1X03A

Crystal structure of endophilin bar domain
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
222
structure length
210
Chain Sequence
b'GTKLDDDFKEMERKVDVTSRAVMEIMTKTIEYLQPNPASRAKLSMIPGYPQAEALLAEAMLKFGRELGDDCNFGPALGEVGEAMRELSEVKDSLDIEVKQNFIDPLQNLHDKDLREIQHHLKKLEGRRLDFDYKKKRQGKIPDEELRQALEKFDESKEIAESSMFNLLEMDIEQVSQLSALVQAQLEYHKQAVQILQQVTVRLEERIRQA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SH3-containing GRB2-like protein 2
publication title Endophilin BAR domain drives membrane curvature by two newly identified structure-based mechanisms
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 79
structure length 210
sequence length 222
ec nomenclature ec 2.3.1.-:
pdb deposition date 2005-03-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03114 BAR BAR domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1270.60 Mainly Alpha Up-down Bundle Substrate Binding Domain Of Dnak; Chain:A; Domain 2 Arfaptin homology (AH) domain/BAR domain 1x03A00
2D1LA 3QNIA 2Z0VA 2X3XA 1URUA 2C08A 1I4LA 4FZSA 1X03A 4AVMA 1ZWWA 4DYLA 1X04A 3G9GA 2X3WA 4WPCA 2D4CA 4AKVA 2ELBA 2FICA 1I4DA 4H8SA 4DCNC 2X3VA 3Q0KA 2Q12A 2EFLA 2Z0OA 4I1QA 3HAJA 2Z0NA 4BNEA 4ATMA 1I4TA 2RAJA 2Q13A 3DYTA 3PLTA 1I49A 1Y2OA 3OK8A 3Q84A 5C5BB 3HAIA 2EFKA 2V0OA 2RAIA 2YKTA 3M3WA 4NQIA 3SOGA 3ABHA 1WDZA 2RAKA 3QE6A 4NSWA 3SYVA 3I2WA 4WPEA 3ACOA 3LLLA 3QWEA 3CAZA 3HAHA 5C5BA
chains in the Genus database with same CATH superfamily
2OBLA 4I1QA 1YWMA 3HAJA 3DX4A 3PLTA 3B52X 2EX3B 1E9VA 2FYVA 1UPXA 3L3OM 2Z8YA 3QE6A 2RT6A 4UDXX 1TQWA 2ALWA 4IWOA 3C7NA 3D50A 1URUA 4FM3A 3ERCC 3BUDA 3BLBA 2X5CA 2EFLA 3BVWA 3O3OB 3ER9B 4FZPA 3CV5A 2PY6A 4R5JA 1OAOA 3D51A 3DX3A 5TKYA 3FD9A 4IWQA 4NQIA 3LVTA 1GNTA 1WDZA 2F1AA 3EJQA 5KBPA 5E84A 1R34A 3ER8C 4F00A 2Z0VA 4EZRA 1SU7A 4H6HA 4JL9A 4EZTA 2X3VA 4AZ5A 4HR1B 3L3PA 3OWGA 3ABHA 3RV0A 2PMRA 4NSWA 4UDYX 1MJGA 4EZZA 3DPPA 2YL5A 4AZBA 1O7DB 3BVVA 3DPOA 1I4TA 3BUBA 5C5BB 3HAIA 2RAIA 3M3WA 4AZ6A 4JWDA 3EJTA 4IM0A 3D4ZA 3F7WA 2YL6A 2ZXQA 3D52A 4JN4A 3T46A 4IM2A 1DKZA 4AZCA 3LMFA 3DDFA 3T48A 4AZIA 4NPHA 4JWIA 3KAVA 4R5IA 2OW7A 4FZSA 3G9GA 3DX2A 4IWPA 2YLLA 1OA1A 2OZNB 3OHXM 3Q84A 4AZHA 4M0MA 4HY9A 3I04A 1O7DC 3SOGA 1OA0A 4IM3A 2GF4A 4EZQA 3O3MB 2GA9D 2F18A 4AZ7A 1E1DA 2LXYA 2OW6A 3BVUA 3QNIA 5FIGA 4JWEA 2YLAA 2F7RA 1QX1A 1U00A 2FICA 4AKVA 3Q0KA 3VEAA 2JNSA 2QXLA 2YL8A 3I39X 2YIBA 2F7OA 2GAFD 4WPEA 2KHOA 3ACOA 4JNEA 3DX0A 4EZOA 1ZWWA 1TQSA 2N3KA 4DCNC 1GN9A 2EWFA 1HXKA 2Z0NA 1Y2OA 2OO2A 3BUPA 3BVXA 3BVTA 3SYVA 1GNLA 3VEBA 3LLLA 4EZWA 3KDRA 1E2UA 3KAWA 2C08A 1X03A 2D4CA 3OK8A 2YI9A 3D2EA 3I01A 1TQVA 4JLCA 4B9QA 2WYHA 4EZSA 2F7QA 4PO2A 1QWUA 3CZSA 4R5KA 3RV1A 3DDGA 4FZOA 2Z0OA 4F01A 2YIAA 4D8JA 2O0I1 4H6IA 4EZXA 3T4AG 1PS3A 3UITA 3A98A 2OBMA 3I2WA 3B53X 4KIKA 2WINM 2QFFA 1LQ7A 3QWEA 4G6QA 3QNJA 3CAZA 1R33A 2D1LA 2LM0A 3BUIA 4AZCB 3QA8A 3T49A 3EJRA 4KIKB 3D2FA 4ATMA 2RAJA 1TQTA 3DYTA 2F7PA 3O3NB 2YKTA 3EJUA 4HYBA 1W9MA 3T47A 2ND0A 2JNKA 1SU6A 2NCZA 4R5GA 4AVMA 1SU8A 2ELBA 1I4DA 4EZVA 2YIVX 1I49A 1JQKA 4E81A 1SUFA 3CVRA 2X3XA 1I4LA 3B51X 4AZGA 1X04A 1HWWA 4H8SA 4EZPA 3EJPA 3CKDA 2EFKA 3EJSA 4E3CA 3VKHA 3D4YA 4HR1A 4EZUA 2MI7A 4JWCA 2F1BA 4JNFA 5FLEX 2X3WA 1QWNA 2YL9A 2YI8A 4EZNA 4R5LA 2ND1A 3RPMA 2WYIA 3GI7A 1TQUA 1ZYLA 5C5BA 2QKWA 4DYLA 3DPQA 1DKYA 4IW0A 4WPCA 4EZYA 3ZEDA 1HTYA 2Q12A 3CZNA 4BNEA 3DX1A 2Q13A 1R5EA 3BUQA 2V0OA 1DKXA 2RAKA 3HAHA
chains in the Genus database with same CATH topology
2D1LA 3QNIA 2Z0VA 2X3XA 1URUA 2C08A 1I4LA 4FZSA 1X03A 4AVMA 1ZWWA 4DYLA 1X04A 3G9GA 2X3WA 4WPCA 2D4CA 4AKVA 2ELBA 2FICA 1I4DA 4H8SA 4DCNC 2X3VA 3Q0KA 2Q12A 2EFLA 2Z0OA 4I1QA 3HAJA 2Z0NA 4BNEA 4ATMA 1I4TA 2RAJA 2Q13A 3DYTA 3PLTA 1I49A 1Y2OA 3OK8A 3Q84A 5C5BB 3HAIA 2EFKA 2V0OA 2RAIA 2YKTA 3M3WA 4NQIA 3SOGA 3ABHA 1WDZA 2RAKA 3QE6A 4NSWA 3SYVA 3I2WA 4WPEA 3ACOA 3LLLA 3QWEA 3CAZA 3HAHA 5C5BA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2D1L A;  3QNI A;  2Z0V A;  2X3X A;  1URU A;  2C08 A;  1I4L A;  4FZS A;  1X03 A;  4AVM A;  1ZWW A;  4DYL A;  1X04 A;  3G9G A;  2X3W A;  4WPC A;  2D4C A;  4AKV A;  2ELB A;  2FIC A;  1I4D A;  4H8S A;  4DCN C;  2X3V A;  3Q0K A;  2Q12 A;  2EFL A;  2Z0O A;  4I1Q A;  3HAJ A;  2Z0N A;  4BNE A;  4ATM A;  1I4T A;  2RAJ A;  2Q13 A;  3DYT A;  3PLT A;  1I49 A;  1Y2O A;  3OK8 A;  3Q84 A;  5C5B B;  3HAI A;  2EFK A;  2V0O A;  2RAI A;  2YKT A;  3M3W A;  4NQI A;  3SOG A;  3ABH A;  1WDZ A;  2RAK A;  3QE6 A;  4NSW A;  3SYV A;  3I2W A;  4WPE A;  3ACO A;  3LLL A;  3QWE A;  3CAZ A;  3HAH A;  5C5B A; 
#chains in the Genus database with same CATH topology
 2OBL A;  4I1Q A;  1YWM A;  3HAJ A;  3DX4 A;  3PLT A;  3B52 X;  2EX3 B;  1E9V A;  2FYV A;  1UPX A;  3L3O M;  2Z8Y A;  3QE6 A;  2RT6 A;  4UDX X;  1TQW A;  2ALW A;  4IWO A;  3C7N A;  3D50 A;  1URU A;  4FM3 A;  3ERC C;  3BUD A;  3BLB A;  2X5C A;  2EFL A;  3BVW A;  3O3O B;  3ER9 B;  4FZP A;  3CV5 A;  2PY6 A;  4R5J A;  1OAO A;  3D51 A;  3DX3 A;  5TKY A;  3FD9 A;  4IWQ A;  4NQI A;  3LVT A;  1GNT A;  1WDZ A;  2F1A A;  3EJQ A;  5KBP A;  5E84 A;  1R34 A;  3ER8 C;  4F00 A;  2Z0V A;  4EZR A;  1SU7 A;  4H6H A;  4JL9 A;  4EZT A;  2X3V A;  4AZ5 A;  4HR1 B;  3L3P A;  3OWG A;  3ABH A;  3RV0 A;  2PMR A;  4NSW A;  4UDY X;  1MJG A;  4EZZ A;  3DPP A;  2YL5 A;  4AZB A;  1O7D B;  3BVV A;  3DPO A;  1I4T A;  3BUB A;  5C5B B;  3HAI A;  2RAI A;  3M3W A;  4AZ6 A;  4JWD A;  3EJT A;  4IM0 A;  3D4Z A;  3F7W A;  2YL6 A;  2ZXQ A;  3D52 A;  4JN4 A;  3T46 A;  4IM2 A;  1DKZ A;  4AZC A;  3LMF A;  3DDF A;  3T48 A;  4AZI A;  4NPH A;  4JWI A;  3KAV A;  4R5I A;  2OW7 A;  4FZS A;  3G9G A;  3DX2 A;  4IWP A;  2YLL A;  1OA1 A;  2OZN B;  3OHX M;  3Q84 A;  4AZH A;  4M0M A;  4HY9 A;  3I04 A;  1O7D C;  3SOG A;  1OA0 A;  4IM3 A;  2GF4 A;  4EZQ A;  3O3M B;  2GA9 D;  2F18 A;  4AZ7 A;  1E1D A;  2LXY A;  2OW6 A;  3BVU A;  3QNI A;  5FIG A;  4JWE A;  2YLA A;  2F7R A;  1QX1 A;  1U00 A;  2FIC A;  4AKV A;  3Q0K A;  3VEA A;  2JNS A;  2QXL A;  2YL8 A;  3I39 X;  2YIB A;  2F7O A;  2GAF D;  4WPE A;  2KHO A;  3ACO A;  4JNE A;  3DX0 A;  4EZO A;  1ZWW A;  1TQS A;  2N3K A;  4DCN C;  1GN9 A;  2EWF A;  1HXK A;  2Z0N A;  1Y2O A;  2OO2 A;  3BUP A;  3BVX A;  3BVT A;  3SYV A;  1GNL A;  3VEB A;  3LLL A;  4EZW A;  3KDR A;  1E2U A;  3KAW A;  2C08 A;  1X03 A;  2D4C A;  3OK8 A;  2YI9 A;  3D2E A;  3I01 A;  1TQV A;  4JLC A;  4B9Q A;  2WYH A;  4EZS A;  2F7Q A;  4PO2 A;  1QWU A;  3CZS A;  4R5K A;  3RV1 A;  3DDG A;  4FZO A;  2Z0O A;  4F01 A;  2YIA A;  4D8J A;  2O0I 1;  4H6I A;  4EZX A;  3T4A G;  1PS3 A;  3UIT A;  3A98 A;  2OBM A;  3I2W A;  3B53 X;  4KIK A;  2WIN M;  2QFF A;  1LQ7 A;  3QWE A;  4G6Q A;  3QNJ A;  3CAZ A;  1R33 A;  2D1L A;  2LM0 A;  3BUI A;  4AZC B;  3QA8 A;  3T49 A;  3EJR A;  4KIK B;  3D2F A;  4ATM A;  2RAJ A;  1TQT A;  3DYT A;  2F7P A;  3O3N B;  2YKT A;  3EJU A;  4HYB A;  1W9M A;  3T47 A;  2ND0 A;  2JNK A;  1SU6 A;  2NCZ A;  4R5G A;  4AVM A;  1SU8 A;  2ELB A;  1I4D A;  4EZV A;  2YIV X;  1I49 A;  1JQK A;  4E81 A;  1SUF A;  3CVR A;  2X3X A;  1I4L A;  3B51 X;  4AZG A;  1X04 A;  1HWW A;  4H8S A;  4EZP A;  3EJP A;  3CKD A;  2EFK A;  3EJS A;  4E3C A;  3VKH A;  3D4Y A;  4HR1 A;  4EZU A;  2MI7 A;  4JWC A;  2F1B A;  4JNF A;  5FLE X;  2X3W A;  1QWN A;  2YL9 A;  2YI8 A;  4EZN A;  4R5L A;  2ND1 A;  3RPM A;  2WYI A;  3GI7 A;  1TQU A;  1ZYL A;  5C5B A;  2QKW A;  4DYL A;  3DPQ A;  1DKY A;  4IW0 A;  4WPC A;  4EZY A;  3ZED A;  1HTY A;  2Q12 A;  3CZN A;  4BNE A;  3DX1 A;  2Q13 A;  1R5E A;  3BUQ A;  2V0O A;  1DKX A;  2RAK A;  3HAH A; 
#chains in the Genus database with same CATH homology
 2D1L A;  3QNI A;  2Z0V A;  2X3X A;  1URU A;  2C08 A;  1I4L A;  4FZS A;  1X03 A;  4AVM A;  1ZWW A;  4DYL A;  1X04 A;  3G9G A;  2X3W A;  4WPC A;  2D4C A;  4AKV A;  2ELB A;  2FIC A;  1I4D A;  4H8S A;  4DCN C;  2X3V A;  3Q0K A;  2Q12 A;  2EFL A;  2Z0O A;  4I1Q A;  3HAJ A;  2Z0N A;  4BNE A;  4ATM A;  1I4T A;  2RAJ A;  2Q13 A;  3DYT A;  3PLT A;  1I49 A;  1Y2O A;  3OK8 A;  3Q84 A;  5C5B B;  3HAI A;  2EFK A;  2V0O A;  2RAI A;  2YKT A;  3M3W A;  4NQI A;  3SOG A;  3ABH A;  1WDZ A;  2RAK A;  3QE6 A;  4NSW A;  3SYV A;  3I2W A;  4WPE A;  3ACO A;  3LLL A;  3QWE A;  3CAZ A;  3HAH A;  5C5B A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...