1X03A

Crystal structure of endophilin bar domain
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
222
structure length
210
Chain Sequence
GTKLDDDFKEMERKVDVTSRAVMEIMTKTIEYLQPNPASRAKLSMIPGYPQAEALLAEAMLKFGRELGDDCNFGPALGEVGEAMRELSEVKDSLDIEVKQNFIDPLQNLHDKDLREIQHHLKKLEGRRLDFDYKKKRQGKIPDEELRQALEKFDESKEIAESSMFNLLEMDIEQVSQLSALVQAQLEYHKQAVQILQQVTVRLEERIRQA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Endophilin BAR domain drives membrane curvature by two newly identified structure-based mechanisms
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords SH3-containing GRB2-like protein 2
total genus 79
structure length 210
sequence length 222
ec nomenclature ec 2.3.1.-:
pdb deposition date 2005-03-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03114 BAR BAR domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1270.60 Mainly Alpha Up-down Bundle Substrate Binding Domain Of Dnak; Chain:A; Domain 2 Arfaptin homology (AH) domain/BAR domain 1x03A00
3OK8A 3HAJA 2RAKA 4WPCA 1X04A 2ELBA 2RAJA 3ACOA 3Q0KA 4DCNC 4I1QA 4DYLA 2RAIA 3ABHA 4ATMA 3SOGA 4WPEA 1I49A 3QE6A 3CAZA 4BNEA 3Q84A 2X3VA 2X3WA 3HAIA 1Y2OA 4NSWA 2Q12A 3M3WA 1ZWWA 2YKTA 2EFKA 3LLLA 3QNIA 3I2WA 5C5BA 2Z0VA 2X3XA 3DYTA 5C5BB 3SYVA 2Z0NA 2Q13A 2Z0OA 2D4CA 4AVMA 3G9GA 2EFLA 4FZSA 4NQIA 1I4DA 1I4LA 4H8SA 2D1LA 1X03A 1I4TA 4AKVA 3PLTA 3HAHA 3QWEA 2V0OA 1WDZA 2FICA 2C08A 1URUA
chains in the Genus database with same CATH superfamily
1ZYLA 2RAKA 2RAJA 4IWPA 4I1QA 2RAIA 2YL8A 3EJTA 4WPEA 4AZCB 3QE6A 3CAZA 1O7DB 4FM3A 4BNEA 4EZPA 3DPQA 4IM3A 2OBLA 1R33A 4FZPA 4R5JA 5E84A 1Y2OA 2ND0A 3I04A 3T48A 4UDXX 3QNJA 4R5LA 4AZIA 4HYBA 2X5CA 3DDFA 1TQTA 3T46A 3BVTA 3QNIA 4EZRA 3ER9B 4AZBA 3D50A 2X3XA 2PMRA 4JL9A 4R5IA 4EZTA 2Z8YA 1E2UA 2NCZA 2YL9A 2YI8A 3D4YA 1DKXA 1MJGA 3BUBA 2YLAA 2F7QA 4JWDA 3EJPA 4EZYA 3FD9A 1SU6A 4NQIA 5FIGA 2F7RA 3BUQA 2D1LA 2FYVA 2YI9A 2OW6A 3O3MB 4HR1A 4R5GA 2LM0A 4AZHA 4UDYX 1SU7A 3B51X 1X04A 2ELBA 3EJQA 3Q0KA 2YLLA 4EZQA 4AZ6A 1HTYA 3ABHA 2ZXQA 3DPOA 1I49A 3BVVA 3VEBA 2N3KA 3D51A 4D8JA 2OBMA 3CVRA 3BUIA 3Q84A 2F18A 3KDRA 4NSWA 4EZSA 3BVUA 4B9QA 3M3WA 1W9MA 2ALWA 1DKYA 2EFKA 2QXLA 3BVXA 3CZSA 3I2WA 3O3NB 3I39X 3OHXM 4G6QA 4EZVA 2YIVX 1GNTA 3DPPA 5C5BB 3UITA 3SYVA 3BUDA 3VEAA 2Z0NA 1QWUA 3VKHA 2GAFD 2Z0OA 4H6IA 1U00A 1UPXA 4JWEA 3OWGA 4JNFA 1I4DA 3LMFA 2PY6A 5FLEX 5KBPA 1TQUA 1R34A 1SU8A 1X03A 3O3OB 3PLTA 4IWOA 4IW0A 3ERCC 1OA0A 2V0OA 3LVTA 3KAVA 2C08A 1URUA 1OA1A 3B52X 3CV5A 1HWWA 1QWNA 2JNKA 2ND1A 3HAJA 3ACOA 3DX2A 3L3OM 3DX4A 4WPCA 4M0MA 4HY9A 2EWFA 2F1AA 2WINM 4EZXA 1E1DA 3D52A 3D2EA 1R5EA 4IM0A 4H6HA 1TQVA 3A98A 3C7NA 2X3VA 2GA9D 2OW7A 3CZNA 1DKZA 2F7PA 4HR1B 3LLLA 2OZNB 4R5KA 4JNEA 4F01A 3RV1A 2Z0VA 4EZWA 1TQWA 3DDGA 4KIKB 4IWQA 2YL5A 2D4CA 2WYHA 2YIBA 1YWMA 2QFFA 3EJRA 3G9GA 4JWCA 4AVMA 4JLCA 4AZ5A 3ER8C 1TQSA 4H8SA 2F7OA 2LXYA 4E3CA 1GNLA 1HXKA 3EJUA 3HAHA 3QWEA 1WDZA 3DX0A 3DYTA 5TKYA 4EZNA 2WYIA 1O7DC 3T49A 4DYLA 4DCNC 2O0I1 3OK8A 4FZOA 1QX1A 4ATMA 4PO2A 3SOGA 3QA8A 1LQ7A 2GF4A 1PS3A 3F7WA 3GI7A 3I01A 4JN4A 2EX3B 3EJSA 4AZCA 3CKDA 4AZGA 2YIAA 2X3WA 3HAIA 1SUFA 2KHOA 1JQKA 2Q12A 3DX3A 4E81A 1ZWWA 2YKTA 3T4AG 2JNSA 5C5BA 3L3PA 4KIKA 2YL6A 4IM2A 3B53X 3BVWA 3BUPA 3D4ZA 4F00A 2Q13A 2F1BA 1E9VA 3RV0A 3ZEDA 2EFLA 4FZSA 4JWIA 2RT6A 4EZZA 1I4LA 3KAWA 4NPHA 3T47A 1GN9A 4EZOA 1I4TA 4AKVA 2OO2A 3DX1A 4AZ7A 4EZUA 3BLBA 2QKWA 3D2FA 1OAOA 2FICA 2MI7A 3RPMA
chains in the Genus database with same CATH topology
3OK8A 3HAJA 2RAKA 4WPCA 1X04A 2ELBA 2RAJA 3ACOA 3Q0KA 4DCNC 4I1QA 4DYLA 2RAIA 3ABHA 4ATMA 3SOGA 4WPEA 1I49A 3QE6A 3CAZA 4BNEA 3Q84A 2X3VA 2X3WA 3HAIA 1Y2OA 4NSWA 2Q12A 3M3WA 1ZWWA 2YKTA 2EFKA 3LLLA 3QNIA 3I2WA 5C5BA 2Z0VA 2X3XA 3DYTA 5C5BB 3SYVA 2Z0NA 2Q13A 2Z0OA 2D4CA 4AVMA 3G9GA 2EFLA 4FZSA 4NQIA 1I4DA 1I4LA 4H8SA 2D1LA 1X03A 1I4TA 4AKVA 3PLTA 3HAHA 3QWEA 2V0OA 1WDZA 2FICA 2C08A 1URUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3OK8 A;  3HAJ A;  2RAK A;  4WPC A;  1X04 A;  2ELB A;  2RAJ A;  3ACO A;  3Q0K A;  4DCN C;  4I1Q A;  4DYL A;  2RAI A;  3ABH A;  4ATM A;  3SOG A;  4WPE A;  1I49 A;  3QE6 A;  3CAZ A;  4BNE A;  3Q84 A;  2X3V A;  2X3W A;  3HAI A;  1Y2O A;  4NSW A;  2Q12 A;  3M3W A;  1ZWW A;  2YKT A;  2EFK A;  3LLL A;  3QNI A;  3I2W A;  5C5B A;  2Z0V A;  2X3X A;  3DYT A;  5C5B B;  3SYV A;  2Z0N A;  2Q13 A;  2Z0O A;  2D4C A;  4AVM A;  3G9G A;  2EFL A;  4FZS A;  4NQI A;  1I4D A;  1I4L A;  4H8S A;  2D1L A;  1X03 A;  1I4T A;  4AKV A;  3PLT A;  3HAH A;  3QWE A;  2V0O A;  1WDZ A;  2FIC A;  2C08 A;  1URU A; 
#chains in the Genus database with same CATH topology
 1ZYL A;  2RAK A;  2RAJ A;  4IWP A;  4I1Q A;  2RAI A;  2YL8 A;  3EJT A;  4WPE A;  4AZC B;  3QE6 A;  3CAZ A;  1O7D B;  4FM3 A;  4BNE A;  4EZP A;  3DPQ A;  4IM3 A;  2OBL A;  1R33 A;  4FZP A;  4R5J A;  5E84 A;  1Y2O A;  2ND0 A;  3I04 A;  3T48 A;  4UDX X;  3QNJ A;  4R5L A;  4AZI A;  4HYB A;  2X5C A;  3DDF A;  1TQT A;  3T46 A;  3BVT A;  3QNI A;  4EZR A;  3ER9 B;  4AZB A;  3D50 A;  2X3X A;  2PMR A;  4JL9 A;  4R5I A;  4EZT A;  2Z8Y A;  1E2U A;  2NCZ A;  2YL9 A;  2YI8 A;  3D4Y A;  1DKX A;  1MJG A;  3BUB A;  2YLA A;  2F7Q A;  4JWD A;  3EJP A;  4EZY A;  3FD9 A;  1SU6 A;  4NQI A;  5FIG A;  2F7R A;  3BUQ A;  2D1L A;  2FYV A;  2YI9 A;  2OW6 A;  3O3M B;  4HR1 A;  4R5G A;  2LM0 A;  4AZH A;  4UDY X;  1SU7 A;  3B51 X;  1X04 A;  2ELB A;  3EJQ A;  3Q0K A;  2YLL A;  4EZQ A;  4AZ6 A;  1HTY A;  3ABH A;  2ZXQ A;  3DPO A;  1I49 A;  3BVV A;  3VEB A;  2N3K A;  3D51 A;  4D8J A;  2OBM A;  3CVR A;  3BUI A;  3Q84 A;  2F18 A;  3KDR A;  4NSW A;  4EZS A;  3BVU A;  4B9Q A;  3M3W A;  1W9M A;  2ALW A;  1DKY A;  2EFK A;  2QXL A;  3BVX A;  3CZS A;  3I2W A;  3O3N B;  3I39 X;  3OHX M;  4G6Q A;  4EZV A;  2YIV X;  1GNT A;  3DPP A;  5C5B B;  3UIT A;  3SYV A;  3BUD A;  3VEA A;  2Z0N A;  1QWU A;  3VKH A;  2GAF D;  2Z0O A;  4H6I A;  1U00 A;  1UPX A;  4JWE A;  3OWG A;  4JNF A;  1I4D A;  3LMF A;  2PY6 A;  5FLE X;  5KBP A;  1TQU A;  1R34 A;  1SU8 A;  1X03 A;  3O3O B;  3PLT A;  4IWO A;  4IW0 A;  3ERC C;  1OA0 A;  2V0O A;  3LVT A;  3KAV A;  2C08 A;  1URU A;  1OA1 A;  3B52 X;  3CV5 A;  1HWW A;  1QWN A;  2JNK A;  2ND1 A;  3HAJ A;  3ACO A;  3DX2 A;  3L3O M;  3DX4 A;  4WPC A;  4M0M A;  4HY9 A;  2EWF A;  2F1A A;  2WIN M;  4EZX A;  1E1D A;  3D52 A;  3D2E A;  1R5E A;  4IM0 A;  4H6H A;  1TQV A;  3A98 A;  3C7N A;  2X3V A;  2GA9 D;  2OW7 A;  3CZN A;  1DKZ A;  2F7P A;  4HR1 B;  3LLL A;  2OZN B;  4R5K A;  4JNE A;  4F01 A;  3RV1 A;  2Z0V A;  4EZW A;  1TQW A;  3DDG A;  4KIK B;  4IWQ A;  2YL5 A;  2D4C A;  2WYH A;  2YIB A;  1YWM A;  2QFF A;  3EJR A;  3G9G A;  4JWC A;  4AVM A;  4JLC A;  4AZ5 A;  3ER8 C;  1TQS A;  4H8S A;  2F7O A;  2LXY A;  4E3C A;  1GNL A;  1HXK A;  3EJU A;  3HAH A;  3QWE A;  1WDZ A;  3DX0 A;  3DYT A;  5TKY A;  4EZN A;  2WYI A;  1O7D C;  3T49 A;  4DYL A;  4DCN C;  2O0I 1;  3OK8 A;  4FZO A;  1QX1 A;  4ATM A;  4PO2 A;  3SOG A;  3QA8 A;  1LQ7 A;  2GF4 A;  1PS3 A;  3F7W A;  3GI7 A;  3I01 A;  4JN4 A;  2EX3 B;  3EJS A;  4AZC A;  3CKD A;  4AZG A;  2YIA A;  2X3W A;  3HAI A;  1SUF A;  2KHO A;  1JQK A;  2Q12 A;  3DX3 A;  4E81 A;  1ZWW A;  2YKT A;  3T4A G;  2JNS A;  5C5B A;  3L3P A;  4KIK A;  2YL6 A;  4IM2 A;  3B53 X;  3BVW A;  3BUP A;  3D4Z A;  4F00 A;  2Q13 A;  2F1B A;  1E9V A;  3RV0 A;  3ZED A;  2EFL A;  4FZS A;  4JWI A;  2RT6 A;  4EZZ A;  1I4L A;  3KAW A;  4NPH A;  3T47 A;  1GN9 A;  4EZO A;  1I4T A;  4AKV A;  2OO2 A;  3DX1 A;  4AZ7 A;  4EZU A;  3BLB A;  2QKW A;  3D2F A;  1OAO A;  2FIC A;  2MI7 A;  3RPM A; 
#chains in the Genus database with same CATH homology
 3OK8 A;  3HAJ A;  2RAK A;  4WPC A;  1X04 A;  2ELB A;  2RAJ A;  3ACO A;  3Q0K A;  4DCN C;  4I1Q A;  4DYL A;  2RAI A;  3ABH A;  4ATM A;  3SOG A;  4WPE A;  1I49 A;  3QE6 A;  3CAZ A;  4BNE A;  3Q84 A;  2X3V A;  2X3W A;  3HAI A;  1Y2O A;  4NSW A;  2Q12 A;  3M3W A;  1ZWW A;  2YKT A;  2EFK A;  3LLL A;  3QNI A;  3I2W A;  5C5B A;  2Z0V A;  2X3X A;  3DYT A;  5C5B B;  3SYV A;  2Z0N A;  2Q13 A;  2Z0O A;  2D4C A;  4AVM A;  3G9G A;  2EFL A;  4FZS A;  4NQI A;  1I4D A;  1I4L A;  4H8S A;  2D1L A;  1X03 A;  1I4T A;  4AKV A;  3PLT A;  3HAH A;  3QWE A;  2V0O A;  1WDZ A;  2FIC A;  2C08 A;  1URU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...