1X0OA

Human arnt c-terminal pas domain
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
119
structure length
119
Chain Sequence
GAMDNVCQPTEFISRHNIEGIFTFVDHRCVATVGYQPQELLGKNIVEFCHPEDQQLLRDSFQQVVKLKGQVLSVMFRFRSKNQEWLWMRTSSFTFQNPYSDEIEYIICTNTNVKNSSQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Basis of ARNT PAS-B Dimerization: Use of a Common Beta-sheet Interface for Hetero- and Homodimerization.
pubmed doi rcsb
molecule tags Transcription
molecule keywords Aryl hydrocarbon receptor nuclear translocator
total genus 33
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2005-03-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14598 PAS_11 PAS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 1x0oA01
3UMEA 5KIZA 4HJ4A 3MQOA 4L9EA 1DP6A 4KUOA 1S4RA 2PYRA 1KOUA 1N9NA 4XT2A 1OJ5A 5F68A 4EERA 1OT9A 4EQ1A 2A24B 2J80A 3E4OA 5AVFA 2WKPA 4R70A 1XJ3A 3A0VA 2PR5A 5J7EA 4PKYG 4HNBA 3BY9A 1DP9A 4KQDA 2Z6CA 4B9OA 4HP9A 1OTDA 1V9YA 1T1CA 4HIAA 1Y28A 3VE3A 2K7SA 3EEHA 3H7WA 2QJ7A 5HD3A 1VB6A 3UMDA 3NOTC 4L9FA 2PHYA 3UE6A 1LL8A 4HH3A 4LRZE 3NOUC 4RQ9A 3MFXA 3GDIA 2PD8A 2QHKA 3E4PA 2VV7A 2Z6DA 4HJ6A 2M1CA 3CAXA 3LYXA 3PYPA 4GHIB 3B33A 1S67L 1LSXA 1X0OA 1WA9A 4PKYA 3H82B 1LT0A 3E4QA 4GCZA 3NOPC 1TS7A 2KDKA 1LSVA 5HWVA 5TBMB 4JGRA 1EW0A 2W27A 3K3CA 3NJAA 4WLAA 3LIDA 1ODVA 2OOLA 1D06A 3C2WA 2OWHA 4HHDA 1XJ6A 1T1BA 3NHQA 1P97A 4E04A 3F1NB 2B02A 3RTYA 4JGPA 4NXGA 4L9GA 4R3AA 5IS1A 4BBTA 2JN7A 2VEAA 3KX0X 1XJ4A 5HD5A 5A8BA 5HSQA 5HDSA 4HH2A 4LRYC 5G4YA 3MQQA 2CMNA 1UWNX 4I39A 1DP8A 4YWZA 1S1ZA 3SW1A 1D7EA 4LLOB 1DRMA 4WUJA 3LI9A 4K08A 1GSWA 1GSXA 5F5YA 4I38A 3MR0A 5I5LA 1XJ2A 4DJ2A 2D02A 2VLGA 4GS9A 4H6JB 5J3WA 3IS2B 3BY8A 4EETB 3IBRA 1S4SA 3F1NA 4HOIA 2BASA 4HP4A 5IU1A 3OLOA 4JGOA 3RH8B 3UB7A 3LICA 3BWLA 3F1OA 3K3DA 1OJGA 1T18A 1F9IA 3EWKA 2ZOHA 3IS2A 4H6JA 4R38A 2WKQA 1OT6A 2JHEA 4I3IA 5TBMA 3PHYA 5F69A 2HV1A 4I3AA 4WL9A 1N9OA 3GECA 3HJKA 2EA9A 2L1MA 3CWFA 4KUKA 4LRXC 5DKLA 2YKHA 5EFWA 4EESA 4EW7A 1JNUA 3D72A 3H9WA 5HWTA 1T19A 4I5SA 4HI4A 3MJQA 4EXOA 4F3LA 3F1PB 2PR6A 2V1AA 2VV6A 4WN5A 2D01A 3H7WB 1TS6A 3ICYA 3LIBA 4NXBA 3UB8A 4F3LB 5HWWA 2I9VA 3C8CA 1LSWA 1S1YA 1OTBA 1UGUA 2YKFA 3FG8A 3P7NA 2L4RA 2WKRA 4NXFA 3ZQ5A 4EEUA 5J4EA 5DJTA 1GSVA 5HZHA 2A24A 1OTIA 2L0WA 2INWA 2H28A 4WF0A 1MZUA 3H82A 3LUQA 4NXEA 1UWPX 4R6LA 1OTEA 2QKPA 2PD7A 2KX6A 2ZOIA 3LIFA 4GHIA 4MN5A 5AVEA 2P7JA 1T1AA 3MXQA 2W0NA 3LIEA 5G4ZA 3A0RA 2PYPA 3T50A 3VOLA 5HDDA 4EEPA 1TS8A 4HJ3A 1P0ZA 2ZBBA 3FC7A 3G6OA 3F1OB 4GW9A 3ULFA 4BBVA 3A0SA 1NWZA 2PDRA 4HQAA 4DJ3A 1G28A 1XFNA 5F6AA 4M4XA 1XFQA 3F1PA 2OWJA 2V0UA 3HJIA 3UB6A 3VE4A 2V0WA 2VV8A 2V1BA 2R78A 4GS9B 5DKKA 2V9AA 2GJ3A 1TS0A 3LIAA 1BYWA 4I3JA 4MN6A 1OTAA 2QWSA 2QJ5A 4HY8A 4JGQA 4XT2B 1S66L 1V9ZA 5DJUA 1F98A 5HDCA 1N9LA 4BBUA 4LPZA 3LI8A 3UB9A 3CLOA
chains in the Genus database with same CATH superfamily
3LEQA 2H5SA 4EERA 2HP9A 4PKYG 1DP9A 3N6IA 1ZTUA 2PHYA 5GHYA 3UE6A 1Y54A 5EVIA 3DWKA 5GLAA 4BWIA 3C7UA 1X0OA 3OCNA 1PFLA 2J9PA 5HWVA 1LL5A 3UY6A 1ODVA 2WGWB 4ZAMA 3C2WA 2ZD8A 2EX6A 1N9BA 4II7A 1ES3A 2VGLM 4BLMA 4JLFA 2MJ6A 3HLGA 5LBRA 4DE3A 4XUZA 3MQQA 1G6OA 1UWNX 3BLSA 3PBQA 3OPPA 1WE4A 3U4LP 3IWQA 1GA0A 4S2NA 4EBNA 5FL3A 4P6ZS 2PU4A 1XA7A 4O01A 4LENA 5TBMA 4PMAA 1N4OA 1YT4A 2DCFA 5L10A 3NC8A 3CZDA 4OPRA 5EOOA 3NDEA 5HWWA 3DTKA 3T1QB 3BFDA 3LR3A 4KQOA 5FQ9A 5DFXA 3IWIA 2ZMFA 4JF4A 2PD7A 4N9KA 4PHTA 1Y4OA 1PRQA 1CJFA 5DF7A 1TS8A 4HJ3A 2RCXA 2ZBBA 3G6OA 3OZHA 4HQAA 3D9YA 2OWJA 3C4PA 2IWDA 4GS9B 1K55A 4JXSA 1W7FA 5EPHA 1PW1A 2XFTA 4UAAA 2W3GA 4ZDXA 1HLUP 5KIZA 4KUOA 3V67A 5HL6A 1OTDA 4RA7A 1I2WA 3W4OA 1ERQA 3N8SA 4I3IA 4GHIB 3NY4A 2ZL1A 3Q1FA 3SZTA 1F2KA 3K3CA 4MN7A 5CXWA 2XEPA 2P9VA 1BT5A 4Y0UA 5CGXA 4Y0TA 1L2SA 3UN7A 4MCWA 3UPPA 4HH2A 4WM9A 4LLOB 4ID4A 3TSGA 4BL3A 4E3NA 3UPOA 4OOMA 2UV0E 3F1OA 4KZ3A 2Y79A 2ZM8A 3VP3A 2VGLS 3BW6A 3PHYA 4FUWA 4EBLA 4JXWA 5AJGA 4DMZA 3H9WA 3HCYA 3TRCA 1S6RA 4E3MA 1VM1A 1QMEA 3H7WB 4F3LB 3GSGA 2R9WA 4ETXA 3CITA 2Q9NA 4YFMA 3P98A 1W8QA 3KSFA 4KG2A 3CHWP 3HLDA 4EWFA 2W0NA 3IXDA 4Y7PA 5HDDA 4EEPA 4PM5A 3LY4A 3UE3A 2IA2A 3BECA 2XQZA 1XFQA 1H0MA 1E25A 1NZOA 4QY5A 2W3HA 1AXBA 4I3JA 2H10A 2Y2IA 3QP2A 5HAQA 4ESPA 5DJUA 2VX8A 4D60A 3UB9A 1K54C 2XSSA 1KOUA 1OJ5A 2QPNA 1OT9A 2A24B 3MZDA 4ETZA 2PR5A 1W79A 4HP9A 2EXAA 4WEKA 3D4FA 4YINA 4OKPA 3NOUC 4G3KA 1WYBA 2EX8A 2Y2LA 3BQAA 1S67L 2J7VA 1TEMA 3WS5A 3NOPC 3T4LA 4PM9A 2V8FA 1P9WA 2I72A 2W3FA 2OWHA 1YMSA 4N1XA 2VGJA 3PBNA 4O0PA 4YWZA 3AGDA 4CPKA 1E3UA 4FSFA 2ZMVA 3QNCA 3T4TA 5KSCA 4H6JA 3B47A 3ITBA 2L1MA 2VKSA 1NRJA 4E3IA 1KE4A 1FSWA 1NXYA 4JXVA 5GLCA 1RCJA 4HI4A 5FDHA 2HP5A 4DXCA 4Z9QA 4ARZA 1IOUA 3W4QA 1UGUA 2XFSA 5EUAA 4BQMA 5CGSA 2EX2A 1Q2PA 3HL9A 1I2SA 3IQAA 3LUQA 1CEFA 3LIFA 2P7JA 1TDLA 3PXPA 3I7JA 3Q7VB 3FC7A 5E2GA 4OOYA 4EU0A 3MKFA 3A3DA 3VSKA 2V1BA 2IWCA 3FKWA 2DNSA 1NYYA 4FD8A 2WUQA 1XX2A 4HEFA 3L9KA 2VK3A 3HBRA 5U47A 3ZNTA 1YPRA 4L9EA 2HZ5A 4EQ1A 4OPZA 4JXGA 3E4OA 2WKPA 5KZHA 1MC0A 5EECA 4N92A 5FQIA 4KQRA 1IYQA 5EVLA 1W63M 2CC1A 4BMWA 2O0YA 2JBFA 2W1TA 2ZQ9A 4HJ6A 3OOVA 3S1YA 4P87A 2P04A 2W27A 4WLAA 5F83A 3NHQA 4R3AA 4S2KA 3N7WA 4OP8A 3TOIA 4R4RA 5A8BA 2WK0A 4OQGA 1D7EA 2X71A 4PM7A 3IXHA 4M3KA 3IS2B 3BY8A 5FQKA 3VP2A 1FOFA 4E6WA 1K4FA 3D72A 4JPMA 2V1ZA 2O9BA 1SDEA 5L8MA 2XROA 1SKOB 1YAXA 5D3OA 1K38A 3CUEA 3DBAA 5FI7A 3HJIA 2J3WA 1W63Q 1RGZA 3LIAA 4U3TA 5F1GA 1H3QA 4X55A 4L0LA 5DF8A 2PT7A 2GZAA 5A92A 4OQ0A 3NCKA 2J80A 4A5RA 3MZEA 5M19A 4R3JA 1YLTA 1EWZA 4GD6A 2HJ9C 4Q8IA 2E8JA 1SKFA 3NDGA 4HH3A 2PRFA 2A3UA 3MFXA 3CG5A 1BTLA 2GDNA 4Z1WA 4S2PA 2V2FF 2P9VB 4MNRA 3A3JA 3WRZA 1SKOA 1FCMA 3ZYTA 1BLSA 4E04A 2EFUA 1W8YA 3BJNA 4BBTA 1XJ4A 3B3XA 4MEZA 3O5YA 3B42A 4K08A 5G18A 2VJWA 1E3UD 2HDQA 3KO6A 4DJ2A 3UDXA 3BEBA 1OMEA 1W5DA 2C6WB 3PBTA 2HJEA 3IX8A 4X53A 2V8CA 1T18A 3EWKA 3M6HA 3UDFA 4C3QA 3HREA 3VP1A 4RX3A 5AQAA 5EFWA 4IBRA 4MMNA 1YM1A 5FAPA 3S4XA 2PR6A 2VV6A 4WN5A 4BD1A 3PBOA 2WKRA 4IEDA 4NXFA 1GCEA 3ZG0A 4CLCB 5CERA 4AFIA 5EVEA 2QYBA 4N1HA 2JC7A 5CHJA 1NWZA 3EQVA 1PIOA 2GJ3A 3HLBA 1TS0A 1HVBA 3E2KA 1PWDA 2W3EA 3BYDA 3OBFA 1CF0A 3LCEA 3C4OA 3CLOA 4WZ5C 3JVUA 4KQDA 1V9YA 3UMDA 3NOTC 2EFXA 2O99A 4RQ9A 3LR4A 2M7UA 4OVDA 2W3DA 3GTCA 1FIKA 4N9LA 4KZ4A 4JF5A 1VETB 3BFGA 1T1BA 1MWUA 1SHVA 5IS1A 2VEAA 2Y59A 5HDSA 4LRYC 5I94A 5GHZA 4GNUA 4JKTA 4DDSA 3ZNYA 2LB5A 3OLOA 2OLVA 1K57C 1OPXA 1OT6A 5F69A 2JKRI 1YLWA 2J3TD 3FPWA 2R9XA 1YLZA 4WELA 5CEDA 5HWTA 4S2JA 1KDSA 4QD4A 4F3LA 3IH9A 1VQQA 2D01A 4MBHA 3P7NA 5JYOA 4Y15A 3NULA 3OC2A 4MN5A 2PYPA 2Q9MA 1U60A 4M4XA 1WYCA 1BYWA 5DF9A 4WBGA 2PBDP 1YSQA 1PWGA 3G31A 5FAQA 4GDNA 2ZC4B 5JYPA 4HJ4A 3MQOA 3UE0A 3FKVA 3SS4A 3PR6A 4X69A 3JVVA 3IF6B 3V3RA 2HGVA 2Z6CA 1FR1A 1T1CA 4WZ5A 3VE3A 2QJ7A 5KSHA 4K91A 3IWOA 4FOFA 3CJMA 3ZG9B 2B18A 1L3LA 3R4KA 3LYXA 3V3SA 4WYYA 5M18A 1LT0A 3VV4A 2Z2LB 4KG5A 5HL1A 3HLEA 4R23A 1XJ6A 1MXOA 1ZG6A 3UPNA 1JTDA 2X02A 3CI6A 4I39A 4E6XA 3U2AA 4BJPA 5HPIA 1BUEA 1NJ4A 2FZ0A 5CHMA 2WYXA 4DE0A 1NZUA 4R0QA 3IBRA 1XXMA 1LLBA 2BASA 4HP4A 3T4KA 1YLPA 1XA1A 4QB8A 1F9IA 2WADA 2WKQA 4CJNA 3GECA 3LEZA 3K2NA 4LRXC 5E43A 5FQQA 4ARZB 2AVXA 4X25A 3BM6A 4YNRA 1YQSA 2Y4AA 5HAIA 1VETA 2QZ6A 4LCMA 3OCLA 4F94A 4WF0A 3H82A 3LY3A 5EM1A 4GHIA 3MXQA 2XLNA 2W1TB 1XFNA 3F1PA 1F5MA 1G6AA 4GDBA 1CEGA 1HZOA 1IYPA 2PU2A 1LHYA 3IH8A 4LPZA 2O9AA 3LR5A 4GB7A 1PZOA 4KZAA 1YLYA 1LI9A 3G34A 1XPBA 4HIAA 3NI9A 4LRZE 1K56A 4E3LA 4LFUA 1Q2QA 1QMFA 2P08A 4R1GA 4CLCA 2RL3A 3DWZA 3H82B 2WGWA 4OOLA 1TS7A 4B93A 2KDKA 3BLMA 3UO9A 4JGRA 3R7WB 1EW0A 3IF6A 3UDIA 2OOLA 3DAVA 4KZBA 3BRMA 4P85A 2A2LA 1L0FA 2ZQ7A 3P01A 5C5KA 3DTIA 4Y0OA 4Y3IA 3NECA 2VLGA 5J3WA 1JWZA 4HOIA 3LICA 3K3DA 3O88A 2OAP1 3ITAA 2ACGA 1TD5A 5M1AA 3WS4A 4KENB 3IX3A 2YKHA 3W4PA 1L0GA 4UQIM 4GOGA 4Q0IA 5K5BA 3MXSA 3EEAA 2X01A 3CPTA 4O7DA 3S22A 4U0XA 3C8CA 1LSWA 1SZVA 5DJTA 4QJGA 3LFVA 4LV0A 1S0WA 3ZVWA 1ESIA 4FH4A 3A0RA 5FAOA 4GW9A 5CRFA 3BQ8A 2JKGA 3G2ZA 4LV3A 5EV0A 1BLPA 4KG6A 1ALQA 2ZQ8A 3IXBA 1F98A 3LI8A 4R3BA 2G7UA 5EVID 4H8RA 4XT2A 2XGNA 3T1XA 4GD8A 2XF3A 3H7WA 1VHMA 3MMHA 3IHAA 4S2NC 2FFFB 5FASA 2Z6DA 3P09A 3CAXA 1PNEA 2Q0OA 3ZG5A 4Y13A 4JGPA 2ZQDA 4S2OA 1KGGA 2ZLYA 1PZPA 3SW1A 3T12B 4WEJA 1XJ2A 5DTKA 3V39A 2EX9A 1KE3A 2Y2PA 3VP0A 3RH8B 5IU1A 3TJZC 5GLBA 3ZG8B 2O9CA 2Y2GA 1HD8A 2ZC5B 2JCHA 2ZL1B 4WMCD 1TDGA 3PBRA 5DKLA 4KZ9A 3KSGA 3V5MA 3BFFA 4EXOA 1ES5A 3G30A 3TE8A 3RXXA 1KDWA 3LR0A 2ZC7A 1S1YA 3ZQ5A 5J4EA 1NY0A 3GRJA 1DJBA 1NLYA 4E3OA 3MFDA 3GMWA 2KX6A 5L07A 3E98A 1HTZA 2PDRA 2WGVA 4CLCD 4Q0JA 4CLCC 3ZHHA 2VV8A 4OH0A 4HBUA 2HDSA 1FCOA 3MS6A 1LI0A 1J9MA 1IELA 3HUOA 1NLZA 2JKTI 3UB5P 2XRNA 1DP6A 4E3KA 5AVFA 4FCFA 4OONA 1NYMA 3AGFA 4KZ7A 1K6RA 5E2HA 5J8XA 1VB6A 2G2WA 1KGFA 2KLIA 3GDIA 4DN0A 2PD8A 2VV7A 1K25A 2M1CA 3ZVTA 2Y2QA 3E4QA 4C6YA 4BD0A 1PYYA 3FPVA 3M2KA 1K6SA 2Y55A 2B02A 2FH5A 1I5QA 3VSLA 4CLCE 3KX0X 5HD5A 3Q82A 1K0KA 3WS2A 1DP8A 1S1ZA 4WMCA 5FDSA 5FSRA 3IT9A 1GSXA 3MR0A 4HESA 2Y2MA 1YMXA 3QP6A 4ZJ1A 3S7QA 4KZ8A 1JWVA 3EGXC 2ZC6B 4DKIA 4EW7A 3O87A 3QP5A 1ESUA 4I5SA 3CPTB 4ZJ3A 3S7OA 1MWSA 5HAPA 3DTEA 3SOIA 2J3TC 4GKUA 4PPRA 3JPUA 1MZUA 3PBSA 4GJ4A 4OQHA 3N8LA 3EOIA 4PAUA 2BG1A 4OLGA 4S2MA 1BZAA 3SH8A 4UEYA 3ZFZA 5F6AA 3SH7A 2Y2HA 4WZ4A 3C5AA 1CI9A 4C75A 1TF1A 2WKEA 2K2NA 1S66L 1SCWA 1V9ZA 1N9LA 3G2YA 4K0WA 4UA6A 1YSPA 4S2IA 4R70A 1XJ3A 2FFYA 3MF0A 3EEHA 5HD3A 1K54A 2ZM0A 3OPRA 1IKIA 1LSVA 1ES2A 3HLFA 3L7HA 3IX4A 4DXBA 3RFBA 1MWRA 2LB9A 5G4YA 3N8RA 4LCLA 2VZWA 5FEGA 5HPFA 2WZZA 3T4QA 4I38A 5HW3A 4ZRRA 4MDZA 4S2LA 1S4SA 3MBZA 4ZTKA 2JHEA 1VEUA 2OAQ1 1M6KA 4FH2A 4KUKA 2OV5A 4EESA 5AQ9A 4QU3A 2P74A 3G32A 3F1PB 1SDNA 3VFFA 4UA9A 1MKIA 2XH9A 3OPLA 2H0YA 1RP5A 1G68A 3E0YA 4D2OA 3R7WA 5KMWA 3Q7ZA 1KVLA 2L0WA 3GVBA 4QHCA 3LIEA 1MY8A 1P0ZA 3V50A 5CTMA 1K4EA 2NUPC 3UB6A 2V0WA 5HARA 5CHUA 2OLUA 2QJ5A 4XXRA 3DW0A 1FQGA 5DTSA 2ZM2A 4LV2A 5FEFA 3IF5A 2PYRA 3FYZA 3NIAA 3UE1A 3MKEA 1XGIA 4IBXA 3BY9A 2K7SA 3C7VA 4GLQA 4L9FA 3QP1A 4PM8A 3MQ0A 2B5RA 4HBTA 1DJAA 3ZGAB 4G3VA 3PAGA 2G2UA 1STZA 2Z2MB 5TBMB 4EV4A 1A0KA 1IFQA 4HHDA 1NRFA 1P97A 3F1NB 1K56D 1D1JA 2B95A 1ZG4A 5CX7A 3WS1A 1ACFA 1DRMA 3HUNA 3CUEC 4IVIA 4G3WA 5F5YA 4OPYA 2EXBA 1H8ZA 4EETB 1MPLA 2XD5A 1H5XA 3EGDC 2HV1A 2ZQCA 4I3AA 4WL9A 5CGWA 5E2FA 1GHPA 4ME4A 3HLWA 1L0DA 4QWOA 3C30A 5GHXA 4DDYA 5HX9A 2HDUA 1ERMA 4IUHA 3JYIA 1M40A 3RJUA 3HLCA 3EQUA 2INWA 2H28A 4EEUA 2QKPA 1YKDA 2J8YA 3VOZA 3VOYA 5L2FA 4X56A 4DJ3A 1G5UA 2A49A 4B88A 2WKIA 2H0TA 3RXWA 4HY8A 3WRTA 4OP5A 4ZBEA 4XT2B 5FQMA 3UMEA 3MSHA 2EWVA 3ISGA 2PBYA 1S4RA 5IT5A 4MLLA 4NEED 4ZJ2A 1KE0A 5J7EA 2C5WB 1Y28A 1RGYA 1LL8A 2Y2JA 4P6ZM 3DTMA 2QHKA 5A90A 4B4XA 2WGIA 4GCZA 2M7VA 4BL2A 5E2EA 1D06A 1ONHA 3RTYA 1IYSA 3SH9A 3MXRA 2JN7A 1JTGA 2GNXA 1CK3A 2DRWA 5A93A 4Q0HA 4RVAA 3IS2A 1MKMA 5FI6A 3AGEA 4RX2A 1ZKJA 4UQIS 4QY6A 4P0MA 1XKZA 3MJQA 2V1AA 3T4JA 4UA7A 3UB8A 3ICYA 1GHIA 1OTBA 2YKFA 5GLDA 3O3VA 5TJJA 3VOLA 2BTFP 2WAEA 1YLJA 2JKFA 1G28A 1ONGA 2V9AA 3ZDJA 5HDCA 4BBUA 4KZ5A 3WS0A 3TG9A 5AQ7A 3SS3A 2HP6A 2XK1A 2VGKA 2WAFA 3KSHA 3FZCA 1KVMA 3HVFA 3T4SA 4NETA 1XP4A 1PW8A 2VA0A 3ZCZA 2JE5A 2ZMAA 4PM6A 4KZ6A 1K57A 3PYPA 5GL9A 2XD1A 3NJAA 3GV9A 3LIDA 2Y8HA 5FI2A 1EROA 2ZC3B 3QP4A 1IYOA 3FWLA 4L9GA 4X68A 2CMNA 5F1FA 3LI9A 3T1SA 1GSWA 4GZBA 3QP8A 1FILA 3Q81A 3FV7A 4H6JB 4NKPA 5BOHA 2PAVP 1ES4A 3BWLA 1ZC2A 2W1RA 5DVAA 2BLSA 2V20A 4NK3A 1FSYA 5FQJA 1JWPA 1T19A 1O07A 2GX5A 3VMAA 3VP4A 3S7PA 4CQHA 2Y2NA 4R4SA 4MBFA 1GHMA 1MBLA 5HZHA 2A24A 4NXEA 1MWTA 1UWPX 4R6LA 2ZOIA 2JKRM 5CTNA 4IUKA 4K0XA 5IHVA 4DF6A 3IHBA 3QHYA 5A91A 4IJGA 2R78A 4EUZA 1BSGA 1OTAA 1TVFA 2QWSA 4DE2A 5EE8A 4JGQA 1Z09A 4IHQA 2Y91A 4EQIA 5EVIC 1JVJA 1N9NA 3KYQA 3A0VA 4HNBA 4B9OA 3A3IA 5TFQA 3LO7A 1DY6A 2KOIA 3VFHA 2XR0A 4Y2FA 4Y5FA 4JBFA 4FTXA 3MZFA 2K31A 3B33A 1WA9A 3OPHA 4X1LA 1IKGA 3T1RA 3A3EA 3KYEA 3GQZA 4B4ZA 4YOFA 1CQAA 3IF6C 4DE1A 2JKTM 1P9RA 4UHUA 3QNBA 4OLDA 2WZXA 2D02A 4GS9A 5FA7A 1BULA 3VE4A 3F1NA 3WWXA 4JGOA 3UB7A 3LGOA 2XA7S 3S7NA 4JF6A 4BENA 3HJKA 2EA9A 2XDMA 3CWFA 2UWXA 3UNWA 1JNUA 3ZG7B 3PAEA 1KGEA 5CECA 4NXBA 2I9VA 4P6BA 1L0EA 2L4RA 1OTIA 5AVEA 1BLCA 2NUTC 5G4ZA 2EWWA 3T50A 4MBKA 4X6TA 4NG2A 2E8IA 5MC7A 2XA7M 3A3FA 2IWBA 2ZJ9A 4OPQA 2ZQAA 1BLHA 1H8YA 1VEUB 4LV1A 5TGFA 4GN2A 4DRTA 3BFEA 2Y2KA 5F68A 3BFCA 1PI5A 1J3WA 3M6BA 4OQIA 4LGWA 4E3JA 3SS5A 2HPBA 1E4DA 1H8MA 3HUMA 3Q7VA 3PTEA 4RYEA 3E4PA 5L09A 4PKYA 1LSXA 2OSUA 3GR2A 3C38A 3NBLA 2WKHA 3W8KA 4NXGA 3O86A 2QMIA 4IVKA 5HSQA 4WUJA 1FCNA 5DFYA 5I5LA 4O8GA 2HF6A 1XGJA 1OJGA 3IBJA 2ZOHA 1IEMA 3Q07A 4R38A 5CEBA 4Y17A 1GA9A 4X1MA 3G4PA 3G35A 1N9OA 2HDRA 3W2ZA 1ZHHB 1LL9A 2J9OA 4XUXA 4QPRA 4EUVA 5EOEA 5EVIB 5FATA 1EI5A 5DTTA 1CI8A 1TS6A 1O7EA 3LIBA 5TR7A 3FG8A 5AQBA 1FR6A 1GSVA 1C3BA 3IXGA 1Z6FA 1OTEA 4EBPA 5F82A 1T1AA 5HFOA 4U0TA 1PI4A 3M2JA 1K55C 4BBVA 4KQQA 3F1OB 1DJCA 3ULFA 3A0SA 3CMZA 2V0UA 3TW8A 5DKKA 3KSIA 3N4IA 4MN6A 1PWCA 2DMWA 3T4OA 3KYZA 2Y2OA 3D3OA 5EM0A 1AWIA 3E2LA
chains in the Genus database with same CATH topology
3UMEA 2EWVA 4XT2A 1S4RA 5IT5A 4EERA 2J80A 4NEED 5J7EA 4PKYG 1DP9A 1Y28A 3H7WA 1VHMA 3MMHA 2HJ9C 1ZTUA 2PHYA 3UE6A 1LL8A 4HH3A 4P6ZM 3MFXA 2QHKA 4BWIA 2Z6DA 3CAXA 4Z1WA 1X0OA 3OCNA 4GCZA 5HWVA 2M7VA 3ZYTA 1ODVA 1D06A 3C2WA 4E04A 4II7A 3RTYA 4JGPA 2VGLM 3BJNA 4BBTA 2JN7A 2MJ6A 5LBRA 1XJ4A 2GNXA 3MQQA 1G6OA 1UWNX 3SW1A 3PBQA 3O5YA 3B42A 4K08A 4WEJA 2VJWA 1XJ2A 3KO6A 4DJ2A 5FL3A 4Q0HA 5IU1A 3RH8B 4P6ZS 3TJZC 3PBTA 2HJEA 2O9CA 3IS2A 1T18A 1MKMA 3EWKA 4O01A 5TBMA 3PBRA 5DKLA 4UQIS 5EFWA 4MMNA 3KSGA 3MJQA 4EXOA 2PR6A 3TE8A 2V1AA 2VV6A 4WN5A 3T4JA 5HWWA 3UB8A 3ICYA 3LR0A 3LR3A 1S1YA 1OTBA 2YKFA 4KQOA 3PBOA 2WKRA 4NXFA 3ZQ5A 5J4EA 5DFXA 1NLYA 2ZMFA 4CLCB 2PD7A 2KX6A 4PHTA 4AFIA 5TJJA 3VOLA 2QYBA 1TS8A 4HJ3A 2ZBBA 3G6OA 3E98A 1NWZA 2PDRA 4HQAA 1G28A 3EQVA 2OWJA 4Q0JA 4CLCD 4CLCC 2VV8A 4GS9B 2V9AA 2GJ3A 1TS0A 2W3EA 3OBFA 5HDCA 4BBUA 3CLOA 1NLZA 2JKTI 2W3GA 2XRNA 5KIZA 1DP6A 4KUOA 3JVUA 3V67A 5AVFA 3KSHA 4KQDA 5HL6A 1OTDA 1V9YA 1VB6A 3UMDA 3NOTC 3T4SA 2O99A 2KLIA 2VA0A 4RQ9A 3GDIA 4DN0A 2PD8A 3LR4A 2VV7A 2M7UA 2M1CA 3PYPA 4GHIB 4I3IA 2W3DA 3E4QA 3K3CA 3NJAA 4MN7A 3FPVA 3LIDA 2Y8HA 1T1BA 2B02A 2FH5A 4L9GA 5IS1A 4CLCE 2VEAA 3KX0X 5HD5A 4MCWA 5HDSA 4HH2A 4LRYC 2CMNA 1DP8A 1S1ZA 4LLOB 3LI9A 1GSWA 1GSXA 3MR0A 4NKPA 4H6JB 3S7QA 4OOMA 2LB5A 3OLOA 3BWLA 3F1OA 3EGXC 1OPXA 1OT6A 2Y79A 2W1RA 2VGLS 3BW6A 3PHYA 5F69A 2JKRI 2J3TD 3FPWA 4EW7A 5AJGA 4WELA 4DMZA 5HWTA 3H9WA 1T19A 3HCYA 4I5SA 3TRCA 2GX5A 4F3LA 2D01A 3H7WB 3S7OA 4F3LB 3S7PA 3P7NA 2J3TC 4CQHA 5HZHA 4ETXA 3CITA 2A24A 3KSFA 1MZUA 3OC2A 3PBSA 4GJ4A 1UWPX 4NXEA 4R6LA 2ZOIA 4MN5A 2JKRM 2W0NA 3EOIA 4PAUA 2PYPA 5HDDA 4EEPA 3UE3A 2IA2A 4IUKA 4UEYA 5F6AA 4M4XA 1XFQA 4IJGA 2R78A 2W3HA 1BYWA 4I3JA 5DF9A 1OTAA 2QWSA 1TF1A 1YSQA 4JGQA 2K2NA 1S66L 4IHQA 1V9ZA 5DJUA 2VX8A 1N9LA 3UB9A 4HJ4A 3MQOA 2XSSA 1YSPA 1KOUA 1N9NA 3KYQA 1OJ5A 1OT9A 2A24B 4R70A 1XJ3A 3A0VA 2PR5A 3JVVA 3PR6A 4ETZA 4HNBA 2HGVA 2Z6CA 4B9OA 4HP9A 1T1CA 3VE3A 3MF0A 3EEHA 2QJ7A 2KOIA 5HD3A 4Y2FA 4Y5FA 5KSHA 4WEKA 4FOFA 3NOUC 4G3KA 2B18A 3R4KA 3LYXA 3BQAA 2K31A 1S67L 3B33A 1WA9A 1LT0A 3NOPC 3T4LA 1LSVA 3VV4A 1P9WA 2W3FA 2OWHA 1XJ6A 4YOFA 3PBNA 4O0PA 3RFBA 2JKTM 3CI6A 2LB9A 5G4YA 4I39A 3U2AA 4YWZA 4BJPA 5HPIA 1P9RA 2VZWA 5HPFA 2FZ0A 4FSFA 3T4QA 4I38A 2ZMVA 2D02A 4GS9A 4ZRRA 4MDZA 3IBRA 1S4SA 3F1NA 3VE4A 2BASA 4HP4A 3T4KA 4JGOA 3UB7A 3T4TA 1F9IA 4H6JA 3B47A 2WKQA 2JHEA 2OAQ1 2XA7S 3S7NA 3GECA 3HJKA 2EA9A 2L1MA 2VKSA 3CWFA 3K2NA 4KUKA 4LRXC 4EESA 1NRJA 1JNUA 4ARZB 4HI4A 3F1PB 4NXBA 2I9VA 4YNRA 4ARZA 1IOUA 1UGUA 3E0YA 3R7WA 2L4RA 1OTIA 2L0WA 3OCLA 4WF0A 3H82A 3LUQA 5AVEA 3LIFA 4GHIA 2P7JA 2NUTC 3MXQA 5G4ZA 2EWWA 3LIEA 3T50A 3PXPA 1P0ZA 2W1TB 3FC7A 5MC7A 1XFNA 4EU0A 3F1PA 2NUPC 1F5MA 3UB6A 2V0WA 2V1BA 2XA7M 2QJ5A 4LPZA 2O9AA 3LR5A 4L9EA 5F68A 2PYRA 4EQ1A 3E4OA 2WKPA 1MC0A 3BY9A 4HIAA 2K7SA 1W63M 4GLQA 4BMWA 2O0YA 4L9FA 1H8MA 4LRZE 2W1TA 3MQ0A 3E4PA 4HJ6A 4G3VA 2P08A 1LSXA 4PKYA 4CLCA 3C38A 3H82B 1STZA 3OOVA 4OOLA 1TS7A 4B93A 2KDKA 5TBMB 4JGRA 3R7WB 1EW0A 2P04A 2W27A 4WLAA 1IFQA 2OOLA 4HHDA 3NHQA 1P97A 3F1NB 4NXGA 4R3AA 5A8BA 5HSQA 2A2LA 5CX7A 1D7EA 1DRMA 4WUJA 3P01A 3CUEC 4G3WA 5DFYA 5C5KA 5F5YA 5I5LA 4Y3IA 4O8GA 2HF6A 2VLGA 5J3WA 3IS2B 3BY8A 4EETB 4HOIA 3LICA 3K3DA 3EGDC 1OJGA 2OAP1 3IBJA 2ZOHA 4R38A 2HV1A 1TD5A 4I3AA 4WL9A 1N9OA 3W2ZA 2YKHA 1ZHHB 3D72A 4ME4A 4QPRA 4EUVA 4UQIM 4Q0IA 3C30A 2O9BA 5K5BA 3EEAA 1TS6A 3LIBA 4IUHA 3C8CA 5L8MA 1LSWA 3FG8A 2XROA 1YAXA 3CUEA 1GSVA 5DJTA 3LFVA 3EQUA 2INWA 2H28A 4EEUA 1OTEA 2QKPA 1YKDA 3DBAA 1T1AA 3A0RA 4BBVA 3F1OB 4GW9A 3ULFA 4DJ3A 3A0SA 3BQ8A 3HJIA 2J3WA 2V0UA 1W63Q 3TW8A 5DKKA 3KSIA 3LIAA 4MN6A 2DMWA 3T4OA 3KYZA 1H3QA 4L0LA 4HY8A 3D3OA 4XT2B 2PT7A 1F98A 2GZAA 3LI8A 2G7UA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3UME A;  5KIZ A;  4HJ4 A;  3MQO A;  4L9E A;  1DP6 A;  4KUO A;  1S4R A;  2PYR A;  1KOU A;  1N9N A;  4XT2 A;  1OJ5 A;  5F68 A;  4EER A;  1OT9 A;  4EQ1 A;  2A24 B;  2J80 A;  3E4O A;  5AVF A;  2WKP A;  4R70 A;  1XJ3 A;  3A0V A;  2PR5 A;  5J7E A;  4PKY G;  4HNB A;  3BY9 A;  1DP9 A;  4KQD A;  2Z6C A;  4B9O A;  4HP9 A;  1OTD A;  1V9Y A;  1T1C A;  4HIA A;  1Y28 A;  3VE3 A;  2K7S A;  3EEH A;  3H7W A;  2QJ7 A;  5HD3 A;  1VB6 A;  3UMD A;  3NOT C;  4L9F A;  2PHY A;  3UE6 A;  1LL8 A;  4HH3 A;  4LRZ E;  3NOU C;  4RQ9 A;  3MFX A;  3GDI A;  2PD8 A;  2QHK A;  3E4P A;  2VV7 A;  2Z6D A;  4HJ6 A;  2M1C A;  3CAX A;  3LYX A;  3PYP A;  4GHI B;  3B33 A;  1S67 L;  1LSX A;  1X0O A;  1WA9 A;  4PKY A;  3H82 B;  1LT0 A;  3E4Q A;  4GCZ A;  3NOP C;  1TS7 A;  2KDK A;  1LSV A;  5HWV A;  5TBM B;  4JGR A;  1EW0 A;  2W27 A;  3K3C A;  3NJA A;  4WLA A;  3LID A;  1ODV A;  2OOL A;  1D06 A;  3C2W A;  2OWH A;  4HHD A;  1XJ6 A;  1T1B A;  3NHQ A;  1P97 A;  4E04 A;  3F1N B;  2B02 A;  3RTY A;  4JGP A;  4NXG A;  4L9G A;  4R3A A;  5IS1 A;  4BBT A;  2JN7 A;  2VEA A;  3KX0 X;  1XJ4 A;  5HD5 A;  5A8B A;  5HSQ A;  5HDS A;  4HH2 A;  4LRY C;  5G4Y A;  3MQQ A;  2CMN A;  1UWN X;  4I39 A;  1DP8 A;  4YWZ A;  1S1Z A;  3SW1 A;  1D7E A;  4LLO B;  1DRM A;  4WUJ A;  3LI9 A;  4K08 A;  1GSW A;  1GSX A;  5F5Y A;  4I38 A;  3MR0 A;  5I5L A;  1XJ2 A;  4DJ2 A;  2D02 A;  2VLG A;  4GS9 A;  4H6J B;  5J3W A;  3IS2 B;  3BY8 A;  4EET B;  3IBR A;  1S4S A;  3F1N A;  4HOI A;  2BAS A;  4HP4 A;  5IU1 A;  3OLO A;  4JGO A;  3RH8 B;  3UB7 A;  3LIC A;  3BWL A;  3F1O A;  3K3D A;  1OJG A;  1T18 A;  1F9I A;  3EWK A;  2ZOH A;  3IS2 A;  4H6J A;  4R38 A;  2WKQ A;  1OT6 A;  2JHE A;  4I3I A;  5TBM A;  3PHY A;  5F69 A;  2HV1 A;  4I3A A;  4WL9 A;  1N9O A;  3GEC A;  3HJK A;  2EA9 A;  2L1M A;  3CWF A;  4KUK A;  4LRX C;  5DKL A;  2YKH A;  5EFW A;  4EES A;  4EW7 A;  1JNU A;  3D72 A;  3H9W A;  5HWT A;  1T19 A;  4I5S A;  4HI4 A;  3MJQ A;  4EXO A;  4F3L A;  3F1P B;  2PR6 A;  2V1A A;  2VV6 A;  4WN5 A;  2D01 A;  3H7W B;  1TS6 A;  3ICY A;  3LIB A;  4NXB A;  3UB8 A;  4F3L B;  5HWW A;  2I9V A;  3C8C A;  1LSW A;  1S1Y A;  1OTB A;  1UGU A;  2YKF A;  3FG8 A;  3P7N A;  2L4R A;  2WKR A;  4NXF A;  3ZQ5 A;  4EEU A;  5J4E A;  5DJT A;  1GSV A;  5HZH A;  2A24 A;  1OTI A;  2L0W A;  2INW A;  2H28 A;  4WF0 A;  1MZU A;  3H82 A;  3LUQ A;  4NXE A;  1UWP X;  4R6L A;  1OTE A;  2QKP A;  2PD7 A;  2KX6 A;  2ZOI A;  3LIF A;  4GHI A;  4MN5 A;  5AVE A;  2P7J A;  1T1A A;  3MXQ A;  2W0N A;  3LIE A;  5G4Z A;  3A0R A;  2PYP A;  3T50 A;  3VOL A;  5HDD A;  4EEP A;  1TS8 A;  4HJ3 A;  1P0Z A;  2ZBB A;  3FC7 A;  3G6O A;  3F1O B;  4GW9 A;  3ULF A;  4BBV A;  3A0S A;  1NWZ A;  2PDR A;  4HQA A;  4DJ3 A;  1G28 A;  1XFN A;  5F6A A;  4M4X A;  1XFQ A;  3F1P A;  2OWJ A;  2V0U A;  3HJI A;  3UB6 A;  3VE4 A;  2V0W A;  2VV8 A;  2V1B A;  2R78 A;  4GS9 B;  5DKK A;  2V9A A;  2GJ3 A;  1TS0 A;  3LIA A;  1BYW A;  4I3J A;  4MN6 A;  1OTA A;  2QWS A;  2QJ5 A;  4HY8 A;  4JGQ A;  4XT2 B;  1S66 L;  1V9Z A;  5DJU A;  1F98 A;  5HDC A;  1N9L A;  4BBU A;  4LPZ A;  3LI8 A;  3UB9 A;  3CLO A; 
#chains in the Genus database with same CATH topology
 3LEQ A;  2H5S A;  4EER A;  2HP9 A;  4PKY G;  1DP9 A;  3N6I A;  1ZTU A;  2PHY A;  5GHY A;  3UE6 A;  1Y54 A;  5EVI A;  3DWK A;  5GLA A;  4BWI A;  3C7U A;  1X0O A;  3OCN A;  1PFL A;  2J9P A;  5HWV A;  1LL5 A;  3UY6 A;  1ODV A;  2WGW B;  4ZAM A;  3C2W A;  2ZD8 A;  2EX6 A;  1N9B A;  4II7 A;  1ES3 A;  2VGL M;  4BLM A;  4JLF A;  2MJ6 A;  3HLG A;  5LBR A;  4DE3 A;  4XUZ A;  3MQQ A;  1G6O A;  1UWN X;  3BLS A;  3PBQ A;  3OPP A;  1WE4 A;  3U4L P;  3IWQ A;  1GA0 A;  4S2N A;  4EBN A;  5FL3 A;  4P6Z S;  2PU4 A;  1XA7 A;  4O01 A;  4LEN A;  5TBM A;  4PMA A;  1N4O A;  1YT4 A;  2DCF A;  5L10 A;  3NC8 A;  3CZD A;  4OPR A;  5EOO A;  3NDE A;  5HWW A;  3DTK A;  3T1Q B;  3BFD A;  3LR3 A;  4KQO A;  5FQ9 A;  5DFX A;  3IWI A;  2ZMF A;  4JF4 A;  2PD7 A;  4N9K A;  4PHT A;  1Y4O A;  1PRQ A;  1CJF A;  5DF7 A;  1TS8 A;  4HJ3 A;  2RCX A;  2ZBB A;  3G6O A;  3OZH A;  4HQA A;  3D9Y A;  2OWJ A;  3C4P A;  2IWD A;  4GS9 B;  1K55 A;  4JXS A;  1W7F A;  5EPH A;  1PW1 A;  2XFT A;  4UAA A;  2W3G A;  4ZDX A;  1HLU P;  5KIZ A;  4KUO A;  3V67 A;  5HL6 A;  1OTD A;  4RA7 A;  1I2W A;  3W4O A;  1ERQ A;  3N8S A;  4I3I A;  4GHI B;  3NY4 A;  2ZL1 A;  3Q1F A;  3SZT A;  1F2K A;  3K3C A;  4MN7 A;  5CXW A;  2XEP A;  2P9V A;  1BT5 A;  4Y0U A;  5CGX A;  4Y0T A;  1L2S A;  3UN7 A;  4MCW A;  3UPP A;  4HH2 A;  4WM9 A;  4LLO B;  4ID4 A;  3TSG A;  4BL3 A;  4E3N A;  3UPO A;  4OOM A;  2UV0 E;  3F1O A;  4KZ3 A;  2Y79 A;  2ZM8 A;  3VP3 A;  2VGL S;  3BW6 A;  3PHY A;  4FUW A;  4EBL A;  4JXW A;  5AJG A;  4DMZ A;  3H9W A;  3HCY A;  3TRC A;  1S6R A;  4E3M A;  1VM1 A;  1QME A;  3H7W B;  4F3L B;  3GSG A;  2R9W A;  4ETX A;  3CIT A;  2Q9N A;  4YFM A;  3P98 A;  1W8Q A;  3KSF A;  4KG2 A;  3CHW P;  3HLD A;  4EWF A;  2W0N A;  3IXD A;  4Y7P A;  5HDD A;  4EEP A;  4PM5 A;  3LY4 A;  3UE3 A;  2IA2 A;  3BEC A;  2XQZ A;  1XFQ A;  1H0M A;  1E25 A;  1NZO A;  4QY5 A;  2W3H A;  1AXB A;  4I3J A;  2H10 A;  2Y2I A;  3QP2 A;  5HAQ A;  4ESP A;  5DJU A;  2VX8 A;  4D60 A;  3UB9 A;  1K54 C;  2XSS A;  1KOU A;  1OJ5 A;  2QPN A;  1OT9 A;  2A24 B;  3MZD A;  4ETZ A;  2PR5 A;  1W79 A;  4HP9 A;  2EXA A;  4WEK A;  3D4F A;  4YIN A;  4OKP A;  3NOU C;  4G3K A;  1WYB A;  2EX8 A;  2Y2L A;  3BQA A;  1S67 L;  2J7V A;  1TEM A;  3WS5 A;  3NOP C;  3T4L A;  4PM9 A;  2V8F A;  1P9W A;  2I72 A;  2W3F A;  2OWH A;  1YMS A;  4N1X A;  2VGJ A;  3PBN A;  4O0P A;  4YWZ A;  3AGD A;  4CPK A;  1E3U A;  4FSF A;  2ZMV A;  3QNC A;  3T4T A;  5KSC A;  4H6J A;  3B47 A;  3ITB A;  2L1M A;  2VKS A;  1NRJ A;  4E3I A;  1KE4 A;  1FSW A;  1NXY A;  4JXV A;  5GLC A;  1RCJ A;  4HI4 A;  5FDH A;  2HP5 A;  4DXC A;  4Z9Q A;  4ARZ A;  1IOU A;  3W4Q A;  1UGU A;  2XFS A;  5EUA A;  4BQM A;  5CGS A;  2EX2 A;  1Q2P A;  3HL9 A;  1I2S A;  3IQA A;  3LUQ A;  1CEF A;  3LIF A;  2P7J A;  1TDL A;  3PXP A;  3I7J A;  3Q7V B;  3FC7 A;  5E2G A;  4OOY A;  4EU0 A;  3MKF A;  3A3D A;  3VSK A;  2V1B A;  2IWC A;  3FKW A;  2DNS A;  1NYY A;  4FD8 A;  2WUQ A;  1XX2 A;  4HEF A;  3L9K A;  2VK3 A;  3HBR A;  5U47 A;  3ZNT A;  1YPR A;  4L9E A;  2HZ5 A;  4EQ1 A;  4OPZ A;  4JXG A;  3E4O A;  2WKP A;  5KZH A;  1MC0 A;  5EEC A;  4N92 A;  5FQI A;  4KQR A;  1IYQ A;  5EVL A;  1W63 M;  2CC1 A;  4BMW A;  2O0Y A;  2JBF A;  2W1T A;  2ZQ9 A;  4HJ6 A;  3OOV A;  3S1Y A;  4P87 A;  2P04 A;  2W27 A;  4WLA A;  5F83 A;  3NHQ A;  4R3A A;  4S2K A;  3N7W A;  4OP8 A;  3TOI A;  4R4R A;  5A8B A;  2WK0 A;  4OQG A;  1D7E A;  2X71 A;  4PM7 A;  3IXH A;  4M3K A;  3IS2 B;  3BY8 A;  5FQK A;  3VP2 A;  1FOF A;  4E6W A;  1K4F A;  3D72 A;  4JPM A;  2V1Z A;  2O9B A;  1SDE A;  5L8M A;  2XRO A;  1SKO B;  1YAX A;  5D3O A;  1K38 A;  3CUE A;  3DBA A;  5FI7 A;  3HJI A;  2J3W A;  1W63 Q;  1RGZ A;  3LIA A;  4U3T A;  5F1G A;  1H3Q A;  4X55 A;  4L0L A;  5DF8 A;  2PT7 A;  2GZA A;  5A92 A;  4OQ0 A;  3NCK A;  2J80 A;  4A5R A;  3MZE A;  5M19 A;  4R3J A;  1YLT A;  1EWZ A;  4GD6 A;  2HJ9 C;  4Q8I A;  2E8J A;  1SKF A;  3NDG A;  4HH3 A;  2PRF A;  2A3U A;  3MFX A;  3CG5 A;  1BTL A;  2GDN A;  4Z1W A;  4S2P A;  2V2F F;  2P9V B;  4MNR A;  3A3J A;  3WRZ A;  1SKO A;  1FCM A;  3ZYT A;  1BLS A;  4E04 A;  2EFU A;  1W8Y A;  3BJN A;  4BBT A;  1XJ4 A;  3B3X A;  4MEZ A;  3O5Y A;  3B42 A;  4K08 A;  5G18 A;  2VJW A;  1E3U D;  2HDQ A;  3KO6 A;  4DJ2 A;  3UDX A;  3BEB A;  1OME A;  1W5D A;  2C6W B;  3PBT A;  2HJE A;  3IX8 A;  4X53 A;  2V8C A;  1T18 A;  3EWK A;  3M6H A;  3UDF A;  4C3Q A;  3HRE A;  3VP1 A;  4RX3 A;  5AQA A;  5EFW A;  4IBR A;  4MMN A;  1YM1 A;  5FAP A;  3S4X A;  2PR6 A;  2VV6 A;  4WN5 A;  4BD1 A;  3PBO A;  2WKR A;  4IED A;  4NXF A;  1GCE A;  3ZG0 A;  4CLC B;  5CER A;  4AFI A;  5EVE A;  2QYB A;  4N1H A;  2JC7 A;  5CHJ A;  1NWZ A;  3EQV A;  1PIO A;  2GJ3 A;  3HLB A;  1TS0 A;  1HVB A;  3E2K A;  1PWD A;  2W3E A;  3BYD A;  3OBF A;  1CF0 A;  3LCE A;  3C4O A;  3CLO A;  4WZ5 C;  3JVU A;  4KQD A;  1V9Y A;  3UMD A;  3NOT C;  2EFX A;  2O99 A;  4RQ9 A;  3LR4 A;  2M7U A;  4OVD A;  2W3D A;  3GTC A;  1FIK A;  4N9L A;  4KZ4 A;  4JF5 A;  1VET B;  3BFG A;  1T1B A;  1MWU A;  1SHV A;  5IS1 A;  2VEA A;  2Y59 A;  5HDS A;  4LRY C;  5I94 A;  5GHZ A;  4GNU A;  4JKT A;  4DDS A;  3ZNY A;  2LB5 A;  3OLO A;  2OLV A;  1K57 C;  1OPX A;  1OT6 A;  5F69 A;  2JKR I;  1YLW A;  2J3T D;  3FPW A;  2R9X A;  1YLZ A;  4WEL A;  5CED A;  5HWT A;  4S2J A;  1KDS A;  4QD4 A;  4F3L A;  3IH9 A;  1VQQ A;  2D01 A;  4MBH A;  3P7N A;  5JYO A;  4Y15 A;  3NUL A;  3OC2 A;  4MN5 A;  2PYP A;  2Q9M A;  1U60 A;  4M4X A;  1WYC A;  1BYW A;  5DF9 A;  4WBG A;  2PBD P;  1YSQ A;  1PWG A;  3G31 A;  5FAQ A;  4GDN A;  2ZC4 B;  5JYP A;  4HJ4 A;  3MQO A;  3UE0 A;  3FKV A;  3SS4 A;  3PR6 A;  4X69 A;  3JVV A;  3IF6 B;  3V3R A;  2HGV A;  2Z6C A;  1FR1 A;  1T1C A;  4WZ5 A;  3VE3 A;  2QJ7 A;  5KSH A;  4K91 A;  3IWO A;  4FOF A;  3CJM A;  3ZG9 B;  2B18 A;  1L3L A;  3R4K A;  3LYX A;  3V3S A;  4WYY A;  5M18 A;  1LT0 A;  3VV4 A;  2Z2L B;  4KG5 A;  5HL1 A;  3HLE A;  4R23 A;  1XJ6 A;  1MXO A;  1ZG6 A;  3UPN A;  1JTD A;  2X02 A;  3CI6 A;  4I39 A;  4E6X A;  3U2A A;  4BJP A;  5HPI A;  1BUE A;  1NJ4 A;  2FZ0 A;  5CHM A;  2WYX A;  4DE0 A;  1NZU A;  4R0Q A;  3IBR A;  1XXM A;  1LLB A;  2BAS A;  4HP4 A;  3T4K A;  1YLP A;  1XA1 A;  4QB8 A;  1F9I A;  2WAD A;  2WKQ A;  4CJN A;  3GEC A;  3LEZ A;  3K2N A;  4LRX C;  5E43 A;  5FQQ A;  4ARZ B;  2AVX A;  4X25 A;  3BM6 A;  4YNR A;  1YQS A;  2Y4A A;  5HAI A;  1VET A;  2QZ6 A;  4LCM A;  3OCL A;  4F94 A;  4WF0 A;  3H82 A;  3LY3 A;  5EM1 A;  4GHI A;  3MXQ A;  2XLN A;  2W1T B;  1XFN A;  3F1P A;  1F5M A;  1G6A A;  4GDB A;  1CEG A;  1HZO A;  1IYP A;  2PU2 A;  1LHY A;  3IH8 A;  4LPZ A;  2O9A A;  3LR5 A;  4GB7 A;  1PZO A;  4KZA A;  1YLY A;  1LI9 A;  3G34 A;  1XPB A;  4HIA A;  3NI9 A;  4LRZ E;  1K56 A;  4E3L A;  4LFU A;  1Q2Q A;  1QMF A;  2P08 A;  4R1G A;  4CLC A;  2RL3 A;  3DWZ A;  3H82 B;  2WGW A;  4OOL A;  1TS7 A;  4B93 A;  2KDK A;  3BLM A;  3UO9 A;  4JGR A;  3R7W B;  1EW0 A;  3IF6 A;  3UDI A;  2OOL A;  3DAV A;  4KZB A;  3BRM A;  4P85 A;  2A2L A;  1L0F A;  2ZQ7 A;  3P01 A;  5C5K A;  3DTI A;  4Y0O A;  4Y3I A;  3NEC A;  2VLG A;  5J3W A;  1JWZ A;  4HOI A;  3LIC A;  3K3D A;  3O88 A;  2OAP 1;  3ITA A;  2ACG A;  1TD5 A;  5M1A A;  3WS4 A;  4KEN B;  3IX3 A;  2YKH A;  3W4P A;  1L0G A;  4UQI M;  4GOG A;  4Q0I A;  5K5B A;  3MXS A;  3EEA A;  2X01 A;  3CPT A;  4O7D A;  3S22 A;  4U0X A;  3C8C A;  1LSW A;  1SZV A;  5DJT A;  4QJG A;  3LFV A;  4LV0 A;  1S0W A;  3ZVW A;  1ESI A;  4FH4 A;  3A0R A;  5FAO A;  4GW9 A;  5CRF A;  3BQ8 A;  2JKG A;  3G2Z A;  4LV3 A;  5EV0 A;  1BLP A;  4KG6 A;  1ALQ A;  2ZQ8 A;  3IXB A;  1F98 A;  3LI8 A;  4R3B A;  2G7U A;  5EVI D;  4H8R A;  4XT2 A;  2XGN A;  3T1X A;  4GD8 A;  2XF3 A;  3H7W A;  1VHM A;  3MMH A;  3IHA A;  4S2N C;  2FFF B;  5FAS A;  2Z6D A;  3P09 A;  3CAX A;  1PNE A;  2Q0O A;  3ZG5 A;  4Y13 A;  4JGP A;  2ZQD A;  4S2O A;  1KGG A;  2ZLY A;  1PZP A;  3SW1 A;  3T12 B;  4WEJ A;  1XJ2 A;  5DTK A;  3V39 A;  2EX9 A;  1KE3 A;  2Y2P A;  3VP0 A;  3RH8 B;  5IU1 A;  3TJZ C;  5GLB A;  3ZG8 B;  2O9C A;  2Y2G A;  1HD8 A;  2ZC5 B;  2JCH A;  2ZL1 B;  4WMC D;  1TDG A;  3PBR A;  5DKL A;  4KZ9 A;  3KSG A;  3V5M A;  3BFF A;  4EXO A;  1ES5 A;  3G30 A;  3TE8 A;  3RXX A;  1KDW A;  3LR0 A;  2ZC7 A;  1S1Y A;  3ZQ5 A;  5J4E A;  1NY0 A;  3GRJ A;  1DJB A;  1NLY A;  4E3O A;  3MFD A;  3GMW A;  2KX6 A;  5L07 A;  3E98 A;  1HTZ A;  2PDR A;  2WGV A;  4CLC D;  4Q0J A;  4CLC C;  3ZHH A;  2VV8 A;  4OH0 A;  4HBU A;  2HDS A;  1FCO A;  3MS6 A;  1LI0 A;  1J9M A;  1IEL A;  3HUO A;  1NLZ A;  2JKT I;  3UB5 P;  2XRN A;  1DP6 A;  4E3K A;  5AVF A;  4FCF A;  4OON A;  1NYM A;  3AGF A;  4KZ7 A;  1K6R A;  5E2H A;  5J8X A;  1VB6 A;  2G2W A;  1KGF A;  2KLI A;  3GDI A;  4DN0 A;  2PD8 A;  2VV7 A;  1K25 A;  2M1C A;  3ZVT A;  2Y2Q A;  3E4Q A;  4C6Y A;  4BD0 A;  1PYY A;  3FPV A;  3M2K A;  1K6S A;  2Y55 A;  2B02 A;  2FH5 A;  1I5Q A;  3VSL A;  4CLC E;  3KX0 X;  5HD5 A;  3Q82 A;  1K0K A;  3WS2 A;  1DP8 A;  1S1Z A;  4WMC A;  5FDS A;  5FSR A;  3IT9 A;  1GSX A;  3MR0 A;  4HES A;  2Y2M A;  1YMX A;  3QP6 A;  4ZJ1 A;  3S7Q A;  4KZ8 A;  1JWV A;  3EGX C;  2ZC6 B;  4DKI A;  4EW7 A;  3O87 A;  3QP5 A;  1ESU A;  4I5S A;  3CPT B;  4ZJ3 A;  3S7O A;  1MWS A;  5HAP A;  3DTE A;  3SOI A;  2J3T C;  4GKU A;  4PPR A;  3JPU A;  1MZU A;  3PBS A;  4GJ4 A;  4OQH A;  3N8L A;  3EOI A;  4PAU A;  2BG1 A;  4OLG A;  4S2M A;  1BZA A;  3SH8 A;  4UEY A;  3ZFZ A;  5F6A A;  3SH7 A;  2Y2H A;  4WZ4 A;  3C5A A;  1CI9 A;  4C75 A;  1TF1 A;  2WKE A;  2K2N A;  1S66 L;  1SCW A;  1V9Z A;  1N9L A;  3G2Y A;  4K0W A;  4UA6 A;  1YSP A;  4S2I A;  4R70 A;  1XJ3 A;  2FFY A;  3MF0 A;  3EEH A;  5HD3 A;  1K54 A;  2ZM0 A;  3OPR A;  1IKI A;  1LSV A;  1ES2 A;  3HLF A;  3L7H A;  3IX4 A;  4DXB A;  3RFB A;  1MWR A;  2LB9 A;  5G4Y A;  3N8R A;  4LCL A;  2VZW A;  5FEG A;  5HPF A;  2WZZ A;  3T4Q A;  4I38 A;  5HW3 A;  4ZRR A;  4MDZ A;  4S2L A;  1S4S A;  3MBZ A;  4ZTK A;  2JHE A;  1VEU A;  2OAQ 1;  1M6K A;  4FH2 A;  4KUK A;  2OV5 A;  4EES A;  5AQ9 A;  4QU3 A;  2P74 A;  3G32 A;  3F1P B;  1SDN A;  3VFF A;  4UA9 A;  1MKI A;  2XH9 A;  3OPL A;  2H0Y A;  1RP5 A;  1G68 A;  3E0Y A;  4D2O A;  3R7W A;  5KMW A;  3Q7Z A;  1KVL A;  2L0W A;  3GVB A;  4QHC A;  3LIE A;  1MY8 A;  1P0Z A;  3V50 A;  5CTM A;  1K4E A;  2NUP C;  3UB6 A;  2V0W A;  5HAR A;  5CHU A;  2OLU A;  2QJ5 A;  4XXR A;  3DW0 A;  1FQG A;  5DTS A;  2ZM2 A;  4LV2 A;  5FEF A;  3IF5 A;  2PYR A;  3FYZ A;  3NIA A;  3UE1 A;  3MKE A;  1XGI A;  4IBX A;  3BY9 A;  2K7S A;  3C7V A;  4GLQ A;  4L9F A;  3QP1 A;  4PM8 A;  3MQ0 A;  2B5R A;  4HBT A;  1DJA A;  3ZGA B;  4G3V A;  3PAG A;  2G2U A;  1STZ A;  2Z2M B;  5TBM B;  4EV4 A;  1A0K A;  1IFQ A;  4HHD A;  1NRF A;  1P97 A;  3F1N B;  1K56 D;  1D1J A;  2B95 A;  1ZG4 A;  5CX7 A;  3WS1 A;  1ACF A;  1DRM A;  3HUN A;  3CUE C;  4IVI A;  4G3W A;  5F5Y A;  4OPY A;  2EXB A;  1H8Z A;  4EET B;  1MPL A;  2XD5 A;  1H5X A;  3EGD C;  2HV1 A;  2ZQC A;  4I3A A;  4WL9 A;  5CGW A;  5E2F A;  1GHP A;  4ME4 A;  3HLW A;  1L0D A;  4QWO A;  3C30 A;  5GHX A;  4DDY A;  5HX9 A;  2HDU A;  1ERM A;  4IUH A;  3JYI A;  1M40 A;  3RJU A;  3HLC A;  3EQU A;  2INW A;  2H28 A;  4EEU A;  2QKP A;  1YKD A;  2J8Y A;  3VOZ A;  3VOY A;  5L2F A;  4X56 A;  4DJ3 A;  1G5U A;  2A49 A;  4B88 A;  2WKI A;  2H0T A;  3RXW A;  4HY8 A;  3WRT A;  4OP5 A;  4ZBE A;  4XT2 B;  5FQM A;  3UME A;  3MSH A;  2EWV A;  3ISG A;  2PBY A;  1S4R A;  5IT5 A;  4MLL A;  4NEE D;  4ZJ2 A;  1KE0 A;  5J7E A;  2C5W B;  1Y28 A;  1RGY A;  1LL8 A;  2Y2J A;  4P6Z M;  3DTM A;  2QHK A;  5A90 A;  4B4X A;  2WGI A;  4GCZ A;  2M7V A;  4BL2 A;  5E2E A;  1D06 A;  1ONH A;  3RTY A;  1IYS A;  3SH9 A;  3MXR A;  2JN7 A;  1JTG A;  2GNX A;  1CK3 A;  2DRW A;  5A93 A;  4Q0H A;  4RVA A;  3IS2 A;  1MKM A;  5FI6 A;  3AGE A;  4RX2 A;  1ZKJ A;  4UQI S;  4QY6 A;  4P0M A;  1XKZ A;  3MJQ A;  2V1A A;  3T4J A;  4UA7 A;  3UB8 A;  3ICY A;  1GHI A;  1OTB A;  2YKF A;  5GLD A;  3O3V A;  5TJJ A;  3VOL A;  2BTF P;  2WAE A;  1YLJ A;  2JKF A;  1G28 A;  1ONG A;  2V9A A;  3ZDJ A;  5HDC A;  4BBU A;  4KZ5 A;  3WS0 A;  3TG9 A;  5AQ7 A;  3SS3 A;  2HP6 A;  2XK1 A;  2VGK A;  2WAF A;  3KSH A;  3FZC A;  1KVM A;  3HVF A;  3T4S A;  4NET A;  1XP4 A;  1PW8 A;  2VA0 A;  3ZCZ A;  2JE5 A;  2ZMA A;  4PM6 A;  4KZ6 A;  1K57 A;  3PYP A;  5GL9 A;  2XD1 A;  3NJA A;  3GV9 A;  3LID A;  2Y8H A;  5FI2 A;  1ERO A;  2ZC3 B;  3QP4 A;  1IYO A;  3FWL A;  4L9G A;  4X68 A;  2CMN A;  5F1F A;  3LI9 A;  3T1S A;  1GSW A;  4GZB A;  3QP8 A;  1FIL A;  3Q81 A;  3FV7 A;  4H6J B;  4NKP A;  5BOH A;  2PAV P;  1ES4 A;  3BWL A;  1ZC2 A;  2W1R A;  5DVA A;  2BLS A;  2V20 A;  4NK3 A;  1FSY A;  5FQJ A;  1JWP A;  1T19 A;  1O07 A;  2GX5 A;  3VMA A;  3VP4 A;  3S7P A;  4CQH A;  2Y2N A;  4R4S A;  4MBF A;  1GHM A;  1MBL A;  5HZH A;  2A24 A;  4NXE A;  1MWT A;  1UWP X;  4R6L A;  2ZOI A;  2JKR M;  5CTN A;  4IUK A;  4K0X A;  5IHV A;  4DF6 A;  3IHB A;  3QHY A;  5A91 A;  4IJG A;  2R78 A;  4EUZ A;  1BSG A;  1OTA A;  1TVF A;  2QWS A;  4DE2 A;  5EE8 A;  4JGQ A;  1Z09 A;  4IHQ A;  2Y91 A;  4EQI A;  5EVI C;  1JVJ A;  1N9N A;  3KYQ A;  3A0V A;  4HNB A;  4B9O A;  3A3I A;  5TFQ A;  3LO7 A;  1DY6 A;  2KOI A;  3VFH A;  2XR0 A;  4Y2F A;  4Y5F A;  4JBF A;  4FTX A;  3MZF A;  2K31 A;  3B33 A;  1WA9 A;  3OPH A;  4X1L A;  1IKG A;  3T1R A;  3A3E A;  3KYE A;  3GQZ A;  4B4Z A;  4YOF A;  1CQA A;  3IF6 C;  4DE1 A;  2JKT M;  1P9R A;  4UHU A;  3QNB A;  4OLD A;  2WZX A;  2D02 A;  4GS9 A;  5FA7 A;  1BUL A;  3VE4 A;  3F1N A;  3WWX A;  4JGO A;  3UB7 A;  3LGO A;  2XA7 S;  3S7N A;  4JF6 A;  4BEN A;  3HJK A;  2EA9 A;  2XDM A;  3CWF A;  2UWX A;  3UNW A;  1JNU A;  3ZG7 B;  3PAE A;  1KGE A;  5CEC A;  4NXB A;  2I9V A;  4P6B A;  1L0E A;  2L4R A;  1OTI A;  5AVE A;  1BLC A;  2NUT C;  5G4Z A;  2EWW A;  3T50 A;  4MBK A;  4X6T A;  4NG2 A;  2E8I A;  5MC7 A;  2XA7 M;  3A3F A;  2IWB A;  2ZJ9 A;  4OPQ A;  2ZQA A;  1BLH A;  1H8Y A;  1VEU B;  4LV1 A;  5TGF A;  4GN2 A;  4DRT A;  3BFE A;  2Y2K A;  5F68 A;  3BFC A;  1PI5 A;  1J3W A;  3M6B A;  4OQI A;  4LGW A;  4E3J A;  3SS5 A;  2HPB A;  1E4D A;  1H8M A;  3HUM A;  3Q7V A;  3PTE A;  4RYE A;  3E4P A;  5L09 A;  4PKY A;  1LSX A;  2OSU A;  3GR2 A;  3C38 A;  3NBL A;  2WKH A;  3W8K A;  4NXG A;  3O86 A;  2QMI A;  4IVK A;  5HSQ A;  4WUJ A;  1FCN A;  5DFY A;  5I5L A;  4O8G A;  2HF6 A;  1XGJ A;  1OJG A;  3IBJ A;  2ZOH A;  1IEM A;  3Q07 A;  4R38 A;  5CEB A;  4Y17 A;  1GA9 A;  4X1M A;  3G4P A;  3G35 A;  1N9O A;  2HDR A;  3W2Z A;  1ZHH B;  1LL9 A;  2J9O A;  4XUX A;  4QPR A;  4EUV A;  5EOE A;  5EVI B;  5FAT A;  1EI5 A;  5DTT A;  1CI8 A;  1TS6 A;  1O7E A;  3LIB A;  5TR7 A;  3FG8 A;  5AQB A;  1FR6 A;  1GSV A;  1C3B A;  3IXG A;  1Z6F A;  1OTE A;  4EBP A;  5F82 A;  1T1A A;  5HFO A;  4U0T A;  1PI4 A;  3M2J A;  1K55 C;  4BBV A;  4KQQ A;  3F1O B;  1DJC A;  3ULF A;  3A0S A;  3CMZ A;  2V0U A;  3TW8 A;  5DKK A;  3KSI A;  3N4I A;  4MN6 A;  1PWC A;  2DMW A;  3T4O A;  3KYZ A;  2Y2O A;  3D3O A;  5EM0 A;  1AWI A;  3E2L A; 
#chains in the Genus database with same CATH homology
 3UME A;  2EWV A;  4XT2 A;  1S4R A;  5IT5 A;  4EER A;  2J80 A;  4NEE D;  5J7E A;  4PKY G;  1DP9 A;  1Y28 A;  3H7W A;  1VHM A;  3MMH A;  2HJ9 C;  1ZTU A;  2PHY A;  3UE6 A;  1LL8 A;  4HH3 A;  4P6Z M;  3MFX A;  2QHK A;  4BWI A;  2Z6D A;  3CAX A;  4Z1W A;  1X0O A;  3OCN A;  4GCZ A;  5HWV A;  2M7V A;  3ZYT A;  1ODV A;  1D06 A;  3C2W A;  4E04 A;  4II7 A;  3RTY A;  4JGP A;  2VGL M;  3BJN A;  4BBT A;  2JN7 A;  2MJ6 A;  5LBR A;  1XJ4 A;  2GNX A;  3MQQ A;  1G6O A;  1UWN X;  3SW1 A;  3PBQ A;  3O5Y A;  3B42 A;  4K08 A;  4WEJ A;  2VJW A;  1XJ2 A;  3KO6 A;  4DJ2 A;  5FL3 A;  4Q0H A;  5IU1 A;  3RH8 B;  4P6Z S;  3TJZ C;  3PBT A;  2HJE A;  2O9C A;  3IS2 A;  1T18 A;  1MKM A;  3EWK A;  4O01 A;  5TBM A;  3PBR A;  5DKL A;  4UQI S;  5EFW A;  4MMN A;  3KSG A;  3MJQ A;  4EXO A;  2PR6 A;  3TE8 A;  2V1A A;  2VV6 A;  4WN5 A;  3T4J A;  5HWW A;  3UB8 A;  3ICY A;  3LR0 A;  3LR3 A;  1S1Y A;  1OTB A;  2YKF A;  4KQO A;  3PBO A;  2WKR A;  4NXF A;  3ZQ5 A;  5J4E A;  5DFX A;  1NLY A;  2ZMF A;  4CLC B;  2PD7 A;  2KX6 A;  4PHT A;  4AFI A;  5TJJ A;  3VOL A;  2QYB A;  1TS8 A;  4HJ3 A;  2ZBB A;  3G6O A;  3E98 A;  1NWZ A;  2PDR A;  4HQA A;  1G28 A;  3EQV A;  2OWJ A;  4Q0J A;  4CLC D;  4CLC C;  2VV8 A;  4GS9 B;  2V9A A;  2GJ3 A;  1TS0 A;  2W3E A;  3OBF A;  5HDC A;  4BBU A;  3CLO A;  1NLZ A;  2JKT I;  2W3G A;  2XRN A;  5KIZ A;  1DP6 A;  4KUO A;  3JVU A;  3V67 A;  5AVF A;  3KSH A;  4KQD A;  5HL6 A;  1OTD A;  1V9Y A;  1VB6 A;  3UMD A;  3NOT C;  3T4S A;  2O99 A;  2KLI A;  2VA0 A;  4RQ9 A;  3GDI A;  4DN0 A;  2PD8 A;  3LR4 A;  2VV7 A;  2M7U A;  2M1C A;  3PYP A;  4GHI B;  4I3I A;  2W3D A;  3E4Q A;  3K3C A;  3NJA A;  4MN7 A;  3FPV A;  3LID A;  2Y8H A;  1T1B A;  2B02 A;  2FH5 A;  4L9G A;  5IS1 A;  4CLC E;  2VEA A;  3KX0 X;  5HD5 A;  4MCW A;  5HDS A;  4HH2 A;  4LRY C;  2CMN A;  1DP8 A;  1S1Z A;  4LLO B;  3LI9 A;  1GSW A;  1GSX A;  3MR0 A;  4NKP A;  4H6J B;  3S7Q A;  4OOM A;  2LB5 A;  3OLO A;  3BWL A;  3F1O A;  3EGX C;  1OPX A;  1OT6 A;  2Y79 A;  2W1R A;  2VGL S;  3BW6 A;  3PHY A;  5F69 A;  2JKR I;  2J3T D;  3FPW A;  4EW7 A;  5AJG A;  4WEL A;  4DMZ A;  5HWT A;  3H9W A;  1T19 A;  3HCY A;  4I5S A;  3TRC A;  2GX5 A;  4F3L A;  2D01 A;  3H7W B;  3S7O A;  4F3L B;  3S7P A;  3P7N A;  2J3T C;  4CQH A;  5HZH A;  4ETX A;  3CIT A;  2A24 A;  3KSF A;  1MZU A;  3OC2 A;  3PBS A;  4GJ4 A;  1UWP X;  4NXE A;  4R6L A;  2ZOI A;  4MN5 A;  2JKR M;  2W0N A;  3EOI A;  4PAU A;  2PYP A;  5HDD A;  4EEP A;  3UE3 A;  2IA2 A;  4IUK A;  4UEY A;  5F6A A;  4M4X A;  1XFQ A;  4IJG A;  2R78 A;  2W3H A;  1BYW A;  4I3J A;  5DF9 A;  1OTA A;  2QWS A;  1TF1 A;  1YSQ A;  4JGQ A;  2K2N A;  1S66 L;  4IHQ A;  1V9Z A;  5DJU A;  2VX8 A;  1N9L A;  3UB9 A;  4HJ4 A;  3MQO A;  2XSS A;  1YSP A;  1KOU A;  1N9N A;  3KYQ A;  1OJ5 A;  1OT9 A;  2A24 B;  4R70 A;  1XJ3 A;  3A0V A;  2PR5 A;  3JVV A;  3PR6 A;  4ETZ A;  4HNB A;  2HGV A;  2Z6C A;  4B9O A;  4HP9 A;  1T1C A;  3VE3 A;  3MF0 A;  3EEH A;  2QJ7 A;  2KOI A;  5HD3 A;  4Y2F A;  4Y5F A;  5KSH A;  4WEK A;  4FOF A;  3NOU C;  4G3K A;  2B18 A;  3R4K A;  3LYX A;  3BQA A;  2K31 A;  1S67 L;  3B33 A;  1WA9 A;  1LT0 A;  3NOP C;  3T4L A;  1LSV A;  3VV4 A;  1P9W A;  2W3F A;  2OWH A;  1XJ6 A;  4YOF A;  3PBN A;  4O0P A;  3RFB A;  2JKT M;  3CI6 A;  2LB9 A;  5G4Y A;  4I39 A;  3U2A A;  4YWZ A;  4BJP A;  5HPI A;  1P9R A;  2VZW A;  5HPF A;  2FZ0 A;  4FSF A;  3T4Q A;  4I38 A;  2ZMV A;  2D02 A;  4GS9 A;  4ZRR A;  4MDZ A;  3IBR A;  1S4S A;  3F1N A;  3VE4 A;  2BAS A;  4HP4 A;  3T4K A;  4JGO A;  3UB7 A;  3T4T A;  1F9I A;  4H6J A;  3B47 A;  2WKQ A;  2JHE A;  2OAQ 1;  2XA7 S;  3S7N A;  3GEC A;  3HJK A;  2EA9 A;  2L1M A;  2VKS A;  3CWF A;  3K2N A;  4KUK A;  4LRX C;  4EES A;  1NRJ A;  1JNU A;  4ARZ B;  4HI4 A;  3F1P B;  4NXB A;  2I9V A;  4YNR A;  4ARZ A;  1IOU A;  1UGU A;  3E0Y A;  3R7W A;  2L4R A;  1OTI A;  2L0W A;  3OCL A;  4WF0 A;  3H82 A;  3LUQ A;  5AVE A;  3LIF A;  4GHI A;  2P7J A;  2NUT C;  3MXQ A;  5G4Z A;  2EWW A;  3LIE A;  3T50 A;  3PXP A;  1P0Z A;  2W1T B;  3FC7 A;  5MC7 A;  1XFN A;  4EU0 A;  3F1P A;  2NUP C;  1F5M A;  3UB6 A;  2V0W A;  2V1B A;  2XA7 M;  2QJ5 A;  4LPZ A;  2O9A A;  3LR5 A;  4L9E A;  5F68 A;  2PYR A;  4EQ1 A;  3E4O A;  2WKP A;  1MC0 A;  3BY9 A;  4HIA A;  2K7S A;  1W63 M;  4GLQ A;  4BMW A;  2O0Y A;  4L9F A;  1H8M A;  4LRZ E;  2W1T A;  3MQ0 A;  3E4P A;  4HJ6 A;  4G3V A;  2P08 A;  1LSX A;  4PKY A;  4CLC A;  3C38 A;  3H82 B;  1STZ A;  3OOV A;  4OOL A;  1TS7 A;  4B93 A;  2KDK A;  5TBM B;  4JGR A;  3R7W B;  1EW0 A;  2P04 A;  2W27 A;  4WLA A;  1IFQ A;  2OOL A;  4HHD A;  3NHQ A;  1P97 A;  3F1N B;  4NXG A;  4R3A A;  5A8B A;  5HSQ A;  2A2L A;  5CX7 A;  1D7E A;  1DRM A;  4WUJ A;  3P01 A;  3CUE C;  4G3W A;  5DFY A;  5C5K A;  5F5Y A;  5I5L A;  4Y3I A;  4O8G A;  2HF6 A;  2VLG A;  5J3W A;  3IS2 B;  3BY8 A;  4EET B;  4HOI A;  3LIC A;  3K3D A;  3EGD C;  1OJG A;  2OAP 1;  3IBJ A;  2ZOH A;  4R38 A;  2HV1 A;  1TD5 A;  4I3A A;  4WL9 A;  1N9O A;  3W2Z A;  2YKH A;  1ZHH B;  3D72 A;  4ME4 A;  4QPR A;  4EUV A;  4UQI M;  4Q0I A;  3C30 A;  2O9B A;  5K5B A;  3EEA A;  1TS6 A;  3LIB A;  4IUH A;  3C8C A;  5L8M A;  1LSW A;  3FG8 A;  2XRO A;  1YAX A;  3CUE A;  1GSV A;  5DJT A;  3LFV A;  3EQU A;  2INW A;  2H28 A;  4EEU A;  1OTE A;  2QKP A;  1YKD A;  3DBA A;  1T1A A;  3A0R A;  4BBV A;  3F1O B;  4GW9 A;  3ULF A;  4DJ3 A;  3A0S A;  3BQ8 A;  3HJI A;  2J3W A;  2V0U A;  1W63 Q;  3TW8 A;  5DKK A;  3KSI A;  3LIA A;  4MN6 A;  2DMW A;  3T4O A;  3KYZ A;  1H3Q A;  4L0L A;  4HY8 A;  3D3O A;  4XT2 B;  2PT7 A;  1F98 A;  2GZA A;  3LI8 A;  2G7U A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...