1X03A

Crystal structure of endophilin bar domain
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
222
structure length
210
Chain Sequence
GTKLDDDFKEMERKVDVTSRAVMEIMTKTIEYLQPNPASRAKLSMIPGYPQAEALLAEAMLKFGRELGDDCNFGPALGEVGEAMRELSEVKDSLDIEVKQNFIDPLQNLHDKDLREIQHHLKKLEGRRLDFDYKKKRQGKIPDEELRQALEKFDESKEIAESSMFNLLEMDIEQVSQLSALVQAQLEYHKQAVQILQQVTVRLEERIRQA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SH3-containing GRB2-like protein 2
publication title Endophilin BAR domain drives membrane curvature by two newly identified structure-based mechanisms
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 79
structure length 210
sequence length 222
ec nomenclature ec 2.3.1.-:
pdb deposition date 2005-03-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03114 BAR BAR domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1270.60 Mainly Alpha Up-down Bundle Substrate Binding Domain Of Dnak; Chain:A; Domain 2 Arfaptin homology (AH) domain/BAR domain 1x03A00
2RAKA 1I4DA 2C08A 4DCNC 1I4LA 1ZWWA 3Q0KA 3HAIA 3Q84A 4I1QA 3DYTA 3I2WA 3HAJA 2EFKA 4WPEA 1X04A 5C5BB 2Q12A 4NQIA 4WPCA 2X3VA 2FICA 3HAHA 2D4CA 3LLLA 2Z0OA 1WDZA 4H8SA 3SYVA 2YKTA 2Z0NA 4DYLA 3QE6A 1URUA 2RAJA 2V0OA 3ABHA 4BNEA 2D1LA 4AKVA 2RAIA 4AVMA 3G9GA 3M3WA 4ATMA 1I4TA 2Z0VA 3CAZA 3PLTA 4NSWA 2EFLA 1I49A 2Q13A 3QNIA 3QWEA 2X3XA 1Y2OA 3ACOA 3OK8A 2X3WA 4FZSA 3SOGA 5C5BA 1X03A 2ELBA
chains in the Genus database with same CATH superfamily
3GI7A 2OW6A 1U00A 4JNEA 3L3OM 1W9MA 4BNEA 3ABHA 2LM0A 1YWMA 4NSWA 3PLTA 3DDGA 3DX1A 1DKYA 4E81A 3DDFA 2YL5A 4EZRA 5KBPA 3HAIA 2F1BA 4F01A 4AZ7A 1TQTA 1LQ7A 4AVMA 4ATMA 1GNTA 4JWDA 1E1DA 4R5LA 2YLLA 2F7RA 4EZYA 2YIBA 3DPQA 3O3NB 2KHOA 3BUQA 3KAWA 3B51X 1PS3A 2YIVX 1HWWA 3CV5A 3T49A 4M0MA 4HY9A 4AZCB 3QNIA 5TKYA 2QXLA 2ELBA 3VEAA 1HTYA 3Q0KA 3DX2A 2ALWA 2D4CA 4JL9A 3BUDA 3OWGA 3RPMA 4R5IA 2V0OA 4G6QA 4D8JA 5E84A 3D2EA 1ZYLA 1SUFA 1TQSA 4WPEA 3DPPA 3EJQA 3HAJA 2EFKA 1X04A 4DYLA 2RAJA 2EWFA 1DKZA 4AZIA 2FYVA 1GNLA 1JQKA 2F7PA 5C5BA 3BVTA 3RV0A 4E3CA 4EZXA 2NCZA 5FIGA 1R5EA 3RV1A 4B9QA 1O7DB 3LVTA 2YKTA 3BUPA 4AKVA 2O0I1 2YL9A 1TQUA 3EJPA 3T48A 3ER8C 3VKHA 1SU8A 1OA1A 4HR1B 3QNJA 2OBMA 1SU7A 4NQIA 2PY6A 1QX1A 3BVXA 1I4TA 2ZXQA 3ZEDA 3ER9B 3T4AG 2Q13A 3D2FA 3QA8A 4FZSA 1QWUA 3SOGA 4PO2A 3Q84A 3CKDA 4WPCA 2FICA 3D51A 2Z0OA 3SYVA 2WYHA 3DX3A 1OA0A 3M3WA 3O3OB 2EFLA 5FLEX 3BUBA 3QWEA 1R33A 2JNSA 2GAFD 3D50A 1I4DA 4DCNC 3I2WA 2MI7A 4AZGA 3FD9A 4H6IA 2YIAA 1URUA 3B53X 4R5JA 1HXKA 3G9GA 2ND0A 1MJGA 4UDXX 4IWQA 2X3XA 4FM3A 2RAKA 3D4ZA 1SU6A 3EJRA 2GF4A 3DX4A 1WDZA 3BVWA 4JWIA 2GA9D 4JWCA 4FZPA 4EZPA 4EZZA 3BVVA 2WINM 1GN9A 2PMRA 2Q12A 2X3VA 3HAHA 2Z0NA 3KDRA 1QWNA 2D1LA 4H6HA 4JWEA 2F18A 4AZBA 1O7DC 2X3WA 3O3MB 1TQWA 1E9VA 3I04A 3EJUA 3UITA 3F7WA 4EZVA 2F1AA 4AZCA 3L3PA 2F7QA 4IM3A 3CAZA 4EZUA 1Y2OA 3CZNA 2WYIA 3EJSA 4FZOA 3ERCC 2YL6A 3T46A 4KIKA 3A98A 5C5BB 1UPXA 4R5KA 1TQVA 3LLLA 4EZNA 3KAVA 3D52A 3EJTA 3DX0A 3CVRA 2OO2A 3I39X 2X5CA 3B52X 2EX3B 4IWPA 1I4LA 4JLCA 1ZWWA 2Z8YA 4UDYX 4AZ5A 3QE6A 2JNKA 3BVUA 4R5GA 4IM0A 2Z0VA 3BLBA 4EZSA 4JN4A 4AZHA 3LMFA 2QKWA 4JNFA 2YL8A 1X03A 2C08A 2F7OA 4IM2A 2YLAA 4I1QA 3DYTA 2RT6A 3DPOA 3C7NA 4KIKB 4H8SA 4EZQA 3T47A 1DKXA 4EZTA 4EZOA 2RAIA 4F00A 2YI8A 1R34A 4HYBA 3OK8A 3D4YA 2N3KA 4HR1A 3VEBA 4NPHA 2LXYA 3OHXM 2QFFA 2OW7A 4IWOA 3I01A 2ND1A 2OBLA 4IW0A 1E2UA 2OZNB 3CZSA 4EZWA 1I49A 2YI9A 4AZ6A 3ACOA 1OAOA 3BUIA
chains in the Genus database with same CATH topology
2RAKA 1I4DA 2C08A 4DCNC 1I4LA 1ZWWA 3Q0KA 3HAIA 3Q84A 4I1QA 3DYTA 3I2WA 3HAJA 2EFKA 4WPEA 1X04A 5C5BB 2Q12A 4NQIA 4WPCA 2X3VA 2FICA 3HAHA 2D4CA 3LLLA 2Z0OA 1WDZA 4H8SA 3SYVA 2YKTA 2Z0NA 4DYLA 3QE6A 1URUA 2RAJA 2V0OA 3ABHA 4BNEA 2D1LA 4AKVA 2RAIA 4AVMA 3G9GA 3M3WA 4ATMA 1I4TA 2Z0VA 3CAZA 3PLTA 4NSWA 2EFLA 1I49A 2Q13A 3QNIA 3QWEA 2X3XA 1Y2OA 3ACOA 3OK8A 2X3WA 4FZSA 3SOGA 5C5BA 1X03A 2ELBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2RAK A;  1I4D A;  2C08 A;  4DCN C;  1I4L A;  1ZWW A;  3Q0K A;  3HAI A;  3Q84 A;  4I1Q A;  3DYT A;  3I2W A;  3HAJ A;  2EFK A;  4WPE A;  1X04 A;  5C5B B;  2Q12 A;  4NQI A;  4WPC A;  2X3V A;  2FIC A;  3HAH A;  2D4C A;  3LLL A;  2Z0O A;  1WDZ A;  4H8S A;  3SYV A;  2YKT A;  2Z0N A;  4DYL A;  3QE6 A;  1URU A;  2RAJ A;  2V0O A;  3ABH A;  4BNE A;  2D1L A;  4AKV A;  2RAI A;  4AVM A;  3G9G A;  3M3W A;  4ATM A;  1I4T A;  2Z0V A;  3CAZ A;  3PLT A;  4NSW A;  2EFL A;  1I49 A;  2Q13 A;  3QNI A;  3QWE A;  2X3X A;  1Y2O A;  3ACO A;  3OK8 A;  2X3W A;  4FZS A;  3SOG A;  5C5B A;  1X03 A;  2ELB A; 
#chains in the Genus database with same CATH topology
 3GI7 A;  2OW6 A;  1U00 A;  4JNE A;  3L3O M;  1W9M A;  4BNE A;  3ABH A;  2LM0 A;  1YWM A;  4NSW A;  3PLT A;  3DDG A;  3DX1 A;  1DKY A;  4E81 A;  3DDF A;  2YL5 A;  4EZR A;  5KBP A;  3HAI A;  2F1B A;  4F01 A;  4AZ7 A;  1TQT A;  1LQ7 A;  4AVM A;  4ATM A;  1GNT A;  4JWD A;  1E1D A;  4R5L A;  2YLL A;  2F7R A;  4EZY A;  2YIB A;  3DPQ A;  3O3N B;  2KHO A;  3BUQ A;  3KAW A;  3B51 X;  1PS3 A;  2YIV X;  1HWW A;  3CV5 A;  3T49 A;  4M0M A;  4HY9 A;  4AZC B;  3QNI A;  5TKY A;  2QXL A;  2ELB A;  3VEA A;  1HTY A;  3Q0K A;  3DX2 A;  2ALW A;  2D4C A;  4JL9 A;  3BUD A;  3OWG A;  3RPM A;  4R5I A;  2V0O A;  4G6Q A;  4D8J A;  5E84 A;  3D2E A;  1ZYL A;  1SUF A;  1TQS A;  4WPE A;  3DPP A;  3EJQ A;  3HAJ A;  2EFK A;  1X04 A;  4DYL A;  2RAJ A;  2EWF A;  1DKZ A;  4AZI A;  2FYV A;  1GNL A;  1JQK A;  2F7P A;  5C5B A;  3BVT A;  3RV0 A;  4E3C A;  4EZX A;  2NCZ A;  5FIG A;  1R5E A;  3RV1 A;  4B9Q A;  1O7D B;  3LVT A;  2YKT A;  3BUP A;  4AKV A;  2O0I 1;  2YL9 A;  1TQU A;  3EJP A;  3T48 A;  3ER8 C;  3VKH A;  1SU8 A;  1OA1 A;  4HR1 B;  3QNJ A;  2OBM A;  1SU7 A;  4NQI A;  2PY6 A;  1QX1 A;  3BVX A;  1I4T A;  2ZXQ A;  3ZED A;  3ER9 B;  3T4A G;  2Q13 A;  3D2F A;  3QA8 A;  4FZS A;  1QWU A;  3SOG A;  4PO2 A;  3Q84 A;  3CKD A;  4WPC A;  2FIC A;  3D51 A;  2Z0O A;  3SYV A;  2WYH A;  3DX3 A;  1OA0 A;  3M3W A;  3O3O B;  2EFL A;  5FLE X;  3BUB A;  3QWE A;  1R33 A;  2JNS A;  2GAF D;  3D50 A;  1I4D A;  4DCN C;  3I2W A;  2MI7 A;  4AZG A;  3FD9 A;  4H6I A;  2YIA A;  1URU A;  3B53 X;  4R5J A;  1HXK A;  3G9G A;  2ND0 A;  1MJG A;  4UDX X;  4IWQ A;  2X3X A;  4FM3 A;  2RAK A;  3D4Z A;  1SU6 A;  3EJR A;  2GF4 A;  3DX4 A;  1WDZ A;  3BVW A;  4JWI A;  2GA9 D;  4JWC A;  4FZP A;  4EZP A;  4EZZ A;  3BVV A;  2WIN M;  1GN9 A;  2PMR A;  2Q12 A;  2X3V A;  3HAH A;  2Z0N A;  3KDR A;  1QWN A;  2D1L A;  4H6H A;  4JWE A;  2F18 A;  4AZB A;  1O7D C;  2X3W A;  3O3M B;  1TQW A;  1E9V A;  3I04 A;  3EJU A;  3UIT A;  3F7W A;  4EZV A;  2F1A A;  4AZC A;  3L3P A;  2F7Q A;  4IM3 A;  3CAZ A;  4EZU A;  1Y2O A;  3CZN A;  2WYI A;  3EJS A;  4FZO A;  3ERC C;  2YL6 A;  3T46 A;  4KIK A;  3A98 A;  5C5B B;  1UPX A;  4R5K A;  1TQV A;  3LLL A;  4EZN A;  3KAV A;  3D52 A;  3EJT A;  3DX0 A;  3CVR A;  2OO2 A;  3I39 X;  2X5C A;  3B52 X;  2EX3 B;  4IWP A;  1I4L A;  4JLC A;  1ZWW A;  2Z8Y A;  4UDY X;  4AZ5 A;  3QE6 A;  2JNK A;  3BVU A;  4R5G A;  4IM0 A;  2Z0V A;  3BLB A;  4EZS A;  4JN4 A;  4AZH A;  3LMF A;  2QKW A;  4JNF A;  2YL8 A;  1X03 A;  2C08 A;  2F7O A;  4IM2 A;  2YLA A;  4I1Q A;  3DYT A;  2RT6 A;  3DPO A;  3C7N A;  4KIK B;  4H8S A;  4EZQ A;  3T47 A;  1DKX A;  4EZT A;  4EZO A;  2RAI A;  4F00 A;  2YI8 A;  1R34 A;  4HYB A;  3OK8 A;  3D4Y A;  2N3K A;  4HR1 A;  3VEB A;  4NPH A;  2LXY A;  3OHX M;  2QFF A;  2OW7 A;  4IWO A;  3I01 A;  2ND1 A;  2OBL A;  4IW0 A;  1E2U A;  2OZN B;  3CZS A;  4EZW A;  1I49 A;  2YI9 A;  4AZ6 A;  3ACO A;  1OAO A;  3BUI A; 
#chains in the Genus database with same CATH homology
 2RAK A;  1I4D A;  2C08 A;  4DCN C;  1I4L A;  1ZWW A;  3Q0K A;  3HAI A;  3Q84 A;  4I1Q A;  3DYT A;  3I2W A;  3HAJ A;  2EFK A;  4WPE A;  1X04 A;  5C5B B;  2Q12 A;  4NQI A;  4WPC A;  2X3V A;  2FIC A;  3HAH A;  2D4C A;  3LLL A;  2Z0O A;  1WDZ A;  4H8S A;  3SYV A;  2YKT A;  2Z0N A;  4DYL A;  3QE6 A;  1URU A;  2RAJ A;  2V0O A;  3ABH A;  4BNE A;  2D1L A;  4AKV A;  2RAI A;  4AVM A;  3G9G A;  3M3W A;  4ATM A;  1I4T A;  2Z0V A;  3CAZ A;  3PLT A;  4NSW A;  2EFL A;  1I49 A;  2Q13 A;  3QNI A;  3QWE A;  2X3X A;  1Y2O A;  3ACO A;  3OK8 A;  2X3W A;  4FZS A;  3SOG A;  5C5B A;  1X03 A;  2ELB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...