1WZOA

Crystal structure of the hpce from thermus thermophilus hb8
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
246
structure length
236
Chain Sequence
b'MKLARFLAKGRVHQGVYREGLLLDEAGEAHRPEDVTWLLPFTPGKILGVALNYAGLSRPEEPALFWKPNTSLLPHKGVVLYPKGARFVHYEVELAVVVGRPMKRVRAKDALDYVLGYTIANDLVARDYVRPPIRAKGRDTFLPLGPFLVVEEVEDPQDLWLRAYVNGELRQEGHTSRMLYSVAELLEFISEFMTLEPYDVLLTGTPKGISQVRPGDVMRLEIEGLGALENPIEEEP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HpcE
publication title Crystal Structure of the HpcE from Thermus Thermophilus HB8
rcsb
source organism Thermus thermophilus
molecule tags Isomerase
total genus 60
structure length 236
sequence length 246
chains with identical sequence B, C, D
ec nomenclature ec 5.3.3.10: 5-carboxymethyl-2-hydroxymuconate Delta-isomerase.
pdb deposition date 2005-03-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01557 FAA_hydrolase Fumarylacetoacetate (FAA) hydrolase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.370 Mainly Beta Roll SH3 type barrels. FAH 1wzoA01
3.90.850.10 Alpha Beta Alpha-Beta Complex Fumarylacetoacetate hydrolase; domain 2 Fumarylacetoacetase-like, C-terminal domain 1wzoA02
1QCOA 2EB6A 4DBFA 5D2JA 1I7OA 5D2IA 3RR6A 3R6OA 3S52A 2DFUA 1QQJA 1NR9A 3BQBA 3LZKA 3QDFA 1SAWA 2Q18X 5D2HA 2EB4A 3V77A 5D2KA 1NKQA 1SV6A 4PFZA 1GTTA 5D2FA 2Q1DX 2Q1AX 4DBHA 2HZYA 1WZOA 2EB5A 2Q1CX 1QCNA 4QKUA 4MAQA 2Q19X 1HYOA 2WQTA 5D2GA
chains in the Genus database with same CATH superfamily
1QCOA 4D8DA 1IXDA 4VUBA 2LDMA 2P0PA 2ATCB 2KEAA 3NTKA 1PKSA 1MNEA 4QQ6A 4XU0A 1H92A 2JOYA 5A0DA 2DPPB 2OAWA 1D3BA 3M9QA 2GGRA 4X9DA 3C94A 2DZ9A 3KBGA 4FL6A 2RK2A 4JS5A 2KROA 3LGFA 3KXTA 4CC4B 3OS0A 2ZZDA 5CK9A 4PNOA 1QCFA 2DNUA 3QG1A 4Z88A 4M7DC 3CBMA 2QEXA 1Y7XA 3QBYA 2EFIA 1ZBXA 4RTWA 1W6XA 2Z0WA 2DL3A 2LJ3A 4OB3B 4BE1A 2KMTA 3PGGA 1VQ8A 3PIOA 2NUPA 3FEOA 5FU6B 4PJOG 5GAN5 2L3SA 4M75E 1E6HA 1LCKA 4EMKB 1NG2A 1JBMA 3CCMQ 3CCJQ 1M1FA 2K3XA 4PJOB 1VQNQ 3CPFA 1RADB 2EWNA 3TVTA 2FO0A 2EQUA 4PJJA 1Y0MA 4OGCA 4MAQA 3UPUA 4M77E 2WQTA 2LMJA 2HNIA 3RKWA 4C92D 1WHLA 2VYTA 1UECA 1SPKA 2JMAA 2LQWA 4AFZC 2IPOB 1OOTA 1GBQA 5LJ3d 4J9BA 4OMNA 4DA4A 2JM8A 4C5GA 4J9FA 2L3QA 3RESA 1TOVA 2BZ8A 3J80E 4IUVA 3REBB 3GIBA 3PE0A 5FU7B 4C8QF 1MMAA 2DK3A 1Q82C 4DBRA 2DM1A 1OX9A 1YWOA 4M78F 3LYIA 1QP3A 3KUFA 3MJXA 3S6WA 5GAOr 1M1KU 4BI3A 4N4IA 5KYYB 2LQKA 3GPLA 3LZKA 1NYFA 5DLOA 1UE9A 1NZ9A 4RUGA 1SHFA 4KH0B 2ENMA 4M75C 2EYXA 3HFNA 1B34B 1H641 2RF0A 5KYWA 3CCVQ 4C5EA 1X2QA 3CCRQ 1Q7YC 1I5LA 1YJ9T 4OB0B 1QVFP 4JZ3A 1C0MA 3CPWA 4F16A 5GANe 5GMKe 4OMMA 1EFNA 1Q82R 2ECZA 4E7ZA 2B8AA 4BB7A 4ESRA 1JJ2A 4FM4B 4PJOE 4YTLA 3OSSC 4OGEA 2CREA 2C0TA 3EGXA 1MV0B 4M7DF 1K9AA 3OA6A 1SRMA 3NFCA 3RIRA 1VQOA 3VUBA 4B9XA 2DERA 4JJNK 2CYZB 3A8LB 1OPKA 3I55A 1K9MC 2ZPIB 2ABLA 2DTHA 1Q7YR 2CH4W 5CQYA 3OYJA 1JXMA 2WSFE 1RABB 4M7AA 2VGNA 2PUOB 2HBWA 4BE0A 5D2FA 3I9QA 3JCMV 1R77A 2ZGWA 1AWJA 2JMCA 3EG9A 3E1SA 3PMTA 5J3BA 5C0MA 4ME7A 3CCST 2HSPA 4EMKC 4C0GA 4BACA 2E1HA 5DLQE 1OV3A 1X75C 3PNWC 4KRTA 1WNLA 4QW2A 4TVRA 1RACB 2BZYA 5IXBA 1K9MR 3CCEA 1PSEA 4FSSA 1WGSA 1YFNA 4PFZA 1YITA 1G3SA 4OMLA 3S3OA 2BTTA 1VQPQ 5CQXA 1HYOA 1RL2A 3SHWA 3CC7Q 2OTJA 2YUOA 2DEUA 1BBZA 4C0DC 3OW2A 4XTUA 2EQIA 3OS1A 3HRUA 1F1BB 1PC0A 2F2XA 3FJPA 1K8AU 2KXDA 3CC4Q 1M4ZA 5L8RE 5GAN8 5FRNA 2QEXT 3L2RA 2XI9A 1VQMT 2KSSA 3M4GA 5GAN6 3RNJA 1UUEA 1HK9A 1YCSB 1KC8U 3JCMP 1K0SA 3G71T 5LJ3f 3SEMA 2QAZA 1OU8A 3VRYA 1G2BA 2RJDA 3JCMb 3JV3A 2PZ1A 3MO8A 2DAQA 1V1CA 2CS7A 4B9WA 1VQ7T 3EGDB 1K73U 4QQGA 1Q81U 2JTMA 3EFRA 5LJ3e 3L2QA 4DEYA 4LDXA 1XNIA 2L0AA 4LD6A 1HSQA 1SF9A 4HCKA 2J6OA 5D2GA 4CC2A 1ABQA 4JJCA 4JRKA 3IQLA 4FSXA 5GAMf 1BIBA 2KQWA 2JNGA 4PFOA 4J7FA 4A54A 1S72T 2CP2A 2LQ8A 4FU6A 2R5AA 3QYHB 2DJZA 2RQTA 1WXUA 2QA4T 1YHQQ 3CC7T 3C0CA 5KYUA 5GAMe 2CSQA 2CP3A 1VQ4Q 1RAIB 1WXBA 1XQHA 2G3RA 2RH2A 3H41A 3EGUA 3LWIA 2XD0A 2LZ6B 4D6WA 1LJOA 3I5RA 1G3YA 1QVFS 1Y07A 2VV5A 3CC4T 3M57A 2HQHA 1WQ7A 1VQ9Q 1LPLA 1IB8A 4QVDA 3OYNA 3JCMW 2EYZA 4M7AF 2K5FA 2O9VA 2RHZA 2C06A 1OZ2A 2RQWA 2EB6A 4PL6A 3V7RA 2QGGA 2OTLQ 2DVEA 2L3PA 1QKWA 1JQQA 4HVWA 3S3MA 5I2SA 4QKUA 3E2UA 4JPBW 2RNAA 1U1TA 3ZBDA 3OYEA 2LT4A 3SD4A 5AYFA 4HT8A 3CD6Q 1RI9A 2VVKA 1PRLC 1OEBA 2QDLA 1U8RA 1DJ7B 3I55T 1NKQA 1X43A 1GTTA 1EZZB 2Q1DX 2HBPA 1VQ5T 1VQKA 2FZCB 1PWTA 1X01A 2XDBA 1TUCA 3RUXA 5GMKm 4LUEA 1SSFA 1K8AC 4ZNXA 1YN8A 3OYYA 1E6GA 1S1NA 4KH1B 3MEVA 2A28A 1VUBA 4C8QD 3OY9A 1FYNA 4HCCA 2DO3A 3L2WA 2KK4A 3X26B 4M78D 3CCQQ 4Z8AA 3GBQA 1YCYA 3JSCA 4FYYB 2MIOA 1CKAA 2J05A 2NYSA 4HCBA 5HY6A 2D0QB 3HFOA 4KGZB 2NUTB 3CCET 2IG0A 2HKQB 1YJ9A 2WSCE 3QWXX 1YITT 4XTYA 3JCMc 2O4XA 2SEMA 2FHDA 1K8AR 2XG8D 1K73C 2CUDA 2BKDN 2J06A 3GNGA 1PSFA 1YWPA 3JRZA 2JXBA 2AZSA 2CH4A 3S52A 4C8QA 1D09B 3CCMA 1UGVA 1P92A 1QVPA 2DL8A 3L42A 1VQNA 2X3XD 3GLXA 3ZFJA 1TTHB 2RHIA 3QHSA 1NJIU 2X9HA 4DBHA 5LJ3g 3NGPA 3HRSA 2A36A 2LC4A 4EDUA 4IKFA 3L2ZA 1N5ZA 1V76A 4MMLA 4M7DD 2KAFA 2V26A 4ANJA 1JRIA 1M2VB 1N27A 2DF6A 4DOVA 4HXJA 3A8MB 1YIJT 1QVFA 2EIFA 1OULA 2FZKB 1TU0B 1N6AA 4DOWA 2LT1A 3TQ7P 3CBOA 5GAMg 3LLRA 3A1PA 5KCOA 2F2WA 3OBWA 3CCSA 3C4SA 3EAEA 3NMZC 5HKCA 4NL2A 4OP0A 4ZGDB 4M77G 2XU8A 1ZUUA 2RB6A 1GCQC 2SRCA 2DE0X 3CCRA 2O88A 1BI0A 3TREA 2K2VA 4XU2A 2AK5A 2CDTA 5A0GA 1TUGB 1NPRA 3PIPA 3DLMA 4FYWB 2QK0A 4KGVB 2QDYB 3NTIA 2D8HA 4FW1A 1AZEA 2O9SA 4B6MA 1Y96B 3OYAA 3JCMh 4BUGA 1B3QA 3PFSA 1KQSP 2YLCA 3H0IA 2CT3A 5FLXE 1IHWA 5GJWB 3VV0A 1I7OA 1KG1A 5IHNA 1RUWA 4J9EA 2LRQA 2M02A 1QLYA 3LH0A 4M75D 5HCKA 4GY5A 4N0AC 1VQLQ 2E70A 3QJ6A 2E10A 4XTVA 1U5SA 1VQMA 2RJEA 4AFQC 4BD3A 4C92B 2RHUA 1ABOA 1YI2Q 1M8VA 4PFPA 3UATA 1PM3A 2R58A 2RK1A 1QMCA 1TS9A 2KRMA 1M90C 1I4K1 2AIRB 1K4US 3G71A 3CMET 1KSWA 2DL4A 4XAXB 1AEYA 4JZ4A 7AT1B 1PHTA 5GAN3 3G4ST 3LGLA 3E9GA 5GAN2 1GL5A 3I56Q 1QVGP 1VQ7A 4L6V5 1X69A 4XTZA 2BIVA 3LX7A 1MHNA 3CC2T 2DX1A 1D1BA 2VXFA 4GLMA 2DL7A 5DY9A 2AT1B 2LJ0A 3L2VA 4M75A 3WXMB 2ED1A 3OW2S 2HMAA 1WHGA 1SAWA 4ZTFA 2X4JA 1AWOA 4F7UG 1UHFA 2KRNA 1GXIE 2EB4A 2KVQG 3SWNB 2D0NA 4E7SA 1VQKT 3JB9H 2K79A 1KD1C 5FW9A 1WZOA 1MUZA 4KUDK 1M90R 1S72A 3VKIA 3MP1A 1PD1A 3BY7A 4M77A 4F7UB 4BI8B 4MZPA 2QA4A 4JDSA 3CC7A 1TSFA 1K0XA 2M9UA 2VC8A 4EMHA 1N8RU 4QVCA 2KY9A 3VS2A 2W10A 3JCMg 5D6XA 3VUZA 5IHKA 5EG2A 2COWA 4R55A 3FJ5A 2JUFA 2XMFA 1WA7A 3CC4A 5DM7R 2VKNA 4C92E 2VASA 5GANf 1Z9ZA 2E64A 3V7SA 5CAIA 3PVLA 4C0FA 5GAOn 2A08A 1QQJA 1KD1R 3FB9A 2L2PA 4IURA 4M77C 1ZSZB 2LQNA 1X6GA 2F5TX 3V77A 4LNPA 4M7AD 4A4HA 4X9CA 2HL3A 2E5KA 4V2SA 1M3CA 2RQVA 1SG5A 5IH2A 3M0QA 5L23A 1NPPA 5LJ5d 5FROA 3CCMT 2B86A 3CCJT 2V8JA 5D2IA 2FRWA 2X4WA 4CRIA 3BE3A 1VQNT 3LWHA 2OJ2A 2FB7A 5GJVB 4EMKA 4PJOA 1RLQC 2QGFB 5GMKj 4CI0C 4F7UE 3EG1A 1VQ5A 2KXCA 3NPFA 4GBQA 2RI3A 5IHIA 3NTHA 1NLOC 4RKUE 2DFUA 2GBQA 2MWOA 4XU1A 5CVIA 3QDRB 1V29B 3H8ZA 3MPUB 2NUZA 1FWZA 2KBTA 2NWMA 4ATOA 2ZCFB 2ZAEA 3OYLA 2RA2A 3MCAB 5EC7A 5FU6C 1R8OB 2HKNA 4DBQA 4ELYC 3PTAA 2YSQA 2XK0A 3OQ5A 1A0NB 4PJOC 3QPHA 1VQ6Q 1T0JA 2CZ7B 8AT1B 1VQ8Q 5KYYA 1WHKA 2PTKA 4R56A 4NL3A 1VQ9A 2AHJB 2LVMA 3CCVT 3J81E 2MWPA 1RAFB 4ELZC 2VB6A 2Q1AX 3QIIA 1MMDA 2DRKA 5GMKl 3CCRT 1U1SA 5GMKh 1Z9QA 3EFOB 1B34A 1VIFA 4LXCA 4HA8A 2OTLA 3X25B 2EAYA 2COYA 4DEXA 1WX6A 5GAOm 1KK7A 5FWBA 1U3OA 3SDZA 4JRQA 5FU7C 2Q18X 2DL5A 2JTEA 1FXXA 5FWCA 2ESWA 2E3HA 2RI2A 5KYUB 3HSBA 1PG5B 4M75F 1NE8A 1D1CA 2DD5A 3CD6A 4AG1C 1H8KA 2V8IA 4II1A 1GBRA 3CBPA 3JB9G 2MYSA 1YJNQ 2D8JA 1N8RC 1ZQ1A 1M1KC 4M77F 3FRNA 3G1JA 4Q5WA 4R0KA 1VYUA 2LNVA 1YIJA 4OMFB 1QVGS 5CKHA 2FL7A 4LD9K 2K5IA 1GFDA 1HD3A 2GTJA 1QW1A 2C0IA 1BCOA 3CXCP 4BI4A 3AHUA 3CCUQ 1SHGA 4BE2A 4J9GA 2KYMA 2RO0A 1AZGB 2ZPBB 4UC4A 5D6WA 2QI2A 4JRIA 4O5VA 2O01E 3RDVA 1M1GA 2KNBB 3CCQA 4K11A 3OBYA 2RQRA 2XKOC 2Y90A 3DB4A 3MEWA 4P5NA 1OI1A 4FT4A 3HL8A 3H6ZA 1ZLMA 1G8XA 1N8RR 4RMOA 1WQWA 1M1KR 3TU4K 3G6EQ 1D1AA 1LVKA 3M54A 1Q86U 2IVWA 4XQ3A 5GANg 1VQPT 2FZGB 2QQSA 3OYHA 3UA6A 2EYQA 4LDUA 5LL6S 3VS0A 2DD4A 1VQOQ 1VOMA 1MNDA 1M3AA 5D6YA 3N5BB 1QWEA 1PNJA 2BUDA 1NLPC 3HRTA 5LJ3j 1QP2A 4E47A 2KGTA 1UJYA 1KJWA 2A0FB 4M4ZA 4PJOF 2P0QA 3HKSA 1NEBA 2CKKA 3CMAQ 2CP5A 3DLLA 4AFSC 2R57A 5KYXB 3E19A 1N9RA 2LP5A 2XHCA 4J9DA 3DKMA 2CUBA 1VA7A 4NS5A 5LJ5f 2M0OA 4AMCA 1IREB 2GCXA 1YJNT 2E6ZA 4J83A 4E7KA 1UFFA 2X4XA 4MZMA 3OS2A 2K2MA 5GAMj 5GAOp 3VS3A 1W4SA 4HKEA 2OI3A 1AD5A 4F17A 2JN0A 2MMPA 3CMEA 1MMGA 5LJ5e 5GMKi 2O2OA 1IGUA 5D2HA 1M8MA 4KUIA 3JB9J 2QXFA 1BYMA 2DETA 3G4SA 2DVJA 2GFAA 1MV3A 5KCHA 1WPYA 2LX7A 1O9SA 4BDYA 1WFWA 1I81A 4OMPA 4X1VA 3CC2A 5LJ3h 4RTUA 3VRZA 2AKKA 2EQKA 2L8DA 4C8QB 5CR2A 1KQSA 4N4HA 1LNXA 2RHXA 1ZA2B 1PCXA 4LDYA 2QYZA 2YUPA 1IO6A 4M78B 2DRMA 4WTOB 2DYIA 2OTJQ 1KIKA 1IRXA 3EGDA 1SV6A 4F04B 1SEMA 2DXBA 3WVDB 1RAGB 1D0YA 2K3YA 4FW2A 2PU9B 4MZTA 1Y57A 5FRMA 8ATCB 1AHJB 1AWXA 2FG0A 2P4TA 4ZN3A 2DTIA 5GAMh 1YJWQ 4FYXB 2KDSA 1LOJA 4L59A 1WJRA 3M0UA 1AOJA 1YHQT 2L89A 4C0ZA 2J6KA 1VQ4T 3M58A 3CQTA 4XTXA 2HD0A 2MPXC 1M27C 4E2FB 3A8OB 3FLGA 1QVGA 3MKDA 2K4YA 1WHHA 5ECAA 1K76A 4BDZA 2QQAA 3VS4A 1NBEB 4AFUC 1WXTA 4RTTA 1KC8C 4GLKA 1VQ9T 4C5HA 3VS5A 1NEGA 1CKBA 3EHRA 4RTYA 3HHTB 1QWFA 2F1LA 4M7DB 3SFMA 2Q1CX 1UEBA 2RPNA 5HK0A 2OTLT 1Q81C 3VJPA 4J9IA 1H3HA 1BI2A 3V7CA 4E6RA 2YRVA 4C8QE 2R5MA 2H8HA 2PQWA 2VGMA 3CCJA 3THKA 3I56A 2FPFA 2JS2A 2KT1A 1KHCA 3LH5A 4M78E 5J39A 1BI1A 1Q86C 1D3BB 1UGPB 3CD6T 1KC8R 2XDDA 2Y4XA 3ZL7C 4WCIA 1ACMB 3CXCS 3RR6A 4E7LA 1GCQA 2DA9A 2FYKA 5I22A 3LW5E 4JJBA 1K73R 3VS1A 3M4YA 1Q82U 1UJ0A 1Q81R 1AVZC 2EPDA 2YDLA 1XOVA 4LE9A 6AT1B 3BFMA 2L3RA 3QKJA 2M16A 1W2BP 3L1AA 3R6NA 1QKXA 3QUIA 2YWWA 2FEIA 4J9CA 2NUPB 4E7IA 1Q86R 4AG2C 4EPCA 1O75A 4HVUA 3S3NA 4LDWA 3CCQT 1GFCA 2WACA 2GQIA 2GQVA 1VYVA 3JCMX 2DJQA 2E3IA 3CCVA 4M7DE 2EJGA 1K1ZA 1Q7YU 1TG0A 4N0AA 1YBYA 2FPEA 3HTRA 4JS4A 3Q1JA 5J26A 1IGQA 4RTXA 5M9OA 2I0NA 2PVDB 1JEGA 1TWBA 2RHYA 2ZPHB 2NUTA 5KH6A 3J7AF 5AT1B 3EFSA 2H3JA 2G6FX 4NOYA 1BKBA 1JO8A 4FT2A 4PKCC 1M9SA 4D8KA 3ME9A 1Y71A 3UWNA 2MOXA 3MP6A 5IXFA 2LTOA 2P4RA 2RJFA 2JW4A 3EG3A 2K9GA 3TCJA 3L2UA 2OX7A 4C92G 4J6YA 3CCLQ 1K9MU 4JUVA 3UDCA 1M3BA 4A4EA 1ZBJA 3M0RA 3VS6A 3MEAA 1UTIA 2BE7D 4LUDA 3QXEB 2DBMA 4PK4A 2MI6A 5KYWB 2E6NA 1G3WA 4OB2B 3GF5A 3OYKA 4M77D 1M2VA 2FVUA 5GAOl 3EG2A 4RCBA 2KYBA 4EIKA 2F5KA 1FMKA 1PRMC 2DEQA 2J6FA 1YJ9Q 4A4FA 2ROTA 3PT9A 2EYWA 4L5GA 4OMOA 5KE3A 4JLGA 1VQ6A 1TUDA 5CKEA 3VYGA 2YUQA 2CSIA 4ZN1A 1MGQA 3EGXB 1I1JA 1RAHB 2RQUA 1ZX6A 2JT4A 4DQ2A 1PD0A 2NLUA 2XICA 1VQPA 3V8LA 4M7AG 1NJIC 3RMSA 2WSEE 4OMQA 4RCCA 2FRYA 2E4HA 4M7AB 1ZUKA 2CGHA 1T0HA 1UGRB 2CZ6B 3P8BB 5KYNA 3CXCA 2CZ1B 2QG9B 3C95A 1J3TA 2QQBA 2LCSA 5D7UA 1MMNA 1Y96A 4J7IA 1UHCA 3EG9B 4C0DB 4ZGJB 3TSZA 3UA7A 3P8HA 4PJOD 2IIMA 1E7OA 3CCLT 2YHTA 1YJNA 3JCMJ 4A63B 3E9FA 5IN1A 1VQLT 4BY6B 2EGEA 2HDAA 4PJMA 3CCSQ 2COZA 1WYXA 1UGQB 4QVZA 1VIEA 2KT8A 4A4GA 5GAMd 4PLIA 1HXDA 2PVOB 1YI2T 2EGAA 1NJIR 1OPLA 1RAAB 4ZGEB 2E65A 1WDXA 4C92A 2D6FA 1I5OB 3V8KA 3CCUA 3EHQA 3H9NA 3A98A 3QZ5B 3T9NA 2C0OA 2YRDA 4PLLA 4DBFA 4J9HA 3I56T 3GNFB 1GCPA 1M2OA 3BW1A 1WIEA 1FX7A 3OMGA 2QQ9A 3ASKA 3QWYA 2JJ9A 4RG8A 4IUUA 2ZPEB 5GANj 1NYGA 3PMIA 5C6SA 1WJQA 1WLPB 2BZXA 3OYBA 3UT1A 1W2BS 1IZ6A 3M55A 2A37A 2EYYA 3G6EA 3MEUA 1D0ZA 2RN8A 4PJNA 2BE9B 4J6WA 4C92C 4M7AE 4RG2A 2RJCA 4EMGA 5I2MA 3UF4A 5D2KA 4CC3A 3SWNA 3QO3A 2QEXQ 1VYTA 3URGA 1YHQA 2XDPA 1XTDA 1EX4A 2JM9A 3I5SA 4E7HA 1VQ4A 4A53A 2KE9A 4XTWA 4F7UA 1VQMQ 2X3WD 2LJ1A 2ROLA 4FCYA 5A2QE 3CMAA 2LNHB 5D2JA 4KT0E 4IIOA 1SSHA 1C1AA 3M0TA 1ZA1B 2CZ0B 4JJDA 5CKFA 5A0LA 3G71Q 2CP0A 3QDFA 2ED0A 2CP6A 2J7IA 2V1QA 1RI0A 3O5ZA 4IUPA 4QT7A 4MDXA 2JTFA 3X28B 1QCNA 5IAYA 5GANh 1VQ7Q 1KFZA 2X35A 1KQSS 2VWFA 4Y91A 3I35A 2RM4A 3SWNC 4Y28E 5I11A 1SRLA 1KQ2A 1Q95G 3H0HA 1NR9A 2P0KA 3OYCA 3H0FA 1ZSZA 3V8JA 4HT9A 2KI7A 3REAB 2M51A 2YUNA 2L5QA 4M7AC 1KQ1A 1ZHIA 1S72Q 3NHNA 1FMVA 2PVGB 5GAOq 1BCMA 2QA4Q 1WJSA 3FDRA 2LCCA 2E12A 1C6VX 3BQBA 1WHJA 3JCMQ 3OB9A 3A8GB 3FC3A 1XJWB 2MAMA 1W1FA 2GTOA 2QASA 2GNCA 2RI5A 2EQJA 1T3LA 5HK3A 3EH1A 4Y92A 3JB9I 2ZPFB 1R0BG 4BY6C 5CKDA 5CIUA 1AWWA 3M59A 2DXTA 3JCMd 2DXUA 1YJWA 1ZSZC 2KRSA 1I8FA 1TH7A 1SKUB 2EBPA 3RKYA 2QTVA 2HAXA 2D1XA 4WF2A 4IUQA 2V1RA 1B7TA 4FYVB 2XIDA 2DXCA 2CP7A 1VQ6T 1VQ8T 1OZ3A 4QQDA 2EGCA 4JLIA 5CKBA 1PKTA 5CO7A 1WHMA 2MK5A 4C92F 3M53A 4LN2A 1ARKA 5IT9E 4OVAA 1G3TA 2HSEB 1I07A 1BB9A 1OQKA 3EH2A 3QZ9B 3JB9D 2F2VA 3EFOA 3I55Q 3P8DA 1G83A 3AT1B 4O6JA 1I0CA 1VQ5Q 3A8HB 4LDVA 2RMOA 3CPWP 1W2BA 4J8OA 2YT6A 1JJ2P 1UB4A 4CC7A 3GP8A 1X27A 3DB3A 2X4YA 4PJLA 1BK2A 3OYIA 3FIFA 3G7ZA 4HVVA 4RTVA 4IIMA 3ZEHA 4XK8E 5KE2A 1CSKA 2MF2A 2HQXA 4F7UF 3ULRB 2O4XB 1OYXA 2EB5A 2QQRA 3A5ZB 3CCEQ 2M1HA 3CCUT 1N9SA 4C8QG 1YITQ 2JS0A 4Z02A 2EQMA 3RMQA 4M78G 4XU3A 4ORZA 2E5QA 2E41A 1X6BA 2EKOA 1H3ZA 3PVQA 4JRPA 2EJFA 4OF1A 3BDLA 3OYGA 3CEYA 2K6DA 5LJ5j 1G5VA 1ZSGA 1M30A 3OS5A 3G6ET 2EKHA 3TEEA 4FIBA 1RAEB 1AT1B 2Y4YA 1VQOT 1OX8A 3OMCA 4N4GA 3F70A 2F69A 1B07A 2DYBA 1YP5A 1GRIA 2K7AA 2W0ZA 1FMWA 2I2LA 1YIJQ 2HQEA 3CMAT 2YRCA 2LCLA 3ER0A 3QSUA 2RD1A 1BI3A 1BU1A 3META 9ATCB 3BDUA 1JXOA 1R0CB 3CCLA 3R6OA 3OW2P 1OU9A 1D0XA 3M0SA 3QJYA 3MHXA 2HEQA 1VQLA 3O8VA 2HL5C 4ZTJA 4M7DG 3RBBB 2DLPA 3VU3C 5KYXA 3INZA 5GAN7 3M0PA 1U06A 4KBMB 2P84A 2VUBA 1YI2A 3X20B 2PNIA 5LJ5h 1M90U 1JU5C 4C5IA 2D9TA 3EG0A 3OYMA 3QYGB 4RTZA 1NM7A 1UDLA 2EW3A 5I21A 3X24B 1WI7A 1M5Q1 2A3LA 4J5YA 1IHVA 2PUKB 4F14A 2VXEA 4HCZA 1YNZA 3OSVA 2K5LA 1RLPC 2MCNA 3SB2A 3JCMf 2DIGA 2Q19X 2ZPGB 4IUTA 4X34A 2FPDA 2K3BA 4MMKA 3OYDA 2OTJT 3JAME 5GANd 2DIQA 1X2KA 1T3SA 2YXYA 3JCMe 2GFUA 1KD1U 1W70A 4M78A 3D7SB 2GF7A 1ZUYA 1BIAA 2KR3A 1UG1A 2O31A 2QTXA 4E7JA 5CCAA 1YJWT 2DBKA 2DILA 1JB0E 2DTOA 4Z89A 2OAUA 2EVRA 2DMOA 1KHIA 1HJDA 2HCKA 2JVVA 4A4KA 2M0YA 5GAN4 3GOXA 2H3EB 2K57A 3CMEQ 2CT4A 4J6XA 4KULA 3MP8A 2HZYA 4C8QC 4M75G 3G4SQ 2DKGA 3HP9A 2X51A 2AKLA 4M78C 2YLBA 2JZ2A 4M75B 2LX9A 3CC2Q 3CPWS 4OB1B 4AT1B 3C12A 3JB9F 3M56A 1JJ2S 5LJ5g 1X6OA 3M5AA 2AZVA 1TXQA 3OYFA 3RERA 2A7YA 3WVEB 3KFVA 3U23A 4M7DA 3RKXA 3TSWA 4MDWA 4M77B 4KGXB 2EJ9A 2V8KA 1UGSB 1EIFA 3HPWA 3VYHB 2DZCA 1VQKQ 3VS7A
chains in the Genus database with same CATH topology
1QCOA 2EB6A 4DBFA 5D2JA 1I7OA 5D2IA 3RR6A 3R6OA 3S52A 2DFUA 1QQJA 1NR9A 3BQBA 3LZKA 3QDFA 1SAWA 2Q18X 5D2HA 2EB4A 3V77A 5D2KA 1NKQA 1SV6A 4PFZA 1GTTA 5D2FA 2Q1DX 2Q1AX 4DBHA 2HZYA 1WZOA 2EB5A 2Q1CX 1QCNA 4QKUA 4MAQA 2Q19X 1HYOA 2WQTA 5D2GA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1QCO A;  2EB6 A;  4DBF A;  5D2J A;  1I7O A;  5D2I A;  3RR6 A;  3R6O A;  3S52 A;  2DFU A;  1QQJ A;  1NR9 A;  3BQB A;  3LZK A;  3QDF A;  1SAW A;  2Q18 X;  5D2H A;  2EB4 A;  3V77 A;  5D2K A;  1NKQ A;  1SV6 A;  4PFZ A;  1GTT A;  5D2F A;  2Q1D X;  2Q1A X;  4DBH A;  2HZY A;  1WZO A;  2EB5 A;  2Q1C X;  1QCN A;  4QKU A;  4MAQ A;  2Q19 X;  1HYO A;  2WQT A;  5D2G A; 
#chains in the Genus database with same CATH topology
 1QCO A;  4D8D A;  1IXD A;  4VUB A;  2LDM A;  2P0P A;  2ATC B;  2KEA A;  3NTK A;  1PKS A;  1MNE A;  4QQ6 A;  4XU0 A;  1H92 A;  2JOY A;  5A0D A;  2DPP B;  2OAW A;  1D3B A;  3M9Q A;  2GGR A;  4X9D A;  3C94 A;  2DZ9 A;  3KBG A;  4FL6 A;  2RK2 A;  4JS5 A;  2KRO A;  3LGF A;  3KXT A;  4CC4 B;  3OS0 A;  2ZZD A;  5CK9 A;  4PNO A;  1QCF A;  2DNU A;  3QG1 A;  4Z88 A;  4M7D C;  3CBM A;  2QEX A;  1Y7X A;  3QBY A;  2EFI A;  1ZBX A;  4RTW A;  1W6X A;  2Z0W A;  2DL3 A;  2LJ3 A;  4OB3 B;  4BE1 A;  2KMT A;  3PGG A;  1VQ8 A;  3PIO A;  2NUP A;  3FEO A;  5FU6 B;  4PJO G;  5GAN 5;  2L3S A;  4M75 E;  1E6H A;  1LCK A;  4EMK B;  1NG2 A;  1JBM A;  3CCM Q;  3CCJ Q;  1M1F A;  2K3X A;  4PJO B;  1VQN Q;  3CPF A;  1RAD B;  2EWN A;  3TVT A;  2FO0 A;  2EQU A;  4PJJ A;  1Y0M A;  4OGC A;  4MAQ A;  3UPU A;  4M77 E;  2WQT A;  2LMJ A;  2HNI A;  3RKW A;  4C92 D;  1WHL A;  2VYT A;  1UEC A;  1SPK A;  2JMA A;  2LQW A;  4AFZ C;  2IPO B;  1OOT A;  1GBQ A;  5LJ3 d;  4J9B A;  4OMN A;  4DA4 A;  2JM8 A;  4C5G A;  4J9F A;  2L3Q A;  3RES A;  1TOV A;  2BZ8 A;  3J80 E;  4IUV A;  3REB B;  3GIB A;  3PE0 A;  5FU7 B;  4C8Q F;  1MMA A;  2DK3 A;  1Q82 C;  4DBR A;  2DM1 A;  1OX9 A;  1YWO A;  4M78 F;  3LYI A;  1QP3 A;  3KUF A;  3MJX A;  3S6W A;  5GAO r;  1M1K U;  4BI3 A;  4N4I A;  5KYY B;  2LQK A;  3GPL A;  3LZK A;  1NYF A;  5DLO A;  1UE9 A;  1NZ9 A;  4RUG A;  1SHF A;  4KH0 B;  2ENM A;  4M75 C;  2EYX A;  3HFN A;  1B34 B;  1H64 1;  2RF0 A;  5KYW A;  3CCV Q;  4C5E A;  1X2Q A;  3CCR Q;  1Q7Y C;  1I5L A;  1YJ9 T;  4OB0 B;  1QVF P;  4JZ3 A;  1C0M A;  3CPW A;  4F16 A;  5GAN e;  5GMK e;  4OMM A;  1EFN A;  1Q82 R;  2ECZ A;  4E7Z A;  2B8A A;  4BB7 A;  4ESR A;  1JJ2 A;  4FM4 B;  4PJO E;  4YTL A;  3OSS C;  4OGE A;  2CRE A;  2C0T A;  3EGX A;  1MV0 B;  4M7D F;  1K9A A;  3OA6 A;  1SRM A;  3NFC A;  3RIR A;  1VQO A;  3VUB A;  4B9X A;  2DER A;  4JJN K;  2CYZ B;  3A8L B;  1OPK A;  3I55 A;  1K9M C;  2ZPI B;  2ABL A;  2DTH A;  1Q7Y R;  2CH4 W;  5CQY A;  3OYJ A;  1JXM A;  2WSF E;  1RAB B;  4M7A A;  2VGN A;  2PUO B;  2HBW A;  4BE0 A;  5D2F A;  3I9Q A;  3JCM V;  1R77 A;  2ZGW A;  1AWJ A;  2JMC A;  3EG9 A;  3E1S A;  3PMT A;  5J3B A;  5C0M A;  4ME7 A;  3CCS T;  2HSP A;  4EMK C;  4C0G A;  4BAC A;  2E1H A;  5DLQ E;  1OV3 A;  1X75 C;  3PNW C;  4KRT A;  1WNL A;  4QW2 A;  4TVR A;  1RAC B;  2BZY A;  5IXB A;  1K9M R;  3CCE A;  1PSE A;  4FSS A;  1WGS A;  1YFN A;  4PFZ A;  1YIT A;  1G3S A;  4OML A;  3S3O A;  2BTT A;  1VQP Q;  5CQX A;  1HYO A;  1RL2 A;  3SHW A;  3CC7 Q;  2OTJ A;  2YUO A;  2DEU A;  1BBZ A;  4C0D C;  3OW2 A;  4XTU A;  2EQI A;  3OS1 A;  3HRU A;  1F1B B;  1PC0 A;  2F2X A;  3FJP A;  1K8A U;  2KXD A;  3CC4 Q;  1M4Z A;  5L8R E;  5GAN 8;  5FRN A;  2QEX T;  3L2R A;  2XI9 A;  1VQM T;  2KSS A;  3M4G A;  5GAN 6;  3RNJ A;  1UUE A;  1HK9 A;  1YCS B;  1KC8 U;  3JCM P;  1K0S A;  3G71 T;  5LJ3 f;  3SEM A;  2QAZ A;  1OU8 A;  3VRY A;  1G2B A;  2RJD A;  3JCM b;  3JV3 A;  2PZ1 A;  3MO8 A;  2DAQ A;  1V1C A;  2CS7 A;  4B9W A;  1VQ7 T;  3EGD B;  1K73 U;  4QQG A;  1Q81 U;  2JTM A;  3EFR A;  5LJ3 e;  3L2Q A;  4DEY A;  4LDX A;  1XNI A;  2L0A A;  4LD6 A;  1HSQ A;  1SF9 A;  4HCK A;  2J6O A;  5D2G A;  4CC2 A;  1ABQ A;  4JJC A;  4JRK A;  3IQL A;  4FSX A;  5GAM f;  1BIB A;  2KQW A;  2JNG A;  4PFO A;  4J7F A;  4A54 A;  1S72 T;  2CP2 A;  2LQ8 A;  4FU6 A;  2R5A A;  3QYH B;  2DJZ A;  2RQT A;  1WXU A;  2QA4 T;  1YHQ Q;  3CC7 T;  3C0C A;  5KYU A;  5GAM e;  2CSQ A;  2CP3 A;  1VQ4 Q;  1RAI B;  1WXB A;  1XQH A;  2G3R A;  2RH2 A;  3H41 A;  3EGU A;  3LWI A;  2XD0 A;  2LZ6 B;  4D6W A;  1LJO A;  3I5R A;  1G3Y A;  1QVF S;  1Y07 A;  2VV5 A;  3CC4 T;  3M57 A;  2HQH A;  1WQ7 A;  1VQ9 Q;  1LPL A;  1IB8 A;  4QVD A;  3OYN A;  3JCM W;  2EYZ A;  4M7A F;  2K5F A;  2O9V A;  2RHZ A;  2C06 A;  1OZ2 A;  2RQW A;  2EB6 A;  4PL6 A;  3V7R A;  2QGG A;  2OTL Q;  2DVE A;  2L3P A;  1QKW A;  1JQQ A;  4HVW A;  3S3M A;  5I2S A;  4QKU A;  3E2U A;  4JPB W;  2RNA A;  1U1T A;  3ZBD A;  3OYE A;  2LT4 A;  3SD4 A;  5AYF A;  4HT8 A;  3CD6 Q;  1RI9 A;  2VVK A;  1PRL C;  1OEB A;  2QDL A;  1U8R A;  1DJ7 B;  3I55 T;  1NKQ A;  1X43 A;  1GTT A;  1EZZ B;  2Q1D X;  2HBP A;  1VQ5 T;  1VQK A;  2FZC B;  1PWT A;  1X01 A;  2XDB A;  1TUC A;  3RUX A;  5GMK m;  4LUE A;  1SSF A;  1K8A C;  4ZNX A;  1YN8 A;  3OYY A;  1E6G A;  1S1N A;  4KH1 B;  3MEV A;  2A28 A;  1VUB A;  4C8Q D;  3OY9 A;  1FYN A;  4HCC A;  2DO3 A;  3L2W A;  2KK4 A;  3X26 B;  4M78 D;  3CCQ Q;  4Z8A A;  3GBQ A;  1YCY A;  3JSC A;  4FYY B;  2MIO A;  1CKA A;  2J05 A;  2NYS A;  4HCB A;  5HY6 A;  2D0Q B;  3HFO A;  4KGZ B;  2NUT B;  3CCE T;  2IG0 A;  2HKQ B;  1YJ9 A;  2WSC E;  3QWX X;  1YIT T;  4XTY A;  3JCM c;  2O4X A;  2SEM A;  2FHD A;  1K8A R;  2XG8 D;  1K73 C;  2CUD A;  2BKD N;  2J06 A;  3GNG A;  1PSF A;  1YWP A;  3JRZ A;  2JXB A;  2AZS A;  2CH4 A;  3S52 A;  4C8Q A;  1D09 B;  3CCM A;  1UGV A;  1P92 A;  1QVP A;  2DL8 A;  3L42 A;  1VQN A;  2X3X D;  3GLX A;  3ZFJ A;  1TTH B;  2RHI A;  3QHS A;  1NJI U;  2X9H A;  4DBH A;  5LJ3 g;  3NGP A;  3HRS A;  2A36 A;  2LC4 A;  4EDU A;  4IKF A;  3L2Z A;  1N5Z A;  1V76 A;  4MML A;  4M7D D;  2KAF A;  2V26 A;  4ANJ A;  1JRI A;  1M2V B;  1N27 A;  2DF6 A;  4DOV A;  4HXJ A;  3A8M B;  1YIJ T;  1QVF A;  2EIF A;  1OUL A;  2FZK B;  1TU0 B;  1N6A A;  4DOW A;  2LT1 A;  3TQ7 P;  3CBO A;  5GAM g;  3LLR A;  3A1P A;  5KCO A;  2F2W A;  3OBW A;  3CCS A;  3C4S A;  3EAE A;  3NMZ C;  5HKC A;  4NL2 A;  4OP0 A;  4ZGD B;  4M77 G;  2XU8 A;  1ZUU A;  2RB6 A;  1GCQ C;  2SRC A;  2DE0 X;  3CCR A;  2O88 A;  1BI0 A;  3TRE A;  2K2V A;  4XU2 A;  2AK5 A;  2CDT A;  5A0G A;  1TUG B;  1NPR A;  3PIP A;  3DLM A;  4FYW B;  2QK0 A;  4KGV B;  2QDY B;  3NTI A;  2D8H A;  4FW1 A;  1AZE A;  2O9S A;  4B6M A;  1Y96 B;  3OYA A;  3JCM h;  4BUG A;  1B3Q A;  3PFS A;  1KQS P;  2YLC A;  3H0I A;  2CT3 A;  5FLX E;  1IHW A;  5GJW B;  3VV0 A;  1I7O A;  1KG1 A;  5IHN A;  1RUW A;  4J9E A;  2LRQ A;  2M02 A;  1QLY A;  3LH0 A;  4M75 D;  5HCK A;  4GY5 A;  4N0A C;  1VQL Q;  2E70 A;  3QJ6 A;  2E10 A;  4XTV A;  1U5S A;  1VQM A;  2RJE A;  4AFQ C;  4BD3 A;  4C92 B;  2RHU A;  1ABO A;  1YI2 Q;  1M8V A;  4PFP A;  3UAT A;  1PM3 A;  2R58 A;  2RK1 A;  1QMC A;  1TS9 A;  2KRM A;  1M90 C;  1I4K 1;  2AIR B;  1K4U S;  3G71 A;  3CME T;  1KSW A;  2DL4 A;  4XAX B;  1AEY A;  4JZ4 A;  7AT1 B;  1PHT A;  5GAN 3;  3G4S T;  3LGL A;  3E9G A;  5GAN 2;  1GL5 A;  3I56 Q;  1QVG P;  1VQ7 A;  4L6V 5;  1X69 A;  4XTZ A;  2BIV A;  3LX7 A;  1MHN A;  3CC2 T;  2DX1 A;  1D1B A;  2VXF A;  4GLM A;  2DL7 A;  5DY9 A;  2AT1 B;  2LJ0 A;  3L2V A;  4M75 A;  3WXM B;  2ED1 A;  3OW2 S;  2HMA A;  1WHG A;  1SAW A;  4ZTF A;  2X4J A;  1AWO A;  4F7U G;  1UHF A;  2KRN A;  1GXI E;  2EB4 A;  2KVQ G;  3SWN B;  2D0N A;  4E7S A;  1VQK T;  3JB9 H;  2K79 A;  1KD1 C;  5FW9 A;  1WZO A;  1MUZ A;  4KUD K;  1M90 R;  1S72 A;  3VKI A;  3MP1 A;  1PD1 A;  3BY7 A;  4M77 A;  4F7U B;  4BI8 B;  4MZP A;  2QA4 A;  4JDS A;  3CC7 A;  1TSF A;  1K0X A;  2M9U A;  2VC8 A;  4EMH A;  1N8R U;  4QVC A;  2KY9 A;  3VS2 A;  2W10 A;  3JCM g;  5D6X A;  3VUZ A;  5IHK A;  5EG2 A;  2COW A;  4R55 A;  3FJ5 A;  2JUF A;  2XMF A;  1WA7 A;  3CC4 A;  5DM7 R;  2VKN A;  4C92 E;  2VAS A;  5GAN f;  1Z9Z A;  2E64 A;  3V7S A;  5CAI A;  3PVL A;  4C0F A;  5GAO n;  2A08 A;  1QQJ A;  1KD1 R;  3FB9 A;  2L2P A;  4IUR A;  4M77 C;  1ZSZ B;  2LQN A;  1X6G A;  2F5T X;  3V77 A;  4LNP A;  4M7A D;  4A4H A;  4X9C A;  2HL3 A;  2E5K A;  4V2S A;  1M3C A;  2RQV A;  1SG5 A;  5IH2 A;  3M0Q A;  5L23 A;  1NPP A;  5LJ5 d;  5FRO A;  3CCM T;  2B86 A;  3CCJ T;  2V8J A;  5D2I A;  2FRW A;  2X4W A;  4CRI A;  3BE3 A;  1VQN T;  3LWH A;  2OJ2 A;  2FB7 A;  5GJV B;  4EMK A;  4PJO A;  1RLQ C;  2QGF B;  5GMK j;  4CI0 C;  4F7U E;  3EG1 A;  1VQ5 A;  2KXC A;  3NPF A;  4GBQ A;  2RI3 A;  5IHI A;  3NTH A;  1NLO C;  4RKU E;  2DFU A;  2GBQ A;  2MWO A;  4XU1 A;  5CVI A;  3QDR B;  1V29 B;  3H8Z A;  3MPU B;  2NUZ A;  1FWZ A;  2KBT A;  2NWM A;  4ATO A;  2ZCF B;  2ZAE A;  3OYL A;  2RA2 A;  3MCA B;  5EC7 A;  5FU6 C;  1R8O B;  2HKN A;  4DBQ A;  4ELY C;  3PTA A;  2YSQ A;  2XK0 A;  3OQ5 A;  1A0N B;  4PJO C;  3QPH A;  1VQ6 Q;  1T0J A;  2CZ7 B;  8AT1 B;  1VQ8 Q;  5KYY A;  1WHK A;  2PTK A;  4R56 A;  4NL3 A;  1VQ9 A;  2AHJ B;  2LVM A;  3CCV T;  3J81 E;  2MWP A;  1RAF B;  4ELZ C;  2VB6 A;  2Q1A X;  3QII A;  1MMD A;  2DRK A;  5GMK l;  3CCR T;  1U1S A;  5GMK h;  1Z9Q A;  3EFO B;  1B34 A;  1VIF A;  4LXC A;  4HA8 A;  2OTL A;  3X25 B;  2EAY A;  2COY A;  4DEX A;  1WX6 A;  5GAO m;  1KK7 A;  5FWB A;  1U3O A;  3SDZ A;  4JRQ A;  5FU7 C;  2Q18 X;  2DL5 A;  2JTE A;  1FXX A;  5FWC A;  2ESW A;  2E3H A;  2RI2 A;  5KYU B;  3HSB A;  1PG5 B;  4M75 F;  1NE8 A;  1D1C A;  2DD5 A;  3CD6 A;  4AG1 C;  1H8K A;  2V8I A;  4II1 A;  1GBR A;  3CBP A;  3JB9 G;  2MYS A;  1YJN Q;  2D8J A;  1N8R C;  1ZQ1 A;  1M1K C;  4M77 F;  3FRN A;  3G1J A;  4Q5W A;  4R0K A;  1VYU A;  2LNV A;  1YIJ A;  4OMF B;  1QVG S;  5CKH A;  2FL7 A;  4LD9 K;  2K5I A;  1GFD A;  1HD3 A;  2GTJ A;  1QW1 A;  2C0I A;  1BCO A;  3CXC P;  4BI4 A;  3AHU A;  3CCU Q;  1SHG A;  4BE2 A;  4J9G A;  2KYM A;  2RO0 A;  1AZG B;  2ZPB B;  4UC4 A;  5D6W A;  2QI2 A;  4JRI A;  4O5V A;  2O01 E;  3RDV A;  1M1G A;  2KNB B;  3CCQ A;  4K11 A;  3OBY A;  2RQR A;  2XKO C;  2Y90 A;  3DB4 A;  3MEW A;  4P5N A;  1OI1 A;  4FT4 A;  3HL8 A;  3H6Z A;  1ZLM A;  1G8X A;  1N8R R;  4RMO A;  1WQW A;  1M1K R;  3TU4 K;  3G6E Q;  1D1A A;  1LVK A;  3M54 A;  1Q86 U;  2IVW A;  4XQ3 A;  5GAN g;  1VQP T;  2FZG B;  2QQS A;  3OYH A;  3UA6 A;  2EYQ A;  4LDU A;  5LL6 S;  3VS0 A;  2DD4 A;  1VQO Q;  1VOM A;  1MND A;  1M3A A;  5D6Y A;  3N5B B;  1QWE A;  1PNJ A;  2BUD A;  1NLP C;  3HRT A;  5LJ3 j;  1QP2 A;  4E47 A;  2KGT A;  1UJY A;  1KJW A;  2A0F B;  4M4Z A;  4PJO F;  2P0Q A;  3HKS A;  1NEB A;  2CKK A;  3CMA Q;  2CP5 A;  3DLL A;  4AFS C;  2R57 A;  5KYX B;  3E19 A;  1N9R A;  2LP5 A;  2XHC A;  4J9D A;  3DKM A;  2CUB A;  1VA7 A;  4NS5 A;  5LJ5 f;  2M0O A;  4AMC A;  1IRE B;  2GCX A;  1YJN T;  2E6Z A;  4J83 A;  4E7K A;  1UFF A;  2X4X A;  4MZM A;  3OS2 A;  2K2M A;  5GAM j;  5GAO p;  3VS3 A;  1W4S A;  4HKE A;  2OI3 A;  1AD5 A;  4F17 A;  2JN0 A;  2MMP A;  3CME A;  1MMG A;  5LJ5 e;  5GMK i;  2O2O A;  1IGU A;  5D2H A;  1M8M A;  4KUI A;  3JB9 J;  2QXF A;  1BYM A;  2DET A;  3G4S A;  2DVJ A;  2GFA A;  1MV3 A;  5KCH A;  1WPY A;  2LX7 A;  1O9S A;  4BDY A;  1WFW A;  1I81 A;  4OMP A;  4X1V A;  3CC2 A;  5LJ3 h;  4RTU A;  3VRZ A;  2AKK A;  2EQK A;  2L8D A;  4C8Q B;  5CR2 A;  1KQS A;  4N4H A;  1LNX A;  2RHX A;  1ZA2 B;  1PCX A;  4LDY A;  2QYZ A;  2YUP A;  1IO6 A;  4M78 B;  2DRM A;  4WTO B;  2DYI A;  2OTJ Q;  1KIK A;  1IRX A;  3EGD A;  1SV6 A;  4F04 B;  1SEM A;  2DXB A;  3WVD B;  1RAG B;  1D0Y A;  2K3Y A;  4FW2 A;  2PU9 B;  4MZT A;  1Y57 A;  5FRM A;  8ATC B;  1AHJ B;  1AWX A;  2FG0 A;  2P4T A;  4ZN3 A;  2DTI A;  5GAM h;  1YJW Q;  4FYX B;  2KDS A;  1LOJ A;  4L59 A;  1WJR A;  3M0U A;  1AOJ A;  1YHQ T;  2L89 A;  4C0Z A;  2J6K A;  1VQ4 T;  3M58 A;  3CQT A;  4XTX A;  2HD0 A;  2MPX C;  1M27 C;  4E2F B;  3A8O B;  3FLG A;  1QVG A;  3MKD A;  2K4Y A;  1WHH A;  5ECA A;  1K76 A;  4BDZ A;  2QQA A;  3VS4 A;  1NBE B;  4AFU C;  1WXT A;  4RTT A;  1KC8 C;  4GLK A;  1VQ9 T;  4C5H A;  3VS5 A;  1NEG A;  1CKB A;  3EHR A;  4RTY A;  3HHT B;  1QWF A;  2F1L A;  4M7D B;  3SFM A;  2Q1C X;  1UEB A;  2RPN A;  5HK0 A;  2OTL T;  1Q81 C;  3VJP A;  4J9I A;  1H3H A;  1BI2 A;  3V7C A;  4E6R A;  2YRV A;  4C8Q E;  2R5M A;  2H8H A;  2PQW A;  2VGM A;  3CCJ A;  3THK A;  3I56 A;  2FPF A;  2JS2 A;  2KT1 A;  1KHC A;  3LH5 A;  4M78 E;  5J39 A;  1BI1 A;  1Q86 C;  1D3B B;  1UGP B;  3CD6 T;  1KC8 R;  2XDD A;  2Y4X A;  3ZL7 C;  4WCI A;  1ACM B;  3CXC S;  3RR6 A;  4E7L A;  1GCQ A;  2DA9 A;  2FYK A;  5I22 A;  3LW5 E;  4JJB A;  1K73 R;  3VS1 A;  3M4Y A;  1Q82 U;  1UJ0 A;  1Q81 R;  1AVZ C;  2EPD A;  2YDL A;  1XOV A;  4LE9 A;  6AT1 B;  3BFM A;  2L3R A;  3QKJ A;  2M16 A;  1W2B P;  3L1A A;  3R6N A;  1QKX A;  3QUI A;  2YWW A;  2FEI A;  4J9C A;  2NUP B;  4E7I A;  1Q86 R;  4AG2 C;  4EPC A;  1O75 A;  4HVU A;  3S3N A;  4LDW A;  3CCQ T;  1GFC A;  2WAC A;  2GQI A;  2GQV A;  1VYV A;  3JCM X;  2DJQ A;  2E3I A;  3CCV A;  4M7D E;  2EJG A;  1K1Z A;  1Q7Y U;  1TG0 A;  4N0A A;  1YBY A;  2FPE A;  3HTR A;  4JS4 A;  3Q1J A;  5J26 A;  1IGQ A;  4RTX A;  5M9O A;  2I0N A;  2PVD B;  1JEG A;  1TWB A;  2RHY A;  2ZPH B;  2NUT A;  5KH6 A;  3J7A F;  5AT1 B;  3EFS A;  2H3J A;  2G6F X;  4NOY A;  1BKB A;  1JO8 A;  4FT2 A;  4PKC C;  1M9S A;  4D8K A;  3ME9 A;  1Y71 A;  3UWN A;  2MOX A;  3MP6 A;  5IXF A;  2LTO A;  2P4R A;  2RJF A;  2JW4 A;  3EG3 A;  2K9G A;  3TCJ A;  3L2U A;  2OX7 A;  4C92 G;  4J6Y A;  3CCL Q;  1K9M U;  4JUV A;  3UDC A;  1M3B A;  4A4E A;  1ZBJ A;  3M0R A;  3VS6 A;  3MEA A;  1UTI A;  2BE7 D;  4LUD A;  3QXE B;  2DBM A;  4PK4 A;  2MI6 A;  5KYW B;  2E6N A;  1G3W A;  4OB2 B;  3GF5 A;  3OYK A;  4M77 D;  1M2V A;  2FVU A;  5GAO l;  3EG2 A;  4RCB A;  2KYB A;  4EIK A;  2F5K A;  1FMK A;  1PRM C;  2DEQ A;  2J6F A;  1YJ9 Q;  4A4F A;  2ROT A;  3PT9 A;  2EYW A;  4L5G A;  4OMO A;  5KE3 A;  4JLG A;  1VQ6 A;  1TUD A;  5CKE A;  3VYG A;  2YUQ A;  2CSI A;  4ZN1 A;  1MGQ A;  3EGX B;  1I1J A;  1RAH B;  2RQU A;  1ZX6 A;  2JT4 A;  4DQ2 A;  1PD0 A;  2NLU A;  2XIC A;  1VQP A;  3V8L A;  4M7A G;  1NJI C;  3RMS A;  2WSE E;  4OMQ A;  4RCC A;  2FRY A;  2E4H A;  4M7A B;  1ZUK A;  2CGH A;  1T0H A;  1UGR B;  2CZ6 B;  3P8B B;  5KYN A;  3CXC A;  2CZ1 B;  2QG9 B;  3C95 A;  1J3T A;  2QQB A;  2LCS A;  5D7U A;  1MMN A;  1Y96 A;  4J7I A;  1UHC A;  3EG9 B;  4C0D B;  4ZGJ B;  3TSZ A;  3UA7 A;  3P8H A;  4PJO D;  2IIM A;  1E7O A;  3CCL T;  2YHT A;  1YJN A;  3JCM J;  4A63 B;  3E9F A;  5IN1 A;  1VQL T;  4BY6 B;  2EGE A;  2HDA A;  4PJM A;  3CCS Q;  2COZ A;  1WYX A;  1UGQ B;  4QVZ A;  1VIE A;  2KT8 A;  4A4G A;  5GAM d;  4PLI A;  1HXD A;  2PVO B;  1YI2 T;  2EGA A;  1NJI R;  1OPL A;  1RAA B;  4ZGE B;  2E65 A;  1WDX A;  4C92 A;  2D6F A;  1I5O B;  3V8K A;  3CCU A;  3EHQ A;  3H9N A;  3A98 A;  3QZ5 B;  3T9N A;  2C0O A;  2YRD A;  4PLL A;  4DBF A;  4J9H A;  3I56 T;  3GNF B;  1GCP A;  1M2O A;  3BW1 A;  1WIE A;  1FX7 A;  3OMG A;  2QQ9 A;  3ASK A;  3QWY A;  2JJ9 A;  4RG8 A;  4IUU A;  2ZPE B;  5GAN j;  1NYG A;  3PMI A;  5C6S A;  1WJQ A;  1WLP B;  2BZX A;  3OYB A;  3UT1 A;  1W2B S;  1IZ6 A;  3M55 A;  2A37 A;  2EYY A;  3G6E A;  3MEU A;  1D0Z A;  2RN8 A;  4PJN A;  2BE9 B;  4J6W A;  4C92 C;  4M7A E;  4RG2 A;  2RJC A;  4EMG A;  5I2M A;  3UF4 A;  5D2K A;  4CC3 A;  3SWN A;  3QO3 A;  2QEX Q;  1VYT A;  3URG A;  1YHQ A;  2XDP A;  1XTD A;  1EX4 A;  2JM9 A;  3I5S A;  4E7H A;  1VQ4 A;  4A53 A;  2KE9 A;  4XTW A;  4F7U A;  1VQM Q;  2X3W D;  2LJ1 A;  2ROL A;  4FCY A;  5A2Q E;  3CMA A;  2LNH B;  5D2J A;  4KT0 E;  4IIO A;  1SSH A;  1C1A A;  3M0T A;  1ZA1 B;  2CZ0 B;  4JJD A;  5CKF A;  5A0L A;  3G71 Q;  2CP0 A;  3QDF A;  2ED0 A;  2CP6 A;  2J7I A;  2V1Q A;  1RI0 A;  3O5Z A;  4IUP A;  4QT7 A;  4MDX A;  2JTF A;  3X28 B;  1QCN A;  5IAY A;  5GAN h;  1VQ7 Q;  1KFZ A;  2X35 A;  1KQS S;  2VWF A;  4Y91 A;  3I35 A;  2RM4 A;  3SWN C;  4Y28 E;  5I11 A;  1SRL A;  1KQ2 A;  1Q95 G;  3H0H A;  1NR9 A;  2P0K A;  3OYC A;  3H0F A;  1ZSZ A;  3V8J A;  4HT9 A;  2KI7 A;  3REA B;  2M51 A;  2YUN A;  2L5Q A;  4M7A C;  1KQ1 A;  1ZHI A;  1S72 Q;  3NHN A;  1FMV A;  2PVG B;  5GAO q;  1BCM A;  2QA4 Q;  1WJS A;  3FDR A;  2LCC A;  2E12 A;  1C6V X;  3BQB A;  1WHJ A;  3JCM Q;  3OB9 A;  3A8G B;  3FC3 A;  1XJW B;  2MAM A;  1W1F A;  2GTO A;  2QAS A;  2GNC A;  2RI5 A;  2EQJ A;  1T3L A;  5HK3 A;  3EH1 A;  4Y92 A;  3JB9 I;  2ZPF B;  1R0B G;  4BY6 C;  5CKD A;  5CIU A;  1AWW A;  3M59 A;  2DXT A;  3JCM d;  2DXU A;  1YJW A;  1ZSZ C;  2KRS A;  1I8F A;  1TH7 A;  1SKU B;  2EBP A;  3RKY A;  2QTV A;  2HAX A;  2D1X A;  4WF2 A;  4IUQ A;  2V1R A;  1B7T A;  4FYV B;  2XID A;  2DXC A;  2CP7 A;  1VQ6 T;  1VQ8 T;  1OZ3 A;  4QQD A;  2EGC A;  4JLI A;  5CKB A;  1PKT A;  5CO7 A;  1WHM A;  2MK5 A;  4C92 F;  3M53 A;  4LN2 A;  1ARK A;  5IT9 E;  4OVA A;  1G3T A;  2HSE B;  1I07 A;  1BB9 A;  1OQK A;  3EH2 A;  3QZ9 B;  3JB9 D;  2F2V A;  3EFO A;  3I55 Q;  3P8D A;  1G83 A;  3AT1 B;  4O6J A;  1I0C A;  1VQ5 Q;  3A8H B;  4LDV A;  2RMO A;  3CPW P;  1W2B A;  4J8O A;  2YT6 A;  1JJ2 P;  1UB4 A;  4CC7 A;  3GP8 A;  1X27 A;  3DB3 A;  2X4Y A;  4PJL A;  1BK2 A;  3OYI A;  3FIF A;  3G7Z A;  4HVV A;  4RTV A;  4IIM A;  3ZEH A;  4XK8 E;  5KE2 A;  1CSK A;  2MF2 A;  2HQX A;  4F7U F;  3ULR B;  2O4X B;  1OYX A;  2EB5 A;  2QQR A;  3A5Z B;  3CCE Q;  2M1H A;  3CCU T;  1N9S A;  4C8Q G;  1YIT Q;  2JS0 A;  4Z02 A;  2EQM A;  3RMQ A;  4M78 G;  4XU3 A;  4ORZ A;  2E5Q A;  2E41 A;  1X6B A;  2EKO A;  1H3Z A;  3PVQ A;  4JRP A;  2EJF A;  4OF1 A;  3BDL A;  3OYG A;  3CEY A;  2K6D A;  5LJ5 j;  1G5V A;  1ZSG A;  1M30 A;  3OS5 A;  3G6E T;  2EKH A;  3TEE A;  4FIB A;  1RAE B;  1AT1 B;  2Y4Y A;  1VQO T;  1OX8 A;  3OMC A;  4N4G A;  3F70 A;  2F69 A;  1B07 A;  2DYB A;  1YP5 A;  1GRI A;  2K7A A;  2W0Z A;  1FMW A;  2I2L A;  1YIJ Q;  2HQE A;  3CMA T;  2YRC A;  2LCL A;  3ER0 A;  3QSU A;  2RD1 A;  1BI3 A;  1BU1 A;  3MET A;  9ATC B;  3BDU A;  1JXO A;  1R0C B;  3CCL A;  3R6O A;  3OW2 P;  1OU9 A;  1D0X A;  3M0S A;  3QJY A;  3MHX A;  2HEQ A;  1VQL A;  3O8V A;  2HL5 C;  4ZTJ A;  4M7D G;  3RBB B;  2DLP A;  3VU3 C;  5KYX A;  3INZ A;  5GAN 7;  3M0P A;  1U06 A;  4KBM B;  2P84 A;  2VUB A;  1YI2 A;  3X20 B;  2PNI A;  5LJ5 h;  1M90 U;  1JU5 C;  4C5I A;  2D9T A;  3EG0 A;  3OYM A;  3QYG B;  4RTZ A;  1NM7 A;  1UDL A;  2EW3 A;  5I21 A;  3X24 B;  1WI7 A;  1M5Q 1;  2A3L A;  4J5Y A;  1IHV A;  2PUK B;  4F14 A;  2VXE A;  4HCZ A;  1YNZ A;  3OSV A;  2K5L A;  1RLP C;  2MCN A;  3SB2 A;  3JCM f;  2DIG A;  2Q19 X;  2ZPG B;  4IUT A;  4X34 A;  2FPD A;  2K3B A;  4MMK A;  3OYD A;  2OTJ T;  3JAM E;  5GAN d;  2DIQ A;  1X2K A;  1T3S A;  2YXY A;  3JCM e;  2GFU A;  1KD1 U;  1W70 A;  4M78 A;  3D7S B;  2GF7 A;  1ZUY A;  1BIA A;  2KR3 A;  1UG1 A;  2O31 A;  2QTX A;  4E7J A;  5CCA A;  1YJW T;  2DBK A;  2DIL A;  1JB0 E;  2DTO A;  4Z89 A;  2OAU A;  2EVR A;  2DMO A;  1KHI A;  1HJD A;  2HCK A;  2JVV A;  4A4K A;  2M0Y A;  5GAN 4;  3GOX A;  2H3E B;  2K57 A;  3CME Q;  2CT4 A;  4J6X A;  4KUL A;  3MP8 A;  2HZY A;  4C8Q C;  4M75 G;  3G4S Q;  2DKG A;  3HP9 A;  2X51 A;  2AKL A;  4M78 C;  2YLB A;  2JZ2 A;  4M75 B;  2LX9 A;  3CC2 Q;  3CPW S;  4OB1 B;  4AT1 B;  3C12 A;  3JB9 F;  3M56 A;  1JJ2 S;  5LJ5 g;  1X6O A;  3M5A A;  2AZV A;  1TXQ A;  3OYF A;  3RER A;  2A7Y A;  3WVE B;  3KFV A;  3U23 A;  4M7D A;  3RKX A;  3TSW A;  4MDW A;  4M77 B;  4KGX B;  2EJ9 A;  2V8K A;  1UGS B;  1EIF A;  3HPW A;  3VYH B;  2DZC A;  1VQK Q;  3VS7 A; 
#chains in the Genus database with same CATH homology
 1QCO A;  2EB6 A;  4DBF A;  5D2J A;  1I7O A;  5D2I A;  3RR6 A;  3R6O A;  3S52 A;  2DFU A;  1QQJ A;  1NR9 A;  3BQB A;  3LZK A;  3QDF A;  1SAW A;  2Q18 X;  5D2H A;  2EB4 A;  3V77 A;  5D2K A;  1NKQ A;  1SV6 A;  4PFZ A;  1GTT A;  5D2F A;  2Q1D X;  2Q1A X;  4DBH A;  2HZY A;  1WZO A;  2EB5 A;  2Q1C X;  1QCN A;  4QKU A;  4MAQ A;  2Q19 X;  1HYO A;  2WQT A;  5D2G A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...