1WZ3A

The crystal structure of plant atg12
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
84
structure length
84
Chain Sequence
QKIVVHLRATGGAPILKQSKFKVSGSDKFANVIDFLRRQLHSDSLFVYVNSAFSPNPDESVIDLYNNFGFDGKLVVNYACSMAW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The crystal structure of plant ATG12 and its biological implication in autophagy.
pubmed rcsb
source organism Arabidopsis thaliana
molecule tags Plant protein
molecule keywords autophagy 12b
total genus 10
structure length 84
sequence length 84
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04110 APG12 Ubiquitin-like autophagy protein Apg12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 1wz3A01
4IM2A 1I35A 2L8JA 1V49A 2BPSA 2J0KA 4DBGA 3IBEA 3VXWA 4HLEA 2BKFA 1Q0WB 1XD3B 4GU2A 1YX5B 2DYMA 1C1YB 2LXCA 3ZLZA 3ZRCA 3DVNV 4ANUA 1WE7A 2DAFA 4HPLB 4IUMB 4WJQA 5DPTA 3A1QB 5GMVA 2G4DB 3QQ8B 4M0WB 5C23A 3VTUA 4M8NA 2KDFB 3O65B 3JSVA 2LRUA 2NBUA 2FCQA 2KDEB 2ZNVB 2DYOA 4MGZE 2JF5A 2R2OA 1WMHB 1K8RB 3AXCA 3EECA 2MRPA 4FBJB 2DX5B 3W1SC 1WE6A 4W9FA 1WI0A 2KZRA 1C3TA 2GBNA 2C7NB 2GBKA 2IO1B 4TKNA 1X1MA 4DHJD 1LM8B 3V60A 4GGQA 4ANXA 2N9PC 3VHTC 3DPDA 2DYBA 1J8CA 1E8WA 4EUTA 2N7EA 3OJ4B 4EKUA 3U7DA 1WY8A 3PZDA 3APDA 3ZTDA 3UQBA 3IG3A 3H7PA 1WF9A 3RD2A 4WWNA 2J0MA 3OAWA 3WIMA 2NPTA 3LDZE 2KWVB 2AL6A 3VH4B 4I6PA 4ICUA 1Z2MA 2C60A 2ZPYA 1MG8A 1WX8A 4ZRIA 1WR1A 4TUUA 4NAWB 4FA6A 2N9XA 3T8MA 2HJ8A 4IM0A 4CYEA 1ISNA 2DZIA 3IFWB 3PT2B 4NQKE 2N7DA 3PTFC 2BYEA 2MP2B 2KQSA 1CMXB 3V6CB 3A4SC 1A5RA 4PYUA 1BT0A 4P7IA 2FIDA 2QHOA 2CHWA 3QHTA 4WJPA 4WQOB 3DBRI 5D7GA 1V80A 4FJYA 1V9JA 2KJRA 4PS8A 4WAAA 2C9WB 3VUYA 2CR5A 1Q1OA 4IWOA 3TL5A 1GJZA 5JHAA 2IZVB 2ZVNA 1HE8A 3DCGA 3QWZB 4FN2A 1GC7A 3U30A 1NBFC 5CX3A 3QA8A 2LVOA 1H8CA 2RPQA 3Q3JA 2Z0DB 2JZ3B 2KWCA 4PS7A 1WIAA 2V1YA 4FADA 4RM9A 2KFKA 5LLIA 1R4MI 3B0AA 5DCNA 2MBBB 4FJVB 5CHWA 3ZUNA 2LVQA 3TBLD 2GBRA 2HD5B 3IVFA 4MM3A 1KOTA 2KNBA 2GBMA 2V4LA 2LZ6A 2KC1A 2YVCA 3PGEA 4KV2A 1SGHA 2L0FA 3JW0X 4URKA 2IO2B 4XZ4A 4WJOA 4LDTD 4LDTB 4EZJA 1U4AA 4W9EA 1YIWA 3DOWA 1LXDA 1TBEA 2KXJA 3M62B 5HKHA 3NHEB 2LJ5A 4WJNA 2A5UA 3L17A 1WXMA 2K25A 4KDIC 4KZ0A 5D2MB 1WZ0A 2XK5A 4GDKB 4BFRA 3RUIB 4AJYB 2LGYA 3BY4B 1KM7A 4DHZB 3RULA 2K1FA 4MDKE 4NPNA 4MGYE 2NVUI 4AP4C 3UGBB 1S3SG 2LGDA 3EHVA 2DZKA 1EO6A 2EKEC 4K7UA 2J0JA 1S1QB 3UINB 2V3SA 4IWQA 2UYZB 2WX0A 4B95A 3IHPC 4WWPA 1E7VA 2FCSA 4GB9A 3L08A 2D2QA 4GSWA 3PRMB 3VFKA 3ZW3A 4BBNC 2D11A 4WWOA 2KD0A 3EC8A 3QAQA 4W9CA 2KQ7A 2L3ZA 4CO7A 2AEHA 5G55A 3SDLC 2EMSA 2KDIA 3QK0A 3ZDTA 2I1JA 3NY5A 3ZIMA 2MBHA 4BOSC 3DVGY 2PPHA 4W9KA 1XQQA 4ICVA 2MBQA 4X57B 3WA0A 4RMAA 2UWQA 3H9DA 5J2RA 1L2NA 2KTFA 1F9JA 1YQBA 3GZNI 2NBVB 3PVLA 4BKGA 4XC2A 3ALBA 2FCNA 2N1VA 2G3QB 3BINA 1E5WA 5JHBA 2KJHB 3QC8B 3RZFA 2BGFA 2KWUB 4MGKE 3TJPA 3ZDMC 1Y8RC 1L7YA 4E3CA 1WRDB 3KYDD 4NAWA 3DDCB 2BWFA 3GOEA 2I1KA 3MJWA 2KO3A 5EDSA 2JZZA 3DBLI 3TMPB 3W1YA 2NBWB 3ZNID 3ZTCA 3CSFA 1GG3A 2IY0B 2D3GA 2N1WA 3PLVA 3PV1A 2CS4A 3TIXA 1J0GA 4I6NB 3PHXB 1V81A 3DVNU 3CSTA 4IM3A 3WANA 2KN5A 5KHOA 2M1MA 2KFJA 2MQJA 1P9DU 4W9DA 5CHVC 3KVFB 2R2QA 4HCNB 2ZZPB 3A9JB 2ZNVC 4II2B 2DHZA 1NDDA 3AULA 1YJ1A 3JYUA 3Q3FA 2AWTA 4HDQA 1LQBA 4HCPB 1I42A 2KANA 1EUVB 4RM8A 2CKHB 3DQVA 2KMAA 4K1RB 4NJ6A 4A3PA 1EF5A 2W9NA 4EEWA 5LXIB 2FNJB 2EMTA 4HXDA 3MTNB 2K8HA 4J6IA 2JXXA 4PYZA 2O2VA 4LJPB 3VTVA 4W9JA 1UELA 1WM2A 2KX0A 2N4FA 3H7SA 3NS8A 3A33B 5J17A 2KLCA 5AEKB 4BOZB 4I6LB 2MWSB 3DBHI 2K6DB 4FHJA 4HPMB 1WR6E 5IAAC 2DZMA 3RT3B 1WJNA 5J18A 3PS6A 3KW5B 3PREA 5AZHA 3HK0A 1WJ4A 2A4ZA 4TV3A 4DDGD 3ECIA 1WM3A 4ZRJA 3AI5A 1PQSA 2FCMA 4K81A 4NNJB 3D32A 2D10A 2MA9B 3JVZX 1VCBA 2G4SA 4LJOB 1SE9A 3V6EB 2PJHA 3ZO5B 4B9KA 2WDTB 2HTHA 1E8ZA 1WJUA 4GIVA 1KJTA 1KLVA 2FAZA 2KFKB 4M8MA 1WXAA 4EZLA 2ZCCA 3OLMD 1E8XA 2KDBA 3A4RA 4DHZE 2ZCBA 2MSED 2JRHA 2DZJA 2MW5A 1UH6A 1Q5WB 1WFYA 2AYOB 4HK2A 4IW0A 5E6OA 4AJWA 3ZKJC 2K39A 2LGXA 1OEYJ 4FJZA 4W9LA 2KKCA 3ML9A 1YD8U 4TQ0A 3ZNGC 5IA7A 1Z5SB 2K8CA 2MBEA 4MELA 2BYFA 1E90A 3SU8X 3N32A 3WAMA 4A3OA 4BVUC 4DDID 5FR6A 1WGDA 4FLHA 4GXBA 4KSLC 5CHFA 2MP2A 5AZGA 5TR5A 4AWJA 3RYTA 2JUOA 4A20A 2BWES 5JZEB 1UBIA 4W9IA 2DENB 3R7QA 4BKSA 3ONSA 1NI2A 2ZVOA 4BBNF 4CHKA 1V2YA 1WJ6A 2PEAA 2MX2A 1UD7A 4FULA 2Z0EB 2JWZA 3HM3A 5DPWA 4EZKA 4JIOU 2C7MB 2VRRB 3M95A 1ZW7A 3SD5A 4ZDVA 1OQYA 3H7PB 2KX3A 2RR9A 3A9KA 3VAWA 3TCAA 2JPHA 5L95C 4II3B 2ZEQA 1M94A 2NR2A 5D94A 3VUWA 1P3QU 3UIPB 4K7WA 2M4NA 1XT9B 1AARA 2OJRA 3QCAA 3ZVVA 2KHWB 1UGMA 5D6JB 2OOBB 3WAPA 1WMHA 1OEYA 4GOCA 3PRPB 2BF8B 3PPAA 4OVUA 3KH0A 2JY6A 1WXSA 4XX5A 4BKTA 3R7RA 3ENEA 3A1QA 4KVGB 5E6PA 5DPRA 1P1AA 2WYQA 3L54A 5L83A 4B6WA 1WXVA 3KUCB 4LCDE 1WGYA 2RGFA 1E7UA 1P98A 2ASQA 2KTRB 3MHSD 3APFA 4DXAB 4K7SA 2WX1A 1IPGA 2KK8A 2L0TA 3QJZA 4DWFA 4G50A 2GBJA 3KUZA 3QIJA 1IYFA 2LXAA 3M63B 3RZWC 4KSKC 1ZKHA 4KDLB 1EF1A 4GDLA 4PS3A 4IWPA 2REXA 1IP9A 2HE7A 3OJ3A 5DPSA 1GUAB 2L7RA 2YLMA 1D3ZA 1V6EA 4F8CB 4E71A 2XK5B 3HM6X 1OGWA 2XEWA 4GDKA 4JL9A 4MJSB 2D07B 3H1UA 4IC7B 1WGGA 4DHJB 3I3TB 4ZYNA 1LFDA 4MJSA 4W9HA 3L13A 3KYCD 2ZPNA 3VDZA 4FHKA 1WZ3A 1YX6B 1UBQA 1TZ1A 5LXHA 3UQAA 2IO3B 1OTRB 2XBBC 4ZRKA 2O2VB 2O6VA 2MLBA 4E74A 2N9EB 1TTNA 2M17A 2BYVE 1GNUA 2RSUA 3SHQA 3L0WB 1E8YA 1J19A 3A9KB 4HDOA 1VD2A 4AUQC 3X0WA 3QARA 5BO4B 3PSEB 4OVVA 3WALA 1WX7A 3L16A 4EOYA 1WGRA 2NPTB 3A9JA 4DK5A 2ZJDA 3ZRFA 3UF8A 3V61A 1V86A 2KC2A 2JT4B 2PE6B 2FUHB 2MCNB 3EFUA 2G45B 2CU1A 3ZNZB 2LD9A 2KOXA 2IYDB 2L76A 3N3KB 3QX1A 1RRBA 2LVPA 4G11A 3K9PB 1FXTB 3PLUA 4JGHB 4NJ7A 4F7ZA 4EFOA 3K9OB 3X23A 2B3AA 2WWZA 3T9LA 3CMMB 1JRUA 1P0RA 2JVCA 2LUEA 3B08A 3NZSA 2IY1B 4MGIE 2C7HA 3DVGX 3WAOA 2PE9A 2Z59B 3APCA 4BKSD 2CHXA 3L10B 2KMCA 2LWPA 2NS5A 2LI5A 2FIFA 1GC6A 2KVRA 2K6QA 5JH5C 4ANWA 4F1SA 4YL8A 4NY0A 3RCZA 3C0RB 2J7QB 2RD0A 3HHMA 3PRZA 4MH0E 2M0XA 1WGHA 1H4RA 2C5LC 3S2AA 1V5OA 2Y5BB 3AU5A 4HWIB 2KJ6A 3P2BA 4TQ1A 1R4NI 2LRWA 3KUDB 3B1LX 2L05A 2DAJA 4GMVA 4IG7B 3VUXA 5KHQA 3HIZA 4JLCA 1SIFA 3LJ3A 1QZEA 4G0NB 4MSMB 5G2NA 3NZUA 1RLFA 2M8SA 3ML8A 3NOBA 4KZCA 4MSQB 3JSVB 3R3MA 2AL3A 4KIKA 4JQWC 1UZXB 4N9F4 3VTWA 3H6NA 2O6VB 1WX9A 4W9GA 3VQIA 4HVBA 2NCNA 1V5TA 3PHWB 2L00B 1RAXA 2JRIB 5E6NA 3V62A 2MBOA 4ASWC 4ANVA 1G6JA 2IBIB 4GN1A 2IO0B 3M3JA 1TGZB 5CTRC 4KIKB 3AU4A 3DBSA 3VH3B 3CF6E 2LASA 2GMIC 1WYWB 2BKRB 1ZGUB 2KTRA 3VVWB 3W1SA 5C1ZA 3UIOB 4AOFA 2GOWA 4MEMA 1RFAA 3N30A 4GDLB 5AZFA 4G3XB 4HJKA 2O6VD 3ZNHB 4NQLB 3U8ZA 1WH3A 2KLGA 2K8BA 3R66C 2CHZA 1T0YA
chains in the Genus database with same CATH superfamily
1I35A 2L8JA 5C2TB 2J0KA 4DBGA 4HLEA 2BKFA 1XD3B 1ROEA 3SFDB 3ZYYX 2PLPA 5GMVA 3A1QB 5C23A 4M0WB 4O1NA 4M8NA 2LGSA 1AN8A 3JSVA 2JF5A 1WMHB 1K8RB 1TIFA 4FBJB 1WE6A 1P7FA 4USAA 1FFVA 2C7NB 3ETRA 4DHJD 4YSYB 1C4AA 4EUTA 2JYEA 3OJ4B 1FRRA 1AW7A 3ZTDA 3IG3A 3AB5A 3OAWA 3WIMA 2KWVB 1UF0A 5IOIA 3BK1A 1ENFA 3BYTB 1TKYA 4TUUA 2ONQA 4IM0A 3IFWB 2RDGA 2N7DA 3P63A 4PYUA 2GRIA 1BT0A 4P7IA 2QHOA 4WQOB 3DBRI 4FJYA 2RPVA 1KFYB 1YN4A 4LTUA 2ZVNA 3QWZB 3AH7A 1N60A 3ZQ4A 3QA8A 1H8CA 3Q3JA 5JXVA 1V1PA 1FO4A 1R4MI 1N6ZA 5DCNA 1N63A 2MBBB 4FJVB 3NRZA 1RYJA 1XXGA 2GBRA 2IJ0A 2V4LA 2L0FA 3JW0X 4EZJA 1YIWA 1LXDA 2L1AA 1TBEA 3M62B 2WU5B 4WJNA 2A5UA 1EM7A 2PKOA 2XK5A 1NENB 3BY4B 3R8BA 1CQVA 2QSDA 2VZKB 4AP4C 1OQRA 2DZKA 2EKEC 4CQNA 1FRDA 4IWQA 3UI3A 3U4EG 4WWPA 2FCSA 2D2QA 4GSWA 3ZW3A 2ZW1A 2KD0A 3T3OA 2KQ7A 4YT0B 3Q8FA 2I1JA 3NY5A 3DVGY 1XQQA 4X57B 3KWLA 4RMAA 4A55A 3N9YC 3GZNI 1F9JA 2NBVB 1D4BA 1XO3A 2E3TA 4XC2A 1SBBB 1QF6A 1UUPA 1YNTE 2G3QB 1FEHA 4P16A 3RZFA 2JU6X 3ZDMC 1T5XD 3AN1A 1T0SC 3AE1B 3B2FA 3ZNID 2VZKD 1GG3A 1ZXHA 2D3GA 3PLVA 4C00A 1J0GA 4HKQA 4W9DA 5CHVC 2NTSA 2QMTA 1BXTA 2LGIA 1NDDA 1YJ1A 2JZPA 4LLGM 2ICIA 1LQBA 4A3PA 2QCZA 2FE8A 4HXDA 1C78A 2JXXA 3ABVB 2WXGA 1D5ZC 1E7PB 3VTVA 2N4FA 3H7SA 3A33B 4BOZB 3DBHI 3RFZB 2D3AA 2IPKD 2AX5A 2DZMA 3RT3B 3PREA 1N5XA 1FMAD 4TV3A 5BYRA 4RGTA 1FNVA 2G4SA 1I4HA 1WJUA 1GB4A 1KLVA 2KFKB 1WXAA 1HZ5A 2ZCCA 2MSED 2MW5A 4AJWA 5E6OA 1TYGB 2BB5A 2K39A 2LGXA 4FJZA 4W9LA 3ML9A 3FAHA 3SU8X 4A3OA 4DHJB 5HI1A 3Q2AC 5AZGA 3NJTA 5TR5A 2KVZA 4YSZB 3AEDB 4A20A 1TS2A 2DENB 3R7QA 4DXFA 4BKSA 3GP7A 3IAM1 3DBRB 3ZXRA 2Z0EB 2JWZA 5DPWA 4JIOU 1ZW7A 2KX3A 4DXGA 3VAWA 4HJGE 4XYCA 1SIJA 3P42A 3DWGC 5EE9A 1P3QU 1STEA 4GLSC 1F77A 4RNAA 2OOBB 4C7YA 1WMHA 1OEYA 3PRPB 2BF8B 4C4VB 4BKTA 4YTPB 5L83A 1L4DB 2KDMA 5E6JA 2JXTA 4KKIA 1P98A 3EUB2 2MJDA 3APFA 1NEKB 2L0TA 2GBJA 4KSKC 2PVGC 1EF1A 1WGKA 1GAQB 4A6QA 3OJ3A 5DPSA 2HTME 1WRIA 1D3ZA 2XK5B 3N1ZC 2KMMA 2MH7A 4IC7B 4MJSA 3W5UB 3KYCD 3RNGC 1UBQA 1TZ1A 2XBBC 4ZHOA 1E6EB 2MLBA 4LNFA 1TTNA 5T8IA 2RSUA 4MT5A 3SHQA 1J19A 4HDOA 1VD2A 3X0WA 3QARA 3WALA 3W2DA 2WXHA 4IOIE 2PE6B 2IGDA 3EFUA 1K52A 5G5GA 4OHJA 2LUMA 2D3CA 2LD9A 3T3NA 2X38A 4TMAB 3K9PB 4JGHB 4EFOA 1B1ZA 3T9LA 1JRUA 1P0RA 2JVCA 2LUEA 3B08A 1NVID 4TSSA 1ET9A 2WHIA 1PDXA 4BKSD 5I4DA 2WXOA 1XLOA 3Q8EA 2NS5A 2K3UA 2FIFA 2K6QA 2V9HA 1TS4A 3MC0B 2RD0A 2M0XA 2C5LC 1TY0A 2J52A 5KHQA 1FXAA 4PK1A 3GB1A 3ML8A 5H8YE 5HHDG 1RFKA 4JQWC 1UZXB 3VTWA 3H6NA 3LYYA 5IO9A 1NYQA 4HVBA 1F1HA 3PHWB 1RAXA 1QOGA 3H8HA 1PYWD 2IO0B 3DBSA 3VH3B 3AEEB 2BKRB 1MG4A 4MEMA 3N30A 5GXGB 4GDLB 4MM3B 2W55A 3P4PB 3U8ZA 3RI7C 2KLGA 2IDYA 1SJED 2E6XA 1Q0WB 1KRHA 3ZRCA 2LXCA 1WYGA 2W54A 3C19A 4ANUA 1WE7A 4WJQA 3VTUA 3ZXVA 2I2YA 2Y3AA 2R2OA 4RFBA 1ZE3D 1SE4A 3AE9B 2GLSA 2KZRA 1C3TA 2GBNA 2IO1B 1X1MA 1LM8B 3DHIC 4ANXA 2N9PC 3DPDA 2DYBA 1E8WA 2WP9B 4EKUA 3UQBA 3PZDA 1F0ZA 1WF9A 3RD2A 4WWNA 1T6BX 3FILB 2NPTA 3LDZE 2AL6A 1IGDA 3W9CB 4I6PA 4WIPA 3BWUD 1J7CA 3RNBC 1MG8A 4ZOHC 4ZRIA 4YXDB 4LNNA 1TKEA 2CU3A 4NAWB 4FA6A 2HJ8A 4NQKE 2DZIA 3Q6BA 5LNK1 2MJEA 1QOBA 1JWSD 1KTKA 2V3PA 1A70A 1DYQA 2INPE 3W5VB 1V80A 1KLUD 3C8YA 4WAAA 2C9WB 3VUYA 1B9RA 1GJZA 5JHAA 1HE8A 3DCGA 4FN2A 3U30A 2MJ3A 5CX3A 2FUG1 3OWEB 3EGRA 2LVOA 2K0PA 2KWCA 2V1YA 1WSPA 3MC8A 5CHWA 3TBLD 3IT4B 1R7SA 4MM3A 2GBMA 4OW0A 4URKA 4XZ4A 3P1MA 4LDTD 3KWVA 4LDTB 4WJOA 2YEPB 1IBXB 4MACA 2WDRB 4KDIC 1WZ0A 4L23A 3RUIB 3EA6A 2K1FA 1V8CA 4NPNA 4MGYE 1C4PA 1S3SG 3BIID 3EHVA 1EO6A 2J0JA 1S1QB 1HEZE 4L2YA 2M56B 3IHPC 3IT6B 4P1CC 4BBNC 1L6UA 4WWOA 3QAQA 1I4RA 2AEHA 3ZDTA 2MBHA 4OZBA 4BOSC 1F52A 3WA0A 3R2TA 5FK9C 2L52A 1L2NA 2EELA 1TJEA 1PUTA 2FCNA 5JHBA 4YTMB 1QKZA 2KWUB 3TJPA 1L7YA 1MI0A 1N61A 2I1KA 5EDSA 3W1YA 4Q2JA 1F2RC 2BS4B 5BMGA 4DQOC 1R4MB 3DVNU 2XNAC 3CSTA 4IM3A 2L32A 3WANA 2M1MA 2MQJA 1P9DU 1VDVA 3KVFB 1FM0D 2R2QA 4II2B 3AULA 2AWTA 3BK2A 4HDQA 1KLGD 4HCPB 2CKHB 4K1RB 4NJ6A 2YEPF 4LNKA 2FNJB 2WXMA 4US8A 3KQ4A 4B0EA 1WM2A 2KX0A 1IGCA 3ZJTA 2K6DB 4ARIA 2PVOD 3PS6A 2A4ZA 1YMHE 3ECIA 1WM3A 4K81A 2D10A 1MHXA 2WXFA 1OFFA 1VCBA 1SF0A 2VH1A 2PJHA 4EE2A 2W82A 4GIVA 2FAZA 4EZLA 3BVMA 3OLMD 1C76A 3FKYA 3A4RA 4DHZE 2UU7A 2ZCBA 4RF0A 2JRHA 4IKGA 1UH6A 1WFYA 4HK2A 4IW0A 1MJDA 1MVKA 1L0XB 1YD8U 1Z5SB 4DDID 1A5RA 1E90A 3WAMA 1DGJA 1N5WA 2D5GA 1WGDA 4FLHA 2PMVA 1HA5A 4KSLC 2MP2A 2WXLA 2QEJC 1UGJA 3GE3C 3V3XA 2JUOA 3AEGB 4W9IA 1L6VA 3ONSA 1V2YA 2HJ1A 1WJ6A 2PEAA 2MX2A 1FNUA 4FULA 3HM3A 3M95A 4ZDVA 3AV8A 2RR9A 1UWXA 3N1XC 5L95C 2G1EA 4K7WA 1XT9B 1ZUD2 3QCAA 4WH4A 2IGGA 1NI3A 2AQ3B 2WQYB 4OVUA 2INDC 2JY6A 1WXSA 3BVZA 3A1QA 5DPRA 2WYQA 1NYRA 1WGYA 1SXTA 2KTRB 3NVWA 1IPGA 4G50A 1ET6A 3KUZA 1IYFA 1C77A 3RZWC 4KDLB 4GDLA 4PS3A 2K9XA 2YLMA 4F8CB 1OGWA 4MJSB 2CJNA 3NG0A 1WGGA 2J4XA 2JYTA 2X8XX 2ZPNA 3VDZA 3Q8AA 4FHKA 5BMHA 2N9KA 2AQ2B 5LXHA 3E56A 2M17A 1FNWA 2WXPA 1EWCA 3L0WB 2WXJA 4AUQC 5BO4B 4OVVA 4YTNB 3NVVA 3L16A 1C79A 2NPTB 3A9JA 3ZRFA 3RNAC 3V61A 2KC2A 1EU3A 4REZA 2FUHB 2MCNB 4JWSC 2G45B 2RDHA 3ZNZB 4UDUC 4XE0A 3QX1A 4YWGG 1RRBA 2LVPA 3NVZA 2WWZA 3NZSA 2PE9A 2D3BA 2KMCA 3FC4A 1GC6A 1ZPSA 4BZAA 5JH5C 3Q69A 4F1SA 4YL8A 3RCZA 3C0RB 3HHMA 1WGHA 1V5OA 2Y5BB 2LRWA 3KUDB 3B1LX 2DAJA 2IGHA 3LJ3A 1QLBB 5AUKA 4MSMB 1SJHD 2BQQA 4MSQB 1CJEA 2WXRA 2LHEA 2CJOA 3V62A 4ASWC 4ANVA 2QJLA 5CTRC 4KIKB 2GI9A 2LASA 2V4IB 4WQMA 1HTOA 2BYTA 1T3QA 4G3XB 4NQLB 2K8BA 1JRPA 1K50A 4C4VA 2BPSA 3VXWA 1MHHE 1YX5B 1VLBA 3TEZA 1XCQL 4HEA1 4KX6B 3Q14C 2DAFA 2B76B 4HPLB 3J9CA 5DPTA 3QQ8B 1XCTL 2KDFB 2PW9A 3O65B 4KGSA 2LRUA 2NBUA 2KDEB 2VH2A 2DYOA 4MGZE 3AXCA 1VZ8A 3AE8B 1WI0A 4TKNA 2BVCA 3VHTC 2BB6A 2QILA 2EKIA 3H7PA 2J0MA 2QC8A 4WWMA 1I7HA 3VH4B 3Q3NC 2SAKA 4ICUA 3MJ5A 2C60A 3Q8CA 1WX8A 3DBHB 3GS2A 1QOFA 3T8MA 1HXYD 1ISNA 3KLSX 1DOXA 1XLQA 2MP2B 5D3IB 2KQSA 3V6CB 3A4SC 4XGAB 2CHWA 3QHTA 4WJPA 5D7GA 1XLNA 2KJRA 1BMLC 1D6EC 1Q1OA 3TL5A 2IZVB 3Q3MC 1GC7A 1QQRA 1NBFC 1TY2A 3AEAB 2RPQA 4FXCA 4PS7A 4FADA 4RM9A 2MHJA 3B0AA 2JSVX 3ZUNA 1T0QC 2LVQA 3TEXA 2KNBA 1KOTA 4KV2A 2KC1A 3N1YC 1SGHA 2IO2B 4OZAA 4W9EA 2Q5WD 1SE3A 2KXJA 5HKHA 1ZP0B 1V1OA 2LJ5A 3L17A 2K25A 4KZ0A 5D2MB 3URYA 4GDKB 4BFRA 4AJYB 2TSSA 1JALA 2LGYA 1KM7A 1AYFA 1TS5A 2LGDA 1DOIA 1C4CA 2J42A 2V3SA 3LXFA 4JE3B 4C7ZA 2WX0A 1E7VA 3NS1A 4GB9A 3L08A 3PRMB 3DHGC 2D11A 3EC8A 4A90A 3AM9A 5G55A 1TT5B 2KDIA 3QK0A 3FILA 1E9MA 4ICVA 3PZ8A 2UWQA 3H9DA 5J2RA 1YQBA 4BKGA 5TSSA 2N1VA 4BAXA 1JWUD 3BINA 1E5WA 2KJHB 1JMLA 2BGFA 4MGKE 3CIRB 2W3SA 3KYDD 4NAWA 2XN9C 2BWFA 3GOEA 2KO3A 3DBLI 3TMPB 2G9HD 3CSFA 5BYSA 2N1WA 2WXIA 3PV1A 2CS4A 3TIXA 5EE0A 2K5PA 3I5JC 3PHXB 1V81A 5KHOA 2KFJA 4LNIA 5HFYA 4HCNB 3RNEC 3JYUA 3AE5B 3Q3FA 2GB1A 1I4GA 1I42A 2L83A 1EUVB 1FPYA 1JQ4A 5LXIB 1EU4A 2EMTA 2K8HA 4M0WA 1VR9A 4PYZA 2DLBA 2WDQB 3I57A 4W9JA 3ZGZA 3NS8A 5H92C 3SR6A 5AEKB 4I6LB 4HPMB 1WR6E 5IAAC 1R4NB 5J18A 3KW5B 1RM6C 4KGRA 2BTEA 2FBWB 1ZDXA 4ZRJA 3AI5A 2FCMA 2MA9B 3JVZX 3AE3B 1SE9A 3ZO5B 2WDTB 2HTHA 1E8ZA 2M19A 3U7ZA 4M8MA 2BBCA 1HQRD 2KDBA 1Q5WB 2AYOB 4TQ0A 4AS1A 4MELA 2MBEA 5FKAC 5IA7A 3N32A 1LGRA 1UWMA 5FR6A 5CHFA 4HROA 4AWJA 4C80A 1D5MC 1N62A 2BWES 5JZEB 1MPEA 1UBIA 2R61A 2WGSA 2WNMA 1UD7A 1ESFA 3DHHC 2DWQA 5IKCM 2VRRB 3SD5A 4OVZA 2NR2A 3R2IA 3UIPB 1WWTA 2DBYA 3ZVVA 2KHWB 1UGMA 1P7EA 3WAPA 4GOCA 1KF6B 3R7RA 3ENEA 4N59A 4KVGB 1P1AA 3L54A 4NJCA 1WXVA 3KUCB 1D5XC 3NVYA 4B0MA 2H88B 3MC9A 2HDEA 2N7JA 4DXAB 2WX1A 2KK8A 4J3OD 3QIJA 5AUIA 3M63B 1JCKB 1ZKHA 1HZ6A 2BS3B 4IWPA 4GDKA 4OZCA 3H1UA 3HUIA 4IDIA 1K53A 1JWAD 1LFDA 3TUOA 3MFGA 1WZ3A 1YX6B 1T0RC 1WXQA 1CZPA 1CK1A 1YJIA 4ZRKA 2O2VB 4E74A 1FCCC 2N9EB 1BUIC 4A8XC 1Y56A 2KACA 2OJWA 3A9KB 3O13A 3MHZA 1WX7A 1VJKA 1VZ7A 1XF5L 1E0ZA 3IXSA 4P1BC 3RNCC 2LEKA 1TKGA 2WXKA 2KOXA 3N3KB 1MFWA 3BYYB 4G11A 1FXTB 1F2RI 1FCLA 2B3AA 3CMMB 1TS3A 4RGMA 2IY1B 4MGIE 2C7HA 3DVGX 3WAOA 3HRDD 3APCA 2CHXA 5HG2A 3L10B 3P4SB 4K3BA 2LWPA 3E9SA 2LI5A 1QILA 4NY0A 2J7QB 4MH0E 4ZHPA 3S2AA 3AU5A 4HWIB 3ZJVA 2KJ6A 3PZ7A 2N9LA 1R4NI 3P2BA 4GMVA 4IG7B 2L05A 3VUXA 3HIZA 4JLCA 4G0NB 5G2NA 1XLPA 2RMMA 1RLFA 2M8SA 4MH8A 3JSVB 2AL3A 4KIKA 4N9F4 2O6VB 1WX9A 1IBXA 2NMQA 2NCNA 3B9JA 2JRIB 2MBOA 2IBIB 4GN1A 1XEEA 1VZ6A 3M3JA 2MEKA 1YOVB 3AEBB 3B2GA 2GMIC 1WYWB 4H2AA 2QDFA 4WURA 5C1ZA 4AOFA 2GOWA 3TSSA 1RFAA 2ON8A 4HJKA 3ZNHB 2AQ1B 2JWUA 4IM2A 1V49A 1YJJA 2PIAA 1L5PA 3IBEA 4GU2A 5IN7A 2DYMA 1C1YB 3ZLZA 2ACZB 3DVNV 4IUMB 2G4DB 2WU2B 2ZNVB 5EE1A 2FCQA 4XWWA 3EECA 1L0YB 2MRPA 2KT7A 2DX5B 3W1SC 5EE3A 4W9FA 2GBKA 4N6EB 2V3NA 3V60A 4GGQA 1J8CA 2Z8LA 2N7EA 3RMKC 4RGNA 3U7DA 1WY8A 3APDA 1M4VA 4HRSA 2V0GA 4JX1C 1Z2MA 2ZPYA 1E10A 1WR1A 4KKJA 2N9XA 4CYEA 3PT2B 3NUHB 4R3DA 3PTFC 1SB3C 3GZNB 2BYEA 2KYWA 1CMXB 5IP4D 4PT5A 2FIDA 4ITKA 5MPOA 1PGBA 4PS8A 1J7BA 1V9JA 4ARCA 1PGAA 2CR5A 4IWOA 4K3CA 5D3DA 2Z0DB 2JZ3B 4KGTA 1WIAA 2KFKA 5LLIA 4US9A 2HD5B 3N20C 3IVFA 2WLBA 1FXIA 2LZ6A 2YVCA 2BW2A 3PGEA 4ZRPA 4S0RA 3NZ3A 1U4AA 4XDDA 2INCC 3DOWA 3AE4B 1LO5D 3NHEB 2I38A 2SEBD 2WXQA 1WXMA 1JROA 4DHZB 3RULA 4MDKE 2NVUI 1QOAA 3UGBB 4RH6A 2M0AA 1FFUA 5FR3A 4K7UA 3UINB 1L4ZB 2UYZB 4B95A 3VFKA 2QIEB 4W9CA 4CO7A 2L3ZA 3SDLC 4RGOS 2LMCA 2EMSA 4LK0M 3ZIMA 2NTTA 1KH0A 2PPHA 5BMIA 2OHFA 4W9KA 2ZW0A 2MBQA 1I4XA 2KTFA 4L1BA 3PVLA 3ALBA 3AE6B 1YQ4B 3QC8B 4RF1A 4E3CA 1Y8RC 1WRDB 1YN3A 4M02A 1IUEA 3DDCB 3MJWA 2JZZA 2NBWB 3ZTCA 2IY0B 2Y5PA 1ZOYB 4I6NB 2Y5CA 2KN5A 5BYQA 2ZZPB 3A9JB 2ZNVC 2DHZA 3AECB 2KANA 4P6VF 4RM8A 3DQVA 2KMAA 1EF5A 2W9NA 4EEWA 4J6IA 3MTNB 4RCOA 1DOYA 2O2VA 4LJPB 1PGXA 2JQRB 1UELA 4C56C 1L0VB 1SEBD 3BZDB 5J17A 2KLCA 1I4QA 2MWSB 4A9AA 3VRBB 4FHJA 1VRAB 3HVZA 1WJNA 1J7AA 1ZXIA 5AZHA 3U2SC 3HK0A 1WJ4A 2WS3B 4DDGD 3SEBA 1PQSA 4NNJB 3D32A 2J53A 2INNE 3GE8C 4LJOB 5C3JB 3V6EB 3TEWA 4B9KA 1KJTA 1YN5A 1V97A 1SSNA 4YSXB 1E8XA 3HVDA 2N0SB 1GPXA 2DZJA 3ZKJC 1OEYJ 1Q10A 2BS2B 2KKCA 3ZNGC 4NZLB 3BVGA 2K8CA 2BYFA 2JX5A 4BVUC 2LJIA 4GXBA 1I4PA 3RYTA 3I9V1 1GB1A 3RPFC 4BBNF 1NI2A 2ZVOA 4CHKA 3VR9B 4HPPA 1K51A 3P4RB 1FIQA 3RN9C 4AQ7A 3WCQA 4EZKA 1PFDA 2C7MB 1OQYA 3H7PB 3A9KA 1OQQA 3TCAA 2JPHA 3OG5A 4XDCA 4II3B 2ZEQA 1M94A 5D94A 3VUWA 2M4NA 1AARA 2OJRA 3CWIA 3EFCA 3Q3OC 1RWSA 5D6JB 3MP9A 3VR8B 3PPAA 3KH0A 1ZDVA 4XX5A 1JWBD 4N58A 5E6PA 3Q8BA 3V05A 4B6WA 4LCDE 1GOZA 2RGFA 1JW9D 1E7UA 2ASQA 4NAMA 3MHSD 3SFEB 4K7SA 3IAS1 3QJZA 4QAYA 2WDVB 4DWFA 2WXNA 4M01A 2LXAA 2REXA 1IP9A 2HE7A 3RNFC 1GUAB 2L7RA 1V6EA 2KAJA 4E71A 3HM6X 4JL9A 3ZJUA 2XEWA 2D07B 3I3TB 4ZYNA 4D2KA 3AMZA 4W9HA 3L13A 2PTLA 3PO0A 2K22A 1HTQA 1TZOA 4JWUC 3UQAA 2IO3B 1OTRB 2O6VA 1JWMD 2KN4A 2BYVE 1GNUA 1E8YA 2H89B 3PSEB 3DWMA 2KQ4X 1YQ3B 1EWYC 4EOYA 3TEYA 1WGRA 4DK5A 2ZJDA 3UF8A 1V86A 2JT4B 1SE2A 1FD6A 4ZRQA 2CU1A 2IYDB 2L76A 4NJ7A 4LNOA 3PLUA 4F7ZA 4XWTA 3K9OB 1ACCA 3X23A 3P4QB 3AE7B 2Z59B 3AEFB 3I63C 4M00A 2LFIA 2KVRA 1AWDA 4ACFA 4ANWA 3PRZA 4JPSA 1H4RA 3AE2B 2BT6A 4TQ1A 1UNSA 3W1SA 3U52E 2RDBC 1C9FA 1SIFA 1QZEA 2DNFA 5G5HA 3NZUA 3NOBA 4KZCA 3R3MA 2LHDA 3L4PA 4S17A 4W9GA 3VQIA 2W3RA 1V5TA 2L00B 3DBLB 5E6NA 3VRAB 1G6JA 2OEDA 1TGZB 3AU4A 3LB8C 3CF6E 1V1PB 1ZGUB 2KTRA 3VVWB 3UIOB 4HKZE 1QT9A 4ZYSA 5AZFA 2O6VD 1WH3A 2KWDA 4WAFA 3R66C 2CHZA 1T0YA
chains in the Genus database with same CATH topology
4IM2A 1I35A 2L8JA 1V49A 2BPSA 2J0KA 4DBGA 3IBEA 3VXWA 4HLEA 2BKFA 1Q0WB 1XD3B 4GU2A 1YX5B 2DYMA 1C1YB 2LXCA 3ZLZA 3ZRCA 3DVNV 4ANUA 1WE7A 2DAFA 4HPLB 4IUMB 4WJQA 5DPTA 3A1QB 5GMVA 2G4DB 3QQ8B 4M0WB 5C23A 3VTUA 4M8NA 2KDFB 3O65B 3JSVA 2LRUA 2NBUA 2FCQA 2KDEB 2ZNVB 2DYOA 4MGZE 2JF5A 2R2OA 1WMHB 1K8RB 3AXCA 3EECA 2MRPA 4FBJB 2DX5B 3W1SC 1WE6A 4W9FA 1WI0A 2KZRA 1C3TA 2GBNA 2C7NB 2GBKA 2IO1B 4TKNA 1X1MA 4DHJD 1LM8B 3V60A 4GGQA 4ANXA 2N9PC 3VHTC 3DPDA 2DYBA 1J8CA 1E8WA 4EUTA 2N7EA 3OJ4B 4EKUA 3U7DA 1WY8A 3PZDA 3APDA 3ZTDA 3UQBA 3IG3A 3H7PA 1WF9A 3RD2A 4WWNA 2J0MA 3OAWA 3WIMA 2NPTA 3LDZE 2KWVB 2AL6A 3VH4B 4I6PA 4ICUA 1Z2MA 2C60A 2ZPYA 1MG8A 1WX8A 4ZRIA 1WR1A 4TUUA 4NAWB 4FA6A 2N9XA 3T8MA 2HJ8A 4IM0A 4CYEA 1ISNA 2DZIA 3IFWB 3PT2B 4NQKE 2N7DA 3PTFC 2BYEA 2MP2B 2KQSA 1CMXB 3V6CB 3A4SC 1A5RA 4PYUA 1BT0A 4P7IA 2FIDA 2QHOA 2CHWA 3QHTA 4WJPA 4WQOB 3DBRI 5D7GA 1V80A 4FJYA 1V9JA 2KJRA 4PS8A 4WAAA 2C9WB 3VUYA 2CR5A 1Q1OA 4IWOA 3TL5A 1GJZA 5JHAA 2IZVB 2ZVNA 1HE8A 3DCGA 3QWZB 4FN2A 1GC7A 3U30A 1NBFC 5CX3A 3QA8A 2LVOA 1H8CA 2RPQA 3Q3JA 2Z0DB 2JZ3B 2KWCA 4PS7A 1WIAA 2V1YA 4FADA 4RM9A 2KFKA 5LLIA 1R4MI 3B0AA 5DCNA 2MBBB 4FJVB 5CHWA 3ZUNA 2LVQA 3TBLD 2GBRA 2HD5B 3IVFA 4MM3A 1KOTA 2KNBA 2GBMA 2V4LA 2LZ6A 2KC1A 2YVCA 3PGEA 4KV2A 1SGHA 2L0FA 3JW0X 4URKA 2IO2B 4XZ4A 4WJOA 4LDTD 4LDTB 4EZJA 1U4AA 4W9EA 1YIWA 3DOWA 1LXDA 1TBEA 2KXJA 3M62B 5HKHA 3NHEB 2LJ5A 4WJNA 2A5UA 3L17A 1WXMA 2K25A 4KDIC 4KZ0A 5D2MB 1WZ0A 2XK5A 4GDKB 4BFRA 3RUIB 4AJYB 2LGYA 3BY4B 1KM7A 4DHZB 3RULA 2K1FA 4MDKE 4NPNA 4MGYE 2NVUI 4AP4C 3UGBB 1S3SG 2LGDA 3EHVA 2DZKA 1EO6A 2EKEC 4K7UA 2J0JA 1S1QB 3UINB 2V3SA 4IWQA 2UYZB 2WX0A 4B95A 3IHPC 4WWPA 1E7VA 2FCSA 4GB9A 3L08A 2D2QA 4GSWA 3PRMB 3VFKA 3ZW3A 4BBNC 2D11A 4WWOA 2KD0A 3EC8A 3QAQA 4W9CA 2KQ7A 2L3ZA 4CO7A 2AEHA 5G55A 3SDLC 2EMSA 2KDIA 3QK0A 3ZDTA 2I1JA 3NY5A 3ZIMA 2MBHA 4BOSC 3DVGY 2PPHA 4W9KA 1XQQA 4ICVA 2MBQA 4X57B 3WA0A 4RMAA 2UWQA 3H9DA 5J2RA 1L2NA 2KTFA 1F9JA 1YQBA 3GZNI 2NBVB 3PVLA 4BKGA 4XC2A 3ALBA 2FCNA 2N1VA 2G3QB 3BINA 1E5WA 5JHBA 2KJHB 3QC8B 3RZFA 2BGFA 2KWUB 4MGKE 3TJPA 3ZDMC 1Y8RC 1L7YA 4E3CA 1WRDB 3KYDD 4NAWA 3DDCB 2BWFA 3GOEA 2I1KA 3MJWA 2KO3A 5EDSA 2JZZA 3DBLI 3TMPB 3W1YA 2NBWB 3ZNID 3ZTCA 3CSFA 1GG3A 2IY0B 2D3GA 2N1WA 3PLVA 3PV1A 2CS4A 3TIXA 1J0GA 4I6NB 3PHXB 1V81A 3DVNU 3CSTA 4IM3A 3WANA 2KN5A 5KHOA 2M1MA 2KFJA 2MQJA 1P9DU 4W9DA 5CHVC 3KVFB 2R2QA 4HCNB 2ZZPB 3A9JB 2ZNVC 4II2B 2DHZA 1NDDA 3AULA 1YJ1A 3JYUA 3Q3FA 2AWTA 4HDQA 1LQBA 4HCPB 1I42A 2KANA 1EUVB 4RM8A 2CKHB 3DQVA 2KMAA 4K1RB 4NJ6A 4A3PA 1EF5A 2W9NA 4EEWA 5LXIB 2FNJB 2EMTA 4HXDA 3MTNB 2K8HA 4J6IA 2JXXA 4PYZA 2O2VA 4LJPB 3VTVA 4W9JA 1UELA 1WM2A 2KX0A 2N4FA 3H7SA 3NS8A 3A33B 5J17A 2KLCA 5AEKB 4BOZB 4I6LB 2MWSB 3DBHI 2K6DB 4FHJA 4HPMB 1WR6E 5IAAC 2DZMA 3RT3B 1WJNA 5J18A 3PS6A 3KW5B 3PREA 5AZHA 3HK0A 1WJ4A 2A4ZA 4TV3A 4DDGD 3ECIA 1WM3A 4ZRJA 3AI5A 1PQSA 2FCMA 4K81A 4NNJB 3D32A 2D10A 2MA9B 3JVZX 1VCBA 2G4SA 4LJOB 1SE9A 3V6EB 2PJHA 3ZO5B 4B9KA 2WDTB 2HTHA 1E8ZA 1WJUA 4GIVA 1KJTA 1KLVA 2FAZA 2KFKB 4M8MA 1WXAA 4EZLA 2ZCCA 3OLMD 1E8XA 2KDBA 3A4RA 4DHZE 2ZCBA 2MSED 2JRHA 2DZJA 2MW5A 1UH6A 1Q5WB 1WFYA 2AYOB 4HK2A 4IW0A 5E6OA 4AJWA 3ZKJC 2K39A 2LGXA 1OEYJ 4FJZA 4W9LA 2KKCA 3ML9A 1YD8U 4TQ0A 3ZNGC 5IA7A 1Z5SB 2K8CA 2MBEA 4MELA 2BYFA 1E90A 3SU8X 3N32A 3WAMA 4A3OA 4BVUC 4DDID 5FR6A 1WGDA 4FLHA 4GXBA 4KSLC 5CHFA 2MP2A 5AZGA 5TR5A 4AWJA 3RYTA 2JUOA 4A20A 2BWES 5JZEB 1UBIA 4W9IA 2DENB 3R7QA 4BKSA 3ONSA 1NI2A 2ZVOA 4BBNF 4CHKA 1V2YA 1WJ6A 2PEAA 2MX2A 1UD7A 4FULA 2Z0EB 2JWZA 3HM3A 5DPWA 4EZKA 4JIOU 2C7MB 2VRRB 3M95A 1ZW7A 3SD5A 4ZDVA 1OQYA 3H7PB 2KX3A 2RR9A 3A9KA 3VAWA 3TCAA 2JPHA 5L95C 4II3B 2ZEQA 1M94A 2NR2A 5D94A 3VUWA 1P3QU 3UIPB 4K7WA 2M4NA 1XT9B 1AARA 2OJRA 3QCAA 3ZVVA 2KHWB 1UGMA 5D6JB 2OOBB 3WAPA 1WMHA 1OEYA 4GOCA 3PRPB 2BF8B 3PPAA 4OVUA 3KH0A 2JY6A 1WXSA 4XX5A 4BKTA 3R7RA 3ENEA 3A1QA 4KVGB 5E6PA 5DPRA 1P1AA 2WYQA 3L54A 5L83A 4B6WA 1WXVA 3KUCB 4LCDE 1WGYA 2RGFA 1E7UA 1P98A 2ASQA 2KTRB 3MHSD 3APFA 4DXAB 4K7SA 2WX1A 1IPGA 2KK8A 2L0TA 3QJZA 4DWFA 4G50A 2GBJA 3KUZA 3QIJA 1IYFA 2LXAA 3M63B 3RZWC 4KSKC 1ZKHA 4KDLB 1EF1A 4GDLA 4PS3A 4IWPA 2REXA 1IP9A 2HE7A 3OJ3A 5DPSA 1GUAB 2L7RA 2YLMA 1D3ZA 1V6EA 4F8CB 4E71A 2XK5B 3HM6X 1OGWA 2XEWA 4GDKA 4JL9A 4MJSB 2D07B 3H1UA 4IC7B 1WGGA 4DHJB 3I3TB 4ZYNA 1LFDA 4MJSA 4W9HA 3L13A 3KYCD 2ZPNA 3VDZA 4FHKA 1WZ3A 1YX6B 1UBQA 1TZ1A 5LXHA 3UQAA 2IO3B 1OTRB 2XBBC 4ZRKA 2O2VB 2O6VA 2MLBA 4E74A 2N9EB 1TTNA 2M17A 2BYVE 1GNUA 2RSUA 3SHQA 3L0WB 1E8YA 1J19A 3A9KB 4HDOA 1VD2A 4AUQC 3X0WA 3QARA 5BO4B 3PSEB 4OVVA 3WALA 1WX7A 3L16A 4EOYA 1WGRA 2NPTB 3A9JA 4DK5A 2ZJDA 3ZRFA 3UF8A 3V61A 1V86A 2KC2A 2JT4B 2PE6B 2FUHB 2MCNB 3EFUA 2G45B 2CU1A 3ZNZB 2LD9A 2KOXA 2IYDB 2L76A 3N3KB 3QX1A 1RRBA 2LVPA 4G11A 3K9PB 1FXTB 3PLUA 4JGHB 4NJ7A 4F7ZA 4EFOA 3K9OB 3X23A 2B3AA 2WWZA 3T9LA 3CMMB 1JRUA 1P0RA 2JVCA 2LUEA 3B08A 3NZSA 2IY1B 4MGIE 2C7HA 3DVGX 3WAOA 2PE9A 2Z59B 3APCA 4BKSD 2CHXA 3L10B 2KMCA 2LWPA 2NS5A 2LI5A 2FIFA 1GC6A 2KVRA 2K6QA 5JH5C 4ANWA 4F1SA 4YL8A 4NY0A 3RCZA 3C0RB 2J7QB 2RD0A 3HHMA 3PRZA 4MH0E 2M0XA 1WGHA 1H4RA 2C5LC 3S2AA 1V5OA 2Y5BB 3AU5A 4HWIB 2KJ6A 3P2BA 4TQ1A 1R4NI 2LRWA 3KUDB 3B1LX 2L05A 2DAJA 4GMVA 4IG7B 3VUXA 5KHQA 3HIZA 4JLCA 1SIFA 3LJ3A 1QZEA 4G0NB 4MSMB 5G2NA 3NZUA 1RLFA 2M8SA 3ML8A 3NOBA 4KZCA 4MSQB 3JSVB 3R3MA 2AL3A 4KIKA 4JQWC 1UZXB 4N9F4 3VTWA 3H6NA 2O6VB 1WX9A 4W9GA 3VQIA 4HVBA 2NCNA 1V5TA 3PHWB 2L00B 1RAXA 2JRIB 5E6NA 3V62A 2MBOA 4ASWC 4ANVA 1G6JA 2IBIB 4GN1A 2IO0B 3M3JA 1TGZB 5CTRC 4KIKB 3AU4A 3DBSA 3VH3B 3CF6E 2LASA 2GMIC 1WYWB 2BKRB 1ZGUB 2KTRA 3VVWB 3W1SA 5C1ZA 3UIOB 4AOFA 2GOWA 4MEMA 1RFAA 3N30A 4GDLB 5AZFA 4G3XB 4HJKA 2O6VD 3ZNHB 4NQLB 3U8ZA 1WH3A 2KLGA 2K8BA 3R66C 2CHZA 1T0YA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4IM2 A;  1I35 A;  2L8J A;  1V49 A;  2BPS A;  2J0K A;  4DBG A;  3IBE A;  3VXW A;  4HLE A;  2BKF A;  1Q0W B;  1XD3 B;  4GU2 A;  1YX5 B;  2DYM A;  1C1Y B;  2LXC A;  3ZLZ A;  3ZRC A;  3DVN V;  4ANU A;  1WE7 A;  2DAF A;  4HPL B;  4IUM B;  4WJQ A;  5DPT A;  3A1Q B;  5GMV A;  2G4D B;  3QQ8 B;  4M0W B;  5C23 A;  3VTU A;  4M8N A;  2KDF B;  3O65 B;  3JSV A;  2LRU A;  2NBU A;  2FCQ A;  2KDE B;  2ZNV B;  2DYO A;  4MGZ E;  2JF5 A;  2R2O A;  1WMH B;  1K8R B;  3AXC A;  3EEC A;  2MRP A;  4FBJ B;  2DX5 B;  3W1S C;  1WE6 A;  4W9F A;  1WI0 A;  2KZR A;  1C3T A;  2GBN A;  2C7N B;  2GBK A;  2IO1 B;  4TKN A;  1X1M A;  4DHJ D;  1LM8 B;  3V60 A;  4GGQ A;  4ANX A;  2N9P C;  3VHT C;  3DPD A;  2DYB A;  1J8C A;  1E8W A;  4EUT A;  2N7E A;  3OJ4 B;  4EKU A;  3U7D A;  1WY8 A;  3PZD A;  3APD A;  3ZTD A;  3UQB A;  3IG3 A;  3H7P A;  1WF9 A;  3RD2 A;  4WWN A;  2J0M A;  3OAW A;  3WIM A;  2NPT A;  3LDZ E;  2KWV B;  2AL6 A;  3VH4 B;  4I6P A;  4ICU A;  1Z2M A;  2C60 A;  2ZPY A;  1MG8 A;  1WX8 A;  4ZRI A;  1WR1 A;  4TUU A;  4NAW B;  4FA6 A;  2N9X A;  3T8M A;  2HJ8 A;  4IM0 A;  4CYE A;  1ISN A;  2DZI A;  3IFW B;  3PT2 B;  4NQK E;  2N7D A;  3PTF C;  2BYE A;  2MP2 B;  2KQS A;  1CMX B;  3V6C B;  3A4S C;  1A5R A;  4PYU A;  1BT0 A;  4P7I A;  2FID A;  2QHO A;  2CHW A;  3QHT A;  4WJP A;  4WQO B;  3DBR I;  5D7G A;  1V80 A;  4FJY A;  1V9J A;  2KJR A;  4PS8 A;  4WAA A;  2C9W B;  3VUY A;  2CR5 A;  1Q1O A;  4IWO A;  3TL5 A;  1GJZ A;  5JHA A;  2IZV B;  2ZVN A;  1HE8 A;  3DCG A;  3QWZ B;  4FN2 A;  1GC7 A;  3U30 A;  1NBF C;  5CX3 A;  3QA8 A;  2LVO A;  1H8C A;  2RPQ A;  3Q3J A;  2Z0D B;  2JZ3 B;  2KWC A;  4PS7 A;  1WIA A;  2V1Y A;  4FAD A;  4RM9 A;  2KFK A;  5LLI A;  1R4M I;  3B0A A;  5DCN A;  2MBB B;  4FJV B;  5CHW A;  3ZUN A;  2LVQ A;  3TBL D;  2GBR A;  2HD5 B;  3IVF A;  4MM3 A;  1KOT A;  2KNB A;  2GBM A;  2V4L A;  2LZ6 A;  2KC1 A;  2YVC A;  3PGE A;  4KV2 A;  1SGH A;  2L0F A;  3JW0 X;  4URK A;  2IO2 B;  4XZ4 A;  4WJO A;  4LDT D;  4LDT B;  4EZJ A;  1U4A A;  4W9E A;  1YIW A;  3DOW A;  1LXD A;  1TBE A;  2KXJ A;  3M62 B;  5HKH A;  3NHE B;  2LJ5 A;  4WJN A;  2A5U A;  3L17 A;  1WXM A;  2K25 A;  4KDI C;  4KZ0 A;  5D2M B;  1WZ0 A;  2XK5 A;  4GDK B;  4BFR A;  3RUI B;  4AJY B;  2LGY A;  3BY4 B;  1KM7 A;  4DHZ B;  3RUL A;  2K1F A;  4MDK E;  4NPN A;  4MGY E;  2NVU I;  4AP4 C;  3UGB B;  1S3S G;  2LGD A;  3EHV A;  2DZK A;  1EO6 A;  2EKE C;  4K7U A;  2J0J A;  1S1Q B;  3UIN B;  2V3S A;  4IWQ A;  2UYZ B;  2WX0 A;  4B95 A;  3IHP C;  4WWP A;  1E7V A;  2FCS A;  4GB9 A;  3L08 A;  2D2Q A;  4GSW A;  3PRM B;  3VFK A;  3ZW3 A;  4BBN C;  2D11 A;  4WWO A;  2KD0 A;  3EC8 A;  3QAQ A;  4W9C A;  2KQ7 A;  2L3Z A;  4CO7 A;  2AEH A;  5G55 A;  3SDL C;  2EMS A;  2KDI A;  3QK0 A;  3ZDT A;  2I1J A;  3NY5 A;  3ZIM A;  2MBH A;  4BOS C;  3DVG Y;  2PPH A;  4W9K A;  1XQQ A;  4ICV A;  2MBQ A;  4X57 B;  3WA0 A;  4RMA A;  2UWQ A;  3H9D A;  5J2R A;  1L2N A;  2KTF A;  1F9J A;  1YQB A;  3GZN I;  2NBV B;  3PVL A;  4BKG A;  4XC2 A;  3ALB A;  2FCN A;  2N1V A;  2G3Q B;  3BIN A;  1E5W A;  5JHB A;  2KJH B;  3QC8 B;  3RZF A;  2BGF A;  2KWU B;  4MGK E;  3TJP A;  3ZDM C;  1Y8R C;  1L7Y A;  4E3C A;  1WRD B;  3KYD D;  4NAW A;  3DDC B;  2BWF A;  3GOE A;  2I1K A;  3MJW A;  2KO3 A;  5EDS A;  2JZZ A;  3DBL I;  3TMP B;  3W1Y A;  2NBW B;  3ZNI D;  3ZTC A;  3CSF A;  1GG3 A;  2IY0 B;  2D3G A;  2N1W A;  3PLV A;  3PV1 A;  2CS4 A;  3TIX A;  1J0G A;  4I6N B;  3PHX B;  1V81 A;  3DVN U;  3CST A;  4IM3 A;  3WAN A;  2KN5 A;  5KHO A;  2M1M A;  2KFJ A;  2MQJ A;  1P9D U;  4W9D A;  5CHV C;  3KVF B;  2R2Q A;  4HCN B;  2ZZP B;  3A9J B;  2ZNV C;  4II2 B;  2DHZ A;  1NDD A;  3AUL A;  1YJ1 A;  3JYU A;  3Q3F A;  2AWT A;  4HDQ A;  1LQB A;  4HCP B;  1I42 A;  2KAN A;  1EUV B;  4RM8 A;  2CKH B;  3DQV A;  2KMA A;  4K1R B;  4NJ6 A;  4A3P A;  1EF5 A;  2W9N A;  4EEW A;  5LXI B;  2FNJ B;  2EMT A;  4HXD A;  3MTN B;  2K8H A;  4J6I A;  2JXX A;  4PYZ A;  2O2V A;  4LJP B;  3VTV A;  4W9J A;  1UEL A;  1WM2 A;  2KX0 A;  2N4F A;  3H7S A;  3NS8 A;  3A33 B;  5J17 A;  2KLC A;  5AEK B;  4BOZ B;  4I6L B;  2MWS B;  3DBH I;  2K6D B;  4FHJ A;  4HPM B;  1WR6 E;  5IAA C;  2DZM A;  3RT3 B;  1WJN A;  5J18 A;  3PS6 A;  3KW5 B;  3PRE A;  5AZH A;  3HK0 A;  1WJ4 A;  2A4Z A;  4TV3 A;  4DDG D;  3ECI A;  1WM3 A;  4ZRJ A;  3AI5 A;  1PQS A;  2FCM A;  4K81 A;  4NNJ B;  3D32 A;  2D10 A;  2MA9 B;  3JVZ X;  1VCB A;  2G4S A;  4LJO B;  1SE9 A;  3V6E B;  2PJH A;  3ZO5 B;  4B9K A;  2WDT B;  2HTH A;  1E8Z A;  1WJU A;  4GIV A;  1KJT A;  1KLV A;  2FAZ A;  2KFK B;  4M8M A;  1WXA A;  4EZL A;  2ZCC A;  3OLM D;  1E8X A;  2KDB A;  3A4R A;  4DHZ E;  2ZCB A;  2MSE D;  2JRH A;  2DZJ A;  2MW5 A;  1UH6 A;  1Q5W B;  1WFY A;  2AYO B;  4HK2 A;  4IW0 A;  5E6O A;  4AJW A;  3ZKJ C;  2K39 A;  2LGX A;  1OEY J;  4FJZ A;  4W9L A;  2KKC A;  3ML9 A;  1YD8 U;  4TQ0 A;  3ZNG C;  5IA7 A;  1Z5S B;  2K8C A;  2MBE A;  4MEL A;  2BYF A;  1E90 A;  3SU8 X;  3N32 A;  3WAM A;  4A3O A;  4BVU C;  4DDI D;  5FR6 A;  1WGD A;  4FLH A;  4GXB A;  4KSL C;  5CHF A;  2MP2 A;  5AZG A;  5TR5 A;  4AWJ A;  3RYT A;  2JUO A;  4A20 A;  2BWE S;  5JZE B;  1UBI A;  4W9I A;  2DEN B;  3R7Q A;  4BKS A;  3ONS A;  1NI2 A;  2ZVO A;  4BBN F;  4CHK A;  1V2Y A;  1WJ6 A;  2PEA A;  2MX2 A;  1UD7 A;  4FUL A;  2Z0E B;  2JWZ A;  3HM3 A;  5DPW A;  4EZK A;  4JIO U;  2C7M B;  2VRR B;  3M95 A;  1ZW7 A;  3SD5 A;  4ZDV A;  1OQY A;  3H7P B;  2KX3 A;  2RR9 A;  3A9K A;  3VAW A;  3TCA A;  2JPH A;  5L95 C;  4II3 B;  2ZEQ A;  1M94 A;  2NR2 A;  5D94 A;  3VUW A;  1P3Q U;  3UIP B;  4K7W A;  2M4N A;  1XT9 B;  1AAR A;  2OJR A;  3QCA A;  3ZVV A;  2KHW B;  1UGM A;  5D6J B;  2OOB B;  3WAP A;  1WMH A;  1OEY A;  4GOC A;  3PRP B;  2BF8 B;  3PPA A;  4OVU A;  3KH0 A;  2JY6 A;  1WXS A;  4XX5 A;  4BKT A;  3R7R A;  3ENE A;  3A1Q A;  4KVG B;  5E6P A;  5DPR A;  1P1A A;  2WYQ A;  3L54 A;  5L83 A;  4B6W A;  1WXV A;  3KUC B;  4LCD E;  1WGY A;  2RGF A;  1E7U A;  1P98 A;  2ASQ A;  2KTR B;  3MHS D;  3APF A;  4DXA B;  4K7S A;  2WX1 A;  1IPG A;  2KK8 A;  2L0T A;  3QJZ A;  4DWF A;  4G50 A;  2GBJ A;  3KUZ A;  3QIJ A;  1IYF A;  2LXA A;  3M63 B;  3RZW C;  4KSK C;  1ZKH A;  4KDL B;  1EF1 A;  4GDL A;  4PS3 A;  4IWP A;  2REX A;  1IP9 A;  2HE7 A;  3OJ3 A;  5DPS A;  1GUA B;  2L7R A;  2YLM A;  1D3Z A;  1V6E A;  4F8C B;  4E71 A;  2XK5 B;  3HM6 X;  1OGW A;  2XEW A;  4GDK A;  4JL9 A;  4MJS B;  2D07 B;  3H1U A;  4IC7 B;  1WGG A;  4DHJ B;  3I3T B;  4ZYN A;  1LFD A;  4MJS A;  4W9H A;  3L13 A;  3KYC D;  2ZPN A;  3VDZ A;  4FHK A;  1WZ3 A;  1YX6 B;  1UBQ A;  1TZ1 A;  5LXH A;  3UQA A;  2IO3 B;  1OTR B;  2XBB C;  4ZRK A;  2O2V B;  2O6V A;  2MLB A;  4E74 A;  2N9E B;  1TTN A;  2M17 A;  2BYV E;  1GNU A;  2RSU A;  3SHQ A;  3L0W B;  1E8Y A;  1J19 A;  3A9K B;  4HDO A;  1VD2 A;  4AUQ C;  3X0W A;  3QAR A;  5BO4 B;  3PSE B;  4OVV A;  3WAL A;  1WX7 A;  3L16 A;  4EOY A;  1WGR A;  2NPT B;  3A9J A;  4DK5 A;  2ZJD A;  3ZRF A;  3UF8 A;  3V61 A;  1V86 A;  2KC2 A;  2JT4 B;  2PE6 B;  2FUH B;  2MCN B;  3EFU A;  2G45 B;  2CU1 A;  3ZNZ B;  2LD9 A;  2KOX A;  2IYD B;  2L76 A;  3N3K B;  3QX1 A;  1RRB A;  2LVP A;  4G11 A;  3K9P B;  1FXT B;  3PLU A;  4JGH B;  4NJ7 A;  4F7Z A;  4EFO A;  3K9O B;  3X23 A;  2B3A A;  2WWZ A;  3T9L A;  3CMM B;  1JRU A;  1P0R A;  2JVC A;  2LUE A;  3B08 A;  3NZS A;  2IY1 B;  4MGI E;  2C7H A;  3DVG X;  3WAO A;  2PE9 A;  2Z59 B;  3APC A;  4BKS D;  2CHX A;  3L10 B;  2KMC A;  2LWP A;  2NS5 A;  2LI5 A;  2FIF A;  1GC6 A;  2KVR A;  2K6Q A;  5JH5 C;  4ANW A;  4F1S A;  4YL8 A;  4NY0 A;  3RCZ A;  3C0R B;  2J7Q B;  2RD0 A;  3HHM A;  3PRZ A;  4MH0 E;  2M0X A;  1WGH A;  1H4R A;  2C5L C;  3S2A A;  1V5O A;  2Y5B B;  3AU5 A;  4HWI B;  2KJ6 A;  3P2B A;  4TQ1 A;  1R4N I;  2LRW A;  3KUD B;  3B1L X;  2L05 A;  2DAJ A;  4GMV A;  4IG7 B;  3VUX A;  5KHQ A;  3HIZ A;  4JLC A;  1SIF A;  3LJ3 A;  1QZE A;  4G0N B;  4MSM B;  5G2N A;  3NZU A;  1RLF A;  2M8S A;  3ML8 A;  3NOB A;  4KZC A;  4MSQ B;  3JSV B;  3R3M A;  2AL3 A;  4KIK A;  4JQW C;  1UZX B;  4N9F 4;  3VTW A;  3H6N A;  2O6V B;  1WX9 A;  4W9G A;  3VQI A;  4HVB A;  2NCN A;  1V5T A;  3PHW B;  2L00 B;  1RAX A;  2JRI B;  5E6N A;  3V62 A;  2MBO A;  4ASW C;  4ANV A;  1G6J A;  2IBI B;  4GN1 A;  2IO0 B;  3M3J A;  1TGZ B;  5CTR C;  4KIK B;  3AU4 A;  3DBS A;  3VH3 B;  3CF6 E;  2LAS A;  2GMI C;  1WYW B;  2BKR B;  1ZGU B;  2KTR A;  3VVW B;  3W1S A;  5C1Z A;  3UIO B;  4AOF A;  2GOW A;  4MEM A;  1RFA A;  3N30 A;  4GDL B;  5AZF A;  4G3X B;  4HJK A;  2O6V D;  3ZNH B;  4NQL B;  3U8Z A;  1WH3 A;  2KLG A;  2K8B A;  3R66 C;  2CHZ A;  1T0Y A; 
#chains in the Genus database with same CATH topology
 1I35 A;  2L8J A;  5C2T B;  2J0K A;  4DBG A;  4HLE A;  2BKF A;  1XD3 B;  1ROE A;  3SFD B;  3ZYY X;  2PLP A;  5GMV A;  3A1Q B;  5C23 A;  4M0W B;  4O1N A;  4M8N A;  2LGS A;  1AN8 A;  3JSV A;  2JF5 A;  1WMH B;  1K8R B;  1TIF A;  4FBJ B;  1WE6 A;  1P7F A;  4USA A;  1FFV A;  2C7N B;  3ETR A;  4DHJ D;  4YSY B;  1C4A A;  4EUT A;  2JYE A;  3OJ4 B;  1FRR A;  1AW7 A;  3ZTD A;  3IG3 A;  3AB5 A;  3OAW A;  3WIM A;  2KWV B;  1UF0 A;  5IOI A;  3BK1 A;  1ENF A;  3BYT B;  1TKY A;  4TUU A;  2ONQ A;  4IM0 A;  3IFW B;  2RDG A;  2N7D A;  3P63 A;  4PYU A;  2GRI A;  1BT0 A;  4P7I A;  2QHO A;  4WQO B;  3DBR I;  4FJY A;  2RPV A;  1KFY B;  1YN4 A;  4LTU A;  2ZVN A;  3QWZ B;  3AH7 A;  1N60 A;  3ZQ4 A;  3QA8 A;  1H8C A;  3Q3J A;  5JXV A;  1V1P A;  1FO4 A;  1R4M I;  1N6Z A;  5DCN A;  1N63 A;  2MBB B;  4FJV B;  3NRZ A;  1RYJ A;  1XXG A;  2GBR A;  2IJ0 A;  2V4L A;  2L0F A;  3JW0 X;  4EZJ A;  1YIW A;  1LXD A;  2L1A A;  1TBE A;  3M62 B;  2WU5 B;  4WJN A;  2A5U A;  1EM7 A;  2PKO A;  2XK5 A;  1NEN B;  3BY4 B;  3R8B A;  1CQV A;  2QSD A;  2VZK B;  4AP4 C;  1OQR A;  2DZK A;  2EKE C;  4CQN A;  1FRD A;  4IWQ A;  3UI3 A;  3U4E G;  4WWP A;  2FCS A;  2D2Q A;  4GSW A;  3ZW3 A;  2ZW1 A;  2KD0 A;  3T3O A;  2KQ7 A;  4YT0 B;  3Q8F A;  2I1J A;  3NY5 A;  3DVG Y;  1XQQ A;  4X57 B;  3KWL A;  4RMA A;  4A55 A;  3N9Y C;  3GZN I;  1F9J A;  2NBV B;  1D4B A;  1XO3 A;  2E3T A;  4XC2 A;  1SBB B;  1QF6 A;  1UUP A;  1YNT E;  2G3Q B;  1FEH A;  4P16 A;  3RZF A;  2JU6 X;  3ZDM C;  1T5X D;  3AN1 A;  1T0S C;  3AE1 B;  3B2F A;  3ZNI D;  2VZK D;  1GG3 A;  1ZXH A;  2D3G A;  3PLV A;  4C00 A;  1J0G A;  4HKQ A;  4W9D A;  5CHV C;  2NTS A;  2QMT A;  1BXT A;  2LGI A;  1NDD A;  1YJ1 A;  2JZP A;  4LLG M;  2ICI A;  1LQB A;  4A3P A;  2QCZ A;  2FE8 A;  4HXD A;  1C78 A;  2JXX A;  3ABV B;  2WXG A;  1D5Z C;  1E7P B;  3VTV A;  2N4F A;  3H7S A;  3A33 B;  4BOZ B;  3DBH I;  3RFZ B;  2D3A A;  2IPK D;  2AX5 A;  2DZM A;  3RT3 B;  3PRE A;  1N5X A;  1FMA D;  4TV3 A;  5BYR A;  4RGT A;  1FNV A;  2G4S A;  1I4H A;  1WJU A;  1GB4 A;  1KLV A;  2KFK B;  1WXA A;  1HZ5 A;  2ZCC A;  2MSE D;  2MW5 A;  4AJW A;  5E6O A;  1TYG B;  2BB5 A;  2K39 A;  2LGX A;  4FJZ A;  4W9L A;  3ML9 A;  3FAH A;  3SU8 X;  4A3O A;  4DHJ B;  5HI1 A;  3Q2A C;  5AZG A;  3NJT A;  5TR5 A;  2KVZ A;  4YSZ B;  3AED B;  4A20 A;  1TS2 A;  2DEN B;  3R7Q A;  4DXF A;  4BKS A;  3GP7 A;  3IAM 1;  3DBR B;  3ZXR A;  2Z0E B;  2JWZ A;  5DPW A;  4JIO U;  1ZW7 A;  2KX3 A;  4DXG A;  3VAW A;  4HJG E;  4XYC A;  1SIJ A;  3P42 A;  3DWG C;  5EE9 A;  1P3Q U;  1STE A;  4GLS C;  1F77 A;  4RNA A;  2OOB B;  4C7Y A;  1WMH A;  1OEY A;  3PRP B;  2BF8 B;  4C4V B;  4BKT A;  4YTP B;  5L83 A;  1L4D B;  2KDM A;  5E6J A;  2JXT A;  4KKI A;  1P98 A;  3EUB 2;  2MJD A;  3APF A;  1NEK B;  2L0T A;  2GBJ A;  4KSK C;  2PVG C;  1EF1 A;  1WGK A;  1GAQ B;  4A6Q A;  3OJ3 A;  5DPS A;  2HTM E;  1WRI A;  1D3Z A;  2XK5 B;  3N1Z C;  2KMM A;  2MH7 A;  4IC7 B;  4MJS A;  3W5U B;  3KYC D;  3RNG C;  1UBQ A;  1TZ1 A;  2XBB C;  4ZHO A;  1E6E B;  2MLB A;  4LNF A;  1TTN A;  5T8I A;  2RSU A;  4MT5 A;  3SHQ A;  1J19 A;  4HDO A;  1VD2 A;  3X0W A;  3QAR A;  3WAL A;  3W2D A;  2WXH A;  4IOI E;  2PE6 B;  2IGD A;  3EFU A;  1K52 A;  5G5G A;  4OHJ A;  2LUM A;  2D3C A;  2LD9 A;  3T3N A;  2X38 A;  4TMA B;  3K9P B;  4JGH B;  4EFO A;  1B1Z A;  3T9L A;  1JRU A;  1P0R A;  2JVC A;  2LUE A;  3B08 A;  1NVI D;  4TSS A;  1ET9 A;  2WHI A;  1PDX A;  4BKS D;  5I4D A;  2WXO A;  1XLO A;  3Q8E A;  2NS5 A;  2K3U A;  2FIF A;  2K6Q A;  2V9H A;  1TS4 A;  3MC0 B;  2RD0 A;  2M0X A;  2C5L C;  1TY0 A;  2J52 A;  5KHQ A;  1FXA A;  4PK1 A;  3GB1 A;  3ML8 A;  5H8Y E;  5HHD G;  1RFK A;  4JQW C;  1UZX B;  3VTW A;  3H6N A;  3LYY A;  5IO9 A;  1NYQ A;  4HVB A;  1F1H A;  3PHW B;  1RAX A;  1QOG A;  3H8H A;  1PYW D;  2IO0 B;  3DBS A;  3VH3 B;  3AEE B;  2BKR B;  1MG4 A;  4MEM A;  3N30 A;  5GXG B;  4GDL B;  4MM3 B;  2W55 A;  3P4P B;  3U8Z A;  3RI7 C;  2KLG A;  2IDY A;  1SJE D;  2E6X A;  1Q0W B;  1KRH A;  3ZRC A;  2LXC A;  1WYG A;  2W54 A;  3C19 A;  4ANU A;  1WE7 A;  4WJQ A;  3VTU A;  3ZXV A;  2I2Y A;  2Y3A A;  2R2O A;  4RFB A;  1ZE3 D;  1SE4 A;  3AE9 B;  2GLS A;  2KZR A;  1C3T A;  2GBN A;  2IO1 B;  1X1M A;  1LM8 B;  3DHI C;  4ANX A;  2N9P C;  3DPD A;  2DYB A;  1E8W A;  2WP9 B;  4EKU A;  3UQB A;  3PZD A;  1F0Z A;  1WF9 A;  3RD2 A;  4WWN A;  1T6B X;  3FIL B;  2NPT A;  3LDZ E;  2AL6 A;  1IGD A;  3W9C B;  4I6P A;  4WIP A;  3BWU D;  1J7C A;  3RNB C;  1MG8 A;  4ZOH C;  4ZRI A;  4YXD B;  4LNN A;  1TKE A;  2CU3 A;  4NAW B;  4FA6 A;  2HJ8 A;  4NQK E;  2DZI A;  3Q6B A;  5LNK 1;  2MJE A;  1QOB A;  1JWS D;  1KTK A;  2V3P A;  1A70 A;  1DYQ A;  2INP E;  3W5V B;  1V80 A;  1KLU D;  3C8Y A;  4WAA A;  2C9W B;  3VUY A;  1B9R A;  1GJZ A;  5JHA A;  1HE8 A;  3DCG A;  4FN2 A;  3U30 A;  2MJ3 A;  5CX3 A;  2FUG 1;  3OWE B;  3EGR A;  2LVO A;  2K0P A;  2KWC A;  2V1Y A;  1WSP A;  3MC8 A;  5CHW A;  3TBL D;  3IT4 B;  1R7S A;  4MM3 A;  2GBM A;  4OW0 A;  4URK A;  4XZ4 A;  3P1M A;  4LDT D;  3KWV A;  4LDT B;  4WJO A;  2YEP B;  1IBX B;  4MAC A;  2WDR B;  4KDI C;  1WZ0 A;  4L23 A;  3RUI B;  3EA6 A;  2K1F A;  1V8C A;  4NPN A;  4MGY E;  1C4P A;  1S3S G;  3BII D;  3EHV A;  1EO6 A;  2J0J A;  1S1Q B;  1HEZ E;  4L2Y A;  2M56 B;  3IHP C;  3IT6 B;  4P1C C;  4BBN C;  1L6U A;  4WWO A;  3QAQ A;  1I4R A;  2AEH A;  3ZDT A;  2MBH A;  4OZB A;  4BOS C;  1F52 A;  3WA0 A;  3R2T A;  5FK9 C;  2L52 A;  1L2N A;  2EEL A;  1TJE A;  1PUT A;  2FCN A;  5JHB A;  4YTM B;  1QKZ A;  2KWU B;  3TJP A;  1L7Y A;  1MI0 A;  1N61 A;  2I1K A;  5EDS A;  3W1Y A;  4Q2J A;  1F2R C;  2BS4 B;  5BMG A;  4DQO C;  1R4M B;  3DVN U;  2XNA C;  3CST A;  4IM3 A;  2L32 A;  3WAN A;  2M1M A;  2MQJ A;  1P9D U;  1VDV A;  3KVF B;  1FM0 D;  2R2Q A;  4II2 B;  3AUL A;  2AWT A;  3BK2 A;  4HDQ A;  1KLG D;  4HCP B;  2CKH B;  4K1R B;  4NJ6 A;  2YEP F;  4LNK A;  2FNJ B;  2WXM A;  4US8 A;  3KQ4 A;  4B0E A;  1WM2 A;  2KX0 A;  1IGC A;  3ZJT A;  2K6D B;  4ARI A;  2PVO D;  3PS6 A;  2A4Z A;  1YMH E;  3ECI A;  1WM3 A;  4K81 A;  2D10 A;  1MHX A;  2WXF A;  1OFF A;  1VCB A;  1SF0 A;  2VH1 A;  2PJH A;  4EE2 A;  2W82 A;  4GIV A;  2FAZ A;  4EZL A;  3BVM A;  3OLM D;  1C76 A;  3FKY A;  3A4R A;  4DHZ E;  2UU7 A;  2ZCB A;  4RF0 A;  2JRH A;  4IKG A;  1UH6 A;  1WFY A;  4HK2 A;  4IW0 A;  1MJD A;  1MVK A;  1L0X B;  1YD8 U;  1Z5S B;  4DDI D;  1A5R A;  1E90 A;  3WAM A;  1DGJ A;  1N5W A;  2D5G A;  1WGD A;  4FLH A;  2PMV A;  1HA5 A;  4KSL C;  2MP2 A;  2WXL A;  2QEJ C;  1UGJ A;  3GE3 C;  3V3X A;  2JUO A;  3AEG B;  4W9I A;  1L6V A;  3ONS A;  1V2Y A;  2HJ1 A;  1WJ6 A;  2PEA A;  2MX2 A;  1FNU A;  4FUL A;  3HM3 A;  3M95 A;  4ZDV A;  3AV8 A;  2RR9 A;  1UWX A;  3N1X C;  5L95 C;  2G1E A;  4K7W A;  1XT9 B;  1ZUD 2;  3QCA A;  4WH4 A;  2IGG A;  1NI3 A;  2AQ3 B;  2WQY B;  4OVU A;  2IND C;  2JY6 A;  1WXS A;  3BVZ A;  3A1Q A;  5DPR A;  2WYQ A;  1NYR A;  1WGY A;  1SXT A;  2KTR B;  3NVW A;  1IPG A;  4G50 A;  1ET6 A;  3KUZ A;  1IYF A;  1C77 A;  3RZW C;  4KDL B;  4GDL A;  4PS3 A;  2K9X A;  2YLM A;  4F8C B;  1OGW A;  4MJS B;  2CJN A;  3NG0 A;  1WGG A;  2J4X A;  2JYT A;  2X8X X;  2ZPN A;  3VDZ A;  3Q8A A;  4FHK A;  5BMH A;  2N9K A;  2AQ2 B;  5LXH A;  3E56 A;  2M17 A;  1FNW A;  2WXP A;  1EWC A;  3L0W B;  2WXJ A;  4AUQ C;  5BO4 B;  4OVV A;  4YTN B;  3NVV A;  3L16 A;  1C79 A;  2NPT B;  3A9J A;  3ZRF A;  3RNA C;  3V61 A;  2KC2 A;  1EU3 A;  4REZ A;  2FUH B;  2MCN B;  4JWS C;  2G45 B;  2RDH A;  3ZNZ B;  4UDU C;  4XE0 A;  3QX1 A;  4YWG G;  1RRB A;  2LVP A;  3NVZ A;  2WWZ A;  3NZS A;  2PE9 A;  2D3B A;  2KMC A;  3FC4 A;  1GC6 A;  1ZPS A;  4BZA A;  5JH5 C;  3Q69 A;  4F1S A;  4YL8 A;  3RCZ A;  3C0R B;  3HHM A;  1WGH A;  1V5O A;  2Y5B B;  2LRW A;  3KUD B;  3B1L X;  2DAJ A;  2IGH A;  3LJ3 A;  1QLB B;  5AUK A;  4MSM B;  1SJH D;  2BQQ A;  4MSQ B;  1CJE A;  2WXR A;  2LHE A;  2CJO A;  3V62 A;  4ASW C;  4ANV A;  2QJL A;  5CTR C;  4KIK B;  2GI9 A;  2LAS A;  2V4I B;  4WQM A;  1HTO A;  2BYT A;  1T3Q A;  4G3X B;  4NQL B;  2K8B A;  1JRP A;  1K50 A;  4C4V A;  2BPS A;  3VXW A;  1MHH E;  1YX5 B;  1VLB A;  3TEZ A;  1XCQ L;  4HEA 1;  4KX6 B;  3Q14 C;  2DAF A;  2B76 B;  4HPL B;  3J9C A;  5DPT A;  3QQ8 B;  1XCT L;  2KDF B;  2PW9 A;  3O65 B;  4KGS A;  2LRU A;  2NBU A;  2KDE B;  2VH2 A;  2DYO A;  4MGZ E;  3AXC A;  1VZ8 A;  3AE8 B;  1WI0 A;  4TKN A;  2BVC A;  3VHT C;  2BB6 A;  2QIL A;  2EKI A;  3H7P A;  2J0M A;  2QC8 A;  4WWM A;  1I7H A;  3VH4 B;  3Q3N C;  2SAK A;  4ICU A;  3MJ5 A;  2C60 A;  3Q8C A;  1WX8 A;  3DBH B;  3GS2 A;  1QOF A;  3T8M A;  1HXY D;  1ISN A;  3KLS X;  1DOX A;  1XLQ A;  2MP2 B;  5D3I B;  2KQS A;  3V6C B;  3A4S C;  4XGA B;  2CHW A;  3QHT A;  4WJP A;  5D7G A;  1XLN A;  2KJR A;  1BML C;  1D6E C;  1Q1O A;  3TL5 A;  2IZV B;  3Q3M C;  1GC7 A;  1QQR A;  1NBF C;  1TY2 A;  3AEA B;  2RPQ A;  4FXC A;  4PS7 A;  4FAD A;  4RM9 A;  2MHJ A;  3B0A A;  2JSV X;  3ZUN A;  1T0Q C;  2LVQ A;  3TEX A;  2KNB A;  1KOT A;  4KV2 A;  2KC1 A;  3N1Y C;  1SGH A;  2IO2 B;  4OZA A;  4W9E A;  2Q5W D;  1SE3 A;  2KXJ A;  5HKH A;  1ZP0 B;  1V1O A;  2LJ5 A;  3L17 A;  2K25 A;  4KZ0 A;  5D2M B;  3URY A;  4GDK B;  4BFR A;  4AJY B;  2TSS A;  1JAL A;  2LGY A;  1KM7 A;  1AYF A;  1TS5 A;  2LGD A;  1DOI A;  1C4C A;  2J42 A;  2V3S A;  3LXF A;  4JE3 B;  4C7Z A;  2WX0 A;  1E7V A;  3NS1 A;  4GB9 A;  3L08 A;  3PRM B;  3DHG C;  2D11 A;  3EC8 A;  4A90 A;  3AM9 A;  5G55 A;  1TT5 B;  2KDI A;  3QK0 A;  3FIL A;  1E9M A;  4ICV A;  3PZ8 A;  2UWQ A;  3H9D A;  5J2R A;  1YQB A;  4BKG A;  5TSS A;  2N1V A;  4BAX A;  1JWU D;  3BIN A;  1E5W A;  2KJH B;  1JML A;  2BGF A;  4MGK E;  3CIR B;  2W3S A;  3KYD D;  4NAW A;  2XN9 C;  2BWF A;  3GOE A;  2KO3 A;  3DBL I;  3TMP B;  2G9H D;  3CSF A;  5BYS A;  2N1W A;  2WXI A;  3PV1 A;  2CS4 A;  3TIX A;  5EE0 A;  2K5P A;  3I5J C;  3PHX B;  1V81 A;  5KHO A;  2KFJ A;  4LNI A;  5HFY A;  4HCN B;  3RNE C;  3JYU A;  3AE5 B;  3Q3F A;  2GB1 A;  1I4G A;  1I42 A;  2L83 A;  1EUV B;  1FPY A;  1JQ4 A;  5LXI B;  1EU4 A;  2EMT A;  2K8H A;  4M0W A;  1VR9 A;  4PYZ A;  2DLB A;  2WDQ B;  3I57 A;  4W9J A;  3ZGZ A;  3NS8 A;  5H92 C;  3SR6 A;  5AEK B;  4I6L B;  4HPM B;  1WR6 E;  5IAA C;  1R4N B;  5J18 A;  3KW5 B;  1RM6 C;  4KGR A;  2BTE A;  2FBW B;  1ZDX A;  4ZRJ A;  3AI5 A;  2FCM A;  2MA9 B;  3JVZ X;  3AE3 B;  1SE9 A;  3ZO5 B;  2WDT B;  2HTH A;  1E8Z A;  2M19 A;  3U7Z A;  4M8M A;  2BBC A;  1HQR D;  2KDB A;  1Q5W B;  2AYO B;  4TQ0 A;  4AS1 A;  4MEL A;  2MBE A;  5FKA C;  5IA7 A;  3N32 A;  1LGR A;  1UWM A;  5FR6 A;  5CHF A;  4HRO A;  4AWJ A;  4C80 A;  1D5M C;  1N62 A;  2BWE S;  5JZE B;  1MPE A;  1UBI A;  2R61 A;  2WGS A;  2WNM A;  1UD7 A;  1ESF A;  3DHH C;  2DWQ A;  5IKC M;  2VRR B;  3SD5 A;  4OVZ A;  2NR2 A;  3R2I A;  3UIP B;  1WWT A;  2DBY A;  3ZVV A;  2KHW B;  1UGM A;  1P7E A;  3WAP A;  4GOC A;  1KF6 B;  3R7R A;  3ENE A;  4N59 A;  4KVG B;  1P1A A;  3L54 A;  4NJC A;  1WXV A;  3KUC B;  1D5X C;  3NVY A;  4B0M A;  2H88 B;  3MC9 A;  2HDE A;  2N7J A;  4DXA B;  2WX1 A;  2KK8 A;  4J3O D;  3QIJ A;  5AUI A;  3M63 B;  1JCK B;  1ZKH A;  1HZ6 A;  2BS3 B;  4IWP A;  4GDK A;  4OZC A;  3H1U A;  3HUI A;  4IDI A;  1K53 A;  1JWA D;  1LFD A;  3TUO A;  3MFG A;  1WZ3 A;  1YX6 B;  1T0R C;  1WXQ A;  1CZP A;  1CK1 A;  1YJI A;  4ZRK A;  2O2V B;  4E74 A;  1FCC C;  2N9E B;  1BUI C;  4A8X C;  1Y56 A;  2KAC A;  2OJW A;  3A9K B;  3O13 A;  3MHZ A;  1WX7 A;  1VJK A;  1VZ7 A;  1XF5 L;  1E0Z A;  3IXS A;  4P1B C;  3RNC C;  2LEK A;  1TKG A;  2WXK A;  2KOX A;  3N3K B;  1MFW A;  3BYY B;  4G11 A;  1FXT B;  1F2R I;  1FCL A;  2B3A A;  3CMM B;  1TS3 A;  4RGM A;  2IY1 B;  4MGI E;  2C7H A;  3DVG X;  3WAO A;  3HRD D;  3APC A;  2CHX A;  5HG2 A;  3L10 B;  3P4S B;  4K3B A;  2LWP A;  3E9S A;  2LI5 A;  1QIL A;  4NY0 A;  2J7Q B;  4MH0 E;  4ZHP A;  3S2A A;  3AU5 A;  4HWI B;  3ZJV A;  2KJ6 A;  3PZ7 A;  2N9L A;  1R4N I;  3P2B A;  4GMV A;  4IG7 B;  2L05 A;  3VUX A;  3HIZ A;  4JLC A;  4G0N B;  5G2N A;  1XLP A;  2RMM A;  1RLF A;  2M8S A;  4MH8 A;  3JSV B;  2AL3 A;  4KIK A;  4N9F 4;  2O6V B;  1WX9 A;  1IBX A;  2NMQ A;  2NCN A;  3B9J A;  2JRI B;  2MBO A;  2IBI B;  4GN1 A;  1XEE A;  1VZ6 A;  3M3J A;  2MEK A;  1YOV B;  3AEB B;  3B2G A;  2GMI C;  1WYW B;  4H2A A;  2QDF A;  4WUR A;  5C1Z A;  4AOF A;  2GOW A;  3TSS A;  1RFA A;  2ON8 A;  4HJK A;  3ZNH B;  2AQ1 B;  2JWU A;  4IM2 A;  1V49 A;  1YJJ A;  2PIA A;  1L5P A;  3IBE A;  4GU2 A;  5IN7 A;  2DYM A;  1C1Y B;  3ZLZ A;  2ACZ B;  3DVN V;  4IUM B;  2G4D B;  2WU2 B;  2ZNV B;  5EE1 A;  2FCQ A;  4XWW A;  3EEC A;  1L0Y B;  2MRP A;  2KT7 A;  2DX5 B;  3W1S C;  5EE3 A;  4W9F A;  2GBK A;  4N6E B;  2V3N A;  3V60 A;  4GGQ A;  1J8C A;  2Z8L A;  2N7E A;  3RMK C;  4RGN A;  3U7D A;  1WY8 A;  3APD A;  1M4V A;  4HRS A;  2V0G A;  4JX1 C;  1Z2M A;  2ZPY A;  1E10 A;  1WR1 A;  4KKJ A;  2N9X A;  4CYE A;  3PT2 B;  3NUH B;  4R3D A;  3PTF C;  1SB3 C;  3GZN B;  2BYE A;  2KYW A;  1CMX B;  5IP4 D;  4PT5 A;  2FID A;  4ITK A;  5MPO A;  1PGB A;  4PS8 A;  1J7B A;  1V9J A;  4ARC A;  1PGA A;  2CR5 A;  4IWO A;  4K3C A;  5D3D A;  2Z0D B;  2JZ3 B;  4KGT A;  1WIA A;  2KFK A;  5LLI A;  4US9 A;  2HD5 B;  3N20 C;  3IVF A;  2WLB A;  1FXI A;  2LZ6 A;  2YVC A;  2BW2 A;  3PGE A;  4ZRP A;  4S0R A;  3NZ3 A;  1U4A A;  4XDD A;  2INC C;  3DOW A;  3AE4 B;  1LO5 D;  3NHE B;  2I38 A;  2SEB D;  2WXQ A;  1WXM A;  1JRO A;  4DHZ B;  3RUL A;  4MDK E;  2NVU I;  1QOA A;  3UGB B;  4RH6 A;  2M0A A;  1FFU A;  5FR3 A;  4K7U A;  3UIN B;  1L4Z B;  2UYZ B;  4B95 A;  3VFK A;  2QIE B;  4W9C A;  4CO7 A;  2L3Z A;  3SDL C;  4RGO S;  2LMC A;  2EMS A;  4LK0 M;  3ZIM A;  2NTT A;  1KH0 A;  2PPH A;  5BMI A;  2OHF A;  4W9K A;  2ZW0 A;  2MBQ A;  1I4X A;  2KTF A;  4L1B A;  3PVL A;  3ALB A;  3AE6 B;  1YQ4 B;  3QC8 B;  4RF1 A;  4E3C A;  1Y8R C;  1WRD B;  1YN3 A;  4M02 A;  1IUE A;  3DDC B;  3MJW A;  2JZZ A;  2NBW B;  3ZTC A;  2IY0 B;  2Y5P A;  1ZOY B;  4I6N B;  2Y5C A;  2KN5 A;  5BYQ A;  2ZZP B;  3A9J B;  2ZNV C;  2DHZ A;  3AEC B;  2KAN A;  4P6V F;  4RM8 A;  3DQV A;  2KMA A;  1EF5 A;  2W9N A;  4EEW A;  4J6I A;  3MTN B;  4RCO A;  1DOY A;  2O2V A;  4LJP B;  1PGX A;  2JQR B;  1UEL A;  4C56 C;  1L0V B;  1SEB D;  3BZD B;  5J17 A;  2KLC A;  1I4Q A;  2MWS B;  4A9A A;  3VRB B;  4FHJ A;  1VRA B;  3HVZ A;  1WJN A;  1J7A A;  1ZXI A;  5AZH A;  3U2S C;  3HK0 A;  1WJ4 A;  2WS3 B;  4DDG D;  3SEB A;  1PQS A;  4NNJ B;  3D32 A;  2J53 A;  2INN E;  3GE8 C;  4LJO B;  5C3J B;  3V6E B;  3TEW A;  4B9K A;  1KJT A;  1YN5 A;  1V97 A;  1SSN A;  4YSX B;  1E8X A;  3HVD A;  2N0S B;  1GPX A;  2DZJ A;  3ZKJ C;  1OEY J;  1Q10 A;  2BS2 B;  2KKC A;  3ZNG C;  4NZL B;  3BVG A;  2K8C A;  2BYF A;  2JX5 A;  4BVU C;  2LJI A;  4GXB A;  1I4P A;  3RYT A;  3I9V 1;  1GB1 A;  3RPF C;  4BBN F;  1NI2 A;  2ZVO A;  4CHK A;  3VR9 B;  4HPP A;  1K51 A;  3P4R B;  1FIQ A;  3RN9 C;  4AQ7 A;  3WCQ A;  4EZK A;  1PFD A;  2C7M B;  1OQY A;  3H7P B;  3A9K A;  1OQQ A;  3TCA A;  2JPH A;  3OG5 A;  4XDC A;  4II3 B;  2ZEQ A;  1M94 A;  5D94 A;  3VUW A;  2M4N A;  1AAR A;  2OJR A;  3CWI A;  3EFC A;  3Q3O C;  1RWS A;  5D6J B;  3MP9 A;  3VR8 B;  3PPA A;  3KH0 A;  1ZDV A;  4XX5 A;  1JWB D;  4N58 A;  5E6P A;  3Q8B A;  3V05 A;  4B6W A;  4LCD E;  1GOZ A;  2RGF A;  1JW9 D;  1E7U A;  2ASQ A;  4NAM A;  3MHS D;  3SFE B;  4K7S A;  3IAS 1;  3QJZ A;  4QAY A;  2WDV B;  4DWF A;  2WXN A;  4M01 A;  2LXA A;  2REX A;  1IP9 A;  2HE7 A;  3RNF C;  1GUA B;  2L7R A;  1V6E A;  2KAJ A;  4E71 A;  3HM6 X;  4JL9 A;  3ZJU A;  2XEW A;  2D07 B;  3I3T B;  4ZYN A;  4D2K A;  3AMZ A;  4W9H A;  3L13 A;  2PTL A;  3PO0 A;  2K22 A;  1HTQ A;  1TZO A;  4JWU C;  3UQA A;  2IO3 B;  1OTR B;  2O6V A;  1JWM D;  2KN4 A;  2BYV E;  1GNU A;  1E8Y A;  2H89 B;  3PSE B;  3DWM A;  2KQ4 X;  1YQ3 B;  1EWY C;  4EOY A;  3TEY A;  1WGR A;  4DK5 A;  2ZJD A;  3UF8 A;  1V86 A;  2JT4 B;  1SE2 A;  1FD6 A;  4ZRQ A;  2CU1 A;  2IYD B;  2L76 A;  4NJ7 A;  4LNO A;  3PLU A;  4F7Z A;  4XWT A;  3K9O B;  1ACC A;  3X23 A;  3P4Q B;  3AE7 B;  2Z59 B;  3AEF B;  3I63 C;  4M00 A;  2LFI A;  2KVR A;  1AWD A;  4ACF A;  4ANW A;  3PRZ A;  4JPS A;  1H4R A;  3AE2 B;  2BT6 A;  4TQ1 A;  1UNS A;  3W1S A;  3U52 E;  2RDB C;  1C9F A;  1SIF A;  1QZE A;  2DNF A;  5G5H A;  3NZU A;  3NOB A;  4KZC A;  3R3M A;  2LHD A;  3L4P A;  4S17 A;  4W9G A;  3VQI A;  2W3R A;  1V5T A;  2L00 B;  3DBL B;  5E6N A;  3VRA B;  1G6J A;  2OED A;  1TGZ B;  3AU4 A;  3LB8 C;  3CF6 E;  1V1P B;  1ZGU B;  2KTR A;  3VVW B;  3UIO B;  4HKZ E;  1QT9 A;  4ZYS A;  5AZF A;  2O6V D;  1WH3 A;  2KWD A;  4WAF A;  3R66 C;  2CHZ A;  1T0Y A; 
#chains in the Genus database with same CATH homology
 4IM2 A;  1I35 A;  2L8J A;  1V49 A;  2BPS A;  2J0K A;  4DBG A;  3IBE A;  3VXW A;  4HLE A;  2BKF A;  1Q0W B;  1XD3 B;  4GU2 A;  1YX5 B;  2DYM A;  1C1Y B;  2LXC A;  3ZLZ A;  3ZRC A;  3DVN V;  4ANU A;  1WE7 A;  2DAF A;  4HPL B;  4IUM B;  4WJQ A;  5DPT A;  3A1Q B;  5GMV A;  2G4D B;  3QQ8 B;  4M0W B;  5C23 A;  3VTU A;  4M8N A;  2KDF B;  3O65 B;  3JSV A;  2LRU A;  2NBU A;  2FCQ A;  2KDE B;  2ZNV B;  2DYO A;  4MGZ E;  2JF5 A;  2R2O A;  1WMH B;  1K8R B;  3AXC A;  3EEC A;  2MRP A;  4FBJ B;  2DX5 B;  3W1S C;  1WE6 A;  4W9F A;  1WI0 A;  2KZR A;  1C3T A;  2GBN A;  2C7N B;  2GBK A;  2IO1 B;  4TKN A;  1X1M A;  4DHJ D;  1LM8 B;  3V60 A;  4GGQ A;  4ANX A;  2N9P C;  3VHT C;  3DPD A;  2DYB A;  1J8C A;  1E8W A;  4EUT A;  2N7E A;  3OJ4 B;  4EKU A;  3U7D A;  1WY8 A;  3PZD A;  3APD A;  3ZTD A;  3UQB A;  3IG3 A;  3H7P A;  1WF9 A;  3RD2 A;  4WWN A;  2J0M A;  3OAW A;  3WIM A;  2NPT A;  3LDZ E;  2KWV B;  2AL6 A;  3VH4 B;  4I6P A;  4ICU A;  1Z2M A;  2C60 A;  2ZPY A;  1MG8 A;  1WX8 A;  4ZRI A;  1WR1 A;  4TUU A;  4NAW B;  4FA6 A;  2N9X A;  3T8M A;  2HJ8 A;  4IM0 A;  4CYE A;  1ISN A;  2DZI A;  3IFW B;  3PT2 B;  4NQK E;  2N7D A;  3PTF C;  2BYE A;  2MP2 B;  2KQS A;  1CMX B;  3V6C B;  3A4S C;  1A5R A;  4PYU A;  1BT0 A;  4P7I A;  2FID A;  2QHO A;  2CHW A;  3QHT A;  4WJP A;  4WQO B;  3DBR I;  5D7G A;  1V80 A;  4FJY A;  1V9J A;  2KJR A;  4PS8 A;  4WAA A;  2C9W B;  3VUY A;  2CR5 A;  1Q1O A;  4IWO A;  3TL5 A;  1GJZ A;  5JHA A;  2IZV B;  2ZVN A;  1HE8 A;  3DCG A;  3QWZ B;  4FN2 A;  1GC7 A;  3U30 A;  1NBF C;  5CX3 A;  3QA8 A;  2LVO A;  1H8C A;  2RPQ A;  3Q3J A;  2Z0D B;  2JZ3 B;  2KWC A;  4PS7 A;  1WIA A;  2V1Y A;  4FAD A;  4RM9 A;  2KFK A;  5LLI A;  1R4M I;  3B0A A;  5DCN A;  2MBB B;  4FJV B;  5CHW A;  3ZUN A;  2LVQ A;  3TBL D;  2GBR A;  2HD5 B;  3IVF A;  4MM3 A;  1KOT A;  2KNB A;  2GBM A;  2V4L A;  2LZ6 A;  2KC1 A;  2YVC A;  3PGE A;  4KV2 A;  1SGH A;  2L0F A;  3JW0 X;  4URK A;  2IO2 B;  4XZ4 A;  4WJO A;  4LDT D;  4LDT B;  4EZJ A;  1U4A A;  4W9E A;  1YIW A;  3DOW A;  1LXD A;  1TBE A;  2KXJ A;  3M62 B;  5HKH A;  3NHE B;  2LJ5 A;  4WJN A;  2A5U A;  3L17 A;  1WXM A;  2K25 A;  4KDI C;  4KZ0 A;  5D2M B;  1WZ0 A;  2XK5 A;  4GDK B;  4BFR A;  3RUI B;  4AJY B;  2LGY A;  3BY4 B;  1KM7 A;  4DHZ B;  3RUL A;  2K1F A;  4MDK E;  4NPN A;  4MGY E;  2NVU I;  4AP4 C;  3UGB B;  1S3S G;  2LGD A;  3EHV A;  2DZK A;  1EO6 A;  2EKE C;  4K7U A;  2J0J A;  1S1Q B;  3UIN B;  2V3S A;  4IWQ A;  2UYZ B;  2WX0 A;  4B95 A;  3IHP C;  4WWP A;  1E7V A;  2FCS A;  4GB9 A;  3L08 A;  2D2Q A;  4GSW A;  3PRM B;  3VFK A;  3ZW3 A;  4BBN C;  2D11 A;  4WWO A;  2KD0 A;  3EC8 A;  3QAQ A;  4W9C A;  2KQ7 A;  2L3Z A;  4CO7 A;  2AEH A;  5G55 A;  3SDL C;  2EMS A;  2KDI A;  3QK0 A;  3ZDT A;  2I1J A;  3NY5 A;  3ZIM A;  2MBH A;  4BOS C;  3DVG Y;  2PPH A;  4W9K A;  1XQQ A;  4ICV A;  2MBQ A;  4X57 B;  3WA0 A;  4RMA A;  2UWQ A;  3H9D A;  5J2R A;  1L2N A;  2KTF A;  1F9J A;  1YQB A;  3GZN I;  2NBV B;  3PVL A;  4BKG A;  4XC2 A;  3ALB A;  2FCN A;  2N1V A;  2G3Q B;  3BIN A;  1E5W A;  5JHB A;  2KJH B;  3QC8 B;  3RZF A;  2BGF A;  2KWU B;  4MGK E;  3TJP A;  3ZDM C;  1Y8R C;  1L7Y A;  4E3C A;  1WRD B;  3KYD D;  4NAW A;  3DDC B;  2BWF A;  3GOE A;  2I1K A;  3MJW A;  2KO3 A;  5EDS A;  2JZZ A;  3DBL I;  3TMP B;  3W1Y A;  2NBW B;  3ZNI D;  3ZTC A;  3CSF A;  1GG3 A;  2IY0 B;  2D3G A;  2N1W A;  3PLV A;  3PV1 A;  2CS4 A;  3TIX A;  1J0G A;  4I6N B;  3PHX B;  1V81 A;  3DVN U;  3CST A;  4IM3 A;  3WAN A;  2KN5 A;  5KHO A;  2M1M A;  2KFJ A;  2MQJ A;  1P9D U;  4W9D A;  5CHV C;  3KVF B;  2R2Q A;  4HCN B;  2ZZP B;  3A9J B;  2ZNV C;  4II2 B;  2DHZ A;  1NDD A;  3AUL A;  1YJ1 A;  3JYU A;  3Q3F A;  2AWT A;  4HDQ A;  1LQB A;  4HCP B;  1I42 A;  2KAN A;  1EUV B;  4RM8 A;  2CKH B;  3DQV A;  2KMA A;  4K1R B;  4NJ6 A;  4A3P A;  1EF5 A;  2W9N A;  4EEW A;  5LXI B;  2FNJ B;  2EMT A;  4HXD A;  3MTN B;  2K8H A;  4J6I A;  2JXX A;  4PYZ A;  2O2V A;  4LJP B;  3VTV A;  4W9J A;  1UEL A;  1WM2 A;  2KX0 A;  2N4F A;  3H7S A;  3NS8 A;  3A33 B;  5J17 A;  2KLC A;  5AEK B;  4BOZ B;  4I6L B;  2MWS B;  3DBH I;  2K6D B;  4FHJ A;  4HPM B;  1WR6 E;  5IAA C;  2DZM A;  3RT3 B;  1WJN A;  5J18 A;  3PS6 A;  3KW5 B;  3PRE A;  5AZH A;  3HK0 A;  1WJ4 A;  2A4Z A;  4TV3 A;  4DDG D;  3ECI A;  1WM3 A;  4ZRJ A;  3AI5 A;  1PQS A;  2FCM A;  4K81 A;  4NNJ B;  3D32 A;  2D10 A;  2MA9 B;  3JVZ X;  1VCB A;  2G4S A;  4LJO B;  1SE9 A;  3V6E B;  2PJH A;  3ZO5 B;  4B9K A;  2WDT B;  2HTH A;  1E8Z A;  1WJU A;  4GIV A;  1KJT A;  1KLV A;  2FAZ A;  2KFK B;  4M8M A;  1WXA A;  4EZL A;  2ZCC A;  3OLM D;  1E8X A;  2KDB A;  3A4R A;  4DHZ E;  2ZCB A;  2MSE D;  2JRH A;  2DZJ A;  2MW5 A;  1UH6 A;  1Q5W B;  1WFY A;  2AYO B;  4HK2 A;  4IW0 A;  5E6O A;  4AJW A;  3ZKJ C;  2K39 A;  2LGX A;  1OEY J;  4FJZ A;  4W9L A;  2KKC A;  3ML9 A;  1YD8 U;  4TQ0 A;  3ZNG C;  5IA7 A;  1Z5S B;  2K8C A;  2MBE A;  4MEL A;  2BYF A;  1E90 A;  3SU8 X;  3N32 A;  3WAM A;  4A3O A;  4BVU C;  4DDI D;  5FR6 A;  1WGD A;  4FLH A;  4GXB A;  4KSL C;  5CHF A;  2MP2 A;  5AZG A;  5TR5 A;  4AWJ A;  3RYT A;  2JUO A;  4A20 A;  2BWE S;  5JZE B;  1UBI A;  4W9I A;  2DEN B;  3R7Q A;  4BKS A;  3ONS A;  1NI2 A;  2ZVO A;  4BBN F;  4CHK A;  1V2Y A;  1WJ6 A;  2PEA A;  2MX2 A;  1UD7 A;  4FUL A;  2Z0E B;  2JWZ A;  3HM3 A;  5DPW A;  4EZK A;  4JIO U;  2C7M B;  2VRR B;  3M95 A;  1ZW7 A;  3SD5 A;  4ZDV A;  1OQY A;  3H7P B;  2KX3 A;  2RR9 A;  3A9K A;  3VAW A;  3TCA A;  2JPH A;  5L95 C;  4II3 B;  2ZEQ A;  1M94 A;  2NR2 A;  5D94 A;  3VUW A;  1P3Q U;  3UIP B;  4K7W A;  2M4N A;  1XT9 B;  1AAR A;  2OJR A;  3QCA A;  3ZVV A;  2KHW B;  1UGM A;  5D6J B;  2OOB B;  3WAP A;  1WMH A;  1OEY A;  4GOC A;  3PRP B;  2BF8 B;  3PPA A;  4OVU A;  3KH0 A;  2JY6 A;  1WXS A;  4XX5 A;  4BKT A;  3R7R A;  3ENE A;  3A1Q A;  4KVG B;  5E6P A;  5DPR A;  1P1A A;  2WYQ A;  3L54 A;  5L83 A;  4B6W A;  1WXV A;  3KUC B;  4LCD E;  1WGY A;  2RGF A;  1E7U A;  1P98 A;  2ASQ A;  2KTR B;  3MHS D;  3APF A;  4DXA B;  4K7S A;  2WX1 A;  1IPG A;  2KK8 A;  2L0T A;  3QJZ A;  4DWF A;  4G50 A;  2GBJ A;  3KUZ A;  3QIJ A;  1IYF A;  2LXA A;  3M63 B;  3RZW C;  4KSK C;  1ZKH A;  4KDL B;  1EF1 A;  4GDL A;  4PS3 A;  4IWP A;  2REX A;  1IP9 A;  2HE7 A;  3OJ3 A;  5DPS A;  1GUA B;  2L7R A;  2YLM A;  1D3Z A;  1V6E A;  4F8C B;  4E71 A;  2XK5 B;  3HM6 X;  1OGW A;  2XEW A;  4GDK A;  4JL9 A;  4MJS B;  2D07 B;  3H1U A;  4IC7 B;  1WGG A;  4DHJ B;  3I3T B;  4ZYN A;  1LFD A;  4MJS A;  4W9H A;  3L13 A;  3KYC D;  2ZPN A;  3VDZ A;  4FHK A;  1WZ3 A;  1YX6 B;  1UBQ A;  1TZ1 A;  5LXH A;  3UQA A;  2IO3 B;  1OTR B;  2XBB C;  4ZRK A;  2O2V B;  2O6V A;  2MLB A;  4E74 A;  2N9E B;  1TTN A;  2M17 A;  2BYV E;  1GNU A;  2RSU A;  3SHQ A;  3L0W B;  1E8Y A;  1J19 A;  3A9K B;  4HDO A;  1VD2 A;  4AUQ C;  3X0W A;  3QAR A;  5BO4 B;  3PSE B;  4OVV A;  3WAL A;  1WX7 A;  3L16 A;  4EOY A;  1WGR A;  2NPT B;  3A9J A;  4DK5 A;  2ZJD A;  3ZRF A;  3UF8 A;  3V61 A;  1V86 A;  2KC2 A;  2JT4 B;  2PE6 B;  2FUH B;  2MCN B;  3EFU A;  2G45 B;  2CU1 A;  3ZNZ B;  2LD9 A;  2KOX A;  2IYD B;  2L76 A;  3N3K B;  3QX1 A;  1RRB A;  2LVP A;  4G11 A;  3K9P B;  1FXT B;  3PLU A;  4JGH B;  4NJ7 A;  4F7Z A;  4EFO A;  3K9O B;  3X23 A;  2B3A A;  2WWZ A;  3T9L A;  3CMM B;  1JRU A;  1P0R A;  2JVC A;  2LUE A;  3B08 A;  3NZS A;  2IY1 B;  4MGI E;  2C7H A;  3DVG X;  3WAO A;  2PE9 A;  2Z59 B;  3APC A;  4BKS D;  2CHX A;  3L10 B;  2KMC A;  2LWP A;  2NS5 A;  2LI5 A;  2FIF A;  1GC6 A;  2KVR A;  2K6Q A;  5JH5 C;  4ANW A;  4F1S A;  4YL8 A;  4NY0 A;  3RCZ A;  3C0R B;  2J7Q B;  2RD0 A;  3HHM A;  3PRZ A;  4MH0 E;  2M0X A;  1WGH A;  1H4R A;  2C5L C;  3S2A A;  1V5O A;  2Y5B B;  3AU5 A;  4HWI B;  2KJ6 A;  3P2B A;  4TQ1 A;  1R4N I;  2LRW A;  3KUD B;  3B1L X;  2L05 A;  2DAJ A;  4GMV A;  4IG7 B;  3VUX A;  5KHQ A;  3HIZ A;  4JLC A;  1SIF A;  3LJ3 A;  1QZE A;  4G0N B;  4MSM B;  5G2N A;  3NZU A;  1RLF A;  2M8S A;  3ML8 A;  3NOB A;  4KZC A;  4MSQ B;  3JSV B;  3R3M A;  2AL3 A;  4KIK A;  4JQW C;  1UZX B;  4N9F 4;  3VTW A;  3H6N A;  2O6V B;  1WX9 A;  4W9G A;  3VQI A;  4HVB A;  2NCN A;  1V5T A;  3PHW B;  2L00 B;  1RAX A;  2JRI B;  5E6N A;  3V62 A;  2MBO A;  4ASW C;  4ANV A;  1G6J A;  2IBI B;  4GN1 A;  2IO0 B;  3M3J A;  1TGZ B;  5CTR C;  4KIK B;  3AU4 A;  3DBS A;  3VH3 B;  3CF6 E;  2LAS A;  2GMI C;  1WYW B;  2BKR B;  1ZGU B;  2KTR A;  3VVW B;  3W1S A;  5C1Z A;  3UIO B;  4AOF A;  2GOW A;  4MEM A;  1RFA A;  3N30 A;  4GDL B;  5AZF A;  4G3X B;  4HJK A;  2O6V D;  3ZNH B;  4NQL B;  3U8Z A;  1WH3 A;  2KLG A;  2K8B A;  3R66 C;  2CHZ A;  1T0Y A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...