JF5 A;  2L0F A;  2MX2 A;  3CSF A;  2FCN A;  3OAW A;  3T9L A;  1YX6 B;  2DZM A;  2LGY A;  5E6O A;  4MGK E;  4XZ4 A;  3KYC D;  1IP9 A;  3CST A;  3Q3F A;  4TUU A;  1RLF A;  4X57 B;  4FJV B;  1WXM A;  1WXS A;  1WFY A;  2LZ6 A;  4AP4 C;  2O2V B;  1Q1O A;  2IBI B;  4LJO B;  4NY0 A;  1SGH A;  2KZR A;  3C0R B;  3PHW B;  4GU2 A;  4NQL B;  4G3X B;  3VHT C;  2M1M A;  4YL8 A;  2L76 A;  2LXC A;  3CF6 E;  2IO1 B;  1V6E A;  2A5U A;  3EC8 A;  3PSE B;  2BYE A;  3M63 B;  3ZLZ A;  2GBN A;  4F8C B;  5DPS A;  2V1Y A;  2WWZ A;  3HHM A;  4MM3 A;  1C3T A;  1KM7 A;  3EEC A;  1J0G A;  4DBG A;  1V81 A;  2G3Q B;  4KSL C;  4DDG D;  1S1Q B;  1WZ3 A;  4MGI E;  2KTF A;  5JHB A;  2BF8 B;  2GOW A;  5HKH A;  3A9K A;  3WAP A;  3R7R A;  3MTN B;  2HJ8 A;  1EF1 A;  3TIX A;  4CYE A;  2KTR A;  3NZU A;  3SU8 X;  4ANV A;  2GMI C;  3L54 A;  5JZE B;  2NPT A;  1V2Y A;  4ASW C;  4MSM B;  4RM8 A;  2BWF A;  4W9I A;  2JRH A;  1A5R A;  2NS5 A;  3PV1 A;  4K7S A;  4W9J A;  1X1M A;  2QHO A;  4JL9 A;  1V5O A;  2KDB A;  1OGW A;  4W9F A;  2LJ5 A;  3A9K B;  2LVO A;  2JY6 A;  2BYV E;  2BWE S;  2KTR B;  1WGD A;  2IO2 B;  2BYF A;  2NPT B;  2D07 B;  2JRI B;  2MP2 B;  3GOE A;  2EMT A;  4N9F 4;  4W9D A;  3V61 A;  3NHE B;  4DXA B;  4JGH B;  3WAL A;  4EFO A;  3RD2 A;  1E8W A;  4BKS D;  2G4D B;  3PRM B;  5DPR A;  4GXB A;  2NCN A;  3PGE A;  4WWO A;  5J17 A;  3VTV A;  3N30 A;  2MBB B;  3H7P A;  1WGY A;  4HDO A;  4DHZ E;  1P9D U;  4W9G A;  2DYB A;  2KDF B;  3QIJ A;  3KYD D;  4I6P A;  2MBO A;  2LAS A;  2LXA A;  4II3 B;  5G55 A;  2MCN B;  1V5T A;  2KJH B;  2Z0E B;  1E7U A;  2N7D A;  2L3Z A;  4MEM A;  3PPA A;  2KC1 A;  2O6V D;  3DDC B;  3WIM A;  2KWU B;  4FAD A;  1P3Q U;  5CHF A;  2HE7 A;  3DBS A;  4EUT A;  2RGF A;  3H7P B;  4EZK A;  1UBI A;  5J2R A;  4HPL B;  4IWO A;  1HE8 A;  1G6J A;  2I1J A;  2UYZ B;  5BO4 B;  2LRU A;  2MBE A;  2GBR A;  5TR5 A;  4W9H A;  1WYW B;  3VUX A;  4A20 A;  1NBF C;  4HPM B;  4XX5 A;  1WI0 A;  1WXA A;  2IYD B;  3GZN I;  1GNU A;  2ZCC A;  3DBH I;  2G4S A;  3S2A A;  2R2Q A;  1GUA B;  3K9O B;  1WR6 E;  4KZ0 A;  4NPN A;  3NZS A;  2DZI A;  2BPS A;  4TKN A;  2N9X A;  2MWS B;  3KW5 B;  1ZKH A;  2D3G A;  3L0W B;  4E71 A;  3SD5 A;  4W9E A;  3DBL I;  3EHV A;  1GC6 A;  4BBN C;  1KOT A;  3PHX B;  4WQO B;  4FJZ A;  3ZNH B;  2KXJ A;  1V80 A;  2DYM A;  1WE7 A;  1R4M I;  2AWT A;  3JVZ X;  1WM3 A;  3PZD A;  4WWN A;  2JUO A;  2J0J A;  3BIN A;  4HJK A;  5DPT A;  4ICU A;  3IBE A;  3VH3 B;  1XQQ A;  3ML9 A;  1XT9 B;  3M62 B;  5J18 A;  2K6Q A;  2MSE D;  4BFR A;  1WZ0 A;  2C7M B;  3TMP B;  2RR9 A;  3R3M A;  4IM2 A;  4F1S A;  2A4Z A;  4HWI B;  3DPD A;  4GDL A;  3TCA A;  2IO0 B;  3RUI B;  2CKH B;  2ZVO A;  4IWQ A;  3UIO B;  4EEW A;  3LJ3 A;  4GOC A;  4DHJ B;  2OJR A;  1E5W A;  1ZW7 A;  4LDT D;  2K8B A;  4TV3 A;  3ALB A;  5D7G A;  2C5L C;  1GJZ A;  2N1W A;  4P7I A;  4WJQ A;  1H4R A;  1LXD A;  2M8S A;  4MSQ B;  5E6P A;  3A1Q A;  3ZRF A;  1SIF A;  2KLC A;  3PRP B;  1YX5 B;  2L05 A;  2MRP A;  4GDL B;  2NVU I;  3ECI A;  2KLG A;  1Z5S B;  3B0A A;  2JT4 B;  2ZJD A;  3AU5 A;  3QQ8 B;  3TBL D;  4EOY A;  3L16 A;  1AAR A;  3PLU A;  1CMX B;  2KD0 A;  4EKU A;  4DWF A;  2DEN B;  3DVG X;  4XC2 A;  3N32 A;  4FLH A;  1IPG A;  2IO3 B;  2JZ3 B;  3A1Q B;  4JIO U;  2J0K A;  4IW0 A;  5C23 A;  3RCZ A;  4BKS A;  1EF5 A;  2WX0 A;  3JW0 X;  3U7D A;  2KJ6 A;  4W9C A;  4NJ7 A;  1WGH A;  3ZIM A;  4GN1 A;  5C1Z A;  2LRW A;  3ONS A;  5AZG A;  2FCM A;  2BKF A;  2L0T A;  2J7Q B;  2LWP A;  4W9L A; 
#chains in the Genus database with same CATH topology
 4AUQ C;  1EM7 A;  4REZ A;  4G50 A;  3ZDT A;  1NI2 A;  4JLC A;  1FRD A;  2LVP A;  1SJH D;  2BGF A;  3UGB B;  4J6I A;  2L1A A;  2MW5 A;  2NBU A;  3MFG A;  3Q3N C;  1V97 A;  3GS2 A;  2PIA A;  1CZP A;  3ZTC A;  3BWU D;  5EE0 A;  4C00 A;  2ON8 A;  4ITK A;  3Q6B A;  2KMC A;  1MI0 A;  4C4V B;  1UUP A;  2KQ7 A;  1VCB A;  1H8C A;  4HXD A;  3BVZ A;  3BVM A;  3MC9 A;  5GXG B;  4CHK A;  1HTO A;  5EDS A;  3ZNI D;  3PZ7 A;  4YT0 B;  4HCN B;  1YMH E;  3CMM B;  2UU7 A;  3QHT A;  2IND C;  2KAN A;  4XDD A;  1QOB A;  1SEB D;  1B1Z A;  1WX7 A;  1WM2 A;  3VTW A;  5BYR A;  2Y5P A;  4IM0 A;  3ZTD A;  3RNG C;  4XWW A;  4GDK B;  2FBW B;  1U4A A;  2PKO A;  3UIN B;  3KH0 A;  2WXQ A;  1E8X A;  3V6C B;  2J42 A;  1J7C A;  1ZGU B;  1JML A;  3R66 C;  3TJP A;  1ET6 A;  2W3S A;  3AE3 B;  3APD A;  4HLE A;  1N63 A;  2HJ1 A;  2Y5B B;  3WAN A;  1D5Z C;  4WUR A;  3AUL A;  3BII D;  4A55 A;  4GMV A;  1SE9 A;  1FFU A;  1VJK A;  2LGX A;  1WF9 A;  2V4L A;  3AMZ A;  1WGG A;  1ZOY B;  2ZPY A;  1XEE A;  4K7W A;  4KV2 A;  3VTU A;  2LUE A;  4G0N B;  3DHH C;  4NAW A;  3A4R A;  2N7J A;  4AQ7 A;  2KHW B;  3W1S C;  2KX0 A;  2LI5 A;  2L8J A;  4E3C A;  4NNJ B;  2FID A;  3PT2 B;  3U2S C;  2WDV B;  4G11 A;  2LVQ A;  2IY0 B;  2FCS A;  4WAA A;  2CR5 A;  3QK0 A;  1WJN A;  4B6W A;  4K1R B;  4ACF A;  1SBB B;  1SXT A;  1D3Z A;  2WXP A;  3M3J A;  3PVL A;  1WR1 A;  1F9J A;  3IVF A;  4WJN A;  3SEB A;  2FCQ A;  2C7H A;  3A9J A;  2KWC A;  4NZL B;  2RD0 A;  3DVN V;  4L23 A;  3WA0 A;  3TEY A;  4MDK E;  2ZZP B;  4C7Y A;  1C79 A;  4M0W B;  2HTH A;  1RFA A;  3V60 A;  3HUI A;  5D3D A;  3ZGZ A;  3PO0 A;  5KHO A;  1E8Y A;  1TTN A;  4ANX A;  4HDQ A;  2ZVN A;  2NMQ A;  4I6N B;  2DAF A;  3UQB A;  1VZ7 A;  4BKT A;  3AE8 B;  3D32 A;  1I42 A;  1SE2 A;  4ZDV A;  1Z2M A;  4A3P A;  2NTT A;  4YSX B;  2NBV B;  1WJ6 A;  3AE1 B;  2KO3 A;  2RSU A;  2OHF A;  1C9F A;  4MH0 E;  1ESF A;  3GP7 A;  2KNB A;  5L83 A;  4OZB A;  1Y8R C;  3BVG A;  4H2A A;  3TEW A;  1HZ6 A;  3VDZ A;  1WJ4 A;  4MJS B;  1C4C A;  4LLG M;  4PYZ A;  1JRU A;  4GB9 A;  3ZUN A;  1F77 A;  2PJH A;  2JZZ A;  2LGS A;  3DBR B;  2AEH A;  4OHJ A;  2JWZ A;  2N9L A;  1RRB A;  4FA6 A;  2BT6 A;  2TSS A;  2K1F A;  2K5P A;  4A9A A;  3Q3J A;  3HVZ A;  1LO5 D;  1UBQ A;  2W54 A;  3ZJT A;  1XLO A;  3QA8 A;  3H8H A;  4ZHP A;  2NBW B;  4KKJ A;  2B76 B;  2DZJ A;  1KJT A;  1FCL A;  3IAM 1;  1N62 A;  4CO7 A;  4KKI A;  4RGN A;  3HM6 X;  1VR9 A;  2LHD A;  4B9K A;  1IUE A;  2LFI A;  3HM3 A;  4HJG E;  1V1O A;  5FK9 C;  3ZQ4 A;  2MX2 A;  3Q8C A;  3V05 A;  3RMK C;  1QOG A;  1IP9 A;  3Q3F A;  4TUU A;  1RLF A;  4X57 B;  3TUO A;  4FJV B;  1WXM A;  1WXS A;  1SIJ A;  1GAQ B;  2O2V B;  3IT6 B;  4M01 A;  4AP4 C;  4NY0 A;  1SGH A;  3C0R B;  3PHW B;  4NQL B;  3U4E G;  1N5W A;  2M1M A;  3AED B;  1HTQ A;  1V6E A;  3EC8 A;  1V8C A;  2IDY A;  2PVO D;  1FPY A;  2V1Y A;  3NVW A;  4DBG A;  2AQ3 B;  4DDG D;  1S1Q B;  4MGI E;  4RNA A;  2BF8 B;  3A9K A;  3WAP A;  3TIX A;  4CYE A;  2NPT A;  3DHI C;  4MSM B;  2BWF A;  1A5R A;  3PV1 A;  4W9J A;  3NUH B;  2QHO A;  2E6X A;  4HKZ E;  3EA6 A;  1V5O A;  2JY6 A;  3AV8 A;  5EE3 A;  1NEK B;  1HQR D;  2IO2 B;  3GOE A;  4N9F 4;  3NHE B;  3WAL A;  4HRS A;  4EFO A;  1E8W A;  1CK1 A;  2LUM A;  2JZP A;  5J17 A;  2MBB B;  2HTM E;  4DHZ E;  4ARI A;  2KAJ A;  4II3 B;  5G55 A;  2KJH B;  4LNF A;  1KLG D;  2O6V D;  4LTU A;  3WIM A;  3FAH A;  3DBS A;  2RGF A;  1UBI A;  5J2R A;  3FC4 A;  4IWO A;  4HKQ A;  2I1J A;  3P63 A;  5BO4 B;  1PGB A;  2MBE A;  1WYW B;  4S0R A;  4KGT A;  4N6E B;  3B2F A;  4HPM B;  2ZCC A;  5BYQ A;  3S2A A;  3L4P A;  2WXG A;  4K3B A;  4ARC A;  2MWS B;  2PMV A;  2D3G A;  4BBN C;  1KOT A;  4FJZ A;  4M02 A;  1QIL A;  3PZD A;  4WWN A;  2JWU A;  2BB5 A;  2PVG C;  4OVZ A;  4BFR A;  1I4G A;  4IM2 A;  1WWT A;  2N0S B;  3TCA A;  4GDL A;  3HRD D;  3LJ3 A;  4GOC A;  4LDT D;  2IGD A;  2C5L C;  2N1W A;  4P7I A;  2RDB C;  4WJQ A;  1MVK A;  2M8S A;  5E6P A;  3GB1 A;  2NVU I;  3DWG C;  2JT4 B;  1TKY A;  3DHG C;  1YQ4 B;  4XC2 A;  4FLH A;  1E7P B;  1JWA D;  5C23 A;  2J0K A;  3AE4 B;  3C8Y A;  1EU4 A;  3KQ4 A;  4BKS A;  1TS2 A;  3U7D A;  4NJ7 A;  1PFD A;  1IBX B;  4GN1 A;  4JPS A;  5MPO A;  3ONS A;  3PZ8 A;  4W9L A;  1FNV A;  1HA5 A;  4MGY E;  4WJO A;  2D2Q A;  2RDH A;  2K8C A;  2JVC A;  2M4N A;  1WXV A;  1VLB A;  4K81 A;  4RMA A;  2BW2 A;  1WRI A;  5DCN A;  2Q5W D;  1XLN A;  3H6N A;  1L2N A;  2W3R A;  2O6V B;  1YJ1 A;  1TJE A;  4IKG A;  2ZPN A;  2W9N A;  4M8N A;  4JWS C;  2MJD A;  3ZVV A;  3BY4 B;  2ZW0 A;  2WXN A;  5FR3 A;  2WQY B;  1S3S G;  1OQY A;  4IC7 B;  3RUL A;  2H88 B;  3MHS D;  4FXC A;  4FJY A;  1WX9 A;  2GI9 A;  2WDR B;  2WXH A;  4ZRP A;  3GE3 C;  4P6V F;  2RPQ A;  2M17 A;  3UQA A;  3SDL C;  4WJP A;  2D3C A;  4RH6 A;  1L6U A;  4ZYN A;  4FHK A;  1F0Z A;  1PQS A;  4NJC A;  3PLV A;  4DK5 A;  2K39 A;  4JQW C;  3SHQ A;  5DPW A;  1J8C A;  3MJW A;  1ACC A;  4EZL A;  4B0M A;  2DZK A;  1F2R I;  4PYU A;  2BS2 B;  2MBQ A;  2ONQ A;  3RZF A;  1F52 A;  1FEH A;  2KKC A;  2K3U A;  3Q8F A;  5FKA C;  4LDT B;  3JYU A;  2J4X A;  5E6N A;  2EKE C;  3W9C B;  1T0Q C;  3KVF B;  3VUY A;  4P1B C;  4GSW A;  1FM0 D;  4DHZ B;  5C3J B;  3W2D A;  1YQB A;  2EEL A;  1L0V B;  1MHH E;  3QAQ A;  2AL3 A;  1R4N I;  1K50 A;  2L52 A;  1ZE3 D;  4S17 A;  1TY2 A;  3PS6 A;  2UWQ A;  3VUW A;  3GZN B;  4P16 A;  3WCQ A;  2WDT B;  4BVU C;  3AE5 B;  2BS4 B;  3ZYY X;  3R7Q A;  3I5J C;  1V1P B;  4OZC A;  1GC7 A;  1TYG B;  2IGH A;  2N9P C;  3DBL B;  2CHW A;  1R4M B;  1WX8 A;  2AX5 A;  4C7Z A;  1RAX A;  1XCT L;  1BT0 A;  3RNC C;  4BOS C;  4ZRI A;  2C9W B;  2LD9 A;  3ZXR A;  5LXH A;  1E10 A;  3DOW A;  2PE6 B;  4DHJ D;  3E9S A;  2BVC A;  1JWB D;  1JCK B;  1STE A;  5GMV A;  4PS8 A;  3ML8 A;  3IAS 1;  4YSY B;  1OEY J;  1E7V A;  3ZKJ C;  1KF6 B;  2MA9 B;  1ISN A;  4R3D A;  3O65 B;  1UNS A;  3ZDM C;  2KC2 A;  3AB5 A;  3GE8 C;  3CIR B;  2Y3A A;  3Q8B A;  2ZCB A;  2JQR B;  2L32 A;  3A4S C;  3VR9 B;  4ANU A;  5D94 A;  1FNW A;  4NJ6 A;  3U8Z A;  1TGZ B;  3I3T B;  4EE2 A;  3NVV A;  1OQR A;  4KIK A;  2I1K A;  5AZH A;  2J0M A;  4K7U A;  2WP9 B;  3IFW B;  4WAF A;  3Q8A A;  2N9K A;  3RT3 B;  4ZHO A;  4OZA A;  4O1N A;  1DYQ A;  3APC A;  2L00 B;  3ENE A;  3E56 A;  2MBH A;  4L1B A;  5EE9 A;  1QKZ A;  1A70 A;  2DX5 B;  1P1A A;  1AN8 A;  1QOF A;  2KWV B;  1JRO A;  3SFE B;  1WE6 A;  1MG4 A;  4NQK E;  3JSV B;  3OJ4 B;  1T5X D;  3TEX A;  1PGX A;  2KQS A;  2KDE B;  3L13 A;  1MG8 A;  1TT5 B;  3T3N A;  1QQR A;  4D2K A;  1KLU D;  1V9J A;  1Q0W B;  1YN4 A;  4IM3 A;  2KQ4 X;  1PDX A;  3V6E B;  1V49 A;  4JX1 C;  2XK5 B;  4GLS C;  2KFK B;  4A8X C;  1UEL A;  3SFD B;  4B95 A;  2DAJ A;  2HDE A;  2XBB C;  4KVG B;  3URY A;  2KJR A;  5FR6 A;  2CHX A;  2LGD A;  2INN E;  2QCZ A;  3L17 A;  3AM9 A;  5C2T B;  1E90 A;  1BML C;  2WS3 B;  4YWG G;  1I4P A;  3VAW A;  1LFD A;  1OEY A;  4FN2 A;  2XEW A;  2GBJ A;  1OTR B;  1V86 A;  1UH6 A;  3PRZ A;  4PS7 A;  4HK2 A;  1WMH B;  1ZXH A;  4ICV A;  2K0P A;  3IG3 A;  1E8Z A;  2JF5 A;  1XO3 A;  2NTS A;  1YX6 B;  2DZM A;  4MGK E;  2KWD A;  3CST A;  1WFY A;  2IBI B;  1WXQ A;  4GU2 A;  1AW7 A;  3R8B A;  4YL8 A;  3CF6 E;  2IO1 B;  3PSE B;  2BYE A;  2GBN A;  3HHM A;  1PGA A;  1SJE D;  1Q10 A;  3SR6 A;  2G3Q B;  2BS3 B;  2KTF A;  2GOW A;  3MTN B;  2HJ8 A;  3AEB B;  2KTR A;  3L54 A;  3AEF B;  1BUI C;  4ASW C;  4MM3 B;  2NS5 A;  4K7S A;  1JQ4 A;  4JL9 A;  2LJ5 A;  1L5P A;  2D07 B;  2MP2 B;  4W9D A;  3V61 A;  3RD2 A;  5EE1 A;  2IPK D;  1E0Z A;  1P7E A;  4QAY A;  3TSS A;  3VTV A;  3H7P A;  4HDO A;  1P9D U;  2KDF B;  3QIJ A;  4USA A;  2MBO A;  1ENF A;  2MCN B;  1V5T A;  2Z0E B;  4MEM A;  2N7D A;  4YTP B;  3MHZ A;  2KWU B;  1P3Q U;  5CHF A;  4EUT A;  2DLB A;  3RI7 C;  2WGS A;  2GBR A;  3VUX A;  3AEA B;  1NBF C;  2K22 A;  5BMI A;  4LK0 M;  4M00 A;  1GNU A;  2KVZ A;  3DBH I;  2G4S A;  5BMH A;  3K9O B;  1TS3 A;  4N58 A;  2R61 A;  3KW5 B;  4W9E A;  1T0S C;  2D3A A;  3V3X A;  2JXT A;  3P4S B;  1SSN A;  1C78 A;  2AWT A;  3JVZ X;  3VH3 B;  2JUO A;  3BIN A;  5DPT A;  4ICU A;  3IBE A;  3EFC A;  1XT9 B;  3RPF C;  1WZ0 A;  2C7M B;  4F1S A;  2A4Z A;  5HG2 A;  3DPD A;  2IO0 B;  2CKH B;  1L0Y B;  1NYR A;  3UIO B;  3EUB 2;  2OJR A;  1E5W A;  1ZW7 A;  4TV3 A;  3VR8 B;  1I7H A;  1GJZ A;  3RNB C;  1TS4 A;  1SIF A;  2KLC A;  4LNI A;  2MRP A;  3P4Q B;  3QQ8 B;  4EOY A;  1Y56 A;  4EKU A;  2DEN B;  3DVG X;  2JZ3 B;  1C76 A;  3A1Q B;  4IW0 A;  1FCC C;  2WLB A;  1EF5 A;  2G9H D;  3JW0 X;  1WGH A;  3RNF C;  2L0T A;  2BKF A;  2WXR A;  5IP4 D;  4K3C A;  2FUG 1;  3FIL B;  3QCA A;  1WH3 A;  4C4V A;  2Z59 B;  2ZNV B;  1T0Y A;  4AJY B;  3RN9 C;  2D11 A;  3ZNZ B;  3VH4 B;  5CX3 A;  3KWL A;  5D6J B;  2WXL A;  2LMC A;  3R2I A;  3K9P B;  2WXM A;  3HIZ A;  4KDL B;  2AL6 A;  3OJ3 A;  4EZJ A;  3BK1 A;  2ZNV C;  4TSS A;  2B3A A;  1YQ3 B;  4GDK A;  2GBM A;  4WWP A;  3LXF A;  1N6Z A;  4KGR A;  3W5V B;  3U30 A;  4DDI D;  4CQN A;  4F7Z A;  2WHI A;  3B1L X;  5H8Y E;  3VQI A;  2BBC A;  3RZW C;  1ZDV A;  4KGS A;  3NZ3 A;  2Z8L A;  1KH0 A;  3DVG Y;  1T6B X;  3W1Y A;  3ZRC A;  2WYQ A;  2VH1 A;  2AQ2 B;  3W1S A;  1QZE A;  3TL5 A;  3VXW A;  2WDQ B;  4AWJ A;  1I35 A;  4N59 A;  1DOI A;  3N9Y C;  4A90 A;  2JYT A;  2XN9 C;  4LNK A;  4IOI E;  4B0E A;  1D5X C;  1QLB B;  4ANW A;  3B08 A;  3ZNG C;  3Q3O C;  5HI1 A;  3AEG B;  5JXV A;  3BYY B;  1MJD A;  1C4P A;  4WIP A;  1J7A A;  1ZUD 2;  1RM6 C;  3RFZ B;  3NVZ A;  2H89 B;  2WNM A;  2HD5 B;  1LQB A;  5G5G A;  4IWP A;  2W55 A;  1FD6 A;  1GPX A;  4WWM A;  4FUL A;  4RGT A;  4NAW B;  4WH4 A;  3RNE C;  1GOZ A;  4KSK C;  4W9K A;  4XGA B;  2C7N B;  1SF0 A;  3KUZ A;  1BXT A;  2AQ1 B;  5JHA A;  5E6J A;  4YTM B;  4RM9 A;  5IKC M;  1MPE A;  4M0W A;  3A33 B;  1NDD A;  4BBN F;  5I4D A;  2CJO A;  1YNT E;  2GBK A;  2PE9 A;  3WAM A;  2CU1 A;  1IGC A;  1P0R A;  2N4F A;  4PS3 A;  3QC8 B;  1I4X A;  2KK8 A;  4TQ1 A;  1M94 A;  2MLB A;  3WAO A;  2MP2 A;  5CHV C;  3APF A;  1YJJ A;  3A9J B;  2V3N A;  1M4V A;  3P4R B;  3IHP C;  2KX3 A;  3L10 B;  1RWS A;  2Z0D B;  4OW0 A;  3LB8 C;  3P2B A;  5D3I B;  3Q14 C;  3N3K B;  4II2 B;  1FXA A;  3B2G A;  3VVW B;  2M56 B;  1L4D B;  4MJS A;  3H7S A;  3R2T A;  2EKI A;  3AXC A;  2KDI A;  1LM8 B;  2WX1 A;  2RDG A;  5AUK A;  1XXG A;  3M95 A;  2D5G A;  3PRE A;  4I6L B;  2N7E A;  1WY8 A;  3I63 C;  1DOY A;  5AUI A;  5LXI B;  3AEC B;  2PEA A;  1NVI D;  2ASQ A;  1E9M A;  2KVR A;  4KDI C;  3DCG A;  1UZX B;  2NR2 A;  4DQO C;  3U52 E;  2ZEQ A;  2OOB B;  2CS4 A;  1L7Y A;  2LHE A;  2IZV B;  3OLM D;  3UF8 A;  1L0X B;  4FBJ B;  2V9H A;  5LNK 1;  3H1U A;  3T3O A;  4A3O A;  5KHQ A;  3O13 A;  3MP9 A;  2MJE A;  3NG0 A;  2WXF A;  3I9V 1;  1FIQ A;  1QT9 A;  5G2N A;  2DBY A;  4ZRK A;  1TKE A;  2K25 A;  1EO6 A;  3AE2 B;  1JW9 D;  3NY5 A;  1YD8 U;  3X0W A;  2L7R A;  3ZJV A;  1VZ8 A;  2BQQ A;  1P98 A;  1SE3 A;  2YVC A;  2ACZ B;  4RF1 A;  2O2V A;  4E74 A;  1J19 A;  1TZ1 A;  4TQ0 A;  3OG5 A;  3MC0 B;  5E6O A;  1K51 A;  4XZ4 A;  3KYC D;  3MC8 A;  1TS5 A;  1QF6 A;  2PTL A;  2VZK D;  4LJO B;  1TZO A;  4IDI A;  2KZR A;  1F2R C;  3ABV B;  4G3X B;  3VHT C;  2KN4 A;  2L76 A;  2K9X A;  1EWC A;  1R4N B;  4C56 C;  2A5U A;  2KDM A;  1YN5 A;  5DPS A;  1NI3 A;  2WWZ A;  1C3T A;  5TSS A;  1J0G A;  1V81 A;  4KSL C;  1WZ3 A;  5JHB A;  3R7R A;  5IN7 A;  2IGG A;  1UWX A;  3NZU A;  3SU8 X;  5JZE B;  2RMM A;  2JSV X;  2JRH A;  1GB1 A;  1X1M A;  4XDC A;  2BTE A;  1B9R A;  3Q3M C;  1HZ5 A;  1OGW A;  3A9K B;  2INC C;  2BWE S;  2BYF A;  2NPT B;  1XF5 L;  3NRZ A;  4LNN A;  4ZOH C;  4DXA B;  4JGH B;  1TKG A;  4BKS D;  3PRM B;  5DPR A;  4GXB A;  4J3O D;  2NCN A;  3PGE A;  4WWO A;  4C80 A;  1YN3 A;  3N30 A;  3C19 A;  1D6E C;  3AE7 B;  3KYD D;  4I6P A;  3DWM A;  2LXA A;  3DDC B;  4XWT A;  1I4H A;  4MH8 A;  1WGK A;  2M0A A;  4EZK A;  1PUT A;  4HPL B;  1HE8 A;  1G6J A;  2WXK A;  3VRA B;  5TR5 A;  3KLS X;  1XCQ L;  1WI0 A;  2IYD B;  4P1C C;  1GUA B;  2QEJ C;  3J9C A;  3NZS A;  4MAC A;  4TKN A;  2N9X A;  3SD5 A;  4DXF A;  2WU5 B;  4WQO B;  1C4A A;  3ZNH B;  1P7F A;  1V80 A;  2DYM A;  2J52 A;  1WM3 A;  1K52 A;  1XQQ A;  3M62 B;  2K6Q A;  2MSE D;  3TMP B;  2VH2 A;  2VZK B;  2MJ3 A;  1SB3 C;  3RUI B;  2X8X X;  4DHJ B;  2PW9 A;  2V3P A;  1I4Q A;  2K8B A;  3ALB A;  4XYC A;  2GLS A;  1LXD A;  3ZRF A;  2QC8 A;  3PRP B;  4GDL B;  1YX5 B;  2KLG A;  1Z5S B;  3B0A A;  2J53 A;  1AAR A;  1AWD A;  1IBX A;  3IXS A;  3Q69 A;  3P1M A;  1IPG A;  3W5U B;  4JIO U;  3ZXV A;  2WX0 A;  2KT7 A;  2D3B A;  3ZIM A;  5C1Z A;  1ZPS A;  3IT4 B;  2J7Q B;  2JU6 X;  2LWP A;  2V3S A;  4JWU C;  3AI5 A;  2O6V A;  1VD2 A;  1WJU A;  1YJI A;  1C77 A;  4ZYS A;  2KAC A;  3RYT A;  4BAX A;  3ZJU A;  4OVU A;  5T8I A;  3HK0 A;  1I4R A;  5BMG A;  1GG3 A;  1KTK A;  1KFY B;  1XLQ A;  2DHZ A;  5LLI A;  4NAM A;  4IG7 B;  2MEK A;  2KN5 A;  4RF0 A;  3OWE B;  4HPP A;  2V0G A;  1KLV A;  2KFJ A;  1WRD B;  3DBR I;  3DVN U;  5AZF A;  3QJZ A;  2MQJ A;  2REX A;  1N61 A;  1UD7 A;  3X23 A;  5IAA C;  1WYG A;  1CQV A;  3HVD A;  4LCD E;  4MGZ E;  2JXX A;  2QSD A;  3LDZ E;  2Y5C A;  3KUD B;  1C1Y B;  1CJE A;  2K6D B;  1TY0 A;  1GB4 A;  2C60 A;  3EFU A;  1FNU A;  4Q2J A;  2OED A;  1RYJ A;  5HFY A;  2JX5 A;  2K8H A;  1IYF A;  2INP E;  4L2Y A;  1OQQ A;  1KRH A;  2X38 A;  2AYO B;  2WXJ A;  4LJP B;  1YIW A;  2GRI A;  3VFK A;  2QMT A;  2JYE A;  1FXT B;  1K8R B;  3QAR A;  3VRB B;  2IJ0 A;  1DGJ A;  1V1P A;  2KMA A;  1J7B A;  2QIE B;  3DBH B;  1FFV A;  3H9D A;  5L95 C;  3EGR A;  4ZRJ A;  2BKR B;  1XD3 B;  2PLP A;  4HCP B;  3V62 A;  1HEZ E;  3AEE B;  4MT5 A;  4HRO A;  4URK A;  1NEN B;  2VRR B;  3PTF C;  2EMS A;  4WQM A;  3KUC B;  1HXY D;  2G45 B;  2DYO A;  2QIL A;  4IUM B;  4RCO A;  1DOX A;  4TMA B;  1PYW D;  4KX6 B;  4GGQ A;  4KZC A;  2FAZ A;  4AJW A;  4OVV A;  3DQV A;  2SAK A;  1E6E B;  3QX1 A;  3QWZ B;  1YOV B;  4RFB A;  1UGM A;  2R2O A;  1AYF A;  3ZW3 A;  3Q2A C;  1Q5W B;  1VZ6 A;  2JPH A;  5CHW A;  1ZXI A;  1EUV B;  1WSP A;  4FHJ A;  1ZDX A;  2OJW A;  2D10 A;  1L4Z B;  3AE9 B;  2YEP B;  1NYQ A;  2CHZ A;  5D2M B;  3UI3 A;  3AH7 A;  3N1X C;  2FE8 A;  4YXD B;  4GIV A;  1WGR A;  1F1H A;  5CTR C;  2I38 A;  3U7Z A;  3NS8 A;  1OFF A;  2LJI A;  1UGJ A;  3BK2 A;  3JSV A;  2PPH A;  2LEK A;  4KIK B;  4BOZ B;  3TEZ A;  4AOF A;  1MHX A;  1VRA B;  1IGD A;  1D4B A;  2FIF A;  1WIA A;  2FUH B;  3T8M A;  2XK5 A;  2KFK A;  2DNF A;  3AE6 B;  2L83 A;  4PT5 A;  1FMA D;  5IO9 A;  2M0X A;  3L08 A;  2YLM A;  2QDF A;  3NOB A;  3BYT B;  2N9E B;  2KYW A;  2KOX A;  4HVB A;  3P42 A;  3AU4 A;  4M8M A;  5IA7 A;  4BZA A;  2N1V A;  1TBE A;  4BKG A;  1JWM D;  1XLP A;  2FNJ B;  5JH5 C;  1N60 A;  3ZO5 B;  2E3T A;  2W82 A;  1WMH A;  1JAL A;  4UDU C;  4MEL A;  2IY1 B;  4DXG A;  3UIP B;  2YEP F;  4RGM A;  2CJN A;  5AEK B;  3CSF A;  2L0F A;  1JRP A;  2LGI A;  2FCN A;  3OAW A;  3T9L A;  4AS1 A;  2LGY A;  3LYY A;  2I2Y A;  5HHD G;  2MHJ A;  3RNA C;  2LZ6 A;  1Q1O A;  3BZD B;  3MJ5 A;  2LXC A;  3M63 B;  3ZLZ A;  4F8C B;  4MM3 A;  4RGO S;  1KM7 A;  3EEC A;  3FKY A;  3NVY A;  5H92 C;  5HKH A;  2WXI A;  1EF1 A;  2ICI A;  4ANV A;  2GMI C;  3N1Y C;  1V2Y A;  5BYS A;  4RM8 A;  1ZP0 B;  4W9I A;  2DWQ A;  2KDB A;  4W9F A;  2LVO A;  3Q8E A;  4YTN B;  2BYV E;  2RPV A;  5G5H A;  2KTR B;  1WGD A;  1FXI A;  1UF0 A;  2JRI B;  1VDV A;  2EMT A;  2BB6 A;  4US9 A;  2G4D B;  1N5X A;  1MFW A;  1WGY A;  1FRR A;  4W9G A;  1QOA A;  2DYB A;  2LAS A;  1E7U A;  3N20 C;  2L3Z A;  3PPA A;  2KC1 A;  2QJL A;  3ETR A;  4FAD A;  2G1E A;  4LNO A;  2HE7 A;  3H7P B;  1D5M C;  1T0R C;  5IOI A;  3NS1 A;  3KWV A;  4ZRQ A;  4JE3 B;  2UYZ B;  2LRU A;  1UWM A;  1TIF A;  4W9H A;  2M19 A;  2CU3 A;  4A20 A;  4XX5 A;  3I57 A;  1WXA A;  1EWY C;  3GZN I;  4PK1 A;  2R2Q A;  4YSZ B;  3N1Z C;  1WR6 E;  4KZ0 A;  2WXO A;  3AN1 A;  4NPN A;  2DZI A;  2BPS A;  1ZKH A;  1ET9 A;  3NJT A;  3L0W B;  4E71 A;  1JWU D;  1L6V A;  3DBL I;  3EHV A;  1GC6 A;  2V4I B;  1SE4 A;  3PHX B;  1JWS D;  2KXJ A;  4A6Q A;  1WE7 A;  1R4M I;  4HJK A;  1RFK A;  2J0J A;  3ML9 A;  5J18 A;  2MH7 A;  1EU3 A;  2RR9 A;  3R3M A;  1FO4 A;  4HWI B;  2ZVO A;  4IWQ A;  4EEW A;  2KMM A;  2XNA C;  3P4P B;  5D7G A;  3B9J A;  1R7S A;  1H4R A;  4MSQ B;  3A1Q A;  2WU2 B;  2L05 A;  1K53 A;  3ECI A;  2ZJD A;  3AU5 A;  3TBL D;  2BYT A;  3L16 A;  3PLU A;  1CMX B;  2KD0 A;  3CWI A;  4DWF A;  1LGR A;  2SEB D;  4HEA 1;  3N32 A;  2IO3 B;  3RCZ A;  3FIL A;  2KJ6 A;  1ROE A;  4W9C A;  4XE0 A;  4US8 A;  2ZW1 A;  2LRW A;  5AZG A;  2FCM A;  2GB1 A;  1T3Q A; 
#chains in the Genus database with same CATH homology
 4AUQ C;  2V3S A;  4MGY E;  4WJO A;  2D2Q A;  3AI5 A;  2O6V A;  4G50 A;  2K8C A;  2JVC A;  2M4N A;  1VD2 A;  1WJU A;  1WXV A;  4K81 A;  3ZDT A;  3QCA A;  1NI2 A;  4JLC A;  4RMA A;  1WH3 A;  2LVP A;  5DCN A;  3RYT A;  2BGF A;  3UGB B;  2Z59 B;  2ZNV B;  4OVU A;  4J6I A;  3HK0 A;  1T0Y A;  4AJY B;  2MW5 A;  2NBU A;  1GG3 A;  2D11 A;  3ZNZ B;  3ZTC A;  3VH4 B;  5CX3 A;  3H6N A;  1L2N A;  2O6V B;  2DHZ A;  5LLI A;  1YJ1 A;  5D6J B;  4IG7 B;  2KMC A;  2ZPN A;  2W9N A;  3K9P B;  2KN5 A;  4M8N A;  3HIZ A;  2KQ7 A;  4KDL B;  2AL6 A;  3ZVV A;  3BY4 B;  1VCB A;  1H8C A;  4HXD A;  3OJ3 A;  4EZJ A;  1KLV A;  4CHK A;  2KFJ A;  1S3S G;  1WRD B;  1OQY A;  2ZNV C;  5EDS A;  3DBR I;  3ZNI D;  3DVN U;  4IC7 B;  3RUL A;  4HCN B;  5AZF A;  3MHS D;  4FJY A;  3CMM B;  2B3A A;  1WX9 A;  3QHT A;  3QJZ A;  2MQJ A;  4GDK A;  2REX A;  2GBM A;  2KAN A;  4WWP A;  2RPQ A;  2M17 A;  3U30 A;  1UD7 A;  4DDI D;  1WX7 A;  3UQA A;  3X23 A;  1WM2 A;  3SDL C;  5IAA C;  3VTW A;  4F7Z A;  4IM0 A;  4WJP A;  3B1L X;  3ZTD A;  4ZYN A;  4FHK A;  1PQS A;  3VQI A;  3PLV A;  4GDK B;  3RZW C;  4DK5 A;  2K39 A;  4JQW C;  1U4A A;  3SHQ A;  4LCD E;  5DPW A;  1J8C A;  4MGZ E;  2JXX A;  3LDZ E;  3MJW A;  3UIN B;  3KH0 A;  1E8X A;  3KUD B;  4EZL A;  2DZK A;  1C1Y B;  3DVG Y;  4PYU A;  2K6D B;  3W1Y A;  2MBQ A;  2C60 A;  3V6C B;  3RZF A;  2KKC A;  3ZRC A;  3R66 C;  1ZGU B;  3TJP A;  2WYQ A;  3EFU A;  3W1S A;  1QZE A;  3TL5 A;  3VXW A;  4LDT B;  3JYU A;  5E6N A;  3APD A;  4AWJ A;  4HLE A;  2K8H A;  1I35 A;  2EKE C;  2Y5B B;  3WAN A;  3KVF B;  3VUY A;  3AUL A;  1IYF A;  4GSW A;  4DHZ B;  2AYO B;  4GMV A;  1YQB A;  1SE9 A;  4LJP B;  1YIW A;  3VFK A;  4ANW A;  2LGX A;  3B08 A;  2AL3 A;  1R4N I;  1WF9 A;  1FXT B;  2V4L A;  3QAQ A;  3ZNG C;  1K8R B;  3QAR A;  3PS6 A;  1WGG A;  2UWQ A;  3VUW A;  2KMA A;  2ZPY A;  3H9D A;  5L95 C;  4K7W A;  4KV2 A;  2WDT B;  3VTU A;  4BVU C;  2LUE A;  4G0N B;  4ZRJ A;  2BKR B;  3A4R A;  4NAW A;  1XD3 B;  2KHW B;  4HCP B;  3R7Q A;  3V62 A;  3W1S C;  2KX0 A;  2LI5 A;  2L8J A;  1GC7 A;  2HD5 B;  2N9P C;  4NNJ B;  2FID A;  1LQB A;  4E3C A;  4IWP A;  4URK A;  2CHW A;  2VRR B;  3PT2 B;  3PTF C;  2EMS A;  1WX8 A;  4G11 A;  1RAX A;  3KUC B;  2LVQ A;  4FUL A;  2IY0 B;  1BT0 A;  2FCS A;  2DYO A;  2G45 B;  4WAA A;  4NAW B;  4BOS C;  4ZRI A;  2CR5 A;  4IUM B;  2C9W B;  3QK0 A;  2LD9 A;  4KSK C;  1WJN A;  4W9K A;  5LXH A;  2C7N B;  4GGQ A;  3DOW A;  2PE6 B;  4KZC A;  4B6W A;  4K1R B;  2FAZ A;  3KUZ A;  4DHJ D;  4AJW A;  4OVV A;  3DQV A;  5JHA A;  3QX1 A;  1D3Z A;  4RM9 A;  3QWZ B;  3M3J A;  3PVL A;  1UGM A;  2R2O A;  1WR1 A;  3A33 B;  3ML8 A;  1F9J A;  3IVF A;  1NDD A;  1Q5W B;  4PS8 A;  4WJN A;  5GMV A;  3ZW3 A;  2FCQ A;  2JPH A;  1OEY J;  1E7V A;  4BBN F;  2C7H A;  2GBK A;  2KWC A;  2PE9 A;  3A9J A;  5CHW A;  3WAM A;  2CU1 A;  3ZKJ C;  1P0R A;  2N4F A;  2RD0 A;  3QC8 B;  2MA9 B;  1ISN A;  1EUV B;  3DVN V;  3O65 B;  4PS3 A;  3WA0 A;  4FHJ A;  3ZDM C;  2KC2 A;  4MDK E;  2KK8 A;  2ZZP B;  1M94 A;  2D10 A;  2MLB A;  4TQ1 A;  2ZCB A;  3A4S C;  4M0W B;  2HTH A;  1RFA A;  2CHZ A;  3WAO A;  5D2M B;  4ANU A;  5D94 A;  2MP2 A;  5CHV C;  3V60 A;  3APF A;  3A9J B;  4NJ6 A;  3U8Z A;  1TGZ B;  3IHP C;  2KX3 A;  3I3T B;  5KHO A;  3L10 B;  2Z0D B;  4GIV A;  1WGR A;  1E8Y A;  2I1K A;  4KIK A;  5AZH A;  2J0M A;  1TTN A;  4K7U A;  4ANX A;  4HDQ A;  5CTR C;  2ZVN A;  3IFW B;  3P2B A;  4I6N B;  2DAF A;  3UQB A;  3N3K B;  3RT3 B;  4II2 B;  4BKT A;  3NS8 A;  3D32 A;  1I42 A;  3APC A;  4ZDV A;  1Z2M A;  2L00 B;  3ENE A;  3VVW B;  4A3P A;  2MBH A;  3JSV A;  2NBV B;  2DX5 B;  1WJ6 A;  2PPH A;  4KIK B;  1P1A A;  2KO3 A;  2RSU A;  2KWV B;  4MJS A;  4BOZ B;  3H7S A;  4AOF A;  4MH0 E;  1WE6 A;  3AXC A;  2KDI A;  2KNB A;  5L83 A;  1LM8 B;  2WX1 A;  3M95 A;  2FIF A;  1Y8R C;  1WIA A;  3PRE A;  4I6L B;  4NQK E;  3VDZ A;  2N7E A;  1WY8 A;  2FUH B;  3JSV B;  3OJ4 B;  3T8M A;  2XK5 A;  5LXI B;  2KFK A;  2KQS A;  1WJ4 A;  2KDE B;  2PEA A;  4MJS B;  3L13 A;  1MG8 A;  2ASQ A;  2KVR A;  4KDI C;  3DCG A;  1UZX B;  2NR2 A;  1V9J A;  1Q0W B;  4IM3 A;  2M0X A;  4PYZ A;  3L08 A;  1JRU A;  2ZEQ A;  2YLM A;  2OOB B;  4GB9 A;  2CS4 A;  1L7Y A;  3V6E B;  2IZV B;  3OLM D;  1V49 A;  3UF8 A;  3ZUN A;  4FBJ B;  2PJH A;  2JZZ A;  2XK5 B;  3H1U A;  3NOB A;  2AEH A;  2KFK B;  2JWZ A;  1UEL A;  2N9E B;  4A3O A;  5KHQ A;  2KOX A;  4HVB A;  4B95 A;  2DAJ A;  3AU4 A;  4M8M A;  2XBB C;  4KVG B;  1RRB A;  2KJR A;  5IA7 A;  4FA6 A;  5FR6 A;  2CHX A;  2N1V A;  2LGD A;  1TBE A;  5G2N A;  4BKG A;  2K1F A;  2FNJ B;  3Q3J A;  3L17 A;  1E90 A;  4ZRK A;  5JH5 C;  2K25 A;  1EO6 A;  1UBQ A;  3ZO5 B;  3VAW A;  1LFD A;  1WMH A;  1OEY A;  3NY5 A;  3QA8 A;  4FN2 A;  2NBW B;  4MEL A;  1YD8 U;  2IY1 B;  3X0W A;  2L7R A;  2DZJ A;  1KJT A;  2XEW A;  1P98 A;  2GBJ A;  1OTR B;  4CO7 A;  1V86 A;  3HM6 X;  1UH6 A;  2YVC A;  3PRZ A;  3UIP B;  4B9K A;  2O2V A;  4PS7 A;  4HK2 A;  4E74 A;  1J19 A;  1WMH B;  3HM3 A;  4ICV A;  5AEK B;  1TZ1 A;  3IG3 A;  1E8Z A;  4TQ0 A;  2JF5 A;  2L0F A;  2MX2 A;  3CSF A;  2FCN A;  3OAW A;  3T9L A;  1YX6 B;  2DZM A;  2LGY A;  5E6O A;  4MGK E;  4XZ4 A;  3KYC D;  1IP9 A;  3CST A;  3Q3F A;  4TUU A;  1RLF A;  4X57 B;  4FJV B;  1WXM A;  1WXS A;  1WFY A;  2LZ6 A;  4AP4 C;  2O2V B;  1Q1O A;  2IBI B;  4LJO B;  4NY0 A;  1SGH A;  2KZR A;  3C0R B;  3PHW B;  4GU2 A;  4NQL B;  4G3X B;  3VHT C;  2M1M A;  4YL8 A;  2L76 A;  2LXC A;  3CF6 E;  2IO1 B;  1V6E A;  2A5U A;  3EC8 A;  3PSE B;  2BYE A;  3M63 B;  3ZLZ A;  2GBN A;  4F8C B;  5DPS A;  2V1Y A;  2WWZ A;  3HHM A;  4MM3 A;  1C3T A;  1KM7 A;  3EEC A;  1J0G A;  4DBG A;  1V81 A;  2G3Q B;  4KSL C;  4DDG D;  1S1Q B;  1WZ3 A;  4MGI E;  2KTF A;  5JHB A;  2BF8 B;  2GOW A;  5HKH A;  3A9K A;  3WAP A;  3R7R A;  3MTN B;  2HJ8 A;  1EF1 A;  3TIX A;  4CYE A;  2KTR A;  3NZU A;  3SU8 X;  4ANV A;  2GMI C;  3L54 A;  5JZE B;  2NPT A;  1V2Y A;  4ASW C;  4MSM B;  4RM8 A;  2BWF A;  4W9I A;  2JRH A;  1A5R A;  2NS5 A;  3PV1 A;  4K7S A;  4W9J A;  1X1M A;  2QHO A;  4JL9 A;  1V5O A;  2KDB A;  1OGW A;  4W9F A;  2LJ5 A;  3A9K B;  2LVO A;  2JY6 A;  2BYV E;  2BWE S;  2KTR B;  1WGD A;  2IO2 B;  2BYF A;  2NPT B;  2D07 B;  2JRI B;  2MP2 B;  3GOE A;  2EMT A;  4N9F 4;  4W9D A;  3V61 A;  3NHE B;  4DXA B;  4JGH B;  3WAL A;  4EFO A;  3RD2 A;  1E8W A;  4BKS D;  2G4D B;  3PRM B;  5DPR A;  4GXB A;  2NCN A;  3PGE A;  4WWO A;  5J17 A;  3VTV A;  3N30 A;  2MBB B;  3H7P A;  1WGY A;  4HDO A;  4DHZ E;  1P9D U;  4W9G A;  2DYB A;  2KDF B;  3QIJ A;  3KYD D;  4I6P A;  2MBO A;  2LAS A;  2LXA A;  4II3 B;  5G55 A;  2MCN B;  1V5T A;  2KJH B;  2Z0E B;  1E7U A;  2N7D A;  2L3Z A;  4MEM A;  3PPA A;  2KC1 A;  2O6V D;  3DDC B;  3WIM A;  2KWU B;  4FAD A;  1P3Q U;  5CHF A;  2HE7 A;  3DBS A;  4EUT A;  2RGF A;  3H7P B;  4EZK A;  1UBI A;  5J2R A;  4HPL B;  4IWO A;  1HE8 A;  1G6J A;  2I1J A;  2UYZ B;  5BO4 B;  2LRU A;  2MBE A;  2GBR A;  5TR5 A;  4W9H A;  1WYW B;  3VUX A;  4A20 A;  1NBF C;  4HPM B;  4XX5 A;  1WI0 A;  1WXA A;  2IYD B;  3GZN I;  1GNU A;  2ZCC A;  3DBH I;  2G4S A;  3S2A A;  2R2Q A;  1GUA B;  3K9O B;  1WR6 E;  4KZ0 A;  4NPN A;  3NZS A;  2DZI A;  2BPS A;  4TKN A;  2N9X A;  2MWS B;  3KW5 B;  1ZKH A;  2D3G A;  3L0W B;  4E71 A;  3SD5 A;  4W9E A;  3DBL I;  3EHV A;  1GC6 A;  4BBN C;  1KOT A;  3PHX B;  4WQO B;  4FJZ A;  3ZNH B;  2KXJ A;  1V80 A;  2DYM A;  1WE7 A;  1R4M I;  2AWT A;  3JVZ X;  1WM3 A;  3PZD A;  4WWN A;  2JUO A;  2J0J A;  3BIN A;  4HJK A;  5DPT A;  4ICU A;  3IBE A;  3VH3 B;  1XQQ A;  3ML9 A;  1XT9 B;  3M62 B;  5J18 A;  2K6Q A;  2MSE D;  4BFR A;  1WZ0 A;  2C7M B;  3TMP B;  2RR9 A;  3R3M A;  4IM2 A;  4F1S A;  2A4Z A;  4HWI B;  3DPD A;  4GDL A;  3TCA A;  2IO0 B;  3RUI B;  2CKH B;  2ZVO A;  4IWQ A;  3UIO B;  4EEW A;  3LJ3 A;  4GOC A;  4DHJ B;  2OJR A;  1E5W A;  1ZW7 A;  4LDT D;  2K8B A;  4TV3 A;  3ALB A;  5D7G A;  2C5L C;  1GJZ A;  2N1W A;  4P7I A;  4WJQ A;  1H4R A;  1LXD A;  2M8S A;  4MSQ B;  5E6P A;  3A1Q A;  3ZRF A;  1SIF A;  2KLC A;  3PRP B;  1YX5 B;  2L05 A;  2MRP A;  4GDL B;  2NVU I;  3ECI A;  2KLG A;  1Z5S B;  3B0A A;  2JT4 B;  2ZJD A;  3AU5 A;  3QQ8 B;  3TBL D;  4EOY A;  3L16 A;  1AAR A;  3PLU A;  1CMX B;  2KD0 A;  4EKU A;  4DWF A;  2DEN B;  3DVG X;  4XC2 A;  3N32 A;  4FLH A;  1IPG A;  2IO3 B;  2JZ3 B;  3A1Q B;  4JIO U;  2J0K A;  4IW0 A;  5C23 A;  3RCZ A;  4BKS A;  1EF5 A;  2WX0 A;  3JW0 X;  3U7D A;  2KJ6 A;  4W9C A;  4NJ7 A;  1WGH A;  3ZIM A;  4GN1 A;  5C1Z A;  2LRW A;  3ONS A;  5AZG A;  2FCM A;  2BKF A;  2L0T A;  2J7Q B;  2LWP A;  4W9L A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...