1WZOA

Crystal structure of the hpce from thermus thermophilus hb8
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
246
structure length
236
Chain Sequence
MKLARFLAKGRVHQGVYREGLLLDEAGEAHRPEDVTWLLPFTPGKILGVALNYAGLSRPEEPALFWKPNTSLLPHKGVVLYPKGARFVHYEVELAVVVGRPMKRVRAKDALDYVLGYTIANDLVARDYVRPPIRAKGRDTFLPLGPFLVVEEVEDPQDLWLRAYVNGELRQEGHTSRMLYSVAELLEFISEFMTLEPYDVLLTGTPKGISQVRPGDVMRLEIEGLGALENPIEEEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HpcE
publication title Crystal Structure of the HpcE from Thermus Thermophilus HB8
rcsb
source organism Thermus thermophilus
molecule tags Isomerase
total genus 60
structure length 236
sequence length 246
chains with identical sequence B, C, D
ec nomenclature ec 5.3.3.10: 5-carboxymethyl-2-hydroxymuconate Delta-isomerase.
pdb deposition date 2005-03-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01557 FAA_hydrolase Fumarylacetoacetate (FAA) hydrolase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.370 Mainly Beta Roll SH3 type barrels. FAH 1wzoA01
3.90.850.10 Alpha Beta Alpha-Beta Complex Fumarylacetoacetate hydrolase; domain 2 Fumarylacetoacetase-like, C-terminal domain 1wzoA02
1SAWA 2EB5A 4QKUA 2Q1DX 2WQTA 1QCNA 1HYOA 1QQJA 1SV6A 2HZYA 5D2FA 3LZKA 4PFZA 1I7OA 1WZOA 4MAQA 3QDFA 5D2HA 1GTTA 3RR6A 2Q1CX 2DFUA 5D2IA 2EB4A 4DBFA 3V77A 2EB6A 3S52A 5D2JA 5D2KA 4DBHA 3R6OA 5D2GA 2Q1AX 3BQBA 1NR9A 2Q18X 1NKQA 1QCOA 2Q19X
chains in the Genus database with same CATH superfamily
3LGLA 2VB6A 3DLLA 3BY7A 4NL2A 3VUZA 4ZN3A 2BZ8A 3OYLA 3CMET 3SHWA 2IIMA 3JCMf 4C92D 4E2FB 3MCAB 2VV5A 1RAIB 2K5IA 2GQIA 2VASA 2QEXQ 1KHIA 2IPOB 2JJ9A 1G5VA 5KCHA 4JJCA 4F7UB 2RNAA 1JXOA 2VGMA 2GTJA 3M9QA 3QDRB 2XDBA 2QDYB 2CSQA 2F2XA 3RKYA 2BUDA 4M77E 3OYJA 1MMNA 5GAOl 2RN8A 1PC0A 4FM4B 2LJ1A 2RHZA 4J9BA 3OW2P 1PKSA 2B86A 3NPFA 3OY9A 4PJOD 1K4US 2YDLA 1Y96A 1R77A 3EFSA 4RCBA 1BI2A 3QDFA 9ATCB 1ABOA 2JOYA 3RMSA 4A63B 2EYWA 3CCJQ 4F7UF 1YBYA 1NJIC 5D2IA 2GNCA 3A5ZB 3M4YA 4PJMA 3VS3A 4E47A 3V8JA 1T0JA 3R6OA 2MMPA 2F69A 4FYYB 2AT1B 4MZMA 2YXYA 3OYNA 4HVUA 4HKEA 1Q86C 2KYMA 3L2ZA 4OP0A 5LJ5f 4M7DC 4F17A 2EW3A 2DEQA 4J7FA 2DNUA 2KGTA 1BI1A 2FPEA 1M3CA 3VS6A 8ATCB 3PTAA 3P8HA 3JB9F 4C0FA 3RKWA 1Q82R 2L3PA 3G4ST 2V8JA 2RQTA 2RHIA 1TUGB 2E4HA 1WPYA 1YN8A 2W10A 2COYA 2X4WA 4E7SA 5KYWB 2QEXA 1GBRA 2MCNA 4N0AC 1I5LA 4DEYA 3JSCA 4M7AC 2CP6A 2DXTA 2RHXA 4MZPA 3J7AF 3TQ7P 1AOJA 1B34A 3SWNC 2XHCA 2HSPA 1VQOA 1X2KA 4M77D 3QSUA 2CGHA 1K1ZA 3ZEHA 2ZPIB 1E6HA 4QQ6A 1PKTA 1NE8A 2DZ9A 2R5MA 4ZGDB 3CCJA 1B07A 2PQWA 1WXTA 4M7DG 3OW2S 5LL6S 1X43A 2M02A 3H0IA 5KCOA 1K9MR 2KI7A 5C0MA 3H8ZA 3LH5A 4AFUC 4A4HA 3I5SA 4JPBW 1Q81R 1I81A 2FPDA 1VQ8A 1QVGP 4JZ3A 2E5QA 2JMCA 4J9EA 4C8QB 3X25B 3BDLA 2AKLA 2DBMA 3S6WA 2COWA 3CC7A 1GFDA 2EGCA 1RAGB 2R58A 2EKOA 2EWNA 1SKUB 1I5OB 4MDWA 2EVRA 4M7AG 5GAMd 3MP1A 5EG2A 3ZL7C 1OU9A 2CDTA 2M1HA 1MGQA 3PVLA 2F5TX 3J81E 3FJPA 3QWYA 4M78F 1HD3A 1G3WA 1SSFA 4C92C 5HKCA 1RAEB 4C8QF 2EAYA 2QQBA 4J83A 1WXBA 4XU2A 3M0QA 3OYKA 2K3YA 3HPWA 4FT2A 5GAN4 2KVQG 2QTXA 1W70A 1TH7A 1NYGA 3CCMA 1VA7A 4J9FA 1PRMC 3SEMA 4J6XA 3OYIA 3FEOA 4KGVB 3EH1A 4ORZA 3GBQA 5CKFA 2OTLQ 1OOTA 2DD4A 3WVDB 1VQOT 4MMKA 2H8HA 5D2HA 3H9NA 4XQ3A 1UGPB 3CCQQ 4A4GA 3QZ9B 2CT3A 4J9IA 2KNBB 2PVOB 1YJ9A 2A37A 5L8RE 2CH4W 1VYTA 1UUEA 3HL8A 2C0OA 3EG0A 4PJOC 4Y91A 4EMGA 3ULRB 3GNGA 4PNOA 3CCRA 1BK2A 4LUDA 2O4XB 1YHQQ 3GPLA 2CUBA 1LPLA 2QTVA 3C94A 3CXCP 3JB9J 5CQYA 2QQRA 3MP6A 5CQXA 1FMWA 1V76A 2RJCA 4HT8A 4A54A 2FL7A 3CCSQ 1H3HA 4PK4A 1VQ8T 2JM8A 4AFQC 1QP2A 4ZN1A 2NUPB 4A4KA 4C92G 3UF4A 2RQRA 3L2UA 4ATOA 1E6GA 4M75F 2CREA 1MNEA 3CC7T 3CMAQ 1KQ2A 4FYWB 1JO8A 2F1LA 3CCLA 2RK2A 4C5HA 4X9CA 2YT6A 1FWZA 3CCUA 2KSSA 1UJ0A 4OMMA 1D0XA 2Q18X 4ANJA 4RTUA 1N9RA 2VWFA 2X35A 1KQSA 2R5AA 3JB9I 5I2SA 2HBPA 4M78A 1B3QA 1TXQA 1X6GA 2KYBA 3PVQA 2BE7D 4PJOG 3M0SA 2E70A 5CR2A 3CCMT 2KRMA 2DKGA 3QYHB 2I0NA 3V7CA 2OTLA 2CZ1B 3NGPA 2O2OA 4EMKA 3CCQA 2VXEA 2DYBA 2J6OA 2FVUA 5GAN7 4FW2A 1ZUUA 1IGUA 1ZUKA 2NWMA 3FLGA 3UPUA 1WNLA 4EMKC 1SEMA 1YJ9T 5DLQE 2MF2A 2JUFA 3MP8A 2HBWA 1C0MA 2KRSA 2J6FA 3MJXA 3X24B 1YJNQ 2JTEA 1YHQA 2M9UA 3OYAA 2EYZA 3UT1A 3CCRT 1FMKA 2RJFA 1M2VB 1VQNQ 3V7SA 1MUZA 2KAFA 1PHTA 3JCMc 3X20B 5GAMj 2ESWA 1PSFA 2X4XA 2K4YA 2DL5A 1IHWA 2RQWA 1F1BB 2QGFB 3CXCS 5DLOA 2PVDB 2X4JA 1VYVA 1WHGA 4HVVA 1QVFP 5L23A 1N8RC 2LQNA 1R0CB 4DEXA 3M0UA 1OEBA 2HD0A 2GQVA 2D0QB 2O01E 3IQLA 4XU0A 5CIUA 2KXCA 3VV0A 3CMAA 4NS5A 3QIIA 2OAWA 3OYEA 1S72Q 4M75A 5FLXE 4D8KA 3AHUA 4JJBA 4M4ZA 3CCLT 2FB7A 1VQ5Q 2XD0A 2IVWA 2CP7A 3CCUT 3RNJA 5KYXA 4FYVB 1JB0E 1KC8U 1AWJA 2QA4Q 3OBYA 3D7SB 2PZ1A 1CKAA 3P8DA 2DJZA 2CUDA 4M77G 2D0NA 3META 2MWPA 3UDCA 1JEGA 1WXUA 3HHTB 1ZQ1A 3TVTA 1GTTA 1VQ9Q 5A2QE 3KFVA 3QPHA 3HRSA 2X3WD 2EPDA 5FROA 1BIAA 5D7UA 1I8FA 3PIOA 3M59A 1KK7A 1QWEA 3LGFA 1M5Q1 2DL7A 2SEMA 1QCFA 4E7ZA 3CCQT 5CVIA 4F7UE 2GCXA 3WVEB 4C5GA 1FXXA 3G6EQ 1NLPC 1GXIE 4L59A 2DZCA 2P4TA 3H0FA 5I21A 1TOVA 2QQSA 4J9CA 1M1KC 1YHQT 2DBKA 3LWHA 1Y96B 2GFUA 3TCJA 1TS9A 5GAMe 1YNZA 1PNJA 1NG2A 4IUPA 1TU0B 1Q7YU 1ZBXA 1KD1C 2DRKA 2LQWA 1H8KA 2JW4A 3KUFA 3EGUA 1K8AC 5GAMh 4VUBA 3EG9A 4IURA 1UEBA 4C0DB 4RTZA 1AHJB 3SD4A 1QVFS 1ZA1B 2DVEA 1C1AA 3MEUA 5GAMg 1PCXA 5IT9E 2DYIA 2NLUA 3I55Q 2DEUA 2D6FA 1VQPQ 4LN2A 1K73R 2QA4A 3HP9A 1D1CA 2OX7A 2RJEA 4IIMA 1X27A 1BB9A 3A8OB 3F70A 1NPPA 2GF7A 1WHLA 1ZA2B 2ED1A 1FX7A 1Y71A 4DOVA 3NHNA 2PVGB 1PD0A 2A36A 4M7DF 5IH2A 2HQHA 1W1FA 1OZ3A 2K3XA 5GAOq 3QXEB 4BUGA 4HCCA 3V8KA 5D6XA 4X1VA 1VQMQ 4F04B 3RKXA 4J9HA 1W4SA 1B34B 4XTXA 2K57A 4Z88A 4XTVA 4BE1A 2V8KA 1YCYA 3I35A 3JCMd 1ABQA 1BCOA 2RM4A 4PFOA 1S1NA 4KULA 2MAMA 3EG3A 3CC2Q 2YSQA 4JUVA 1PM3A 4X9DA 2Y4XA 2ZPGB 2V1RA 3VS5A 3CEYA 1N8RR 4R56A 4WF2A 4M7AF 3OW2A 3WXMB 3TSWA 1WQ7A 3CPWP 2CH4A 1KHCA 2DILA 2RA2A 3NMZC 2EQUA 2K2VA 2HCKA 2L3RA 3N5BB 1K0SA 1M90R 1UGVA 3EAEA 3MEWA 3JB9D 4OB1B 5I11A 1VQKQ 3HFNA 4BI3A 3EH2A 1TUCA 3FDRA 1HJDA 1WJRA 2DK3A 4M78E 2KRNA 3I55A 1VQPA 2Q1DX 2DRMA 1MMDA 2PNIA 5HY6A 3QHSA 4C8QE 5A0LA 1GRIA 1PD1A 1U5SA 1GL5A 3DB4A 2DXCA 1VQ4Q 1KC8C 1X6BA 1WZOA 1G3YA 1ZSZC 3M4GA 2YUPA 2JTFA 2YHTA 3VJPA 4AG2C 4ELYC 4QVCA 1G83A 3MPUB 4OB0B 2AKKA 1NKQA 2JNGA 5FU7B 4AFZC 3U23A 2LQKA 1FYNA 2LQ8A 2VYTA 1HSQA 4M7DA 5LJ5d 1Y07A 1D1AA 2JN0A 3EHQA 3CCVQ 1VQMA 2DL3A 1EIFA 2JS0A 3EG2A 1N27A 1BI3A 3OQ5A 1JXMA 4FSSA 4FU6A 1LCKA 4KH0B 4UC4A 3LYIA 1YI2Q 2EIFA 4WTOB 4C92F 3VRYA 3TEEA 1QQJA 2PTKA 3EGDA 2E6ZA 1VUBA 2VUBA 3ER0A 3GP8A 4N0AA 1KD1R 2O31A 2DF6A 1CKBA 1K8AR 7AT1B 1LNXA 2CZ6B 5GMKl 3AT1B 4QW2A 4M7AA 1WJSA 1KJWA 2DMOA 3QO3A 3V8LA 1U06A 3SWNA 3L2RA 4BE0A 1Q7YC 1AZGB 1DJ7B 5GAOr 3CPWS 5KH6A 1VQKA 1VQ6Q 3S3MA 2RHYA 3M54A 1G3SA 1T0HA 3OSSC 4J6YA 3M58A 5KE3A 1QVGA 1NM7A 4M78D 1KQ1A 1KSWA 4RTVA 1RABB 2A7YA 4PJOF 4C8QD 4FIBA 3I55T 1VQPT 1VQ7Q 2YRCA 1VQ4A 4AG1C 2DTHA 3QYGB 1J3TA 2QQAA 1WIEA 3EFOA 1UJYA 2DL8A 4JS4A 2O9VA 3MEVA 2HMAA 2OTJQ 1MMGA 3I5RA 2AK5A 1QP3A 4IUVA 4KRTA 6AT1B 2EQJA 4M78B 1I1JA 2WACA 1TUDA 5IHKA 1MV3A 2LCLA 2H3EB 1M27C 4PKCC 3M53A 1VQMT 1Z9QA 5CAIA 1UHFA 1YP5A 1WLPB 1X6OA 3LX7A 3DKMA 1LVKA 1WHMA 2EQMA 3SDZA 4QVDA 1YI2A 1M3BA 1M30A 2JT4A 2E65A 2ED0A 1YJWQ 5GJWB 4N4GA 2K5LA 4EMKB 1N5ZA 3QZ5B 1RLQC 2F5KA 4C92A 5GAN6 1R8OB 2ZGWA 4LE9A 4IIOA 2LZ6B 2Y4YA 5A0DA 1AT1B 3CCEQ 2QEXT 1M90U 2G6FX 2L0AA 2KK4A 1AWXA 3C4SA 3GF5A 5ECAA 3X28B 2J06A 1RAFB 3FJ5A 1VQ6A 2MYSA 1OPKA 3I56Q 3CXCA 2I2LA 2XIDA 3QJ6A 2KE9A 1VQKT 1K9AA 4PLIA 4LXCA 1SF9A 4K11A 3CBOA 1NJIR 4OMLA 2XICA 1WYXA 4J5YA 3JCMb 4PJOA 2RK1A 2HKQB 4M75B 5LJ5j 3L42A 1VQ4T 3REBB 5FU6C 4C5EA 3UWNA 4ME7A 1W2BP 3OYMA 2OTJA 4Q5WA 1D3BA 2RF0A 2QAZA 5KYXB 2BTTA 3CCJT 1GCQA 1Q86R 3OYHA 2HQXA 4RUGA 3LW5E 3URGA 4CC3A 4F7UG 3JCMe 2DFUA 2BKDN 1M2OA 3VRZA 3ASKA 2RI5A 3MO8A 1GCQC 3L2VA 3QJYA 1QVPA 1N6AA 2KT8A 4HCBA 3JCMh 4HT9A 4FSXA 1QVGS 2E1HA 2RD1A 4FL6A 2CSIA 3LZKA 1AWWA 2ZPHB 1YJWA 2FPFA 1Q82U 3JCMg 1YI2T 2QG9B 3RERA 1OU8A 2PUKB 1BKBA 2SRCA 3CBMA 3TU4K 2FZCB 1LJOA 4N4IA 2DD5A 3G71Q 1JJ2P 3HFOA 2F2WA 1VQLQ 1RUWA 2GBQA 4J9DA 4DBRA 2P84A 2JZ2A 1RAAB 2X4YA 3CCEA 1EFNA 5HK3A 1QKWA 3PMTA 2MIOA 2GGRA 2YUOA 3E2UA 4Y92A 4A4FA 4JDSA 2FHDA 5D2JA 1YITQ 3PT9A 3I56A 3JCMQ 4BACA 1OX8A 1XNIA 4M77A 4BY6C 2JXBA 2RH2A 2KXDA 3A8GB 4M77C 3EG9B 2YWWA 1QVFA 4XU1A 4MDXA 3VS7A 3EG1A 5IHIA 2A08A 1M4ZA 1BBZA 5LJ5e 2CKKA 2V1QA 1K9MU 2VGNA 1U3OA 1VIFA 5FW9A 5GAOp 5FRMA 1Q81U 5LJ5h 2OTJT 4IKFA 1ZX6A 5KE2A 1W2BS 4OMNA 4CRIA 3RESA 4N4HA 1NEGA 3CPFA 3DLMA 3CCSA 5GANd 4OMPA 5LJ5g 3OS0A 3M56A 3QUIA 2C0IA 2EQKA 1PG5B 1TTHB 1W6XA 3BQBA 4FYXB 5GANf 5C6SA 3ME9A 2FG0A 4HCZA 3KXTA 2LC4A 4JRPA 2VXFA 2CZ7B 2D9TA 3GNFB 2P4RA 5J26A 2RB6A 4HXJA 2ZPEB 5I22A 2LNHB 5CO7A 2QQ9A 2LMJA 3G71A 4J6WA 4ZGEB 1M9SA 2ATCB 4CC4B 1PSEA 2EB6A 2CP0A 1VQLA 4RKUE 4DBHA 5D6WA 1ARKA 2EYXA 1SPKA 3GIBA 4J9GA 1JJ2S 1QKXA 3PGGA 5KYUA 2NUTA 5KYYA 1T3LA 3CCET 1YWPA 2LJ3A 2RQVA 2HAXA 4JS5A 1JRIA 3CQTA 4C8QG 4KT0E 2L3SA 4PL6A 3H6ZA 2J05A 3ZFJA 4OF1A 2BZXA 2J7IA 1OYXA 4QQDA 1IXDA 3OYYA 1YWOA 3I56T 2C0TA 2HL3A 5D6YA 4BDYA 1NR9A 3P8BB 2JM9A 3THKA 1JU5C 3GOXA 2OTLT 2XG8D 3LH0A 3FB9A 5IXFA 5GMKm 2LJ0A 2BZYA 2FO0A 4F16A 3OYDA 4GLMA 1KFZA 4RMOA 4MMLA 2XU8A 1YJNA 1U1SA 2RJDA 2BE9B 3L1AA 5LJ3d 2MPXC 1VQNA 3JCMP 4O6JA 4DBQA 2HZYA 1BYMA 3ZBDA 5CCAA 3VS1A 3VYHB 5LJ3f 1WDXA 2KT1A 3C0CA 3CCST 2E5KA 3G4SQ 1M1FA 5GAN3 2L5QA 1KG1A 5IHNA 4QT7A 2D8HA 2YRVA 1HXDA 3E19A 2LCSA 2G3RA 4M7DB 1S72A 4XTWA 4HVWA 2P0PA 3JCMJ 1JBMA 3CMAT 1VQ5A 1IB8A 2ENMA 3MEAA 4RTYA 5GAN8 1BI0A 4E7JA 2PU9B 5A0GA 1M1GA 4PLLA 2YLCA 2AZVA 4OMQA 1VQLT 2WSFE 4BE2A 3EGXA 3S3OA 2MWOA 3EFRA 1E7OA 2WSCE 3EGDB 1VYUA 4JJDA 1SSHA 2DA9A 2RO0A 1UGQB 1FMVA 3VS4A 2RMOA 2HL5C 1VQ9A 4ZNXA 1UGRB 3JV3A 2PUOB 4M7AB 3OYGA 1H92A 3TREA 2RI3A 4KGXB 4XTYA 3SWNB 4LDYA 1D09B 3VUBA 3NTIA 1A0NB 3CPWA 1UECA 2KY9A 2HEQA 1NPRA 2AHJB 2DVJA 4R0KA 2ZPBB 5GANj 2K3BA 5D2FA 1TSFA 3G6EA 2RQUA 5M9OA 1K9MC 2XK0A 1U1TA 2EB4A 2OJ2A 2E6NA 1YJNT 4CC2A 1Y57A 2AZSA 1Q81C 3EFOB 2KEAA 2L2PA 1VQNT 3FC3A 5DM7R 1G2BA 1I0CA 2Y90A 2FRYA 1YCSB 1OULA 1V29B 3G4SA 4QVZA 1IREB 2EGEA 2O9SA 1ZBJA 5GAN2 2ABLA 3INZA 4OVAA 1ZUYA 4LDWA 3M0RA 1IRXA 3BFMA 4XTZA 4KUIA 1UGSB 1S72T 1CSKA 4L5GA 1Q95G 2QDLA 5FWBA 2EB5A 1ZHIA 1WA7A 1VQ5T 3DB3A 1ZSZA 3OS2A 3VYGA 4Z89A 4QQGA 1M8MA 2O88A 1I7OA 4RG8A 1OPLA 3V7RA 2QA4T 4ZTFA 2RPNA 1VQOQ 4XK8E 3SB2A 2K7AA 4C92B 4OGEA 1UE9A 4ZTJA 3OS1A 3H0HA 2K9GA 2P0KA 3HKSA 1K76A 5HK0A 2HNIA 1RI0A 3NTKA 2EBPA 2DPPB 1K0XA 4Y28E 2X51A 4BDZA 1VQ9T 1SRMA 4E7HA 4ESRA 2XMFA 2NYSA 2KROA 3R6NA 4KUDK 2E3IA 5GAOn 5LJ3j 4Z02A 5J39A 3HRTA 4JLIA 1XTDA 4LDXA 3S52A 4J8OA 2W0ZA 5D2KA 1UB4A 5GANe 2LCCA 2HSEB 2NUZA 1M1KR 3MHXA 1QCOA 1EZZB 1AZEA 3OSVA 1VQ8Q 2LDMA 1HYOA 1GFCA 1WGSA 3G6ET 3CC2A 4JJNK 4AMCA 1C6VX 2DIQA 5GANh 2RI2A 5FU6B 4LDVA 4C0DC 4PJOB 3JCMW 2R57A 3LLRA 4DA4A 3CC7Q 4JZ4A 4BD3A 2X9HA 2L3QA 1D3BB 3VS0A 5GANg 4JRKA 1RACB 2K79A 4FW1A 4M75E 4XTUA 4ELZC 2DJQA 4FCYA 1HK9A 4R55A 3Q1JA 1UFFA 2DXUA 3E9GA 4MZTA 2FRWA 1I07A 1IGQA 2DERA 1ACMB 4B9WA 4LNPA 4C0ZA 1WHKA 2KBTA 1K73U 3A8MB 4OB2B 3HSBA 3O8VA 3A98A 2VKNA 3VKIA 3OYFA 5GMKj 3TSZA 3CCMQ 3L2QA 3MKDA 4OB3B 3RR6A 1NYFA 4LD9K 2EJFA 5AT1B 3JAME 2DXBA 1IZ6A 4OMOA 2ZPFB 1YJ9Q 3PNWC 1KIKA 3PE0A 4JRIA 2ZZDA 1H641 2LVMA 3CCVA 2QGGA 4GY5A 4BY6B 2LRQA 5LJ3e 2CT4A 1NEBA 2KR3A 3BW1A 3CCRQ 4F7UA 3O5ZA 1EX4A 3CD6Q 4M77B 2CZ0B 1QMCA 2LX7A 1Y7XA 5LJ3h 4NL3A 2Q1AX 5CKEA 2M0YA 1YFNA 3M5AA 3BDUA 2EYYA 4KH1B 4WCIA 1P92A 3RUXA 1RLPC 3OMCA 1N8RU 4BI4A 2XDDA 3CC2T 5LJ3g 1GBQA 1BU1A 4RCCA 2D1XA 2EKHA 4KBMB 4GLKA 4C0GA 2Q1CX 5IAYA 2YUNA 2M0OA 4DBFA 1T3SA 3V77A 2MI6A 3CCLQ 4M75D 2K5FA 2FYKA 3G7ZA 1SG5A 3BE3A 1W2BA 3CCUQ 4FT4A 5CKBA 2JS2A 4JLGA 1ZSGA 2A3LA 2L8DA 2OAUA 3JB9H 4M77F 5IN1A 5GAMf 2ROLA 2DLPA 1WFWA 2DTIA 4E7LA 1KC8R 4B6MA 2EGAA 4O5VA 5FU7C 2Z0WA 4RTXA 1VQ7A 2K2MA 2XKOC 3M0PA 2GTOA 5GMKe 3QWXX 2XDPA 1V1CA 1JQQA 2VC8A 2E3HA 4EMHA 5GMKh 2QI2A 3J80E 3OBWA 1JJ2A 1AVZC 2E10A 1OV3A 1Y0MA 1X2QA 4PJNA 1O75A 1RADB 3QBYA 4TVRA 2NUTB 5KYUB 5KYYB 2EFIA 2YLBA 3H41A 1WHHA 5KYWA 3X26B 2GFAA 1X69A 2JTMA 1M1KU 3CCVT 4NOYA 1OX9A 1AD5A 2BIVA 2YRDA 1H3ZA 3A8LB 4L6V5 2B8AA 3CD6A 2K6DA 3OMGA 3CC4Q 2KDSA 3PMIA 2F2VA 2E64A 1R0BG 1BIBA 4AT1B 1KD1U 4YTLA 1PRLC 3UA7A 2ROTA 1K8AU 1SHFA 2M51A 1XQHA 3M0TA 3GLXA 2Q19X 1SAWA 3OA6A 3JB9G 5J3BA 1Q7YR 1ZLMA 1YIJQ 2QYZA 4V2SA 3OS5A 2DIGA 1TG0A 4ZGJB 2A0FB 2CS7A 5CKDA 3REAB 1WHJA 4HA8A 3C95A 3G1JA 4AFSC 3E1SA 1VQ6T 8AT1B 2C06A 1NZ9A 1SV6A 3RIRA 1MNDA 4C8QA 1K73C 4M78C 1VOMA 5AYFA 5IXBA 2XI9A 3FRNA 3M57A 3PIPA 2DAQA 1VQ7T 4C8QC 1XJWB 3L2WA 1SRLA 4XAXB 4M7DE 2DE0X 4P5NA 1NBEB 3JCMV 5CKHA 2QASA 1KQSP 4PFZA 1UHCA 3EGXB 3HTRA 4MAQA 3PFSA 4E6RA 1RL2A 1OI1A 2E12A 4EIKA 1M3AA 3KBGA 1Z9ZA 3NTHA 1NLOC 3CMEQ 1B7TA 1WJQA 3T9NA 2IG0A 2P0QA 1D1BA 2L89A 3JCMX 4RTWA 4DQ2A 2FZKB 4RG2A 5GAOm 5FRNA 3CC4A 1X75C 1QW1A 2J6KA 3CD6T 2V26A 2OI3A 1YJWT 3QKJA 4II1A 2LNVA 2H3JA 4HCKA 4M7AE 3CBPA 3LWIA 3JRZA 2HQEA 3NFCA 1U8RA 4IUUA 4BB7A 2QK0A 2CYZB 4JRQA 1YIJA 4CC7A 2CP3A 1X01A 3UATA 3RDVA 1QCNA 4E7IA 2KMTA 2MOXA 4M78G 2DO3A 4GBQA 3A1PA 1M90C 1I4K1 2KQWA 1SHGA 2E41A 4LDUA 4M75C 1YITA 1QWFA 2HDAA 4C5IA 2O4XA 1G3TA 3EHRA 5I2MA 2LP5A 3SFMA 4D6WA 2LTOA 1NJIU 1VIEA 1UTIA 4RTTA 2VVKA 2NUPA 4BI8B 2QXFA 3QG1A 1BCMA 2RHUA 4X34A 5DY9A 4E7KA 1Q86U 4PJJA 3VS2A 4CI0C 4A53A 2CP2A 4DOWA 4M7DD 1ZSZB 3RMQA 2LX9A 4EDUA 1MMAA 2COZA 4QKUA 2FZGB 1AWOA 4EPCA 1D0ZA 2FEIA 1IO6A 2A28A 3A8HB 5FWCA 4OMFB 1OZ2A 1KQSS 2CP5A 3CMEA 3FIFA 1WX6A 4J7IA 4IUTA 1M8VA 2EQIA 3OYBA 4C92E 3C12A 5KYNA 2YUQA 3S3NA 4XU3A 1LOJA 1MV0B 1OQKA 2DL4A 3CC4T 4PJLA 1Q82C 5GAN5 3OB9A 4M75G 2ZAEA 4M7AD 2EJGA 3G71T 5CK9A 1WQWA 1PWTA 5EC7A 3OYCA 2V8IA 1O9SA 1YIJT 2D8JA 3I9QA 1QLYA 2LT1A 2WQTA 1XOVA 2JMAA 4A4EA 1AEYA 4LD6A 2DM1A 3HRUA 1YITT 2AIRB 4LUEA 4PJOE 2ECZA 1M2VA 2X3XD 1RAHB 4F14A 2ZCFB 3E9FA 4B9XA 5GMKi 1N9SA 1MHNA 3VU3C 1UG1A 4PFPA 2DX1A 5HCKA 2EYQA 2M16A 1TWBA 4Z8AA 2JVVA 2MK5A 3UA6A 4D8DA 2DTOA 1D0YA 2WSEE 1G8XA 2DETA 3RBBB 2LT4A 2HKNA 1IHVA 1RI9A 5GJVB 1WI7A 4OGCA 4IUQA 1GCPA 5D2GA 3M55A 4KGZB 1UDLA 2EJ9A
chains in the Genus database with same CATH topology
1SAWA 2EB5A 4QKUA 2Q1DX 2WQTA 1QCNA 1HYOA 1QQJA 1SV6A 2HZYA 5D2FA 3LZKA 4PFZA 1I7OA 1WZOA 4MAQA 3QDFA 5D2HA 1GTTA 3RR6A 2Q1CX 2DFUA 5D2IA 2EB4A 4DBFA 3V77A 2EB6A 3S52A 5D2JA 5D2KA 4DBHA 3R6OA 5D2GA 2Q1AX 3BQBA 1NR9A 2Q18X 1NKQA 1QCOA 2Q19X
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SAW A;  2EB5 A;  4QKU A;  2Q1D X;  2WQT A;  1QCN A;  1HYO A;  1QQJ A;  1SV6 A;  2HZY A;  5D2F A;  3LZK A;  4PFZ A;  1I7O A;  1WZO A;  4MAQ A;  3QDF A;  5D2H A;  1GTT A;  3RR6 A;  2Q1C X;  2DFU A;  5D2I A;  2EB4 A;  4DBF A;  3V77 A;  2EB6 A;  3S52 A;  5D2J A;  5D2K A;  4DBH A;  3R6O A;  5D2G A;  2Q1A X;  3BQB A;  1NR9 A;  2Q18 X;  1NKQ A;  1QCO A;  2Q19 X; 
#chains in the Genus database with same CATH topology
 3LGL A;  2VB6 A;  3DLL A;  3BY7 A;  4NL2 A;  3VUZ A;  4ZN3 A;  2BZ8 A;  3OYL A;  3CME T;  3SHW A;  2IIM A;  3JCM f;  4C92 D;  4E2F B;  3MCA B;  2VV5 A;  1RAI B;  2K5I A;  2GQI A;  2VAS A;  2QEX Q;  1KHI A;  2IPO B;  2JJ9 A;  1G5V A;  5KCH A;  4JJC A;  4F7U B;  2RNA A;  1JXO A;  2VGM A;  2GTJ A;  3M9Q A;  3QDR B;  2XDB A;  2QDY B;  2CSQ A;  2F2X A;  3RKY A;  2BUD A;  4M77 E;  3OYJ A;  1MMN A;  5GAO l;  2RN8 A;  1PC0 A;  4FM4 B;  2LJ1 A;  2RHZ A;  4J9B A;  3OW2 P;  1PKS A;  2B86 A;  3NPF A;  3OY9 A;  4PJO D;  1K4U S;  2YDL A;  1Y96 A;  1R77 A;  3EFS A;  4RCB A;  1BI2 A;  3QDF A;  9ATC B;  1ABO A;  2JOY A;  3RMS A;  4A63 B;  2EYW A;  3CCJ Q;  4F7U F;  1YBY A;  1NJI C;  5D2I A;  2GNC A;  3A5Z B;  3M4Y A;  4PJM A;  3VS3 A;  4E47 A;  3V8J A;  1T0J A;  3R6O A;  2MMP A;  2F69 A;  4FYY B;  2AT1 B;  4MZM A;  2YXY A;  3OYN A;  4HVU A;  4HKE A;  1Q86 C;  2KYM A;  3L2Z A;  4OP0 A;  5LJ5 f;  4M7D C;  4F17 A;  2EW3 A;  2DEQ A;  4J7F A;  2DNU A;  2KGT A;  1BI1 A;  2FPE A;  1M3C A;  3VS6 A;  8ATC B;  3PTA A;  3P8H A;  3JB9 F;  4C0F A;  3RKW A;  1Q82 R;  2L3P A;  3G4S T;  2V8J A;  2RQT A;  2RHI A;  1TUG B;  2E4H A;  1WPY A;  1YN8 A;  2W10 A;  2COY A;  2X4W A;  4E7S A;  5KYW B;  2QEX A;  1GBR A;  2MCN A;  4N0A C;  1I5L A;  4DEY A;  3JSC A;  4M7A C;  2CP6 A;  2DXT A;  2RHX A;  4MZP A;  3J7A F;  3TQ7 P;  1AOJ A;  1B34 A;  3SWN C;  2XHC A;  2HSP A;  1VQO A;  1X2K A;  4M77 D;  3QSU A;  2CGH A;  1K1Z A;  3ZEH A;  2ZPI B;  1E6H A;  4QQ6 A;  1PKT A;  1NE8 A;  2DZ9 A;  2R5M A;  4ZGD B;  3CCJ A;  1B07 A;  2PQW A;  1WXT A;  4M7D G;  3OW2 S;  5LL6 S;  1X43 A;  2M02 A;  3H0I A;  5KCO A;  1K9M R;  2KI7 A;  5C0M A;  3H8Z A;  3LH5 A;  4AFU C;  4A4H A;  3I5S A;  4JPB W;  1Q81 R;  1I81 A;  2FPD A;  1VQ8 A;  1QVG P;  4JZ3 A;  2E5Q A;  2JMC A;  4J9E A;  4C8Q B;  3X25 B;  3BDL A;  2AKL A;  2DBM A;  3S6W A;  2COW A;  3CC7 A;  1GFD A;  2EGC A;  1RAG B;  2R58 A;  2EKO A;  2EWN A;  1SKU B;  1I5O B;  4MDW A;  2EVR A;  4M7A G;  5GAM d;  3MP1 A;  5EG2 A;  3ZL7 C;  1OU9 A;  2CDT A;  2M1H A;  1MGQ A;  3PVL A;  2F5T X;  3J81 E;  3FJP A;  3QWY A;  4M78 F;  1HD3 A;  1G3W A;  1SSF A;  4C92 C;  5HKC A;  1RAE B;  4C8Q F;  2EAY A;  2QQB A;  4J83 A;  1WXB A;  4XU2 A;  3M0Q A;  3OYK A;  2K3Y A;  3HPW A;  4FT2 A;  5GAN 4;  2KVQ G;  2QTX A;  1W70 A;  1TH7 A;  1NYG A;  3CCM A;  1VA7 A;  4J9F A;  1PRM C;  3SEM A;  4J6X A;  3OYI A;  3FEO A;  4KGV B;  3EH1 A;  4ORZ A;  3GBQ A;  5CKF A;  2OTL Q;  1OOT A;  2DD4 A;  3WVD B;  1VQO T;  4MMK A;  2H8H A;  5D2H A;  3H9N A;  4XQ3 A;  1UGP B;  3CCQ Q;  4A4G A;  3QZ9 B;  2CT3 A;  4J9I A;  2KNB B;  2PVO B;  1YJ9 A;  2A37 A;  5L8R E;  2CH4 W;  1VYT A;  1UUE A;  3HL8 A;  2C0O A;  3EG0 A;  4PJO C;  4Y91 A;  4EMG A;  3ULR B;  3GNG A;  4PNO A;  3CCR A;  1BK2 A;  4LUD A;  2O4X B;  1YHQ Q;  3GPL A;  2CUB A;  1LPL A;  2QTV A;  3C94 A;  3CXC P;  3JB9 J;  5CQY A;  2QQR A;  3MP6 A;  5CQX A;  1FMW A;  1V76 A;  2RJC A;  4HT8 A;  4A54 A;  2FL7 A;  3CCS Q;  1H3H A;  4PK4 A;  1VQ8 T;  2JM8 A;  4AFQ C;  1QP2 A;  4ZN1 A;  2NUP B;  4A4K A;  4C92 G;  3UF4 A;  2RQR A;  3L2U A;  4ATO A;  1E6G A;  4M75 F;  2CRE A;  1MNE A;  3CC7 T;  3CMA Q;  1KQ2 A;  4FYW B;  1JO8 A;  2F1L A;  3CCL A;  2RK2 A;  4C5H A;  4X9C A;  2YT6 A;  1FWZ A;  3CCU A;  2KSS A;  1UJ0 A;  4OMM A;  1D0X A;  2Q18 X;  4ANJ A;  4RTU A;  1N9R A;  2VWF A;  2X35 A;  1KQS A;  2R5A A;  3JB9 I;  5I2S A;  2HBP A;  4M78 A;  1B3Q A;  1TXQ A;  1X6G A;  2KYB A;  3PVQ A;  2BE7 D;  4PJO G;  3M0S A;  2E70 A;  5CR2 A;  3CCM T;  2KRM A;  2DKG A;  3QYH B;  2I0N A;  3V7C A;  2OTL A;  2CZ1 B;  3NGP A;  2O2O A;  4EMK A;  3CCQ A;  2VXE A;  2DYB A;  2J6O A;  2FVU A;  5GAN 7;  4FW2 A;  1ZUU A;  1IGU A;  1ZUK A;  2NWM A;  3FLG A;  3UPU A;  1WNL A;  4EMK C;  1SEM A;  1YJ9 T;  5DLQ E;  2MF2 A;  2JUF A;  3MP8 A;  2HBW A;  1C0M A;  2KRS A;  2J6F A;  3MJX A;  3X24 B;  1YJN Q;  2JTE A;  1YHQ A;  2M9U A;  3OYA A;  2EYZ A;  3UT1 A;  3CCR T;  1FMK A;  2RJF A;  1M2V B;  1VQN Q;  3V7S A;  1MUZ A;  2KAF A;  1PHT A;  3JCM c;  3X20 B;  5GAM j;  2ESW A;  1PSF A;  2X4X A;  2K4Y A;  2DL5 A;  1IHW A;  2RQW A;  1F1B B;  2QGF B;  3CXC S;  5DLO A;  2PVD B;  2X4J A;  1VYV A;  1WHG A;  4HVV A;  1QVF P;  5L23 A;  1N8R C;  2LQN A;  1R0C B;  4DEX A;  3M0U A;  1OEB A;  2HD0 A;  2GQV A;  2D0Q B;  2O01 E;  3IQL A;  4XU0 A;  5CIU A;  2KXC A;  3VV0 A;  3CMA A;  4NS5 A;  3QII A;  2OAW A;  3OYE A;  1S72 Q;  4M75 A;  5FLX E;  4D8K A;  3AHU A;  4JJB A;  4M4Z A;  3CCL T;  2FB7 A;  1VQ5 Q;  2XD0 A;  2IVW A;  2CP7 A;  3CCU T;  3RNJ A;  5KYX A;  4FYV B;  1JB0 E;  1KC8 U;  1AWJ A;  2QA4 Q;  3OBY A;  3D7S B;  2PZ1 A;  1CKA A;  3P8D A;  2DJZ A;  2CUD A;  4M77 G;  2D0N A;  3MET A;  2MWP A;  3UDC A;  1JEG A;  1WXU A;  3HHT B;  1ZQ1 A;  3TVT A;  1GTT A;  1VQ9 Q;  5A2Q E;  3KFV A;  3QPH A;  3HRS A;  2X3W D;  2EPD A;  5FRO A;  1BIA A;  5D7U A;  1I8F A;  3PIO A;  3M59 A;  1KK7 A;  1QWE A;  3LGF A;  1M5Q 1;  2DL7 A;  2SEM A;  1QCF A;  4E7Z A;  3CCQ T;  5CVI A;  4F7U E;  2GCX A;  3WVE B;  4C5G A;  1FXX A;  3G6E Q;  1NLP C;  1GXI E;  4L59 A;  2DZC A;  2P4T A;  3H0F A;  5I21 A;  1TOV A;  2QQS A;  4J9C A;  1M1K C;  1YHQ T;  2DBK A;  3LWH A;  1Y96 B;  2GFU A;  3TCJ A;  1TS9 A;  5GAM e;  1YNZ A;  1PNJ A;  1NG2 A;  4IUP A;  1TU0 B;  1Q7Y U;  1ZBX A;  1KD1 C;  2DRK A;  2LQW A;  1H8K A;  2JW4 A;  3KUF A;  3EGU A;  1K8A C;  5GAM h;  4VUB A;  3EG9 A;  4IUR A;  1UEB A;  4C0D B;  4RTZ A;  1AHJ B;  3SD4 A;  1QVF S;  1ZA1 B;  2DVE A;  1C1A A;  3MEU A;  5GAM g;  1PCX A;  5IT9 E;  2DYI A;  2NLU A;  3I55 Q;  2DEU A;  2D6F A;  1VQP Q;  4LN2 A;  1K73 R;  2QA4 A;  3HP9 A;  1D1C A;  2OX7 A;  2RJE A;  4IIM A;  1X27 A;  1BB9 A;  3A8O B;  3F70 A;  1NPP A;  2GF7 A;  1WHL A;  1ZA2 B;  2ED1 A;  1FX7 A;  1Y71 A;  4DOV A;  3NHN A;  2PVG B;  1PD0 A;  2A36 A;  4M7D F;  5IH2 A;  2HQH A;  1W1F A;  1OZ3 A;  2K3X A;  5GAO q;  3QXE B;  4BUG A;  4HCC A;  3V8K A;  5D6X A;  4X1V A;  1VQM Q;  4F04 B;  3RKX A;  4J9H A;  1W4S A;  1B34 B;  4XTX A;  2K57 A;  4Z88 A;  4XTV A;  4BE1 A;  2V8K A;  1YCY A;  3I35 A;  3JCM d;  1ABQ A;  1BCO A;  2RM4 A;  4PFO A;  1S1N A;  4KUL A;  2MAM A;  3EG3 A;  3CC2 Q;  2YSQ A;  4JUV A;  1PM3 A;  4X9D A;  2Y4X A;  2ZPG B;  2V1R A;  3VS5 A;  3CEY A;  1N8R R;  4R56 A;  4WF2 A;  4M7A F;  3OW2 A;  3WXM B;  3TSW A;  1WQ7 A;  3CPW P;  2CH4 A;  1KHC A;  2DIL A;  2RA2 A;  3NMZ C;  2EQU A;  2K2V A;  2HCK A;  2L3R A;  3N5B B;  1K0S A;  1M90 R;  1UGV A;  3EAE A;  3MEW A;  3JB9 D;  4OB1 B;  5I11 A;  1VQK Q;  3HFN A;  4BI3 A;  3EH2 A;  1TUC A;  3FDR A;  1HJD A;  1WJR A;  2DK3 A;  4M78 E;  2KRN A;  3I55 A;  1VQP A;  2Q1D X;  2DRM A;  1MMD A;  2PNI A;  5HY6 A;  3QHS A;  4C8Q E;  5A0L A;  1GRI A;  1PD1 A;  1U5S A;  1GL5 A;  3DB4 A;  2DXC A;  1VQ4 Q;  1KC8 C;  1X6B A;  1WZO A;  1G3Y A;  1ZSZ C;  3M4G A;  2YUP A;  2JTF A;  2YHT A;  3VJP A;  4AG2 C;  4ELY C;  4QVC A;  1G83 A;  3MPU B;  4OB0 B;  2AKK A;  1NKQ A;  2JNG A;  5FU7 B;  4AFZ C;  3U23 A;  2LQK A;  1FYN A;  2LQ8 A;  2VYT A;  1HSQ A;  4M7D A;  5LJ5 d;  1Y07 A;  1D1A A;  2JN0 A;  3EHQ A;  3CCV Q;  1VQM A;  2DL3 A;  1EIF A;  2JS0 A;  3EG2 A;  1N27 A;  1BI3 A;  3OQ5 A;  1JXM A;  4FSS A;  4FU6 A;  1LCK A;  4KH0 B;  4UC4 A;  3LYI A;  1YI2 Q;  2EIF A;  4WTO B;  4C92 F;  3VRY A;  3TEE A;  1QQJ A;  2PTK A;  3EGD A;  2E6Z A;  1VUB A;  2VUB A;  3ER0 A;  3GP8 A;  4N0A A;  1KD1 R;  2O31 A;  2DF6 A;  1CKB A;  1K8A R;  7AT1 B;  1LNX A;  2CZ6 B;  5GMK l;  3AT1 B;  4QW2 A;  4M7A A;  1WJS A;  1KJW A;  2DMO A;  3QO3 A;  3V8L A;  1U06 A;  3SWN A;  3L2R A;  4BE0 A;  1Q7Y C;  1AZG B;  1DJ7 B;  5GAO r;  3CPW S;  5KH6 A;  1VQK A;  1VQ6 Q;  3S3M A;  2RHY A;  3M54 A;  1G3S A;  1T0H A;  3OSS C;  4J6Y A;  3M58 A;  5KE3 A;  1QVG A;  1NM7 A;  4M78 D;  1KQ1 A;  1KSW A;  4RTV A;  1RAB B;  2A7Y A;  4PJO F;  4C8Q D;  4FIB A;  3I55 T;  1VQP T;  1VQ7 Q;  2YRC A;  1VQ4 A;  4AG1 C;  2DTH A;  3QYG B;  1J3T A;  2QQA A;  1WIE A;  3EFO A;  1UJY A;  2DL8 A;  4JS4 A;  2O9V A;  3MEV A;  2HMA A;  2OTJ Q;  1MMG A;  3I5R A;  2AK5 A;  1QP3 A;  4IUV A;  4KRT A;  6AT1 B;  2EQJ A;  4M78 B;  1I1J A;  2WAC A;  1TUD A;  5IHK A;  1MV3 A;  2LCL A;  2H3E B;  1M27 C;  4PKC C;  3M53 A;  1VQM T;  1Z9Q A;  5CAI A;  1UHF A;  1YP5 A;  1WLP B;  1X6O A;  3LX7 A;  3DKM A;  1LVK A;  1WHM A;  2EQM A;  3SDZ A;  4QVD A;  1YI2 A;  1M3B A;  1M30 A;  2JT4 A;  2E65 A;  2ED0 A;  1YJW Q;  5GJW B;  4N4G A;  2K5L A;  4EMK B;  1N5Z A;  3QZ5 B;  1RLQ C;  2F5K A;  4C92 A;  5GAN 6;  1R8O B;  2ZGW A;  4LE9 A;  4IIO A;  2LZ6 B;  2Y4Y A;  5A0D A;  1AT1 B;  3CCE Q;  2QEX T;  1M90 U;  2G6F X;  2L0A A;  2KK4 A;  1AWX A;  3C4S A;  3GF5 A;  5ECA A;  3X28 B;  2J06 A;  1RAF B;  3FJ5 A;  1VQ6 A;  2MYS A;  1OPK A;  3I56 Q;  3CXC A;  2I2L A;  2XID A;  3QJ6 A;  2KE9 A;  1VQK T;  1K9A A;  4PLI A;  4LXC A;  1SF9 A;  4K11 A;  3CBO A;  1NJI R;  4OML A;  2XIC A;  1WYX A;  4J5Y A;  3JCM b;  4PJO A;  2RK1 A;  2HKQ B;  4M75 B;  5LJ5 j;  3L42 A;  1VQ4 T;  3REB B;  5FU6 C;  4C5E A;  3UWN A;  4ME7 A;  1W2B P;  3OYM A;  2OTJ A;  4Q5W A;  1D3B A;  2RF0 A;  2QAZ A;  5KYX B;  2BTT A;  3CCJ T;  1GCQ A;  1Q86 R;  3OYH A;  2HQX A;  4RUG A;  3LW5 E;  3URG A;  4CC3 A;  4F7U G;  3JCM e;  2DFU A;  2BKD N;  1M2O A;  3VRZ A;  3ASK A;  2RI5 A;  3MO8 A;  1GCQ C;  3L2V A;  3QJY A;  1QVP A;  1N6A A;  2KT8 A;  4HCB A;  3JCM h;  4HT9 A;  4FSX A;  1QVG S;  2E1H A;  2RD1 A;  4FL6 A;  2CSI A;  3LZK A;  1AWW A;  2ZPH B;  1YJW A;  2FPF A;  1Q82 U;  3JCM g;  1YI2 T;  2QG9 B;  3RER A;  1OU8 A;  2PUK B;  1BKB A;  2SRC A;  3CBM A;  3TU4 K;  2FZC B;  1LJO A;  4N4I A;  2DD5 A;  3G71 Q;  1JJ2 P;  3HFO A;  2F2W A;  1VQL Q;  1RUW A;  2GBQ A;  4J9D A;  4DBR A;  2P84 A;  2JZ2 A;  1RAA B;  2X4Y A;  3CCE A;  1EFN A;  5HK3 A;  1QKW A;  3PMT A;  2MIO A;  2GGR A;  2YUO A;  3E2U A;  4Y92 A;  4A4F A;  4JDS A;  2FHD A;  5D2J A;  1YIT Q;  3PT9 A;  3I56 A;  3JCM Q;  4BAC A;  1OX8 A;  1XNI A;  4M77 A;  4BY6 C;  2JXB A;  2RH2 A;  2KXD A;  3A8G B;  4M77 C;  3EG9 B;  2YWW A;  1QVF A;  4XU1 A;  4MDX A;  3VS7 A;  3EG1 A;  5IHI A;  2A08 A;  1M4Z A;  1BBZ A;  5LJ5 e;  2CKK A;  2V1Q A;  1K9M U;  2VGN A;  1U3O A;  1VIF A;  5FW9 A;  5GAO p;  5FRM A;  1Q81 U;  5LJ5 h;  2OTJ T;  4IKF A;  1ZX6 A;  5KE2 A;  1W2B S;  4OMN A;  4CRI A;  3RES A;  4N4H A;  1NEG A;  3CPF A;  3DLM A;  3CCS A;  5GAN d;  4OMP A;  5LJ5 g;  3OS0 A;  3M56 A;  3QUI A;  2C0I A;  2EQK A;  1PG5 B;  1TTH B;  1W6X A;  3BQB A;  4FYX B;  5GAN f;  5C6S A;  3ME9 A;  2FG0 A;  4HCZ A;  3KXT A;  2LC4 A;  4JRP A;  2VXF A;  2CZ7 B;  2D9T A;  3GNF B;  2P4R A;  5J26 A;  2RB6 A;  4HXJ A;  2ZPE B;  5I22 A;  2LNH B;  5CO7 A;  2QQ9 A;  2LMJ A;  3G71 A;  4J6W A;  4ZGE B;  1M9S A;  2ATC B;  4CC4 B;  1PSE A;  2EB6 A;  2CP0 A;  1VQL A;  4RKU E;  4DBH A;  5D6W A;  1ARK A;  2EYX A;  1SPK A;  3GIB A;  4J9G A;  1JJ2 S;  1QKX A;  3PGG A;  5KYU A;  2NUT A;  5KYY A;  1T3L A;  3CCE T;  1YWP A;  2LJ3 A;  2RQV A;  2HAX A;  4JS5 A;  1JRI A;  3CQT A;  4C8Q G;  4KT0 E;  2L3S A;  4PL6 A;  3H6Z A;  2J05 A;  3ZFJ A;  4OF1 A;  2BZX A;  2J7I A;  1OYX A;  4QQD A;  1IXD A;  3OYY A;  1YWO A;  3I56 T;  2C0T A;  2HL3 A;  5D6Y A;  4BDY A;  1NR9 A;  3P8B B;  2JM9 A;  3THK A;  1JU5 C;  3GOX A;  2OTL T;  2XG8 D;  3LH0 A;  3FB9 A;  5IXF A;  5GMK m;  2LJ0 A;  2BZY A;  2FO0 A;  4F16 A;  3OYD A;  4GLM A;  1KFZ A;  4RMO A;  4MML A;  2XU8 A;  1YJN A;  1U1S A;  2RJD A;  2BE9 B;  3L1A A;  5LJ3 d;  2MPX C;  1VQN A;  3JCM P;  4O6J A;  4DBQ A;  2HZY A;  1BYM A;  3ZBD A;  5CCA A;  3VS1 A;  3VYH B;  5LJ3 f;  1WDX A;  2KT1 A;  3C0C A;  3CCS T;  2E5K A;  3G4S Q;  1M1F A;  5GAN 3;  2L5Q A;  1KG1 A;  5IHN A;  4QT7 A;  2D8H A;  2YRV A;  1HXD A;  3E19 A;  2LCS A;  2G3R A;  4M7D B;  1S72 A;  4XTW A;  4HVW A;  2P0P A;  3JCM J;  1JBM A;  3CMA T;  1VQ5 A;  1IB8 A;  2ENM A;  3MEA A;  4RTY A;  5GAN 8;  1BI0 A;  4E7J A;  2PU9 B;  5A0G A;  1M1G A;  4PLL A;  2YLC A;  2AZV A;  4OMQ A;  1VQL T;  2WSF E;  4BE2 A;  3EGX A;  3S3O A;  2MWO A;  3EFR A;  1E7O A;  2WSC E;  3EGD B;  1VYU A;  4JJD A;  1SSH A;  2DA9 A;  2RO0 A;  1UGQ B;  1FMV A;  3VS4 A;  2RMO A;  2HL5 C;  1VQ9 A;  4ZNX A;  1UGR B;  3JV3 A;  2PUO B;  4M7A B;  3OYG A;  1H92 A;  3TRE A;  2RI3 A;  4KGX B;  4XTY A;  3SWN B;  4LDY A;  1D09 B;  3VUB A;  3NTI A;  1A0N B;  3CPW A;  1UEC A;  2KY9 A;  2HEQ A;  1NPR A;  2AHJ B;  2DVJ A;  4R0K A;  2ZPB B;  5GAN j;  2K3B A;  5D2F A;  1TSF A;  3G6E A;  2RQU A;  5M9O A;  1K9M C;  2XK0 A;  1U1T A;  2EB4 A;  2OJ2 A;  2E6N A;  1YJN T;  4CC2 A;  1Y57 A;  2AZS A;  1Q81 C;  3EFO B;  2KEA A;  2L2P A;  1VQN T;  3FC3 A;  5DM7 R;  1G2B A;  1I0C A;  2Y90 A;  2FRY A;  1YCS B;  1OUL A;  1V29 B;  3G4S A;  4QVZ A;  1IRE B;  2EGE A;  2O9S A;  1ZBJ A;  5GAN 2;  2ABL A;  3INZ A;  4OVA A;  1ZUY A;  4LDW A;  3M0R A;  1IRX A;  3BFM A;  4XTZ A;  4KUI A;  1UGS B;  1S72 T;  1CSK A;  4L5G A;  1Q95 G;  2QDL A;  5FWB A;  2EB5 A;  1ZHI A;  1WA7 A;  1VQ5 T;  3DB3 A;  1ZSZ A;  3OS2 A;  3VYG A;  4Z89 A;  4QQG A;  1M8M A;  2O88 A;  1I7O A;  4RG8 A;  1OPL A;  3V7R A;  2QA4 T;  4ZTF A;  2RPN A;  1VQO Q;  4XK8 E;  3SB2 A;  2K7A A;  4C92 B;  4OGE A;  1UE9 A;  4ZTJ A;  3OS1 A;  3H0H A;  2K9G A;  2P0K A;  3HKS A;  1K76 A;  5HK0 A;  2HNI A;  1RI0 A;  3NTK A;  2EBP A;  2DPP B;  1K0X A;  4Y28 E;  2X51 A;  4BDZ A;  1VQ9 T;  1SRM A;  4E7H A;  4ESR A;  2XMF A;  2NYS A;  2KRO A;  3R6N A;  4KUD K;  2E3I A;  5GAO n;  5LJ3 j;  4Z02 A;  5J39 A;  3HRT A;  4JLI A;  1XTD A;  4LDX A;  3S52 A;  4J8O A;  2W0Z A;  5D2K A;  1UB4 A;  5GAN e;  2LCC A;  2HSE B;  2NUZ A;  1M1K R;  3MHX A;  1QCO A;  1EZZ B;  1AZE A;  3OSV A;  1VQ8 Q;  2LDM A;  1HYO A;  1GFC A;  1WGS A;  3G6E T;  3CC2 A;  4JJN K;  4AMC A;  1C6V X;  2DIQ A;  5GAN h;  2RI2 A;  5FU6 B;  4LDV A;  4C0D C;  4PJO B;  3JCM W;  2R57 A;  3LLR A;  4DA4 A;  3CC7 Q;  4JZ4 A;  4BD3 A;  2X9H A;  2L3Q A;  1D3B B;  3VS0 A;  5GAN g;  4JRK A;  1RAC B;  2K79 A;  4FW1 A;  4M75 E;  4XTU A;  4ELZ C;  2DJQ A;  4FCY A;  1HK9 A;  4R55 A;  3Q1J A;  1UFF A;  2DXU A;  3E9G A;  4MZT A;  2FRW A;  1I07 A;  1IGQ A;  2DER A;  1ACM B;  4B9W A;  4LNP A;  4C0Z A;  1WHK A;  2KBT A;  1K73 U;  3A8M B;  4OB2 B;  3HSB A;  3O8V A;  3A98 A;  2VKN A;  3VKI A;  3OYF A;  5GMK j;  3TSZ A;  3CCM Q;  3L2Q A;  3MKD A;  4OB3 B;  3RR6 A;  1NYF A;  4LD9 K;  2EJF A;  5AT1 B;  3JAM E;  2DXB A;  1IZ6 A;  4OMO A;  2ZPF B;  1YJ9 Q;  3PNW C;  1KIK A;  3PE0 A;  4JRI A;  2ZZD A;  1H64 1;  2LVM A;  3CCV A;  2QGG A;  4GY5 A;  4BY6 B;  2LRQ A;  5LJ3 e;  2CT4 A;  1NEB A;  2KR3 A;  3BW1 A;  3CCR Q;  4F7U A;  3O5Z A;  1EX4 A;  3CD6 Q;  4M77 B;  2CZ0 B;  1QMC A;  2LX7 A;  1Y7X A;  5LJ3 h;  4NL3 A;  2Q1A X;  5CKE A;  2M0Y A;  1YFN A;  3M5A A;  3BDU A;  2EYY A;  4KH1 B;  4WCI A;  1P92 A;  3RUX A;  1RLP C;  3OMC A;  1N8R U;  4BI4 A;  2XDD A;  3CC2 T;  5LJ3 g;  1GBQ A;  1BU1 A;  4RCC A;  2D1X A;  2EKH A;  4KBM B;  4GLK A;  4C0G A;  2Q1C X;  5IAY A;  2YUN A;  2M0O A;  4DBF A;  1T3S A;  3V77 A;  2MI6 A;  3CCL Q;  4M75 D;  2K5F A;  2FYK A;  3G7Z A;  1SG5 A;  3BE3 A;  1W2B A;  3CCU Q;  4FT4 A;  5CKB A;  2JS2 A;  4JLG A;  1ZSG A;  2A3L A;  2L8D A;  2OAU A;  3JB9 H;  4M77 F;  5IN1 A;  5GAM f;  2ROL A;  2DLP A;  1WFW A;  2DTI A;  4E7L A;  1KC8 R;  4B6M A;  2EGA A;  4O5V A;  5FU7 C;  2Z0W A;  4RTX A;  1VQ7 A;  2K2M A;  2XKO C;  3M0P A;  2GTO A;  5GMK e;  3QWX X;  2XDP A;  1V1C A;  1JQQ A;  2VC8 A;  2E3H A;  4EMH A;  5GMK h;  2QI2 A;  3J80 E;  3OBW A;  1JJ2 A;  1AVZ C;  2E10 A;  1OV3 A;  1Y0M A;  1X2Q A;  4PJN A;  1O75 A;  1RAD B;  3QBY A;  4TVR A;  2NUT B;  5KYU B;  5KYY B;  2EFI A;  2YLB A;  3H41 A;  1WHH A;  5KYW A;  3X26 B;  2GFA A;  1X69 A;  2JTM A;  1M1K U;  3CCV T;  4NOY A;  1OX9 A;  1AD5 A;  2BIV A;  2YRD A;  1H3Z A;  3A8L B;  4L6V 5;  2B8A A;  3CD6 A;  2K6D A;  3OMG A;  3CC4 Q;  2KDS A;  3PMI A;  2F2V A;  2E64 A;  1R0B G;  1BIB A;  4AT1 B;  1KD1 U;  4YTL A;  1PRL C;  3UA7 A;  2ROT A;  1K8A U;  1SHF A;  2M51 A;  1XQH A;  3M0T A;  3GLX A;  2Q19 X;  1SAW A;  3OA6 A;  3JB9 G;  5J3B A;  1Q7Y R;  1ZLM A;  1YIJ Q;  2QYZ A;  4V2S A;  3OS5 A;  2DIG A;  1TG0 A;  4ZGJ B;  2A0F B;  2CS7 A;  5CKD A;  3REA B;  1WHJ A;  4HA8 A;  3C95 A;  3G1J A;  4AFS C;  3E1S A;  1VQ6 T;  8AT1 B;  2C06 A;  1NZ9 A;  1SV6 A;  3RIR A;  1MND A;  4C8Q A;  1K73 C;  4M78 C;  1VOM A;  5AYF A;  5IXB A;  2XI9 A;  3FRN A;  3M57 A;  3PIP A;  2DAQ A;  1VQ7 T;  4C8Q C;  1XJW B;  3L2W A;  1SRL A;  4XAX B;  4M7D E;  2DE0 X;  4P5N A;  1NBE B;  3JCM V;  5CKH A;  2QAS A;  1KQS P;  4PFZ A;  1UHC A;  3EGX B;  3HTR A;  4MAQ A;  3PFS A;  4E6R A;  1RL2 A;  1OI1 A;  2E12 A;  4EIK A;  1M3A A;  3KBG A;  1Z9Z A;  3NTH A;  1NLO C;  3CME Q;  1B7T A;  1WJQ A;  3T9N A;  2IG0 A;  2P0Q A;  1D1B A;  2L89 A;  3JCM X;  4RTW A;  4DQ2 A;  2FZK B;  4RG2 A;  5GAO m;  5FRN A;  3CC4 A;  1X75 C;  1QW1 A;  2J6K A;  3CD6 T;  2V26 A;  2OI3 A;  1YJW T;  3QKJ A;  4II1 A;  2LNV A;  2H3J A;  4HCK A;  4M7A E;  3CBP A;  3LWI A;  3JRZ A;  2HQE A;  3NFC A;  1U8R A;  4IUU A;  4BB7 A;  2QK0 A;  2CYZ B;  4JRQ A;  1YIJ A;  4CC7 A;  2CP3 A;  1X01 A;  3UAT A;  3RDV A;  1QCN A;  4E7I A;  2KMT A;  2MOX A;  4M78 G;  2DO3 A;  4GBQ A;  3A1P A;  1M90 C;  1I4K 1;  2KQW A;  1SHG A;  2E41 A;  4LDU A;  4M75 C;  1YIT A;  1QWF A;  2HDA A;  4C5I A;  2O4X A;  1G3T A;  3EHR A;  5I2M A;  2LP5 A;  3SFM A;  4D6W A;  2LTO A;  1NJI U;  1VIE A;  1UTI A;  4RTT A;  2VVK A;  2NUP A;  4BI8 B;  2QXF A;  3QG1 A;  1BCM A;  2RHU A;  4X34 A;  5DY9 A;  4E7K A;  1Q86 U;  4PJJ A;  3VS2 A;  4CI0 C;  4A53 A;  2CP2 A;  4DOW A;  4M7D D;  1ZSZ B;  3RMQ A;  2LX9 A;  4EDU A;  1MMA A;  2COZ A;  4QKU A;  2FZG B;  1AWO A;  4EPC A;  1D0Z A;  2FEI A;  1IO6 A;  2A28 A;  3A8H B;  5FWC A;  4OMF B;  1OZ2 A;  1KQS S;  2CP5 A;  3CME A;  3FIF A;  1WX6 A;  4J7I A;  4IUT A;  1M8V A;  2EQI A;  3OYB A;  4C92 E;  3C12 A;  5KYN A;  2YUQ A;  3S3N A;  4XU3 A;  1LOJ A;  1MV0 B;  1OQK A;  2DL4 A;  3CC4 T;  4PJL A;  1Q82 C;  5GAN 5;  3OB9 A;  4M75 G;  2ZAE A;  4M7A D;  2EJG A;  3G71 T;  5CK9 A;  1WQW A;  1PWT A;  5EC7 A;  3OYC A;  2V8I A;  1O9S A;  1YIJ T;  2D8J A;  3I9Q A;  1QLY A;  2LT1 A;  2WQT A;  1XOV A;  2JMA A;  4A4E A;  1AEY A;  4LD6 A;  2DM1 A;  3HRU A;  1YIT T;  2AIR B;  4LUE A;  4PJO E;  2ECZ A;  1M2V A;  2X3X D;  1RAH B;  4F14 A;  2ZCF B;  3E9F A;  4B9X A;  5GMK i;  1N9S A;  1MHN A;  3VU3 C;  1UG1 A;  4PFP A;  2DX1 A;  5HCK A;  2EYQ A;  2M16 A;  1TWB A;  4Z8A A;  2JVV A;  2MK5 A;  3UA6 A;  4D8D A;  2DTO A;  1D0Y A;  2WSE E;  1G8X A;  2DET A;  3RBB B;  2LT4 A;  2HKN A;  1IHV A;  1RI9 A;  5GJV B;  1WI7 A;  4OGC A;  4IUQ A;  1GCP A;  5D2G A;  3M55 A;  4KGZ B;  1UDL A;  2EJ9 A; 
#chains in the Genus database with same CATH homology
 1SAW A;  2EB5 A;  4QKU A;  2Q1D X;  2WQT A;  1QCN A;  1HYO A;  1QQJ A;  1SV6 A;  2HZY A;  5D2F A;  3LZK A;  4PFZ A;  1I7O A;  1WZO A;  4MAQ A;  3QDF A;  5D2H A;  1GTT A;  3RR6 A;  2Q1C X;  2DFU A;  5D2I A;  2EB4 A;  4DBF A;  3V77 A;  2EB6 A;  3S52 A;  5D2J A;  5D2K A;  4DBH A;  3R6O A;  5D2G A;  2Q1A X;  3BQB A;  1NR9 A;  2Q18 X;  1NKQ A;  1QCO A;  2Q19 X; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...