1X03A

Crystal structure of endophilin bar domain
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
222
structure length
210
Chain Sequence
GTKLDDDFKEMERKVDVTSRAVMEIMTKTIEYLQPNPASRAKLSMIPGYPQAEALLAEAMLKFGRELGDDCNFGPALGEVGEAMRELSEVKDSLDIEVKQNFIDPLQNLHDKDLREIQHHLKKLEGRRLDFDYKKKRQGKIPDEELRQALEKFDESKEIAESSMFNLLEMDIEQVSQLSALVQAQLEYHKQAVQILQQVTVRLEERIRQA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SH3-containing GRB2-like protein 2
publication title Endophilin BAR domain drives membrane curvature by two newly identified structure-based mechanisms
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 79
structure length 210
sequence length 222
ec nomenclature ec 2.3.1.-:
pdb deposition date 2005-03-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03114 BAR BAR domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1270.60 Mainly Alpha Up-down Bundle Substrate Binding Domain Of Dnak; Chain:A; Domain 2 Arfaptin homology (AH) domain/BAR domain 1x03A00
3QNIA 1WDZA 2FICA 1I49A 3ABHA 3M3WA 3PLTA 3LLLA 1Y2OA 1I4LA 4ATMA 3Q84A 2V0OA 2EFLA 4NQIA 4AVMA 2Q12A 1ZWWA 1I4DA 2X3WA 2X3XA 3HAHA 4WPEA 3SYVA 3I2WA 4H8SA 4BNEA 2RAIA 2RAJA 2X3VA 2Z0OA 1URUA 3ACOA 3HAJA 2Z0VA 3HAIA 3OK8A 2YKTA 4NSWA 3QE6A 2Z0NA 3CAZA 2C08A 2EFKA 4DYLA 3Q0KA 2D4CA 1I4TA 2Q13A 4I1QA 3G9GA 4DCNC 2ELBA 4AKVA 3DYTA 2D1LA 4FZSA 5C5BB 1X03A 1X04A 3QWEA 4WPCA 2RAKA 5C5BA 3SOGA
chains in the Genus database with same CATH superfamily
4EZPA 1R34A 4HR1B 3D2EA 3CZNA 1QX1A 2RAJA 1TQVA 5TKYA 1ZYLA 2NCZA 3ER9B 3EJRA 5FIGA 2F7RA 4R5JA 3L3OM 4KIKA 2YLAA 4HYBA 4IWOA 2F7OA 2LM0A 5KBPA 3DDGA 2D4CA 2Q13A 1TQUA 4I1QA 2ELBA 3ERCC 2GA9D 1E9VA 2F7PA 4EZQA 4AZ7A 2N3KA 3BUQA 4D8JA 2OO2A 3HAIA 2MI7A 3ZEDA 1U00A 2OBLA 3I39X 1HTYA 3T46A 3EJPA 3DPPA 2YL6A 2V0OA 1OA0A 3HAHA 2X5CA 3SYVA 2WYHA 1URUA 4AZ6A 4JWDA 4G6QA 4B9QA 3DDFA 2WYIA 3T4AG 2O0I1 3RV1A 3T49A 2YI8A 4IM3A 4FZOA 3M3WA 4AZHA 2PMRA 1I4LA 1QWNA 2OW7A 3BVTA 1O7DB 2YI9A 3O3OB 3EJSA 2X3XA 4NPHA 3Q0KA 3BVUA 1R33A 4R5KA 2JNSA 1TQTA 3QNIA 1GN9A 2RT6A 4PO2A 2Q12A 1I4DA 1SU7A 4E3CA 2ND0A 3BVWA 3QE6A 1YWMA 3BVXA 1PS3A 5FLEX 1SUFA 1JQKA 2FICA 1I49A 3BLBA 2X3VA 2Z0VA 3GI7A 3CAZA 3QNJA 4AZBA 2YIAA 3BUDA 3B51X 2YLLA 4AKVA 3C7NA 3D51A 3B52X 3BUPA 3DPOA 4JWIA 3L3PA 3VEAA 3RPMA 4FM3A 3PLTA 3EJUA 4HR1A 4NQIA 4JL9A 4M0MA 3I2WA 4F01A 1W9MA 4DYLA 3QA8A 1HXKA 4EZWA 1LQ7A 2OZNB 1DKZA 3CVRA 4EZZA 4IM2A 2EFLA 3DX2A 2JNKA 4BNEA 1MJGA 2Z0OA 2WINM 2KHOA 4EZYA 4JNEA 4DCNC 4FZPA 4AZ5A 5C5BB 1SU6A 1WDZA 2OW6A 3ABHA 3D4ZA 1Y2OA 4H8SA 3ACOA 2QXLA 3OWGA 2YIBA 3DYTA 3QWEA 4WPCA 4IWQA 2ALWA 3SOGA 1R5EA 4EZRA 4KIKB 3O3MB 3DPQA 4NSWA 2EX3B 3I04A 3DX3A 3D2FA 4EZVA 1HWWA 4AZGA 3D4YA 3OHXM 2QFFA 2F1AA 3D50A 3LLLA 1DKYA 3FD9A 4E81A 2YL5A 3VKHA 3EJTA 3BUBA 3KAWA 1TQWA 2EFKA 4IW0A 3LMFA 3A98A 1X04A 2F1BA 4JN4A 2YL9A 4HY9A 4AZCA 3RV0A 4F00A 2LXYA 1QWUA 2F18A 1GNTA 4UDYX 3HAJA 3CV5A 3O3NB 1TQSA 4R5GA 2D1LA 3I01A 4EZTA 4EZNA 4EZUA 4WPEA 3DX0A 3CZSA 2PY6A 3BUIA 4JWEA 4UDXX 3CKDA 3OK8A 4EZOA 3DX1A 4EZXA 3BVVA 4EZSA 2ZXQA 1X03A 3ER8C 3KAVA 1E1DA 1DKXA 1OA1A 3LVTA 1UPXA 2YIVX 4AVMA 2X3WA 2GAFD 2QKWA 2RAIA 4JLCA 1E2UA 2ND1A 2YKTA 4R5LA 2Z0NA 2Z8YA 2C08A 4IM0A 3F7WA 2OBMA 2FYVA 3KDRA 4H6IA 3DX4A 4FZSA 4JNFA 3T48A 1GNLA 1SU8A 2F7QA 4ATMA 3Q84A 1ZWWA 4H6HA 1OAOA 4R5IA 1O7DC 3B53X 3D52A 4AZIA 2EWFA 4JWCA 1I4TA 2GF4A 5E84A 3G9GA 3T47A 2YL8A 3EJQA 4IWPA 3VEBA 3UITA 4AZCB 2RAKA 5C5BA
chains in the Genus database with same CATH topology
3QNIA 1WDZA 2FICA 1I49A 3ABHA 3M3WA 3PLTA 3LLLA 1Y2OA 1I4LA 4ATMA 3Q84A 2V0OA 2EFLA 4NQIA 4AVMA 2Q12A 1ZWWA 1I4DA 2X3WA 2X3XA 3HAHA 4WPEA 3SYVA 3I2WA 4H8SA 4BNEA 2RAIA 2RAJA 2X3VA 2Z0OA 1URUA 3ACOA 3HAJA 2Z0VA 3HAIA 3OK8A 2YKTA 4NSWA 3QE6A 2Z0NA 3CAZA 2C08A 2EFKA 4DYLA 3Q0KA 2D4CA 1I4TA 2Q13A 4I1QA 3G9GA 4DCNC 2ELBA 4AKVA 3DYTA 2D1LA 4FZSA 5C5BB 1X03A 1X04A 3QWEA 4WPCA 2RAKA 5C5BA 3SOGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3QNI A;  1WDZ A;  2FIC A;  1I49 A;  3ABH A;  3M3W A;  3PLT A;  3LLL A;  1Y2O A;  1I4L A;  4ATM A;  3Q84 A;  2V0O A;  2EFL A;  4NQI A;  4AVM A;  2Q12 A;  1ZWW A;  1I4D A;  2X3W A;  2X3X A;  3HAH A;  4WPE A;  3SYV A;  3I2W A;  4H8S A;  4BNE A;  2RAI A;  2RAJ A;  2X3V A;  2Z0O A;  1URU A;  3ACO A;  3HAJ A;  2Z0V A;  3HAI A;  3OK8 A;  2YKT A;  4NSW A;  3QE6 A;  2Z0N A;  3CAZ A;  2C08 A;  2EFK A;  4DYL A;  3Q0K A;  2D4C A;  1I4T A;  2Q13 A;  4I1Q A;  3G9G A;  4DCN C;  2ELB A;  4AKV A;  3DYT A;  2D1L A;  4FZS A;  5C5B B;  1X03 A;  1X04 A;  3QWE A;  4WPC A;  2RAK A;  5C5B A;  3SOG A; 
#chains in the Genus database with same CATH topology
 4EZP A;  1R34 A;  4HR1 B;  3D2E A;  3CZN A;  1QX1 A;  2RAJ A;  1TQV A;  5TKY A;  1ZYL A;  2NCZ A;  3ER9 B;  3EJR A;  5FIG A;  2F7R A;  4R5J A;  3L3O M;  4KIK A;  2YLA A;  4HYB A;  4IWO A;  2F7O A;  2LM0 A;  5KBP A;  3DDG A;  2D4C A;  2Q13 A;  1TQU A;  4I1Q A;  2ELB A;  3ERC C;  2GA9 D;  1E9V A;  2F7P A;  4EZQ A;  4AZ7 A;  2N3K A;  3BUQ A;  4D8J A;  2OO2 A;  3HAI A;  2MI7 A;  3ZED A;  1U00 A;  2OBL A;  3I39 X;  1HTY A;  3T46 A;  3EJP A;  3DPP A;  2YL6 A;  2V0O A;  1OA0 A;  3HAH A;  2X5C A;  3SYV A;  2WYH A;  1URU A;  4AZ6 A;  4JWD A;  4G6Q A;  4B9Q A;  3DDF A;  2WYI A;  3T4A G;  2O0I 1;  3RV1 A;  3T49 A;  2YI8 A;  4IM3 A;  4FZO A;  3M3W A;  4AZH A;  2PMR A;  1I4L A;  1QWN A;  2OW7 A;  3BVT A;  1O7D B;  2YI9 A;  3O3O B;  3EJS A;  2X3X A;  4NPH A;  3Q0K A;  3BVU A;  1R33 A;  4R5K A;  2JNS A;  1TQT A;  3QNI A;  1GN9 A;  2RT6 A;  4PO2 A;  2Q12 A;  1I4D A;  1SU7 A;  4E3C A;  2ND0 A;  3BVW A;  3QE6 A;  1YWM A;  3BVX A;  1PS3 A;  5FLE X;  1SUF A;  1JQK A;  2FIC A;  1I49 A;  3BLB A;  2X3V A;  2Z0V A;  3GI7 A;  3CAZ A;  3QNJ A;  4AZB A;  2YIA A;  3BUD A;  3B51 X;  2YLL A;  4AKV A;  3C7N A;  3D51 A;  3B52 X;  3BUP A;  3DPO A;  4JWI A;  3L3P A;  3VEA A;  3RPM A;  4FM3 A;  3PLT A;  3EJU A;  4HR1 A;  4NQI A;  4JL9 A;  4M0M A;  3I2W A;  4F01 A;  1W9M A;  4DYL A;  3QA8 A;  1HXK A;  4EZW A;  1LQ7 A;  2OZN B;  1DKZ A;  3CVR A;  4EZZ A;  4IM2 A;  2EFL A;  3DX2 A;  2JNK A;  4BNE A;  1MJG A;  2Z0O A;  2WIN M;  2KHO A;  4EZY A;  4JNE A;  4DCN C;  4FZP A;  4AZ5 A;  5C5B B;  1SU6 A;  1WDZ A;  2OW6 A;  3ABH A;  3D4Z A;  1Y2O A;  4H8S A;  3ACO A;  2QXL A;  3OWG A;  2YIB A;  3DYT A;  3QWE A;  4WPC A;  4IWQ A;  2ALW A;  3SOG A;  1R5E A;  4EZR A;  4KIK B;  3O3M B;  3DPQ A;  4NSW A;  2EX3 B;  3I04 A;  3DX3 A;  3D2F A;  4EZV A;  1HWW A;  4AZG A;  3D4Y A;  3OHX M;  2QFF A;  2F1A A;  3D50 A;  3LLL A;  1DKY A;  3FD9 A;  4E81 A;  2YL5 A;  3VKH A;  3EJT A;  3BUB A;  3KAW A;  1TQW A;  2EFK A;  4IW0 A;  3LMF A;  3A98 A;  1X04 A;  2F1B A;  4JN4 A;  2YL9 A;  4HY9 A;  4AZC A;  3RV0 A;  4F00 A;  2LXY A;  1QWU A;  2F18 A;  1GNT A;  4UDY X;  3HAJ A;  3CV5 A;  3O3N B;  1TQS A;  4R5G A;  2D1L A;  3I01 A;  4EZT A;  4EZN A;  4EZU A;  4WPE A;  3DX0 A;  3CZS A;  2PY6 A;  3BUI A;  4JWE A;  4UDX X;  3CKD A;  3OK8 A;  4EZO A;  3DX1 A;  4EZX A;  3BVV A;  4EZS A;  2ZXQ A;  1X03 A;  3ER8 C;  3KAV A;  1E1D A;  1DKX A;  1OA1 A;  3LVT A;  1UPX A;  2YIV X;  4AVM A;  2X3W A;  2GAF D;  2QKW A;  2RAI A;  4JLC A;  1E2U A;  2ND1 A;  2YKT A;  4R5L A;  2Z0N A;  2Z8Y A;  2C08 A;  4IM0 A;  3F7W A;  2OBM A;  2FYV A;  3KDR A;  4H6I A;  3DX4 A;  4FZS A;  4JNF A;  3T48 A;  1GNL A;  1SU8 A;  2F7Q A;  4ATM A;  3Q84 A;  1ZWW A;  4H6H A;  1OAO A;  4R5I A;  1O7D C;  3B53 X;  3D52 A;  4AZI A;  2EWF A;  4JWC A;  1I4T A;  2GF4 A;  5E84 A;  3G9G A;  3T47 A;  2YL8 A;  3EJQ A;  4IWP A;  3VEB A;  3UIT A;  4AZC B;  2RAK A;  5C5B A; 
#chains in the Genus database with same CATH homology
 3QNI A;  1WDZ A;  2FIC A;  1I49 A;  3ABH A;  3M3W A;  3PLT A;  3LLL A;  1Y2O A;  1I4L A;  4ATM A;  3Q84 A;  2V0O A;  2EFL A;  4NQI A;  4AVM A;  2Q12 A;  1ZWW A;  1I4D A;  2X3W A;  2X3X A;  3HAH A;  4WPE A;  3SYV A;  3I2W A;  4H8S A;  4BNE A;  2RAI A;  2RAJ A;  2X3V A;  2Z0O A;  1URU A;  3ACO A;  3HAJ A;  2Z0V A;  3HAI A;  3OK8 A;  2YKT A;  4NSW A;  3QE6 A;  2Z0N A;  3CAZ A;  2C08 A;  2EFK A;  4DYL A;  3Q0K A;  2D4C A;  1I4T A;  2Q13 A;  4I1Q A;  3G9G A;  4DCN C;  2ELB A;  4AKV A;  3DYT A;  2D1L A;  4FZS A;  5C5B B;  1X03 A;  1X04 A;  3QWE A;  4WPC A;  2RAK A;  5C5B A;  3SOG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...