1WZOA

Crystal structure of the hpce from thermus thermophilus hb8
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
246
structure length
236
Chain Sequence
MKLARFLAKGRVHQGVYREGLLLDEAGEAHRPEDVTWLLPFTPGKILGVALNYAGLSRPEEPALFWKPNTSLLPHKGVVLYPKGARFVHYEVELAVVVGRPMKRVRAKDALDYVLGYTIANDLVARDYVRPPIRAKGRDTFLPLGPFLVVEEVEDPQDLWLRAYVNGELRQEGHTSRMLYSVAELLEFISEFMTLEPYDVLLTGTPKGISQVRPGDVMRLEIEGLGALENPIEEEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HpcE
publication title Crystal Structure of the HpcE from Thermus Thermophilus HB8
rcsb
source organism Thermus thermophilus
molecule tags Isomerase
total genus 60
structure length 236
sequence length 246
chains with identical sequence B, C, D
ec nomenclature ec 5.3.3.10: 5-carboxymethyl-2-hydroxymuconate Delta-isomerase.
pdb deposition date 2005-03-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01557 FAA_hydrolase Fumarylacetoacetate (FAA) hydrolase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.370 Mainly Beta Roll SH3 type barrels. FAH 1wzoA01
3.90.850.10 Alpha Beta Alpha-Beta Complex Fumarylacetoacetate hydrolase; domain 2 Fumarylacetoacetase-like, C-terminal domain 1wzoA02
2EB4A 5D2GA 3R6OA 2Q18X 5D2JA 4PFZA 2EB5A 5D2HA 2DFUA 2Q1DX 4DBHA 2Q19X 1NKQA 3V77A 3RR6A 2HZYA 1HYOA 1I7OA 1WZOA 2WQTA 4DBFA 1QCNA 5D2IA 4QKUA 3S52A 1NR9A 1SAWA 3LZKA 3BQBA 3QDFA 5D2KA 5D2FA 1QQJA 2Q1AX 1GTTA 2EB6A 1QCOA 2Q1CX 4MAQA 1SV6A
chains in the Genus database with same CATH superfamily
4ZGDB 2EYYA 1BBZA 1M90C 1VIEA 1I4K1 1VQ6Q 3EH2A 4J9CA 5L8RE 1DJ7B 3BY7A 1M1KC 1SF9A 1SSFA 5GAOl 3META 1NLPC 1PSFA 2P84A 5I2SA 5L23A 4KULA 4M77D 2L8DA 5FLXE 2EBPA 5FWCA 2DTIA 4A54A 1E6GA 5GMKe 4HVVA 3EG2A 2ABLA 1BI2A 1XOVA 5FROA 4IIMA 1UFFA 3CD6T 4MMKA 2DYIA 2MK5A 2YHTA 4IIOA 3OYHA 4IKFA 1HYOA 3OS5A 1YJWA 4LE9A 4M7AE 2HQXA 2KEAA 5HCKA 2ED0A 1PNJA 4M75F 1KSWA 2V8IA 1MMAA 5GANd 1MMNA 3CCVA 1MNEA 4FM4B 3G71Q 1VYUA 3M57A 3TSZA 3ZFJA 1OYXA 3CCMA 2D0NA 2KXDA 3MEAA 1YIJQ 3VS7A 4Z02A 1BI3A 1MV3A 1WI7A 4RTTA 4D8DA 1PHTA 2P0KA 3CPFA 1S72Q 2C0OA 1D3BA 4LD6A 1M1KU 3CCLT 3E2UA 4KBMB 3QXEB 3CMAT 3EFOB 2HZYA 1IHVA 1ZSZB 5GAOm 3OS1A 2M02A 1R77A 3OMCA 5KYWB 4JUVA 2FPDA 2JS2A 3I55T 2Q1CX 3GPLA 3D7SB 5KYUA 2RA2A 2GQVA 3AHUA 1YFNA 1VQ8T 2JJ9A 1FMVA 5ECAA 3A8MB 1U3OA 4BE2A 4M7AA 2J7IA 1JEGA 2DX1A 4DBQA 2QAZA 3H6ZA 4F7UB 3GP8A 4V2SA 2DIQA 1VYVA 1Z9QA 2JM8A 3CBPA 2Y4XA 1SEMA 2IVWA 3FIFA 1TS9A 2KRNA 3M0PA 2KYBA 3VS5A 2EB5A 1K73U 1M8VA 2JT4A 5CKHA 3CMEA 2EGEA 4VUBA 1YI2A 4N0AA 1X2KA 1KIKA 3QBYA 3KUFA 3JB9H 2PVGB 3JCMd 1AOJA 3G71A 1I07A 1KC8U 4M7DD 1LPLA 2FHDA 2KNBB 2DEUA 1N6AA 4M77E 4LDWA 2J05A 3FDRA 3UWNA 4FL6A 1WXUA 5LJ5d 3L2QA 3JCMW 2VV5A 3MO8A 4DA4A 3CCET 5A0DA 2BZ8A 3OYAA 1MV0B 5LJ3j 1M2VB 3MPUB 2K5LA 3LX7A 4KGZB 1D0ZA 2ZPFB 3VRZA 4C5EA 1BB9A 3HRTA 2LQ8A 3LH0A 4OMFB 2K3BA 4C0DC 2DXUA 4C92E 1BK2A 2M51A 4J6XA 3SWNC 2AT1B 2QEXT 1JB0E 1TOVA 3T9NA 2K57A 3QWXX 2DAQA 3G6EA 1K8AC 1WHHA 1QKWA 4MDXA 4IUUA 4KUIA 3VUZA 2QA4T 2BE9B 1JQQA 4QVDA 4A53A 1OX9A 4OMLA 3MCAB 2K6DA 4L6V5 3ZBDA 3JCMg 3OYDA 4LXCA 3JCMJ 3CPWA 2WQTA 3NMZC 1NR9A 1X01A 4M77A 2XG8D 5IH2A 3JB9D 2EB6A 4RMOA 1VQ4Q 1YCYA 3I5RA 1N9SA 3M59A 3X26B 3MHXA 2PVOB 4QQ6A 1D0XA 1Z9ZA 3LGFA 4XTYA 1VQMT 1Y71A 4FCYA 2OTJT 3MEVA 2BE7D 3TQ7P 1QCNA 4OMQA 2CH4A 4KRTA 2MI6A 3ASKA 2ZZDA 2CP3A 4F7UG 4ZN3A 2LVMA 2QXFA 3PVLA 2J6KA 3M5AA 2QQ9A 4C0GA 2RHXA 4CC2A 1UGQB 4F16A 1I5LA 2DL5A 3RUXA 4M78F 4HVWA 2RM4A 5LJ3e 3QWYA 2OI3A 4OMPA 1KD1R 5KYYB 4R0KA 2FPEA 3UA7A 3EHQA 4ESRA 2D6FA 2B8AA 4X9CA 3P8HA 1GCQA 3I35A 3L42A 2JZ2A 1VQ5A 5DLQE 5GANh 2JTFA 1VQ6T 3TEEA 3OYCA 2JMCA 2RI2A 1NEBA 4PJOB 2RJEA 2OTLA 1UJ0A 1QKXA 4M7DG 1Q86R 3EGDA 3PMIA 2E65A 3CCQA 1K9MR 4QQDA 3G4ST 3VU3C 5GAOq 2FZKB 3LWHA 4J5YA 2GF7A 1KJWA 2HDAA 3QZ9B 2H3EB 1VQ9T 2KK4A 2XIDA 2DERA 3OYJA 2JVVA 2X3XD 4XTZA 3CCLQ 5CKDA 2RHZA 4E7KA 2HD0A 3CMAQ 1RUWA 1UHFA 4Z89A 1UGRB 4ELZC 5D2GA 3OMGA 1ZUKA 1WXBA 4DOVA 2M9UA 4MZMA 5D2HA 2EJFA 2KVQG 4M78B 3JSCA 4M7AC 2G3RA 4LUDA 2GQIA 2RJFA 2DE0X 4BY6C 3I55Q 2QYZA 1Q82R 2RMOA 1ZUUA 2XDPA 4Z88A 4JS4A 1N8RC 3N5BB 1VQOT 5FRNA 1S72T 2NUPB 2JN0A 1FWZA 2CDTA 1YHQA 1X2QA 4RG2A 4O5VA 2YT6A 3URGA 2CKKA 2M0YA 4PLLA 5DY9A 3CD6A 3L2UA 3QZ5B 3P8BB 3X24B 4B9XA 2DL3A 2JUFA 1QVGP 2PVDB 4QQGA 1LVKA 1JO8A 5GAMf 1O75A 2A08A 2EQUA 1B07A 3DKMA 3JCMh 2R5AA 3MJXA 3VS1A 2K79A 1B7TA 3C94A 2B86A 4C0FA 5LJ5h 4PJJA 3CXCS 2JTMA 4RTZA 1D0YA 4PJNA 3CC2T 2O4XA 3CCEQ 4C8QB 2RQUA 1Q81C 2F2XA 2XKOC 3FEOA 5GAN2 1NKQA 2DVJA 3SFMA 4M7AF 4LUEA 3REBB 1H8KA 2A7YA 3PVQA 3CCLA 1JXOA 1OZ2A 3E19A 2QQBA 3OSSC 2L3QA 4E6RA 3PIOA 3C12A 5IXFA 4PJOG 4OB2B 4OP0A 1RABB 1G3TA 3S3NA 5FU6C 2XICA 5IAYA 2NUZA 1ZBXA 4J6WA 5D7UA 5HK0A 3LLRA 3CC4T 3VYGA 2QA4Q 2J6OA 4AFSC 3TU4K 1VQ8A 3AT1B 4E47A 4M77C 7AT1B 3RDVA 2YLBA 3QYHB 1MMGA 2L5QA 1QVGS 1AHJB 5GAN8 1RACB 3VUBA 3X20B 3FRNA 4CC4B 1BU1A 1C1AA 4ZTFA 4FSSA 2ROTA 1VQ7T 1P92A 3H8ZA 2FL7A 5A0GA 4FW1A 4QT7A 2EW3A 4J9BA 1RADB 4JLIA 2V26A 1VQMQ 2ED1A 5A0LA 2OTJQ 3V8KA 1WX6A 4HT9A 1Q86C 4FW2A 1U8RA 1YITQ 3GIBA 2VVKA 4XK8E 2OAUA 3CCEA 3CC7Q 5LJ3d 5D2KA 1N5ZA 5IHIA 3VS0A 5C0MA 2W10A 2EQIA 2XDBA 3QJYA 2KT1A 2FRYA 3DB4A 4CC3A 1RAFB 1UB4A 5IN1A 1VIFA 1GCQC 2PUKB 2LNVA 3JCMV 3HRSA 2VC8A 3CBOA 2H3JA 3A98A 4Z8AA 4BUGA 3VV0A 4QW2A 2HL3A 4NOYA 4M77F 4FIBA 1GFDA 2QEXA 5D2FA 4BI4A 3VRYA 5I22A 1XTDA 4AT1B 1UEBA 1YCSB 3HRUA 2OJ2A 2L3SA 4JRIA 3V8LA 3HP9A 4BI3A 4EMKC 2QA4A 2RK1A 3H0FA 5I21A 4C8QG 1Q7YR 3L2ZA 2K9GA 1D1CA 4ZN1A 4FSXA 1UTIA 1NJIR 2CYZB 1VQNA 2RPNA 4JDSA 4C92F 1WNLA 3G4SQ 1QMCA 3EHRA 2XDDA 1Q86U 1GL5A 4XTXA 4J7FA 1EIFA 3GF5A 1JJ2S 2ENMA 2LCCA 1K9MU 3OYNA 2KDSA 1WHKA 2WSCE 2L0AA 2RD1A 3A8OB 1VQ9Q 1M9SA 5J26A 2D8HA 4M7DC 2R5MA 2HEQA 2HQEA 1ZA2B 4XQ3A 1W2BA 2KT8A 2Y4YA 1WXTA 1H3ZA 1MUZA 1B34B 5J3BA 3CCUQ 3RKXA 1VUBA 3HFNA 1X6OA 3RMQA 2RNAA 2PU9B 1VA7A 1K0SA 4OMOA 2E6ZA 3JB9J 4QKUA 3OW2S 1YJ9T 1K73C 3CPWP 1Q82U 2Q1AX 8AT1B 1UGSB 1XJWB 1WYXA 2RF0A 4A4EA 1S1NA 1VQOQ 1KHCA 3FB9A 2FZCB 4RCCA 2PTKA 3LWIA 1KC8C 2D8JA 2EWNA 2FVUA 4QVZA 2DJZA 3L2VA 4LDVA 2EQMA 4BACA 2KROA 2RQVA 2HAXA 3IQLA 4JJBA 3A8LB 4NL2A 4C92B 3UATA 1VQ6A 1M27C 2EYWA 1M3BA 2K5FA 4BE0A 3CCST 2BKDN 4D8KA 2EKOA 2EJGA 5CKEA 2BTTA 3BE3A 4EDUA 2GBQA 5GANg 2NLUA 2CZ6B 3SB2A 4M75B 2EKHA 3CC2Q 2COWA 1M3CA 1AZEA 4E7ZA 1SSHA 1FX7A 2RHUA 3OSVA 3M0TA 3S3OA 1EX4A 4JS5A 2J06A 5GAMj 2DO3A 4A63B 2W0ZA 3EGDB 2O2OA 3RERA 4BDZA 3OYLA 3FLGA 3TVTA 3CC4Q 1YIJA 2Q1DX 1U1TA 1OPLA 1NZ9A 2ZPIB 4LDYA 1KK7A 2QQRA 1D09B 2DF6A 4E7LA 2JOYA 1VQOA 1S72A 1N27A 4JPBW 1IXDA 1GFCA 2MOXA 4GBQA 2E5KA 3OYMA 5IHNA 1ABOA 1SHGA 4RTVA 2QTVA 5CK9A 5KYNA 3GBQA 3CCJT 1H92A 1AWJA 1VQ7Q 4E7IA 2M0OA 4PKCC 1NYFA 2L3PA 2P4TA 1I81A 1JRIA 3JB9F 4Y91A 1Q7YC 1TUGB 1RAEB 2GFUA 3OQ5A 2CUDA 2LMJA 2G6FX 4C5GA 4CI0C 2I0NA 1PSEA 3HFOA 1KQ2A 3PE0A 4L59A 2GGRA 4XAXB 2MCNA 3RKWA 3MEUA 5HKCA 5LJ3h 4ZGJB 4N4IA 4JJNK 1NEGA 5AYFA 2J6FA 4A4KA 4IUQA 1UE9A 4F04B 2RI5A 3PGGA 2WSEE 3ME9A 1ARKA 5CR2A 4F7UE 4ELYC 1I0CA 1AZGB 5LJ5g 1SV6A 4C92G 5IXBA 1OI1A 1C6VX 1ZSGA 4E7SA 1IB8A 1IZ6A 1VQKQ 5KCHA 3GNFB 2LT4A 1I8FA 3HSBA 4ATOA 3C0CA 2LZ6B 1G3SA 5GAMe 3OYFA 3WXMB 1YITT 4M75G 2C0TA 4GLMA 1NE8A 1WJQA 2PQWA 2K4YA 3CC7T 2DMOA 2LP5A 2X51A 5I2MA 4JJCA 2EYZA 2GTJA 3CCVT 3RKYA 1Q7YU 5GANj 3OYGA 4YTLA 1WQ7A 3JCMc 3SHWA 1NJIU 1IGUA 2BZXA 1AD5A 4PJOD 4M7DE 3QIIA 1H3HA 2QASA 1T3LA 1VQ7A 5CIUA 1PD1A 3S6WA 2LX9A 1U1SA 3I56T 4RKUE 2XMFA 3EGXA 4F7UA 2VB6A 3ULRB 2KE9A 2C0IA 1PG5B 3EG1A 3QSUA 2DA9A 2OX7A 3JV3A 2MWPA 2ROLA 5FU7C 1E7OA 5GMKi 2LX7A 3TREA 2DEQA 4EMKA 3HTRA 5KE2A 2CT4A 1J3TA 4F17A 1YJ9Q 1RLPC 3KBGA 4M78D 4CC7A 1WA7A 1UDLA 2IG0A 4IUVA 3S52A 1OULA 3M56A 2AZVA 3A5ZB 1VQ4A 2HSEB 2LTOA 2KR3A 4AFUC 1GCPA 2A36A 3V7CA 4C0DB 2X3WD 2CZ1B 1FMKA 4BD3A 2PUOB 1SHFA 2JNGA 1QLYA 1KQSA 3JAME 4KGVB 3SWNB 3M0SA 1WHJA 3L2WA 4FU6A 2FYKA 3M0QA 4OB0B 3CCUT 2DZ9A 2K3YA 2ATCB 3RMSA 3C4SA 1QVFA 2DD4A 3UF4A 3BQBA 4M7DA 3E9FA 5KYXA 4X9DA 2GCXA 3NTKA 4AFZC 3CMET 1R0BG 2D1XA 3CCSQ 4WTOB 3I9QA 2L3RA 4NS5A 3GOXA 5GAN6 4DQ2A 2DLPA 2O9SA 4ANJA 2O31A 2JTEA 4PFOA 5GANe 1WQWA 5CCAA 1NLOC 3FJ5A 2GNCA 1M90R 4Y92A 3OYBA 4RUGA 2VASA 2NWMA 5LJ5j 1A0NB 2COYA 1SRMA 1ABQA 1O9SA 4HCZA 3VS2A 1M1KR 2AIRB 4LN2A 4HA8A 4RG8A 3OYEA 2DNUA 4C8QD 2XD0A 2EQJA 6AT1B 1ZUYA 2X9HA 2DD5A 5GJWB 5AT1B 1NYGA 4X34A 2Z0WA 2XHCA 3CBMA 3OB9A 4N4HA 4N4GA 3KXTA 3L2RA 1X6GA 4OB3B 1D1AA 1GXIE 4KH1B 3PTAA 4PJOE 2DL8A 3G6ET 1XQHA 3JRZA 4XTUA 2K5IA 3A8HB 2DBKA 3M0UA 2E4HA 3UPUA 2AKLA 3V77A 1TG0A 1SG5A 1M1GA 1CSKA 2O9VA 2ZAEA 1JBMA 2QGFB 2C06A 2K2MA 1F1BB 1AWWA 3CMAA 4C0ZA 4KT0E 1HK9A 3ER0A 1BIAA 5GAOr 3M58A 3PIPA 4JRQA 1HD3A 2NUTA 2HKQB 1MNDA 3CCJQ 3JCMP 1X6BA 4IUPA 2DBMA 1QP3A 3J81E 3M9QA 5IHKA 2BIVA 1AWOA 4A4GA 3I55A 4PFPA 3INZA 5GAN7 1VQPT 3CCSA 2KXCA 5KYYA 5GJVB 1D3BB 3UDCA 1KD1C 1GBRA 2Q18X 1W6XA 5DM7R 5D6WA 3JCMe 3OY9A 2KAFA 3QDRB 4O6JA 1RL2A 4E7HA 2E5QA 4M78G 1AEYA 2YLCA 2KQWA 4QVCA 4XTWA 1YWPA 4PJOA 3NPFA 1GTTA 2F2VA 2JMAA 1WJRA 5LJ5e 5KE3A 5KYUB 2IIMA 5GAMd 3F70A 3EG0A 1UJYA 4FT2A 4DBHA 2JXBA 4M7AB 3RBBB 1LJOA 3M4GA 3JCMb 1ZSZC 4A4FA 1H641 3CXCA 4BY6B 1M2OA 1XNIA 3QYGB 1K9MC 1M3AA 1W1FA 2CT3A 3VYHB 3VKIA 3WVEB 2VYTA 5GANf 5GMKh 3CCVQ 4DEXA 3EG9A 2LJ1A 3X25B 3NHNA 3SDZA 3MEWA 3OS0A 2ZPGB 4C8QE 4EMGA 2OTLT 4EPCA 2VGMA 2YRDA 4TVRA 3M55A 1U5SA 2E64A 1KD1U 2F5KA 2HQHA 3CCQT 1VQKT 2A3LA 2QQAA 4FYWB 4J9FA 4HCCA 1K4US 3I5SA 2YDLA 4OF1A 3EFSA 3HPWA 2KYMA 3VS3A 3I56Q 3THKA 2LJ3A 1Q82C 1G3WA 2YUQA 2NUPA 2CSIA 1PKSA 2F2WA 2FEIA 1NPPA 1WZOA 3E9GA 2DRKA 1YWOA 3MP6A 2RN8A 1Y96A 2LDMA 1VYTA 2QK0A 1EFNA 1WGSA 1QVGA 3DB3A 4HT8A 4MZTA 2HSPA 2HKNA 2GFAA 1K8AR 4LDXA 1IHWA 1I5OB 1IREB 2GTOA 4JZ4A 4R56A 3DLLA 4PNOA 3QG1A 3X28B 3EGUA 4WCIA 4NL3A 1PCXA 3HHTB 1YN8A 5LJ3g 2COZA 3EH1A 2CZ0B 4JJDA 1CKAA 1K1ZA 1AVZC 1VQMA 2RHYA 2E3IA 1G5VA 2OTJA 2PZ1A 3LW5E 1YHQT 1HSQA 2V8JA 4FYVB 5GAN3 4C8QA 2PNIA 5FU6B 1YITA 2Q19X 2E6NA 1V29B 3CC7A 1TXQA 2ECZA 5D2IA 3CMEQ 4MZPA 3UA6A 3O8VA 3VS4A 4F7UF 2YXYA 4M77B 2AHJB 1PD0A 4UC4A 1YI2Q 3NGPA 1TUCA 2RK2A 3E1SA 1UUEA 2FZGB 3JCMf 2QQSA 2DKGA 5J39A 4C92D 1GRIA 1BI1A 2RQRA 2JM9A 4Y28E 5CKFA 1BKBA 3G7ZA 2RQWA 2DVEA 5LJ5f 3OYIA 1WPYA 1ZHIA 2JS0A 2O88A 1QWEA 2QGGA 2YUOA 4CRIA 2EPDA 4M7AG 1M90U 2LQWA 2RHIA 1QP2A 2KGTA 4M75D 2EQKA 5GAN4 1WFWA 5CVIA 2QI2A 4K11A 1OOTA 1AWXA 3I56A 5CQYA 1GBQA 4IURA 3BDUA 1SKUB 4C5IA 3RR6A 2DIGA 4AFQC 2FPFA 2HBWA 3HL8A 1Y57A 1MHNA 4LDUA 3G4SA 1C0MA 4M7DF 2FG0A 3G6EQ 3CCRT 3KFVA 1PWTA 3S3MA 2YRCA 1JJ2A 1QCOA 2AK5A 3LYIA 1VQ9A 4BI8B 2CZ7B 2RJDA 3OBYA 2DXTA 2V1RA 2KMTA 2K2VA 1I7OA 3EGXB 1RI0A 2YSQA 5D6YA 5A2QE 2ZPHB 3LZKA 4J8OA 2OAWA 2YUNA 3J80E 2O01E 1BI0A 3CPWS 4EMHA 3CCUA 1NPRA 2MMPA 3CEYA 4EMKB 1VQPQ 2DRMA 3OW2A 1ZX6A 3OYKA 1JXMA 1JU5C 2LT1A 2E70A 1M30A 3ZL7C 2RB6A 5FRMA 3SD4A 5I11A 1PKTA 1YJNT 3C95A 1PM3A 4PJOC 3M0RA 3QHSA 2DXCA 3NFCA 3PT9A 2LNHB 1UGVA 5DLOA 5KH6A 1TU0B 4OB1B 1WHLA 3R6OA 1LCKA 2DK3A 3PMTA 1KQSP 2CREA 4OGCA 2DZCA 1UGPB 2BUDA 1N8RR 2VGNA 1VQLT 4M7DB 5KYXB 2IPOB 2X4JA 5GAMh 2A0FB 2EGCA 1QVFP 4M77G 4E7JA 3RNJA 3R6NA 2CP0A 3VS6A 1NJIC 1WJSA 3OBWA 3J7AF 2R58A 2YUPA 5CAIA 4M78C 3A8GB 1RAIB 3H9NA 3OS2A 3CC2A 3LGLA 2HBPA 2ZCFB 1HJDA 1OEBA 2LJ0A 1VQ5Q 1NG2A 2YRVA 1VOMA 4M75E 2LQKA 1BCOA 1OX8A 4WF2A 4XU3A 2OTLQ 4R55A 2RQTA 4ZTJA 1B34A 2F5TX 2QTXA 1FXXA 3VJPA 4PL6A 1BIBA 2D9TA 1QWFA 3U23A 1VQNT 5FW9A 2ESWA 3CCQQ 1G2BA 1YBYA 4J9DA 2KRSA 2AZSA 3QDFA 1Q81R 4PJOF 2MIOA 4II1A 2O4XB 1VQPA 3CC4A 2K3XA 2WACA 4C5HA 1YJWT 4AG2C 4OVAA 9ATCB 1G83A 3A1PA 3QUIA 1KQSS 1M8MA 2LQNA 3EFOA 5GAOn 1TWBA 1ZSZA 3H0IA 2H8HA 1T0JA 2KBTA 1X75C 2E10A 3QO3A 1QQJA 2NUTB 4HXJA 4IUTA 3M4YA 5LL6S 1R8OB 4C92A 1QVFS 3CCMT 2RI3A 1OU8A 5KYWA 4PK4A 3EFRA 2EB4A 1W70A 1K8AU 4C8QC 3FJPA 2E1HA 2CP7A 2V1QA 2ZGWA 2A28A 1MGQA 2CGHA 4XU1A 3QKJA 1T0HA 4HCKA 4KUDK 2X4XA 3ZEHA 1YHQQ 4M75A 1OU9A 2MPXC 4JZ3A 1TH7A 2CS7A 3CD6Q 4MAQA 4A4HA 2EVRA 2MWOA 4J7IA 4J9GA 3BFMA 4MMLA 2MAMA 2XK0A 2CP2A 4RCBA 3BW1A 1QW1A 1Y07A 5HK3A 2E3HA 4AMCA 3TSWA 4DOWA 1M5Q1 1RLQC 1WHMA 1EZZB 2DYBA 1RI9A 1K9AA 4JRKA 1IGQA 1VQKA 4KH0B 4HCBA 2DTOA 1I1JA 4RTWA 1UHCA 2FB7A 2JW4A 2F69A 4HKEA 2WSFE 1BCMA 2QDYB 4M4ZA 4B6MA 2KI7A 1M2VA 5CQXA 1PRMC 1HXDA 1QVPA 4BB7A 5HY6A 2HNIA 1Y7XA 3CXCP 2FRWA 4XU2A 1NM7A 3CQTA 1X69A 3EG9B 4DBRA 1YI2T 1OZ3A 2FO0A 2KSSA 2SRCA 4C8QF 4J9EA 1CKBA 1U06A 1V1CA 3G71T 1ZQ1A 2DJQA 3DLMA 1K0XA 3PNWC 5EG2A 3CCRQ 5M9OA 2E12A 1YP5A 2EFIA 2LCLA 4DEYA 2X4YA 1YIJT 1VQ8Q 4GLKA 3M54A 4J9IA 4PJLA 4AG1C 1IO6A 5C6SA 2AKKA 2CH4W 2CSQA 2RJCA 2X4WA 1X27A 5D2JA 4PFZA 5GAN5 1D1BA 4XU0A 2SEMA 1WLPB 4FYXB 4N0AC 3LH5A 5GMKl 4RTYA 3H0HA 4GY5A 1Y96B 3V7SA 1LOJA 1SAWA 1YNZA 1T3SA 3RESA 4LD9K 4JRPA 3JB9G 4E2FB 4XTVA 3L1AA 1NBEB 1R0CB 3P8DA 2HL5C 3M53A 1YJ9A 1TTHB 4P5NA 2EAYA 4LNPA 1OPKA 3OA6A 1YJNQ 2YWWA 4ZNXA 2M1HA 2DXBA 3G1JA 2EYXA 3FC3A 2RO0A 5EC7A 2KY9A 1WIEA 3PFSA 1G3YA 1Q95G 5LJ3f 4F14A 3QPHA 3JB9I 2CUBA 2F1LA 4J83A 2CP5A 2M16A 1W2BP 4FT4A 1WHGA 1K73R 2DFUA 2A37A 3Q1JA 3JCMX 3V8JA 1VQLQ 2P4RA 3NTIA 2XU8A 2QDLA 2VUBA 2VXFA 1M1FA 2LC4A 1IRXA 3SEMA 1RAHB 4M78E 1N8RU 2RH2A 1PC0A 2Y90A 1FMWA 1ZBJA 1SRLA 1TSFA 2ZPBB 1KC8R 2MYSA 1AT1B 4ME7A 1WDXA 2ZPEB 3REAB 2V8KA 4KGXB 2DM1A 4J6YA 2QEXQ 3V7RA 3O5ZA 5FU7B 2NYSA 4B9WA 1RAAB 3CCRA 2DILA 2L89A 3MKDA 5GMKm 2X35A 1E6HA 2L2PA 3GNGA 4J9HA 1ACMB 2VWFA 3RIRA 1K76A 4M7AD 2P0PA 1KHIA 4RTXA 1ZLMA 1X43A 1BYMA 2DL7A 2EYQA 1G8XA 5KCOA 4OMMA 8ATCB 2K7AA 3GLXA 2LCSA 5GMKj 1LNXA 4BE1A 4X1VA 1VQNQ 4D6WA 5GAOp 1OQKA 1KFZA 4ZGEB 2LRQA 2VKNA 5CKBA 1MMDA 1UECA 5IT9E 3MP8A 4MDWA 3WVDB 4HVUA 3UT1A 4JLGA 2HMAA 4OGEA 2DL4A 4RTUA 3HKSA 2QG9B 1PRLC 1YJWQ 1Q81U 4C92C 1SPKA 2R57A 4Q5WA 2HCKA 3TCJA 1OV3A 1B3QA 1N9RA 3JCMQ 1ZA1B 1VQ5T 1Y0MA 1JJ2P 1YJNA 3H41A 4L5GA 1RAGB 1W2BS 5D6XA 3BDLA 2EGAA 3SWNA 2E41A 1KQ1A 1KG1A 2CP6A 1FYNA 4FYYB 4M78A 4PLIA 4OMNA 3NTHA 2EIFA 3OYYA 3EG3A 3CCMQ 3CCJA 1V76A 4M75C 1W4SA 4EIKA 2XI9A 2DTHA 1TUDA 4ORZA 1VQLA 2DPPB 3MP1A 2MF2A 1VQ4T 2VXEA 2EJ9A 5FWBA 2D0QB 2I2LA 2KRMA 3EAEA 3OW2P 4DBFA 1UG1A 3QJ6A 4PJMA 1QCFA 2P0QA 5CO7A 5GAMg 1M4ZA 4BDYA 2BZYA 2DETA
chains in the Genus database with same CATH topology
2EB4A 5D2GA 3R6OA 2Q18X 5D2JA 4PFZA 2EB5A 5D2HA 2DFUA 2Q1DX 4DBHA 2Q19X 1NKQA 3V77A 3RR6A 2HZYA 1HYOA 1I7OA 1WZOA 2WQTA 4DBFA 1QCNA 5D2IA 4QKUA 3S52A 1NR9A 1SAWA 3LZKA 3BQBA 3QDFA 5D2KA 5D2FA 1QQJA 2Q1AX 1GTTA 2EB6A 1QCOA 2Q1CX 4MAQA 1SV6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EB4 A;  5D2G A;  3R6O A;  2Q18 X;  5D2J A;  4PFZ A;  2EB5 A;  5D2H A;  2DFU A;  2Q1D X;  4DBH A;  2Q19 X;  1NKQ A;  3V77 A;  3RR6 A;  2HZY A;  1HYO A;  1I7O A;  1WZO A;  2WQT A;  4DBF A;  1QCN A;  5D2I A;  4QKU A;  3S52 A;  1NR9 A;  1SAW A;  3LZK A;  3BQB A;  3QDF A;  5D2K A;  5D2F A;  1QQJ A;  2Q1A X;  1GTT A;  2EB6 A;  1QCO A;  2Q1C X;  4MAQ A;  1SV6 A; 
#chains in the Genus database with same CATH topology
 4ZGD B;  2EYY A;  1BBZ A;  1M90 C;  1VIE A;  1I4K 1;  1VQ6 Q;  3EH2 A;  4J9C A;  5L8R E;  1DJ7 B;  3BY7 A;  1M1K C;  1SF9 A;  1SSF A;  5GAO l;  3MET A;  1NLP C;  1PSF A;  2P84 A;  5I2S A;  5L23 A;  4KUL A;  4M77 D;  2L8D A;  5FLX E;  2EBP A;  5FWC A;  2DTI A;  4A54 A;  1E6G A;  5GMK e;  4HVV A;  3EG2 A;  2ABL A;  1BI2 A;  1XOV A;  5FRO A;  4IIM A;  1UFF A;  3CD6 T;  4MMK A;  2DYI A;  2MK5 A;  2YHT A;  4IIO A;  3OYH A;  4IKF A;  1HYO A;  3OS5 A;  1YJW A;  4LE9 A;  4M7A E;  2HQX A;  2KEA A;  5HCK A;  2ED0 A;  1PNJ A;  4M75 F;  1KSW A;  2V8I A;  1MMA A;  5GAN d;  1MMN A;  3CCV A;  1MNE A;  4FM4 B;  3G71 Q;  1VYU A;  3M57 A;  3TSZ A;  3ZFJ A;  1OYX A;  3CCM A;  2D0N A;  2KXD A;  3MEA A;  1YIJ Q;  3VS7 A;  4Z02 A;  1BI3 A;  1MV3 A;  1WI7 A;  4RTT A;  4D8D A;  1PHT A;  2P0K A;  3CPF A;  1S72 Q;  2C0O A;  1D3B A;  4LD6 A;  1M1K U;  3CCL T;  3E2U A;  4KBM B;  3QXE B;  3CMA T;  3EFO B;  2HZY A;  1IHV A;  1ZSZ B;  5GAO m;  3OS1 A;  2M02 A;  1R77 A;  3OMC A;  5KYW B;  4JUV A;  2FPD A;  2JS2 A;  3I55 T;  2Q1C X;  3GPL A;  3D7S B;  5KYU A;  2RA2 A;  2GQV A;  3AHU A;  1YFN A;  1VQ8 T;  2JJ9 A;  1FMV A;  5ECA A;  3A8M B;  1U3O A;  4BE2 A;  4M7A A;  2J7I A;  1JEG A;  2DX1 A;  4DBQ A;  2QAZ A;  3H6Z A;  4F7U B;  3GP8 A;  4V2S A;  2DIQ A;  1VYV A;  1Z9Q A;  2JM8 A;  3CBP A;  2Y4X A;  1SEM A;  2IVW A;  3FIF A;  1TS9 A;  2KRN A;  3M0P A;  2KYB A;  3VS5 A;  2EB5 A;  1K73 U;  1M8V A;  2JT4 A;  5CKH A;  3CME A;  2EGE A;  4VUB A;  1YI2 A;  4N0A A;  1X2K A;  1KIK A;  3QBY A;  3KUF A;  3JB9 H;  2PVG B;  3JCM d;  1AOJ A;  3G71 A;  1I07 A;  1KC8 U;  4M7D D;  1LPL A;  2FHD A;  2KNB B;  2DEU A;  1N6A A;  4M77 E;  4LDW A;  2J05 A;  3FDR A;  3UWN A;  4FL6 A;  1WXU A;  5LJ5 d;  3L2Q A;  3JCM W;  2VV5 A;  3MO8 A;  4DA4 A;  3CCE T;  5A0D A;  2BZ8 A;  3OYA A;  1MV0 B;  5LJ3 j;  1M2V B;  3MPU B;  2K5L A;  3LX7 A;  4KGZ B;  1D0Z A;  2ZPF B;  3VRZ A;  4C5E A;  1BB9 A;  3HRT A;  2LQ8 A;  3LH0 A;  4OMF B;  2K3B A;  4C0D C;  2DXU A;  4C92 E;  1BK2 A;  2M51 A;  4J6X A;  3SWN C;  2AT1 B;  2QEX T;  1JB0 E;  1TOV A;  3T9N A;  2K57 A;  3QWX X;  2DAQ A;  3G6E A;  1K8A C;  1WHH A;  1QKW A;  4MDX A;  4IUU A;  4KUI A;  3VUZ A;  2QA4 T;  2BE9 B;  1JQQ A;  4QVD A;  4A53 A;  1OX9 A;  4OML A;  3MCA B;  2K6D A;  4L6V 5;  3ZBD A;  3JCM g;  3OYD A;  4LXC A;  3JCM J;  3CPW A;  2WQT A;  3NMZ C;  1NR9 A;  1X01 A;  4M77 A;  2XG8 D;  5IH2 A;  3JB9 D;  2EB6 A;  4RMO A;  1VQ4 Q;  1YCY A;  3I5R A;  1N9S A;  3M59 A;  3X26 B;  3MHX A;  2PVO B;  4QQ6 A;  1D0X A;  1Z9Z A;  3LGF A;  4XTY A;  1VQM T;  1Y71 A;  4FCY A;  2OTJ T;  3MEV A;  2BE7 D;  3TQ7 P;  1QCN A;  4OMQ A;  2CH4 A;  4KRT A;  2MI6 A;  3ASK A;  2ZZD A;  2CP3 A;  4F7U G;  4ZN3 A;  2LVM A;  2QXF A;  3PVL A;  2J6K A;  3M5A A;  2QQ9 A;  4C0G A;  2RHX A;  4CC2 A;  1UGQ B;  4F16 A;  1I5L A;  2DL5 A;  3RUX A;  4M78 F;  4HVW A;  2RM4 A;  5LJ3 e;  3QWY A;  2OI3 A;  4OMP A;  1KD1 R;  5KYY B;  4R0K A;  2FPE A;  3UA7 A;  3EHQ A;  4ESR A;  2D6F A;  2B8A A;  4X9C A;  3P8H A;  1GCQ A;  3I35 A;  3L42 A;  2JZ2 A;  1VQ5 A;  5DLQ E;  5GAN h;  2JTF A;  1VQ6 T;  3TEE A;  3OYC A;  2JMC A;  2RI2 A;  1NEB A;  4PJO B;  2RJE A;  2OTL A;  1UJ0 A;  1QKX A;  4M7D G;  1Q86 R;  3EGD A;  3PMI A;  2E65 A;  3CCQ A;  1K9M R;  4QQD A;  3G4S T;  3VU3 C;  5GAO q;  2FZK B;  3LWH A;  4J5Y A;  2GF7 A;  1KJW A;  2HDA A;  3QZ9 B;  2H3E B;  1VQ9 T;  2KK4 A;  2XID A;  2DER A;  3OYJ A;  2JVV A;  2X3X D;  4XTZ A;  3CCL Q;  5CKD A;  2RHZ A;  4E7K A;  2HD0 A;  3CMA Q;  1RUW A;  1UHF A;  4Z89 A;  1UGR B;  4ELZ C;  5D2G A;  3OMG A;  1ZUK A;  1WXB A;  4DOV A;  2M9U A;  4MZM A;  5D2H A;  2EJF A;  2KVQ G;  4M78 B;  3JSC A;  4M7A C;  2G3R A;  4LUD A;  2GQI A;  2RJF A;  2DE0 X;  4BY6 C;  3I55 Q;  2QYZ A;  1Q82 R;  2RMO A;  1ZUU A;  2XDP A;  4Z88 A;  4JS4 A;  1N8R C;  3N5B B;  1VQO T;  5FRN A;  1S72 T;  2NUP B;  2JN0 A;  1FWZ A;  2CDT A;  1YHQ A;  1X2Q A;  4RG2 A;  4O5V A;  2YT6 A;  3URG A;  2CKK A;  2M0Y A;  4PLL A;  5DY9 A;  3CD6 A;  3L2U A;  3QZ5 B;  3P8B B;  3X24 B;  4B9X A;  2DL3 A;  2JUF A;  1QVG P;  2PVD B;  4QQG A;  1LVK A;  1JO8 A;  5GAM f;  1O75 A;  2A08 A;  2EQU A;  1B07 A;  3DKM A;  3JCM h;  2R5A A;  3MJX A;  3VS1 A;  2K79 A;  1B7T A;  3C94 A;  2B86 A;  4C0F A;  5LJ5 h;  4PJJ A;  3CXC S;  2JTM A;  4RTZ A;  1D0Y A;  4PJN A;  3CC2 T;  2O4X A;  3CCE Q;  4C8Q B;  2RQU A;  1Q81 C;  2F2X A;  2XKO C;  3FEO A;  5GAN 2;  1NKQ A;  2DVJ A;  3SFM A;  4M7A F;  4LUE A;  3REB B;  1H8K A;  2A7Y A;  3PVQ A;  3CCL A;  1JXO A;  1OZ2 A;  3E19 A;  2QQB A;  3OSS C;  2L3Q A;  4E6R A;  3PIO A;  3C12 A;  5IXF A;  4PJO G;  4OB2 B;  4OP0 A;  1RAB B;  1G3T A;  3S3N A;  5FU6 C;  2XIC A;  5IAY A;  2NUZ A;  1ZBX A;  4J6W A;  5D7U A;  5HK0 A;  3LLR A;  3CC4 T;  3VYG A;  2QA4 Q;  2J6O A;  4AFS C;  3TU4 K;  1VQ8 A;  3AT1 B;  4E47 A;  4M77 C;  7AT1 B;  3RDV A;  2YLB A;  3QYH B;  1MMG A;  2L5Q A;  1QVG S;  1AHJ B;  5GAN 8;  1RAC B;  3VUB A;  3X20 B;  3FRN A;  4CC4 B;  1BU1 A;  1C1A A;  4ZTF A;  4FSS A;  2ROT A;  1VQ7 T;  1P92 A;  3H8Z A;  2FL7 A;  5A0G A;  4FW1 A;  4QT7 A;  2EW3 A;  4J9B A;  1RAD B;  4JLI A;  2V26 A;  1VQM Q;  2ED1 A;  5A0L A;  2OTJ Q;  3V8K A;  1WX6 A;  4HT9 A;  1Q86 C;  4FW2 A;  1U8R A;  1YIT Q;  3GIB A;  2VVK A;  4XK8 E;  2OAU A;  3CCE A;  3CC7 Q;  5LJ3 d;  5D2K A;  1N5Z A;  5IHI A;  3VS0 A;  5C0M A;  2W10 A;  2EQI A;  2XDB A;  3QJY A;  2KT1 A;  2FRY A;  3DB4 A;  4CC3 A;  1RAF B;  1UB4 A;  5IN1 A;  1VIF A;  1GCQ C;  2PUK B;  2LNV A;  3JCM V;  3HRS A;  2VC8 A;  3CBO A;  2H3J A;  3A98 A;  4Z8A A;  4BUG A;  3VV0 A;  4QW2 A;  2HL3 A;  4NOY A;  4M77 F;  4FIB A;  1GFD A;  2QEX A;  5D2F A;  4BI4 A;  3VRY A;  5I22 A;  1XTD A;  4AT1 B;  1UEB A;  1YCS B;  3HRU A;  2OJ2 A;  2L3S A;  4JRI A;  3V8L A;  3HP9 A;  4BI3 A;  4EMK C;  2QA4 A;  2RK1 A;  3H0F A;  5I21 A;  4C8Q G;  1Q7Y R;  3L2Z A;  2K9G A;  1D1C A;  4ZN1 A;  4FSX A;  1UTI A;  1NJI R;  2CYZ B;  1VQN A;  2RPN A;  4JDS A;  4C92 F;  1WNL A;  3G4S Q;  1QMC A;  3EHR A;  2XDD A;  1Q86 U;  1GL5 A;  4XTX A;  4J7F A;  1EIF A;  3GF5 A;  1JJ2 S;  2ENM A;  2LCC A;  1K9M U;  3OYN A;  2KDS A;  1WHK A;  2WSC E;  2L0A A;  2RD1 A;  3A8O B;  1VQ9 Q;  1M9S A;  5J26 A;  2D8H A;  4M7D C;  2R5M A;  2HEQ A;  2HQE A;  1ZA2 B;  4XQ3 A;  1W2B A;  2KT8 A;  2Y4Y A;  1WXT A;  1H3Z A;  1MUZ A;  1B34 B;  5J3B A;  3CCU Q;  3RKX A;  1VUB A;  3HFN A;  1X6O A;  3RMQ A;  2RNA A;  2PU9 B;  1VA7 A;  1K0S A;  4OMO A;  2E6Z A;  3JB9 J;  4QKU A;  3OW2 S;  1YJ9 T;  1K73 C;  3CPW P;  1Q82 U;  2Q1A X;  8AT1 B;  1UGS B;  1XJW B;  1WYX A;  2RF0 A;  4A4E A;  1S1N A;  1VQO Q;  1KHC A;  3FB9 A;  2FZC B;  4RCC A;  2PTK A;  3LWI A;  1KC8 C;  2D8J A;  2EWN A;  2FVU A;  4QVZ A;  2DJZ A;  3L2V A;  4LDV A;  2EQM A;  4BAC A;  2KRO A;  2RQV A;  2HAX A;  3IQL A;  4JJB A;  3A8L B;  4NL2 A;  4C92 B;  3UAT A;  1VQ6 A;  1M27 C;  2EYW A;  1M3B A;  2K5F A;  4BE0 A;  3CCS T;  2BKD N;  4D8K A;  2EKO A;  2EJG A;  5CKE A;  2BTT A;  3BE3 A;  4EDU A;  2GBQ A;  5GAN g;  2NLU A;  2CZ6 B;  3SB2 A;  4M75 B;  2EKH A;  3CC2 Q;  2COW A;  1M3C A;  1AZE A;  4E7Z A;  1SSH A;  1FX7 A;  2RHU A;  3OSV A;  3M0T A;  3S3O A;  1EX4 A;  4JS5 A;  2J06 A;  5GAM j;  2DO3 A;  4A63 B;  2W0Z A;  3EGD B;  2O2O A;  3RER A;  4BDZ A;  3OYL A;  3FLG A;  3TVT A;  3CC4 Q;  1YIJ A;  2Q1D X;  1U1T A;  1OPL A;  1NZ9 A;  2ZPI B;  4LDY A;  1KK7 A;  2QQR A;  1D09 B;  2DF6 A;  4E7L A;  2JOY A;  1VQO A;  1S72 A;  1N27 A;  4JPB W;  1IXD A;  1GFC A;  2MOX A;  4GBQ A;  2E5K A;  3OYM A;  5IHN A;  1ABO A;  1SHG A;  4RTV A;  2QTV A;  5CK9 A;  5KYN A;  3GBQ A;  3CCJ T;  1H92 A;  1AWJ A;  1VQ7 Q;  4E7I A;  2M0O A;  4PKC C;  1NYF A;  2L3P A;  2P4T A;  1I81 A;  1JRI A;  3JB9 F;  4Y91 A;  1Q7Y C;  1TUG B;  1RAE B;  2GFU A;  3OQ5 A;  2CUD A;  2LMJ A;  2G6F X;  4C5G A;  4CI0 C;  2I0N A;  1PSE A;  3HFO A;  1KQ2 A;  3PE0 A;  4L59 A;  2GGR A;  4XAX B;  2MCN A;  3RKW A;  3MEU A;  5HKC A;  5LJ3 h;  4ZGJ B;  4N4I A;  4JJN K;  1NEG A;  5AYF A;  2J6F A;  4A4K A;  4IUQ A;  1UE9 A;  4F04 B;  2RI5 A;  3PGG A;  2WSE E;  3ME9 A;  1ARK A;  5CR2 A;  4F7U E;  4ELY C;  1I0C A;  1AZG B;  5LJ5 g;  1SV6 A;  4C92 G;  5IXB A;  1OI1 A;  1C6V X;  1ZSG A;  4E7S A;  1IB8 A;  1IZ6 A;  1VQK Q;  5KCH A;  3GNF B;  2LT4 A;  1I8F A;  3HSB A;  4ATO A;  3C0C A;  2LZ6 B;  1G3S A;  5GAM e;  3OYF A;  3WXM B;  1YIT T;  4M75 G;  2C0T A;  4GLM A;  1NE8 A;  1WJQ A;  2PQW A;  2K4Y A;  3CC7 T;  2DMO A;  2LP5 A;  2X51 A;  5I2M A;  4JJC A;  2EYZ A;  2GTJ A;  3CCV T;  3RKY A;  1Q7Y U;  5GAN j;  3OYG A;  4YTL A;  1WQ7 A;  3JCM c;  3SHW A;  1NJI U;  1IGU A;  2BZX A;  1AD5 A;  4PJO D;  4M7D E;  3QII A;  1H3H A;  2QAS A;  1T3L A;  1VQ7 A;  5CIU A;  1PD1 A;  3S6W A;  2LX9 A;  1U1S A;  3I56 T;  4RKU E;  2XMF A;  3EGX A;  4F7U A;  2VB6 A;  3ULR B;  2KE9 A;  2C0I A;  1PG5 B;  3EG1 A;  3QSU A;  2DA9 A;  2OX7 A;  3JV3 A;  2MWP A;  2ROL A;  5FU7 C;  1E7O A;  5GMK i;  2LX7 A;  3TRE A;  2DEQ A;  4EMK A;  3HTR A;  5KE2 A;  2CT4 A;  1J3T A;  4F17 A;  1YJ9 Q;  1RLP C;  3KBG A;  4M78 D;  4CC7 A;  1WA7 A;  1UDL A;  2IG0 A;  4IUV A;  3S52 A;  1OUL A;  3M56 A;  2AZV A;  3A5Z B;  1VQ4 A;  2HSE B;  2LTO A;  2KR3 A;  4AFU C;  1GCP A;  2A36 A;  3V7C A;  4C0D B;  2X3W D;  2CZ1 B;  1FMK A;  4BD3 A;  2PUO B;  1SHF A;  2JNG A;  1QLY A;  1KQS A;  3JAM E;  4KGV B;  3SWN B;  3M0S A;  1WHJ A;  3L2W A;  4FU6 A;  2FYK A;  3M0Q A;  4OB0 B;  3CCU T;  2DZ9 A;  2K3Y A;  2ATC B;  3RMS A;  3C4S A;  1QVF A;  2DD4 A;  3UF4 A;  3BQB A;  4M7D A;  3E9F A;  5KYX A;  4X9D A;  2GCX A;  3NTK A;  4AFZ C;  3CME T;  1R0B G;  2D1X A;  3CCS Q;  4WTO B;  3I9Q A;  2L3R A;  4NS5 A;  3GOX A;  5GAN 6;  4DQ2 A;  2DLP A;  2O9S A;  4ANJ A;  2O31 A;  2JTE A;  4PFO A;  5GAN e;  1WQW A;  5CCA A;  1NLO C;  3FJ5 A;  2GNC A;  1M90 R;  4Y92 A;  3OYB A;  4RUG A;  2VAS A;  2NWM A;  5LJ5 j;  1A0N B;  2COY A;  1SRM A;  1ABQ A;  1O9S A;  4HCZ A;  3VS2 A;  1M1K R;  2AIR B;  4LN2 A;  4HA8 A;  4RG8 A;  3OYE A;  2DNU A;  4C8Q D;  2XD0 A;  2EQJ A;  6AT1 B;  1ZUY A;  2X9H A;  2DD5 A;  5GJW B;  5AT1 B;  1NYG A;  4X34 A;  2Z0W A;  2XHC A;  3CBM A;  3OB9 A;  4N4H A;  4N4G A;  3KXT A;  3L2R A;  1X6G A;  4OB3 B;  1D1A A;  1GXI E;  4KH1 B;  3PTA A;  4PJO E;  2DL8 A;  3G6E T;  1XQH A;  3JRZ A;  4XTU A;  2K5I A;  3A8H B;  2DBK A;  3M0U A;  2E4H A;  3UPU A;  2AKL A;  3V77 A;  1TG0 A;  1SG5 A;  1M1G A;  1CSK A;  2O9V A;  2ZAE A;  1JBM A;  2QGF B;  2C06 A;  2K2M A;  1F1B B;  1AWW A;  3CMA A;  4C0Z A;  4KT0 E;  1HK9 A;  3ER0 A;  1BIA A;  5GAO r;  3M58 A;  3PIP A;  4JRQ A;  1HD3 A;  2NUT A;  2HKQ B;  1MND A;  3CCJ Q;  3JCM P;  1X6B A;  4IUP A;  2DBM A;  1QP3 A;  3J81 E;  3M9Q A;  5IHK A;  2BIV A;  1AWO A;  4A4G A;  3I55 A;  4PFP A;  3INZ A;  5GAN 7;  1VQP T;  3CCS A;  2KXC A;  5KYY A;  5GJV B;  1D3B B;  3UDC A;  1KD1 C;  1GBR A;  2Q18 X;  1W6X A;  5DM7 R;  5D6W A;  3JCM e;  3OY9 A;  2KAF A;  3QDR B;  4O6J A;  1RL2 A;  4E7H A;  2E5Q A;  4M78 G;  1AEY A;  2YLC A;  2KQW A;  4QVC A;  4XTW A;  1YWP A;  4PJO A;  3NPF A;  1GTT A;  2F2V A;  2JMA A;  1WJR A;  5LJ5 e;  5KE3 A;  5KYU B;  2IIM A;  5GAM d;  3F70 A;  3EG0 A;  1UJY A;  4FT2 A;  4DBH A;  2JXB A;  4M7A B;  3RBB B;  1LJO A;  3M4G A;  3JCM b;  1ZSZ C;  4A4F A;  1H64 1;  3CXC A;  4BY6 B;  1M2O A;  1XNI A;  3QYG B;  1K9M C;  1M3A A;  1W1F A;  2CT3 A;  3VYH B;  3VKI A;  3WVE B;  2VYT A;  5GAN f;  5GMK h;  3CCV Q;  4DEX A;  3EG9 A;  2LJ1 A;  3X25 B;  3NHN A;  3SDZ A;  3MEW A;  3OS0 A;  2ZPG B;  4C8Q E;  4EMG A;  2OTL T;  4EPC A;  2VGM A;  2YRD A;  4TVR A;  3M55 A;  1U5S A;  2E64 A;  1KD1 U;  2F5K A;  2HQH A;  3CCQ T;  1VQK T;  2A3L A;  2QQA A;  4FYW B;  4J9F A;  4HCC A;  1K4U S;  3I5S A;  2YDL A;  4OF1 A;  3EFS A;  3HPW A;  2KYM A;  3VS3 A;  3I56 Q;  3THK A;  2LJ3 A;  1Q82 C;  1G3W A;  2YUQ A;  2NUP A;  2CSI A;  1PKS A;  2F2W A;  2FEI A;  1NPP A;  1WZO A;  3E9G A;  2DRK A;  1YWO A;  3MP6 A;  2RN8 A;  1Y96 A;  2LDM A;  1VYT A;  2QK0 A;  1EFN A;  1WGS A;  1QVG A;  3DB3 A;  4HT8 A;  4MZT A;  2HSP A;  2HKN A;  2GFA A;  1K8A R;  4LDX A;  1IHW A;  1I5O B;  1IRE B;  2GTO A;  4JZ4 A;  4R56 A;  3DLL A;  4PNO A;  3QG1 A;  3X28 B;  3EGU A;  4WCI A;  4NL3 A;  1PCX A;  3HHT B;  1YN8 A;  5LJ3 g;  2COZ A;  3EH1 A;  2CZ0 B;  4JJD A;  1CKA A;  1K1Z A;  1AVZ C;  1VQM A;  2RHY A;  2E3I A;  1G5V A;  2OTJ A;  2PZ1 A;  3LW5 E;  1YHQ T;  1HSQ A;  2V8J A;  4FYV B;  5GAN 3;  4C8Q A;  2PNI A;  5FU6 B;  1YIT A;  2Q19 X;  2E6N A;  1V29 B;  3CC7 A;  1TXQ A;  2ECZ A;  5D2I A;  3CME Q;  4MZP A;  3UA6 A;  3O8V A;  3VS4 A;  4F7U F;  2YXY A;  4M77 B;  2AHJ B;  1PD0 A;  4UC4 A;  1YI2 Q;  3NGP A;  1TUC A;  2RK2 A;  3E1S A;  1UUE A;  2FZG B;  3JCM f;  2QQS A;  2DKG A;  5J39 A;  4C92 D;  1GRI A;  1BI1 A;  2RQR A;  2JM9 A;  4Y28 E;  5CKF A;  1BKB A;  3G7Z A;  2RQW A;  2DVE A;  5LJ5 f;  3OYI A;  1WPY A;  1ZHI A;  2JS0 A;  2O88 A;  1QWE A;  2QGG A;  2YUO A;  4CRI A;  2EPD A;  4M7A G;  1M90 U;  2LQW A;  2RHI A;  1QP2 A;  2KGT A;  4M75 D;  2EQK A;  5GAN 4;  1WFW A;  5CVI A;  2QI2 A;  4K11 A;  1OOT A;  1AWX A;  3I56 A;  5CQY A;  1GBQ A;  4IUR A;  3BDU A;  1SKU B;  4C5I A;  3RR6 A;  2DIG A;  4AFQ C;  2FPF A;  2HBW A;  3HL8 A;  1Y57 A;  1MHN A;  4LDU A;  3G4S A;  1C0M A;  4M7D F;  2FG0 A;  3G6E Q;  3CCR T;  3KFV A;  1PWT A;  3S3M A;  2YRC A;  1JJ2 A;  1QCO A;  2AK5 A;  3LYI A;  1VQ9 A;  4BI8 B;  2CZ7 B;  2RJD A;  3OBY A;  2DXT A;  2V1R A;  2KMT A;  2K2V A;  1I7O A;  3EGX B;  1RI0 A;  2YSQ A;  5D6Y A;  5A2Q E;  2ZPH B;  3LZK A;  4J8O A;  2OAW A;  2YUN A;  3J80 E;  2O01 E;  1BI0 A;  3CPW S;  4EMH A;  3CCU A;  1NPR A;  2MMP A;  3CEY A;  4EMK B;  1VQP Q;  2DRM A;  3OW2 A;  1ZX6 A;  3OYK A;  1JXM A;  1JU5 C;  2LT1 A;  2E70 A;  1M30 A;  3ZL7 C;  2RB6 A;  5FRM A;  3SD4 A;  5I11 A;  1PKT A;  1YJN T;  3C95 A;  1PM3 A;  4PJO C;  3M0R A;  3QHS A;  2DXC A;  3NFC A;  3PT9 A;  2LNH B;  1UGV A;  5DLO A;  5KH6 A;  1TU0 B;  4OB1 B;  1WHL A;  3R6O A;  1LCK A;  2DK3 A;  3PMT A;  1KQS P;  2CRE A;  4OGC A;  2DZC A;  1UGP B;  2BUD A;  1N8R R;  2VGN A;  1VQL T;  4M7D B;  5KYX B;  2IPO B;  2X4J A;  5GAM h;  2A0F B;  2EGC A;  1QVF P;  4M77 G;  4E7J A;  3RNJ A;  3R6N A;  2CP0 A;  3VS6 A;  1NJI C;  1WJS A;  3OBW A;  3J7A F;  2R58 A;  2YUP A;  5CAI A;  4M78 C;  3A8G B;  1RAI B;  3H9N A;  3OS2 A;  3CC2 A;  3LGL A;  2HBP A;  2ZCF B;  1HJD A;  1OEB A;  2LJ0 A;  1VQ5 Q;  1NG2 A;  2YRV A;  1VOM A;  4M75 E;  2LQK A;  1BCO A;  1OX8 A;  4WF2 A;  4XU3 A;  2OTL Q;  4R55 A;  2RQT A;  4ZTJ A;  1B34 A;  2F5T X;  2QTX A;  1FXX A;  3VJP A;  4PL6 A;  1BIB A;  2D9T A;  1QWF A;  3U23 A;  1VQN T;  5FW9 A;  2ESW A;  3CCQ Q;  1G2B A;  1YBY A;  4J9D A;  2KRS A;  2AZS A;  3QDF A;  1Q81 R;  4PJO F;  2MIO A;  4II1 A;  2O4X B;  1VQP A;  3CC4 A;  2K3X A;  2WAC A;  4C5H A;  1YJW T;  4AG2 C;  4OVA A;  9ATC B;  1G83 A;  3A1P A;  3QUI A;  1KQS S;  1M8M A;  2LQN A;  3EFO A;  5GAO n;  1TWB A;  1ZSZ A;  3H0I A;  2H8H A;  1T0J A;  2KBT A;  1X75 C;  2E10 A;  3QO3 A;  1QQJ A;  2NUT B;  4HXJ A;  4IUT A;  3M4Y A;  5LL6 S;  1R8O B;  4C92 A;  1QVF S;  3CCM T;  2RI3 A;  1OU8 A;  5KYW A;  4PK4 A;  3EFR A;  2EB4 A;  1W70 A;  1K8A U;  4C8Q C;  3FJP A;  2E1H A;  2CP7 A;  2V1Q A;  2ZGW A;  2A28 A;  1MGQ A;  2CGH A;  4XU1 A;  3QKJ A;  1T0H A;  4HCK A;  4KUD K;  2X4X A;  3ZEH A;  1YHQ Q;  4M75 A;  1OU9 A;  2MPX C;  4JZ3 A;  1TH7 A;  2CS7 A;  3CD6 Q;  4MAQ A;  4A4H A;  2EVR A;  2MWO A;  4J7I A;  4J9G A;  3BFM A;  4MML A;  2MAM A;  2XK0 A;  2CP2 A;  4RCB A;  3BW1 A;  1QW1 A;  1Y07 A;  5HK3 A;  2E3H A;  4AMC A;  3TSW A;  4DOW A;  1M5Q 1;  1RLQ C;  1WHM A;  1EZZ B;  2DYB A;  1RI9 A;  1K9A A;  4JRK A;  1IGQ A;  1VQK A;  4KH0 B;  4HCB A;  2DTO A;  1I1J A;  4RTW A;  1UHC A;  2FB7 A;  2JW4 A;  2F69 A;  4HKE A;  2WSF E;  1BCM A;  2QDY B;  4M4Z A;  4B6M A;  2KI7 A;  1M2V A;  5CQX A;  1PRM C;  1HXD A;  1QVP A;  4BB7 A;  5HY6 A;  2HNI A;  1Y7X A;  3CXC P;  2FRW A;  4XU2 A;  1NM7 A;  3CQT A;  1X69 A;  3EG9 B;  4DBR A;  1YI2 T;  1OZ3 A;  2FO0 A;  2KSS A;  2SRC A;  4C8Q F;  4J9E A;  1CKB A;  1U06 A;  1V1C A;  3G71 T;  1ZQ1 A;  2DJQ A;  3DLM A;  1K0X A;  3PNW C;  5EG2 A;  3CCR Q;  5M9O A;  2E12 A;  1YP5 A;  2EFI A;  2LCL A;  4DEY A;  2X4Y A;  1YIJ T;  1VQ8 Q;  4GLK A;  3M54 A;  4J9I A;  4PJL A;  4AG1 C;  1IO6 A;  5C6S A;  2AKK A;  2CH4 W;  2CSQ A;  2RJC A;  2X4W A;  1X27 A;  5D2J A;  4PFZ A;  5GAN 5;  1D1B A;  4XU0 A;  2SEM A;  1WLP B;  4FYX B;  4N0A C;  3LH5 A;  5GMK l;  4RTY A;  3H0H A;  4GY5 A;  1Y96 B;  3V7S A;  1LOJ A;  1SAW A;  1YNZ A;  1T3S A;  3RES A;  4LD9 K;  4JRP A;  3JB9 G;  4E2F B;  4XTV A;  3L1A A;  1NBE B;  1R0C B;  3P8D A;  2HL5 C;  3M53 A;  1YJ9 A;  1TTH B;  4P5N A;  2EAY A;  4LNP A;  1OPK A;  3OA6 A;  1YJN Q;  2YWW A;  4ZNX A;  2M1H A;  2DXB A;  3G1J A;  2EYX A;  3FC3 A;  2RO0 A;  5EC7 A;  2KY9 A;  1WIE A;  3PFS A;  1G3Y A;  1Q95 G;  5LJ3 f;  4F14 A;  3QPH A;  3JB9 I;  2CUB A;  2F1L A;  4J83 A;  2CP5 A;  2M16 A;  1W2B P;  4FT4 A;  1WHG A;  1K73 R;  2DFU A;  2A37 A;  3Q1J A;  3JCM X;  3V8J A;  1VQL Q;  2P4R A;  3NTI A;  2XU8 A;  2QDL A;  2VUB A;  2VXF A;  1M1F A;  2LC4 A;  1IRX A;  3SEM A;  1RAH B;  4M78 E;  1N8R U;  2RH2 A;  1PC0 A;  2Y90 A;  1FMW A;  1ZBJ A;  1SRL A;  1TSF A;  2ZPB B;  1KC8 R;  2MYS A;  1AT1 B;  4ME7 A;  1WDX A;  2ZPE B;  3REA B;  2V8K A;  4KGX B;  2DM1 A;  4J6Y A;  2QEX Q;  3V7R A;  3O5Z A;  5FU7 B;  2NYS A;  4B9W A;  1RAA B;  3CCR A;  2DIL A;  2L89 A;  3MKD A;  5GMK m;  2X35 A;  1E6H A;  2L2P A;  3GNG A;  4J9H A;  1ACM B;  2VWF A;  3RIR A;  1K76 A;  4M7A D;  2P0P A;  1KHI A;  4RTX A;  1ZLM A;  1X43 A;  1BYM A;  2DL7 A;  2EYQ A;  1G8X A;  5KCO A;  4OMM A;  8ATC B;  2K7A A;  3GLX A;  2LCS A;  5GMK j;  1LNX A;  4BE1 A;  4X1V A;  1VQN Q;  4D6W A;  5GAO p;  1OQK A;  1KFZ A;  4ZGE B;  2LRQ A;  2VKN A;  5CKB A;  1MMD A;  1UEC A;  5IT9 E;  3MP8 A;  4MDW A;  3WVD B;  4HVU A;  3UT1 A;  4JLG A;  2HMA A;  4OGE A;  2DL4 A;  4RTU A;  3HKS A;  2QG9 B;  1PRL C;  1YJW Q;  1Q81 U;  4C92 C;  1SPK A;  2R57 A;  4Q5W A;  2HCK A;  3TCJ A;  1OV3 A;  1B3Q A;  1N9R A;  3JCM Q;  1ZA1 B;  1VQ5 T;  1Y0M A;  1JJ2 P;  1YJN A;  3H41 A;  4L5G A;  1RAG B;  1W2B S;  5D6X A;  3BDL A;  2EGA A;  3SWN A;  2E41 A;  1KQ1 A;  1KG1 A;  2CP6 A;  1FYN A;  4FYY B;  4M78 A;  4PLI A;  4OMN A;  3NTH A;  2EIF A;  3OYY A;  3EG3 A;  3CCM Q;  3CCJ A;  1V76 A;  4M75 C;  1W4S A;  4EIK A;  2XI9 A;  2DTH A;  1TUD A;  4ORZ A;  1VQL A;  2DPP B;  3MP1 A;  2MF2 A;  1VQ4 T;  2VXE A;  2EJ9 A;  5FWB A;  2D0Q B;  2I2L A;  2KRM A;  3EAE A;  3OW2 P;  4DBF A;  1UG1 A;  3QJ6 A;  4PJM A;  1QCF A;  2P0Q A;  5CO7 A;  5GAM g;  1M4Z A;  4BDY A;  2BZY A;  2DET A; 
#chains in the Genus database with same CATH homology
 2EB4 A;  5D2G A;  3R6O A;  2Q18 X;  5D2J A;  4PFZ A;  2EB5 A;  5D2H A;  2DFU A;  2Q1D X;  4DBH A;  2Q19 X;  1NKQ A;  3V77 A;  3RR6 A;  2HZY A;  1HYO A;  1I7O A;  1WZO A;  2WQT A;  4DBF A;  1QCN A;  5D2I A;  4QKU A;  3S52 A;  1NR9 A;  1SAW A;  3LZK A;  3BQB A;  3QDF A;  5D2K A;  5D2F A;  1QQJ A;  2Q1A X;  1GTT A;  2EB6 A;  1QCO A;  2Q1C X;  4MAQ A;  1SV6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...