1X0OA

Human arnt c-terminal pas domain
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
119
structure length
119
Chain Sequence
b'GAMDNVCQPTEFISRHNIEGIFTFVDHRCVATVGYQPQELLGKNIVEFCHPEDQQLLRDSFQQVVKLKGQVLSVMFRFRSKNQEWLWMRTSSFTFQNPYSDEIEYIICTNTNVKNSSQE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Aryl hydrocarbon receptor nuclear translocator
publication title Structural Basis of ARNT PAS-B Dimerization: Use of a Common Beta-sheet Interface for Hetero- and Homodimerization.
pubmed doi rcsb
molecule tags Transcription
total genus 33
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2005-03-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14598 PAS_11 PAS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 1x0oA01
3A0VA 3EWKA 3H82A 4EEPA 5IU1A 1OT9A 3A0SA 4KUOA 2BASA 3A0RA 5F69A 4HI4A 4PKYA 2R78A 5J7EA 3BWLA 2PHYA 1XJ6A 1GSWA 1UGUA 2L0WA 3CLOA 4L9EA 4NXFA 3CWFA 3UMEA 3MQOA 1TS7A 1XJ2A 2HV1A 3ULFA 3LUQA 3VE3A 5AVFA 4WN5A 1NWZA 3P7NA 3RH8B 4BBVA 1DP9A 1GSXA 4HIAA 4F3LA 2PD8A 1F98A 5HZHA 1S1YA 3LYXA 2M1CA 4BBUA 1TS8A 3LIEA 4JGPA 5G4YA 3K3CA 2W27A 3VOLA 2INWA 4LRZE 2PYRA 4JGRA 4L9FA 4BBTA 2PDRA 5A8BA 2Z6DA 3KX0X 5F5YA 1T1BA 3C8CA 3FG8A 1X0OA 4I38A 4R6LA 4HY8A 3RTYA 5G4ZA 1LT0A 3SW1A 4JGOA 3LIFA 3NJAA 4HJ4A 3NHQA 2QHKA 5DKLA 3GECA 1UWPX 2CMNA 2L1MA 1EW0A 2I9VA 1DP6A 3LIBA 2OWHA 3CAXA 1MZUA 3IS2B 3T50A 3E4PA 1DP8A 4HQAA 3UB7A 3MQQA 3UB6A 3PHYA 5HDCA 3G6OA 2KX6A 4M4XA 4EETB 3FC7A 2PYPA 4HP4A 3NOUC 3E4OA 1D06A 2JN7A 4H6JA 2WKQA 1ODVA 5HWVA 4MN5A 2A24B 4LRXC 4GW9A 4MN6A 2VV8A 3LI8A 1N9NA 5HDDA 3ZQ5A 2V0UA 4XT2B 1LSWA 3F1OB 4RQ9A 4I5SA 4K08A 3IS2A 4NXEA 1XJ4A 4EW7A 3HJIA 1T1CA 2VV6A 2VV7A 3H7WB 4I3JA 1T18A 5EFWA 2QWSA 5HWTA 4LRYC 5HD3A 1OTAA 4DJ2A 3MFXA 5J4EA 1OJ5A 4WLAA 1TS0A 5J3WA 2J80A 3D72A 1VB6A 4L9GA 1GSVA 1UWNX 4I3IA 1OTBA 1S4SA 3HJKA 4NXGA 1JNUA 4GHIB 2A24A 2H28A 2B02A 1BYWA 3E4QA 4EXOA 1Y28A 1XFQA 4YWZA 3UE6A 4KQDA 3BY9A 1D7EA 2WKRA 3K3DA 3ICYA 4XT2A 2QJ7A 2OOLA 4B9OA 2GJ3A 4WUJA 2P7JA 2PD7A 2V1AA 1OTIA 4EESA 5IS1A 4HJ3A 3GDIA 3MJQA 5I5LA 1TS6A 1N9OA 2YKHA 3B33A 4HNBA 4WF0A 1T1AA 2K7SA 4NXBA 3BY8A 4LPZA 2L4RA 4HH3A 5HDSA 1OT6A 5HD5A 1XJ3A 4GHIA 1OTEA 5DJTA 4PKYG 5TBMB 1F9IA 3EEHA 4HH2A 2YKFA 1S66L 3LIDA 3MR0A 2VEAA 4R70A 1DRMA 3LI9A 3F1NB 1LSVA 2V0WA 5DJUA 4I3AA 2D01A 3NOPC 2VLGA 3LIAA 4HP9A 4WL9A 4EQ1A 1WA9A 4JGQA 1V9ZA 1LSXA 2V1BA 3C2WA 2Z6CA 3VE4A 4GS9B 3UB8A 2PR5A 1S4RA 3F1PB 4HHDA 1OJGA 3NOTC 1P0ZA 2JHEA 4HOIA 3UB9A 2ZOHA 4LLOB 1V9YA 3UMDA 3LICA 3IBRA 2ZBBA 4I39A 2QKPA 5TBMA 4DJ3A 3H82B 4GCZA 4EERA 4R38A 3F1NA 5F68A 2W0NA 3H9WA 2V9AA 3PYPA 4EEUA 3F1OA 2D02A 1S1ZA 5HWWA 1XFNA 4H6JB 1T19A 1LL8A 3H7WA 3OLOA 5HSQA 4GS9A 5DKKA 1OTDA 3F1PA 4R3AA 2OWJA 2EA9A 1N9LA 1KOUA 5F6AA 3MXQA 4E04A 2PR6A 4F3LB 2WKPA 4KUKA 2QJ5A 1G28A 1P97A 5AVEA 4HJ6A 5KIZA 2KDKA 2ZOIA 1S67L
chains in the Genus database with same CATH superfamily
2H0TA 1JTGA 3A0VA 2JKTM 1E4DA 3IWQA 1J9MA 5GLCA 3IX8A 3FV7A 2FZ0A 4PM8A 2BASA 2VKSA 3QP8A 2JKRI 5GLBA 2XD5A 3BJNA 2R78A 5GHXA 1GSWA 1DJBA 3O5YA 2L0WA 3CLOA 1KGEA 5M19A 5FATA 3ZG9B 2WZZA 4GD8A 4WN5A 3NCKA 3BFGA 1HLUP 1G6AA 3CPTB 3DTIA 4UA9A 3MF0A 4BBVA 1YSQA 4HIAA 5EVIA 1ES3A 3RXXA 1S6RA 4OQ0A 1K55C 5E2GA 4UQIS 4BBUA 3N7WA 4WYYA 3C4OA 3LIEA 3UE1A 1TF1A 2XFSA 4JGPA 5FQIA 5G4YA 4EBLA 4EUZA 3VFFA 3G2YA 5EVID 2W27A 3VOLA 2Q9NA 3W4OA 1PWDA 1K56A 4Z1WA 1L0EA 4BBTA 3MZEA 1D1JA 4GLQA 3P01A 5HFOA 3A3EA 3GV9A 4PHTA 4IJGA 4JF4A 3FG8A 2PT7A 4KZ4A 1YAXA 1K56D 3UO9A 2Y4AA 1LT0A 3E2KA 3QNBA 4S2KA 3NHQA 2QHKA 2HDSA 1SCWA 3C4PA 3GECA 2L1MA 1EW0A 3IHBA 3UN7A 5FQ9A 5F83A 1IOUA 1GA9A 4OVDA 5DTTA 4FTXA 4B93A 4PAUA 3O86A 4S2LA 3VFHA 3G2ZA 2V8FA 2HDRA 3VP1A 4M4XA 2HP6A 2PYPA 1HVBA 5CGXA 2Y2NA 2PBDP 3WS4A 5EM0A 3W8KA 1FR1A 1CF0A 3WRZA 1HD8A 4IBXA 2WKQA 4KZ9A 2A24B 1CK3A 3GTCA 1SHVA 4GW9A 1Z09A 1AWIA 4PM7A 2VV8A 1N9NA 4O7DA 4JXSA 2EX9A 2V0UA 4I5SA 2WGWA 4X55A 1W63M 1XJ4A 4WZ5C 1NRJA 3S1YA 4EW7A 1T1CA 3VP3A 5CGWA 1BLHA 4UQIM 1DY6A 1LI0A 3M2JA 4C6YA 2QWSA 5HWTA 2Y2HA 1YM1A 2HP9A 2EWVA 3QP2A 4IUKA 3HUOA 4QD4A 3PXPA 4WLAA 1TS0A 3D4FA 1WYBA 3A3FA 3PR6A 5GHZA 3HL9A 4ZTKA 2Y79A 4WELA 3HJKA 5EECA 4QY6A 4B4ZA 5HAPA 4N9LA 2X71A 3N4IA 4R1GA 4FD8A 3E4QA 1Q2QA 1XFQA 4YWZA 4X6TA 3FPWA 2VA0A 2ZC3B 5M18A 1NZOA 2P7JA 3UPOA 3BYDA 3GDIA 5I5LA 1YLZA 5DF8A 1MPLA 1TS6A 1N9OA 2CC1A 2J3WA 1XP4A 2YKHA 3G31A 1KVMA 1K54A 5A93A 4ETZA 4DDYA 3BQ8A 3FKVA 3T4SA 3Q7VA 4ME4A 3P98A 3T4LA 3JVUA 2HF6A 4NXBA 3E98A 3BY8A 2V2FF 5HL6A 4HEFA 5HDSA 4BD1A 2V20A 4LENA 4HBUA 4EUVA 1OT6A 5HPIA 5TR7A 4GOGA 3BFDA 5DTKA 5FAPA 4PKYG 5TBMB 3CUEA 1W79A 3LIDA 4PM6A 4PM5A 1EROA 3ZG0A 1H8YA 1I2SA 3MR0A 5DF7A 3LI9A 1JWPA 4KZ5A 3BFCA 2OSUA 2VLGA 4JGQA 2X01A 4EV4A 4GN2A 5CRFA 4MEZA 4KQQA 2DCFA 4LV0A 5FEGA 4JXGA 4DKIA 1DJCA 1NYMA 3F1PB 5F82A 2ZLYA 5HW3A 4OONA 4MDZA 1HTZA 2HDQA 4UAAA 2EX6A 3SH7A 3UB9A 3ZG8B 4HBTA 3V5MA 1NJ4A 3MKEA 3LICA 1BSGA 2ZBBA 4I39A 1J3WA 3VSLA 1JVJA 4O01A 1F5MA 5CGSA 4DRTA 2G2UA 4GCZA 5GLAA 2GZAA 4EERA 4U0TA 2VGLS 3CMZA 1JTDA 3F1NA 5CTNA 2OV5A 1PWGA 3H9WA 3A3IA 3F1OA 2P9VA 2WKHA 4QHCA 4NG2A 5FQKA 3VP4A 4H6JB 2XFTA 1IYOA 1BTLA 3TW8A 2W3DA 4R3AA 3CI6A 1K6RA 4DF6A 3ZVTA 3ZDJA 2VZWA 4E6WA 4CPKA 1N9LA 3VMAA 1KOUA 5F6AA 4OQIA 2QZ6A 2ZL1A 1TVFA 4E04A 1W5DA 4BENA 2W3EA 2OLUA 2PR6A 4F3LB 2DRWA 4D2OA 1SKOB 3D9YA 4H8RA 3DTMA 1G28A 2P04A 1P97A 1K57A 5AVEA 4E6XA 2W1TA 5CX7A 4Y17A 2B5RA 4EEPA 1S0WA 4F94A 5IU1A 2A2LA 3A0SA 1YLPA 2QMIA 3A0RA 3T4OA 3EGXC 4BMWA 1YLJA 1PFLA 4FH4A 3HLEA 4JKTA 4B88A 5HPFA 3IXGA 3LR5A 1NY0A 4CLCB 3S4XA 1FQGA 3ZFZA 2VX8A 4U0XA 4QB8A 3MQOA 5AJGA 2HV1A 3QNCA 3LUQA 5KMWA 4ARZB 4GJ4A 3VOYA 2G2WA 4E3NA 2XK1A 4FSFA 3OPPA 4BWIA 5EOOA 2Z2LB 2ZQDA 2PD8A 2NUTC 3IT9A 3FYZA 4ZAMA 5HZHA 3KSHA 5KZHA 3T4JA 3W4QA 5L8MA 1W63Q 4MNRA 2J3TC 4ZBEA 3PBSA 4ZJ1A 3IHAA 1TS8A 2FFYA 3B47A 3NDEA 2MJ6A 1IKIA 5FI6A 3K3CA 3BFFA 4LV2A 4ZJ2A 4LRZE 1XGJA 1IEMA 4L9FA 2PDRA 1G6OA 3EQVA 2Z6DA 3BQAA 2VGLM 2K2NA 4WMCD 2HP5A 1VQQA 3ZYTA 5A92A 5IT5A 1TDLA 1K0KA 1X0OA 3Q81A 4PPRA 4R6LA 3KSIA 2ZQCA 3LIFA 3O87A 4KZBA 2BLSA 1CEGA 4OPQA 3OC2A 2Y8HA 5DFXA 3HREA 3IS2B 3A3JA 1STZA 4FUWA 1GHIA 2WGIA 4JXWA 3IBJA 1VETB 3BEBA 4GZBA 1MC0A 4LCMA 3PHYA 1MWSA 3HUMA 5DF9A 3VSKA 1FOFA 4OLDA 4HP4A 5FQQA 3E4OA 1H0MA 4GDBA 2Q9MA 3HLDA 4E3MA 4RA7A 4OOMA 1Y4OA 3Q07A 2GNXA 5E2EA 1IYPA 4N1XA 2EX2A 2ZMAA 1BLCA 3Q82A 3M2KA 4OKPA 5CHJA 2C5WB 4Q0HA 4FH2A 1LSWA 3DTEA 2W3FA 3EOIA 2WGVA 4ID4A 2VV7A 4KZAA 4I3JA 2X02A 2DMWA 4LV1A 4LRYC 4OPZA 1OTAA 4DJ2A 2Y55A 4LV3A 3MFXA 2PAVP 3IXHA 1CEFA 2J80A 3D72A 4L9GA 1UWNX 5JYPA 2ZJ9A 2WKEA 3NI9A 4UEYA 4NXGA 3OBFA 1JNUA 3IXDA 2A24A 4GHIB 2H28A 4CQHA 2J9OA 1BYWA 4Y0TA 1D7EA 1PI4A 2WKRA 5CEBA 3OOVA 4E3KA 3FPVA 4UA6A 1VEUA 4B9OA 4WUJA 1NZUA 3ZHHA 3P09A 3DWKA 1ZC2A 3MJQA 3MSHA 1RP5A 2V1ZA 5KSCA 1ONHA 4HNBA 3VV4A 3U2AA 4C3QA 2O9AA 4X56A 4DE1A 3T4QA 2XR0A 5EVIB 4MCWA 1L2SA 1FCNA 3RJUA 3N8SA 3T4TA 3HVFA 3K2NA 1JWVA 3MXRA 5CERA 2ZM2A 5HD5A 3EEHA 4BL3A 4OOLA 4KQRA 3LEZA 2OAQ1 4WM9A 3S7PA 3VP2A 4R70A 1WE4A 3MS6A 1LSVA 2V0WA 4I3AA 2D01A 3NDGA 5EM1A 3NOPC 4EQ1A 4ZRRA 1WA9A 1RGYA 1U60A 1V9ZA 3IF5A 1QMEA 5EVIC 2JE5A 2V1BA 2Z6CA 4R3BA 3VE4A 4FOFA 5I94A 4YINA 2EFXA 3UB8A 3T12B 1IYQA 2PR5A 1S4RA 2W3HA 2EXAA 5HL1A 4IUHA 1OJGA 1RGZA 3TSGA 2O9CA 2HJ9C 3UPPA 3NOTC 3PAEA 1P9RA 2JHEA 3S7NA 5D3OA 3HLFA 4LLOB 5FAOA 5AQ9A 1XA7A 2VK3A 3BECA 3BRMA 4X25A 3EGDC 1KGFA 5HX9A 2B18A 5DVAA 2WK0A 5TBMA 5LBRA 4S2JA 4Y15A 3RXWA 1ZG4A 3H82B 3NC8A 5K5BA 1Q2PA 4MBHA 2XRNA 5F68A 2JKTI 2W0NA 4A5RA 3SH9A 3TRCA 3PBTA 1KDSA 5HWWA 1XFNA 3I7JA 4PM9A 3IX4A 3H7WA 3HBRA 5DKKA 3HLBA 3F1PA 2OWJA 3ISGA 3TG9A 3OPHA 4IVKA 4K0XA 2PU4A 3KO6A 3MXQA 3DWZA 2P74A 4MN7A 4JF6A 2E8IA 5U47A 4IBRA 4N1HA 3IXBA 1PWCA 4IHQA 4KUKA 2ZQ9A 2QJ5A 1H3QA 5CXWA 1PIOA 3N8RA 5KIZA 1L0DA 3HCYA 4L0LA 4R23A 1UGUA 1MWTA 4EU0A 3EWKA 3R7WB 1MWUA 5EVLA 2I72A 3CJMA 1FILA 3WRTA 3BLMA 4HI4A 3BWLA 3VP0A 3SH8A 5CHMA 4OQHA 4JF5A 5EVEA 2Y2LA 4L9EA 4NXFA 3V50A 5HAQA 3CWFA 1XGIA 3VE3A 5AVFA 4QPRA 1HZOA 1BULA 3MZFA 4S2OA 3P7NA 2H0YA 3RH8B 2R9WA 1GSXA 1SKFA 2IA2A 2OLVA 5A91A 1ZTUA 4F3LA 4G3KA 1VM1A 4KG2A 3CZDA 2ZQAA 3PBOA 1SDEA 2XA7S 1SKOA 1O07A 3LYXA 5F1FA 4P87A 2LB5A 3WS1A 5L10A 2IWBA 3TJZC 4OQGA 1H8MA 1PW8A 2JCHA 1L3LA 1MKMA 4KG6A 2OAP1 3O3VA 2XD1A 4KENB 2HPBA 3IF6A 4E3IA 1IKGA 5EV0A 1ES5A 5A8BA 5CECA 3BW6A 3KX0X 2K31A 5C5KA 2Y2IA 2VJWA 1T1BA 4S2NA 4Q0JA 3C8CA 5J8XA 2WUQA 4I38A 4ARZA 3RTYA 4JGOA 3NJAA 4HJ4A 5AQBA 2IWDA 3AGFA 2KLIA 5DKLA 1UWPX 3HLCA 2KOIA 4CLCD 2CMNA 1K54C 4MBFA 1GCEA 1DP6A 4B4XA 1RCJA 1NYYA 3CAXA 1MZUA 5CTMA 3T1QB 3T50A 4II7A 3E4PA 1DP8A 4HQAA 3MQQA 3UB6A 4X69A 3BFEA 3S7QA 2EX8A 4CLCE 2KX6A 5TJJA 2XH9A 5JYOA 3KYZA 4JBFA 5GLDA 3SZTA 4EETB 4KZ3A 3CUEC 4S2PA 2ACGA 5BOHA 3UE0A 2A3UA 4JXVA 3PBNA 2H10A 3UDFA 1MWRA 1XKZA 3A3DA 1D06A 2JN7A 3LCEA 4ZJ3A 4P85A 1DJAA 3V39A 4XXRA 5HWVA 4MN5A 4K91A 1ERMA 2JKGA 4KQOA 3UE3A 4R3JA 5EOEA 2Y2OA 4D60A 2V8CA 1F2KA 4XT2B 2O99A 3F1OB 4KZ7A 3VOZA 1KE3A 3IS2A 1YKDA 1L0GA 1ZHHB 3HJIA 3C38A 1MKIA 2VV6A 2XA7M 1VETA 3DTKA 1KVLA 5FI7A 4WMCA 5F1GA 2H5SA 2O9BA 3N6IA 2ZC4B 3AGDA 1LHYA 1YT4A 4R0QA 5HD3A 1K55A 4OPYA 2ZL1B 3V67A 4DE3A 2M7VA 3GVBA 3E0YA 2PU2A 2Z2MB 1PZOA 3IF6C 3JYIA 4JPMA 5EPHA 5DFYA 4I3IA 1Z6FA 4KG5A 3JVVA 4DXBA 3G32A 2W1TB 3GR2A 4X53A 2JBFA 1OPXA 2B02A 4EXOA 5FASA 5MC7A 3UE6A 4KQDA 2A49A 2R9XA 2C6WB 3CPTA 3K3DA 2QYBA 3SS5A 2NUPC 1MXOA 3FKWA 1QMFA 3EQUA 5AQAA 4GKUA 1OTIA 3T1SA 1KE0A 4EESA 5IS1A 4HJ3A 1WYCA 2WADA 1CI8A 1PZPA 5L07A 2ZD8A 3T4KA 3G4PA 1YLWA 3PBQA 4QWOA 3KSGA 3T1RA 2W1RA 1K57C 3LR0A 4OPRA 1W7FA 1KDWA 3MQ0A 4Y0OA 4HH3A 3M6HA 2WAFA 3DAVA 1BT5A 2Y2JA 3ZNTA 1H8ZA 2M7UA 5L2FA 4WBGA 2WZXA 4P6ZS 2ZQ7A 1XJ3A 4GHIA 2Y2MA 5DJTA 3LY4A 2Y2KA 1S66L 4WEKA 4BLMA 4U3TA 5HAIA 4DDSA 1NRFA 4DMZA 5DJUA 3GRJA 3ZGAB 3GQZA 3LIAA 1W8QA 3ZNYA 1TEMA 4NEED 4C75A 1LSXA 3C2WA 3MZDA 4BJPA 1KGGA 4E3LA 1OMEA 4GS9B 3S7OA 1ESUA 4NK3A 4HHDA 2WAEA 5IHVA 3HUNA 2ZC5B 4WZ5A 3WS2A 4DE0A 1O7EA 4MBKA 1K38A 3LGOA 4QU3A 2BTFP 4RVAA 2P08A 4HOIA 2E8JA 3CHWP 2ZOHA 1E25A 3GSGA 2J9PA 2WYXA 3UMDA 2GDNA 3IBRA 2EWWA 1FCMA 2XLNA 3BLSA 1AXBA 4X1LA 3C7UA 3HLWA 4WEJA 3W4PA 2XF3A 3GMWA 1YPRA 5FSRA 5E43A 4G3WA 4DN0A 3PYPA 2V9AA 3UPNA 4R4RA 4P0MA 4EEUA 2AVXA 2D02A 1VHMA 4G3VA 2XEPA 5CEDA 4S2IA 4PMAA 1BZAA 5TGFA 3ZCZA 3UB5P 1OTDA 3UNWA 3UY6A 2EA9A 5G18A 5FQMA 4M3KA 4FCFA 1PI5A 3NULA 1FSYA 2ZM0A 5EE8A 3L9KA 3IH8A 2Y2PA 2PBYA 3QHYA 2KDKA 4Q0IA 3LEQA 3HLGA 2J8YA 1XX2A 1S67L 2JC7A 3H82A 3LFVA 4P6ZM 3UDIA 4R4SA 1OT9A 4KUOA 3SOIA 2DNSA 5HARA 5F69A 2PRFA 3BM6A 1P9WA 1FCOA 1TD5A 4PKYA 4Y7PA 5J7EA 2PHYA 1XJ6A 2B95A 4Y2FA 3UMEA 3MBZA 3W2ZA 1TS7A 1K4FA 1XJ2A 3ULFA 3MXSA 4OH0A 3M6BA 4EWFA 1PW1A 1NWZA 3QP1A 1Y54A 3LY3A 3OCNA 4XUZA 1DP9A 1N4OA 2QPNA 1ES4A 1VEUB 1A0KA 2Y2QA 1F98A 4MLLA 1S1YA 2M1CA 1K4EA 1N9BA 3QP5A 4WZ4A 5FA7A 3R7WA 4NETA 2ZC6B 1FIKA 5M1AA 4KZ8A 2VGJA 2INWA 1MY8A 2PYRA 1EWZA 4JGRA 3PTEA 3QP6A 5F5YA 4XUXA 1XPBA 1FSWA 4N9KA 4QY5A 2O0YA 4RX2A 3ITBA 1NLYA 3ZG5A 4HY8A 4YOFA 5G4ZA 3SW1A 3V3SA 2ZM8A 1ZKJA 3DW0A 1KE4A 4GD6A 3Q7ZA 3IX3A 2I9VA 1G68A 1M40A 2RCXA 3LIBA 2OWHA 2GX5A 2WGWB 3ZG7B 3UB7A 4Z9QA 1E3UA 3C7VA 3UDXA 1BUEA 5HDCA 3G6OA 2EXBA 3OZHA 3WS0A 3MKFA 3PAGA 3CITA 2IWCA 1LLBA 2HJEA 1YSPA 4BD0A 2BG1A 5AQ7A 1PNEA 4ETXA 4Y13A 3FC7A 5E2HA 1IFQA 1W8YA 3NOUC 4E3JA 1E3UD 3NBLA 4RX3A 2ZMVA 1MBLA 1JWZA 1LL5A 4AFIA 3QP4A 4H6JA 2G7UA 1ODVA 4LRXC 4K0WA 2WKIA 4GDNA 1I2WA 4MN6A 1GA0A 1IYSA 3LI8A 2LB9A 3NY4A 5HDDA 3ZQ5A 1YLTA 4RQ9A 4K08A 3PBRA 1C3BA 4NXEA 4Q8IA 3OCLA 2UWXA 4OOYA 1M6KA 4N92A 3H7WB 3TOIA 1YLYA 1ALQA 1T18A 3KYEA 4LFUA 5EFWA 2W3GA 4RYEA 1FR6A 3Q7VB 2JKRM 3ITAA 3SS3A 4GB7A 3RFBA 1K6SA 1CJFA 5J4EA 1OJ5A 1GHMA 5J3WA 5CHUA 3CG5A 1VB6A 1GSVA 3E2LA 4CLCA 1OTBA 1S4SA 4CJNA 3S22A 5GL9A 3WWXA 4KZ6A 3OPRA 2J3TD 1Y28A 3KSFA 3LR4A 2XROA 3BY9A 2Y59A 4LGWA 5E2FA 4P6BA 3ICYA 4XT2A 2QJ7A 1L0FA 2OOLA 2GJ3A 3IWOA 2PD7A 2V1AA 3JPUA 3WS5A 4X68A 2ZC7A 5DTSA 3L7HA 3OPLA 5FQJA 1LI9A 2VGKA 3O88A 4EBNA 3B33A 4IVIA 4NKPA 4ZDXA 3G30A 2HGVA 4Y3IA 4WF0A 1T1AA 2K7SA 2XSSA 4DXCA 4Y5FA 4LPZA 2L4RA 1SDNA 2ZQ8A 2EFUA 4JLFA 3IWIA 3NIAA 3LO7A 5FDSA 2XGNA 3FWLA 3B42A 1OTEA 1F9IA 4HH2A 2YKFA 3NECA 3V3RA 3IF6B 1I5QA 2J7VA 5A90A 2VEAA 3IH9A 1XXMA 4EBPA 3G34A 3U4LP 5FEFA 1DRMA 3F1NB 1GHPA 2HDUA 3G35A 5L09A 2HZ5A 4HP9A 4WL9A 2P9VB 2XDMA 3T1XA 1NLZA 3EEAA 1BLSA 2ZMFA 1YMXA 1ES2A 4YNRA 3SS4A 2JKFA 2Q0OA 5FI2A 3LR3A 1P0ZA 4E3OA 5FL3A 4UHUA 4DE2A 1LL9A 4QJGA 5FAQA 4HESA 1V9YA 3ZVWA 1SZVA 4Y0UA 2QKPA 1PRQA 1YMSA 2FH5A 3B3XA 4DJ3A 4CLCC 4BQMA 1PYYA 3D3OA 4S2NC 4IEDA 4S2MA 1BLPA 4R38A 1ACFA 3R4KA 1CQAA 5KSHA 1ESIA 3N8LA 4EQIA 1XA1A 1EI5A 2XQZA 3C30A 1S1ZA 1ZG6A 2UV0E 3FZCA 1G5UA 2Y91A 1T19A 1TDGA 1LL8A 1K25A 2FFFB 3OLOA 3Q1FA 4MMNA 5HSQA 4GS9A 5EUAA 4ESPA 1ERQA 3MFDA 4OP5A 1NXYA 4YFMA 5FDHA 4OP8A 1IELA 3C5AA 1YQSA 3MMHA 1H5XA 5TFQA 3TE8A 4O0PA 2WKPA 3DBAA 4GNUA 4UA7A 3KYQA 4LCLA 4BL2A 4OLGA 1ONGA 3AGEA 4O8GA 4HJ6A 3IQAA 1CI9A 2RL3A 4X1MA 5GHYA 2ZOIA 2Y2GA
chains in the Genus database with same CATH topology
3A0VA 2JKTM 3EWKA 3H82A 3LFVA 4P6ZM 4EEPA 3R7WB 5IU1A 2A2LA 1OT9A 3A0SA 4KUOA 2FZ0A 2BASA 3A0RA 5F69A 3T4OA 2VKSA 3EGXC 4BMWA 4HI4A 2JKRI 1P9WA 1TD5A 3BJNA 4PKYA 2R78A 5J7EA 3BWLA 2PHYA 1XJ6A 5HPFA 1GSWA 1UGUA 3LR5A 3O5YA 2L0WA 3CLOA 4CLCB 4Y2FA 4L9EA 4NXFA 2VX8A 3CWFA 3UMEA 3MQOA 5AJGA 1TS7A 3W2ZA 1XJ2A 2HV1A 3ULFA 3LUQA 3VE3A 5AVFA 4QPRA 4WN5A 4ARZB 4GJ4A 1NWZA 3P7NA 3RH8B 4FSFA 4BBVA 3MF0A 4BWIA 1YSQA 3OCNA 1DP9A 1GSXA 4HIAA 2IA2A 1ZTUA 4F3LA 2PD8A 4G3KA 2NUTC 3PBOA 1F98A 5HZHA 2XA7S 3KSHA 1S1YA 3T4JA 5L8MA 3LYXA 2M1CA 1W63Q 2J3TC 3PBSA 4UQIS 2LB5A 4BBUA 1TS8A 3B47A 3TJZC 3LIEA 1H8MA 2MJ6A 1TF1A 4JGPA 1MKMA 5G4YA 2OAP1 3R7WA 3K3CA 2W27A 3VOLA 2INWA 4LRZE 4Z1WA 2PYRA 4JGRA 4L9FA 4BBTA 2PDRA 5A8BA 1G6OA 3EQVA 2Z6DA 3BW6A 3KX0X 3BQAA 2VGLM 4GLQA 2K2NA 2K31A 5F5YA 5C5KA 3P01A 2VJWA 3ZYTA 1T1BA 4PHTA 4Q0JA 3C8CA 4IJGA 2O0YA 5IT5A 3FG8A 2PT7A 1NLYA 1X0OA 4I38A 4R6LA 1YAXA 4HY8A 4ARZA 3RTYA 3KSIA 4YOFA 1LT0A 5G4ZA 3SW1A 4JGOA 3LIFA 3NJAA 4HJ4A 2KLIA 3NHQA 2QHKA 5DKLA 3GECA 1UWPX 2KOIA 4CLCD 2CMNA 2L1MA 1EW0A 2I9VA 3OC2A 1DP6A 1IOUA 2Y8HA 5DFXA 3LIBA 2OWHA 2GX5A 3CAXA 1MZUA 4B93A 3IS2B 1STZA 4PAUA 3T50A 4II7A 3E4PA 1DP8A 4HQAA 3UB7A 3MQQA 3UB6A 3IBJA 1MC0A 3PHYA 5HDCA 3S7QA 3G6OA 2KX6A 4CLCE 5TJJA 3KYZA 4M4XA 3CITA 2HJEA 5DF9A 1YSPA 4EETB 4ETXA 3FC7A 3CUEC 2PYPA 1IFQA 4HP4A 3NOUC 3E4OA 2ZMVA 3PBNA 4AFIA 1D06A 4OOMA 2JN7A 4H6JA 2GNXA 2G7UA 2WKQA 1ODVA 5HWVA 4MN5A 2A24B 4LRXC 4KQOA 3UE3A 4GW9A 4MN6A 2VV8A 3LI8A 1N9NA 2LB9A 5HDDA 3ZQ5A 2V0UA 4Q0HA 4XT2B 1LSWA 2O99A 3F1OB 4RQ9A 4I5SA 2W3FA 4K08A 3PBRA 1W63M 3IS2A 4NXEA 1XJ4A 1YKDA 3EOIA 3OCLA 1NRJA 1ZHHB 4EW7A 3HJIA 1T1CA 3C38A 2VV6A 2XA7M 2VV7A 3H7WB 4I3JA 1T18A 4UQIM 2O9BA 2DMWA 5EFWA 2QWSA 5HWTA 2W3GA 4LRYC 5HD3A 2JKRM 1OTAA 2EWVA 4DJ2A 3V67A 3MFXA 4IUKA 2M7VA 3RFBA 3E0YA 5J4EA 1OJ5A 3PXPA 4WLAA 1TS0A 5J3WA 2J80A 3PR6A 3D72A 1VB6A 4L9GA 5DFYA 1GSVA 1UWNX 4CLCA 4I3IA 1OTBA 2Y79A 1S4SA 3JVVA 2W1TB 4WELA 3HJKA 4UEYA 3OBFA 1JNUA 4GHIB 4NXGA 1OPXA 2A24A 2H28A 4CQHA 2J3TD 2B02A 1BYWA 3E4QA 4EXOA 1Y28A 3KSFA 1XFQA 3LR4A 4YWZA 3UE6A 5MC7A 4KQDA 2XROA 3BY9A 1D7EA 2WKRA 3K3DA 2QYBA 2NUPC 3FPWA 3OOVA 2VA0A 3ICYA 4XT2A 2QJ7A 3FPVA 3EQUA 2OOLA 4B9OA 2GJ3A 4WUJA 2P7JA 2PD7A 2V1AA 1OTIA 4EESA 5IS1A 4HJ3A 3GDIA 3MJQA 5I5LA 1TS6A 1N9OA 2J3WA 2YKHA 4ETZA 3B33A 3BQ8A 3T4KA 4NKPA 3PBQA 3T4SA 3KSGA 2HGVA 4HNBA 4Y3IA 3VV4A 4ME4A 2W1RA 4WF0A 3U2AA 1T1AA 2O9AA 3JVUA 3T4LA 2K7SA 3LR0A 2HF6A 4NXBA 3T4QA 2XSSA 4MCWA 3E98A 3BY8A 4Y5FA 4LPZA 5HL6A 2L4RA 3T4TA 3MQ0A 4HH3A 5HDSA 3K2NA 2M7UA 3B42A 4P6ZS 4EUVA 1OT6A 5HPIA 5HD5A 1XJ3A 4GHIA 1OTEA 4EU0A 5DJTA 4PKYG 5TBMB 3CUEA 1F9IA 3EEHA 4HH2A 2YKFA 1S66L 4OOLA 4WEKA 3LIDA 2OAQ1 3MR0A 2VEAA 3S7PA 4R70A 1DRMA 3LI9A 3F1NB 1LSVA 2V0WA 5DJUA 4DMZA 4I3AA 2D01A 3NOPC 2VLGA 3LIAA 4HP9A 4WL9A 4EQ1A 4ZRRA 1WA9A 4JGQA 4NEED 1V9ZA 1NLZA 3EEAA 1LSXA 2V1BA 3C2WA 2Z6CA 4BJPA 3VE4A 2ZMFA 4FOFA 4GS9B 3S7OA 3UB8A 2PR5A 1S4RA 2W3HA 4YNRA 3F1PB 4HHDA 4IUHA 1OJGA 2O9CA 2HJ9C 4MDZA 3NOTC 3LR3A 1P0ZA 1P9RA 5FL3A 2JHEA 2P08A 4HOIA 3S7NA 3UB9A 2ZOHA 4LLOB 1V9YA 3UMDA 3EGDC 3LICA 3IBRA 2EWWA 2ZBBA 4I39A 2QKPA 2B18A 5TBMA 4WEJA 2FH5A 5LBRA 4DJ3A 4CLCC 4O01A 3D3OA 1F5MA 3H82B 4GCZA 2GZAA 4EERA 5K5BA 2VGLS 4R38A 2XRNA 3F1NA 3R4KA 5F68A 2JKTI 2W0NA 5KSHA 4G3WA 4DN0A 3H9WA 2V9AA 3PYPA 4EEUA 3F1OA 3TRCA 3C30A 3PBTA 2D02A 1S1ZA 1VHMA 5HWWA 4G3VA 1XFNA 4H6JB 1T19A 1LL8A 3H7WA 3OLOA 4MMNA 5HSQA 3TW8A 4GS9A 5DKKA 1OTDA 3F1PA 2W3DA 4R3AA 2OWJA 3CI6A 2EA9A 2VZWA 1N9LA 1KOUA 5F6AA 3KO6A 3MXQA 4MN7A 4E04A 3MMHA 3TE8A 2W3EA 2PR6A 4O0PA 4F3LB 2WKPA 3DBAA 4IHQA 4KUKA 3KYQA 2QJ5A 1H3QA 1G28A 2P04A 1P97A 5AVEA 4O8GA 4HJ6A 5KIZA 2W1TA 2KDKA 4Q0IA 5CX7A 4L0LA 3HCYA 2ZOIA 1S67L
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3A0V A;  3EWK A;  3H82 A;  4EEP A;  5IU1 A;  1OT9 A;  3A0S A;  4KUO A;  2BAS A;  3A0R A;  5F69 A;  4HI4 A;  4PKY A;  2R78 A;  5J7E A;  3BWL A;  2PHY A;  1XJ6 A;  1GSW A;  1UGU A;  2L0W A;  3CLO A;  4L9E A;  4NXF A;  3CWF A;  3UME A;  3MQO A;  1TS7 A;  1XJ2 A;  2HV1 A;  3ULF A;  3LUQ A;  3VE3 A;  5AVF A;  4WN5 A;  1NWZ A;  3P7N A;  3RH8 B;  4BBV A;  1DP9 A;  1GSX A;  4HIA A;  4F3L A;  2PD8 A;  1F98 A;  5HZH A;  1S1Y A;  3LYX A;  2M1C A;  4BBU A;  1TS8 A;  3LIE A;  4JGP A;  5G4Y A;  3K3C A;  2W27 A;  3VOL A;  2INW A;  4LRZ E;  2PYR A;  4JGR A;  4L9F A;  4BBT A;  2PDR A;  5A8B A;  2Z6D A;  3KX0 X;  5F5Y A;  1T1B A;  3C8C A;  3FG8 A;  1X0O A;  4I38 A;  4R6L A;  4HY8 A;  3RTY A;  5G4Z A;  1LT0 A;  3SW1 A;  4JGO A;  3LIF A;  3NJA A;  4HJ4 A;  3NHQ A;  2QHK A;  5DKL A;  3GEC A;  1UWP X;  2CMN A;  2L1M A;  1EW0 A;  2I9V A;  1DP6 A;  3LIB A;  2OWH A;  3CAX A;  1MZU A;  3IS2 B;  3T50 A;  3E4P A;  1DP8 A;  4HQA A;  3UB7 A;  3MQQ A;  3UB6 A;  3PHY A;  5HDC A;  3G6O A;  2KX6 A;  4M4X A;  4EET B;  3FC7 A;  2PYP A;  4HP4 A;  3NOU C;  3E4O A;  1D06 A;  2JN7 A;  4H6J A;  2WKQ A;  1ODV A;  5HWV A;  4MN5 A;  2A24 B;  4LRX C;  4GW9 A;  4MN6 A;  2VV8 A;  3LI8 A;  1N9N A;  5HDD A;  3ZQ5 A;  2V0U A;  4XT2 B;  1LSW A;  3F1O B;  4RQ9 A;  4I5S A;  4K08 A;  3IS2 A;  4NXE A;  1XJ4 A;  4EW7 A;  3HJI A;  1T1C A;  2VV6 A;  2VV7 A;  3H7W B;  4I3J A;  1T18 A;  5EFW A;  2QWS A;  5HWT A;  4LRY C;  5HD3 A;  1OTA A;  4DJ2 A;  3MFX A;  5J4E A;  1OJ5 A;  4WLA A;  1TS0 A;  5J3W A;  2J80 A;  3D72 A;  1VB6 A;  4L9G A;  1GSV A;  1UWN X;  4I3I A;  1OTB A;  1S4S A;  3HJK A;  4NXG A;  1JNU A;  4GHI B;  2A24 A;  2H28 A;  2B02 A;  1BYW A;  3E4Q A;  4EXO A;  1Y28 A;  1XFQ A;  4YWZ A;  3UE6 A;  4KQD A;  3BY9 A;  1D7E A;  2WKR A;  3K3D A;  3ICY A;  4XT2 A;  2QJ7 A;  2OOL A;  4B9O A;  2GJ3 A;  4WUJ A;  2P7J A;  2PD7 A;  2V1A A;  1OTI A;  4EES A;  5IS1 A;  4HJ3 A;  3GDI A;  3MJQ A;  5I5L A;  1TS6 A;  1N9O A;  2YKH A;  3B33 A;  4HNB A;  4WF0 A;  1T1A A;  2K7S A;  4NXB A;  3BY8 A;  4LPZ A;  2L4R A;  4HH3 A;  5HDS A;  1OT6 A;  5HD5 A;  1XJ3 A;  4GHI A;  1OTE A;  5DJT A;  4PKY G;  5TBM B;  1F9I A;  3EEH A;  4HH2 A;  2YKF A;  1S66 L;  3LID A;  3MR0 A;  2VEA A;  4R70 A;  1DRM A;  3LI9 A;  3F1N B;  1LSV A;  2V0W A;  5DJU A;  4I3A A;  2D01 A;  3NOP C;  2VLG A;  3LIA A;  4HP9 A;  4WL9 A;  4EQ1 A;  1WA9 A;  4JGQ A;  1V9Z A;  1LSX A;  2V1B A;  3C2W A;  2Z6C A;  3VE4 A;  4GS9 B;  3UB8 A;  2PR5 A;  1S4R A;  3F1P B;  4HHD A;  1OJG A;  3NOT C;  1P0Z A;  2JHE A;  4HOI A;  3UB9 A;  2ZOH A;  4LLO B;  1V9Y A;  3UMD A;  3LIC A;  3IBR A;  2ZBB A;  4I39 A;  2QKP A;  5TBM A;  4DJ3 A;  3H82 B;  4GCZ A;  4EER A;  4R38 A;  3F1N A;  5F68 A;  2W0N A;  3H9W A;  2V9A A;  3PYP A;  4EEU A;  3F1O A;  2D02 A;  1S1Z A;  5HWW A;  1XFN A;  4H6J B;  1T19 A;  1LL8 A;  3H7W A;  3OLO A;  5HSQ A;  4GS9 A;  5DKK A;  1OTD A;  3F1P A;  4R3A A;  2OWJ A;  2EA9 A;  1N9L A;  1KOU A;  5F6A A;  3MXQ A;  4E04 A;  2PR6 A;  4F3L B;  2WKP A;  4KUK A;  2QJ5 A;  1G28 A;  1P97 A;  5AVE A;  4HJ6 A;  5KIZ A;  2KDK A;  2ZOI A;  1S67 L; 
#chains in the Genus database with same CATH topology
 2H0T A;  1JTG A;  3A0V A;  2JKT M;  1E4D A;  3IWQ A;  1J9M A;  5GLC A;  3IX8 A;  3FV7 A;  2FZ0 A;  4PM8 A;  2BAS A;  2VKS A;  3QP8 A;  2JKR I;  5GLB A;  2XD5 A;  3BJN A;  2R78 A;  5GHX A;  1GSW A;  1DJB A;  3O5Y A;  2L0W A;  3CLO A;  1KGE A;  5M19 A;  5FAT A;  3ZG9 B;  2WZZ A;  4GD8 A;  4WN5 A;  3NCK A;  3BFG A;  1HLU P;  1G6A A;  3CPT B;  3DTI A;  4UA9 A;  3MF0 A;  4BBV A;  1YSQ A;  4HIA A;  5EVI A;  1ES3 A;  3RXX A;  1S6R A;  4OQ0 A;  1K55 C;  5E2G A;  4UQI S;  4BBU A;  3N7W A;  4WYY A;  3C4O A;  3LIE A;  3UE1 A;  1TF1 A;  2XFS A;  4JGP A;  5FQI A;  5G4Y A;  4EBL A;  4EUZ A;  3VFF A;  3G2Y A;  5EVI D;  2W27 A;  3VOL A;  2Q9N A;  3W4O A;  1PWD A;  1K56 A;  4Z1W A;  1L0E A;  4BBT A;  3MZE A;  1D1J A;  4GLQ A;  3P01 A;  5HFO A;  3A3E A;  3GV9 A;  4PHT A;  4IJG A;  4JF4 A;  3FG8 A;  2PT7 A;  4KZ4 A;  1YAX A;  1K56 D;  3UO9 A;  2Y4A A;  1LT0 A;  3E2K A;  3QNB A;  4S2K A;  3NHQ A;  2QHK A;  2HDS A;  1SCW A;  3C4P A;  3GEC A;  2L1M A;  1EW0 A;  3IHB A;  3UN7 A;  5FQ9 A;  5F83 A;  1IOU A;  1GA9 A;  4OVD A;  5DTT A;  4FTX A;  4B93 A;  4PAU A;  3O86 A;  4S2L A;  3VFH A;  3G2Z A;  2V8F A;  2HDR A;  3VP1 A;  4M4X A;  2HP6 A;  2PYP A;  1HVB A;  5CGX A;  2Y2N A;  2PBD P;  3WS4 A;  5EM0 A;  3W8K A;  1FR1 A;  1CF0 A;  3WRZ A;  1HD8 A;  4IBX A;  2WKQ A;  4KZ9 A;  2A24 B;  1CK3 A;  3GTC A;  1SHV A;  4GW9 A;  1Z09 A;  1AWI A;  4PM7 A;  2VV8 A;  1N9N A;  4O7D A;  4JXS A;  2EX9 A;  2V0U A;  4I5S A;  2WGW A;  4X55 A;  1W63 M;  1XJ4 A;  4WZ5 C;  1NRJ A;  3S1Y A;  4EW7 A;  1T1C A;  3VP3 A;  5CGW A;  1BLH A;  4UQI M;  1DY6 A;  1LI0 A;  3M2J A;  4C6Y A;  2QWS A;  5HWT A;  2Y2H A;  1YM1 A;  2HP9 A;  2EWV A;  3QP2 A;  4IUK A;  3HUO A;  4QD4 A;  3PXP A;  4WLA A;  1TS0 A;  3D4F A;  1WYB A;  3A3F A;  3PR6 A;  5GHZ A;  3HL9 A;  4ZTK A;  2Y79 A;  4WEL A;  3HJK A;  5EEC A;  4QY6 A;  4B4Z A;  5HAP A;  4N9L A;  2X71 A;  3N4I A;  4R1G A;  4FD8 A;  3E4Q A;  1Q2Q A;  1XFQ A;  4YWZ A;  4X6T A;  3FPW A;  2VA0 A;  2ZC3 B;  5M18 A;  1NZO A;  2P7J A;  3UPO A;  3BYD A;  3GDI A;  5I5L A;  1YLZ A;  5DF8 A;  1MPL A;  1TS6 A;  1N9O A;  2CC1 A;  2J3W A;  1XP4 A;  2YKH A;  3G31 A;  1KVM A;  1K54 A;  5A93 A;  4ETZ A;  4DDY A;  3BQ8 A;  3FKV A;  3T4S A;  3Q7V A;  4ME4 A;  3P98 A;  3T4L A;  3JVU A;  2HF6 A;  4NXB A;  3E98 A;  3BY8 A;  2V2F F;  5HL6 A;  4HEF A;  5HDS A;  4BD1 A;  2V20 A;  4LEN A;  4HBU A;  4EUV A;  1OT6 A;  5HPI A;  5TR7 A;  4GOG A;  3BFD A;  5DTK A;  5FAP A;  4PKY G;  5TBM B;  3CUE A;  1W79 A;  3LID A;  4PM6 A;  4PM5 A;  1ERO A;  3ZG0 A;  1H8Y A;  1I2S A;  3MR0 A;  5DF7 A;  3LI9 A;  1JWP A;  4KZ5 A;  3BFC A;  2OSU A;  2VLG A;  4JGQ A;  2X01 A;  4EV4 A;  4GN2 A;  5CRF A;  4MEZ A;  4KQQ A;  2DCF A;  4LV0 A;  5FEG A;  4JXG A;  4DKI A;  1DJC A;  1NYM A;  3F1P B;  5F82 A;  2ZLY A;  5HW3 A;  4OON A;  4MDZ A;  1HTZ A;  2HDQ A;  4UAA A;  2EX6 A;  3SH7 A;  3UB9 A;  3ZG8 B;  4HBT A;  3V5M A;  1NJ4 A;  3MKE A;  3LIC A;  1BSG A;  2ZBB A;  4I39 A;  1J3W A;  3VSL A;  1JVJ A;  4O01 A;  1F5M A;  5CGS A;  4DRT A;  2G2U A;  4GCZ A;  5GLA A;  2GZA A;  4EER A;  4U0T A;  2VGL S;  3CMZ A;  1JTD A;  3F1N A;  5CTN A;  2OV5 A;  1PWG A;  3H9W A;  3A3I A;  3F1O A;  2P9V A;  2WKH A;  4QHC A;  4NG2 A;  5FQK A;  3VP4 A;  4H6J B;  2XFT A;  1IYO A;  1BTL A;  3TW8 A;  2W3D A;  4R3A A;  3CI6 A;  1K6R A;  4DF6 A;  3ZVT A;  3ZDJ A;  2VZW A;  4E6W A;  4CPK A;  1N9L A;  3VMA A;  1KOU A;  5F6A A;  4OQI A;  2QZ6 A;  2ZL1 A;  1TVF A;  4E04 A;  1W5D A;  4BEN A;  2W3E A;  2OLU A;  2PR6 A;  4F3L B;  2DRW A;  4D2O A;  1SKO B;  3D9Y A;  4H8R A;  3DTM A;  1G28 A;  2P04 A;  1P97 A;  1K57 A;  5AVE A;  4E6X A;  2W1T A;  5CX7 A;  4Y17 A;  2B5R A;  4EEP A;  1S0W A;  4F94 A;  5IU1 A;  2A2L A;  3A0S A;  1YLP A;  2QMI A;  3A0R A;  3T4O A;  3EGX C;  4BMW A;  1YLJ A;  1PFL A;  4FH4 A;  3HLE A;  4JKT A;  4B88 A;  5HPF A;  3IXG A;  3LR5 A;  1NY0 A;  4CLC B;  3S4X A;  1FQG A;  3ZFZ A;  2VX8 A;  4U0X A;  4QB8 A;  3MQO A;  5AJG A;  2HV1 A;  3QNC A;  3LUQ A;  5KMW A;  4ARZ B;  4GJ4 A;  3VOY A;  2G2W A;  4E3N A;  2XK1 A;  4FSF A;  3OPP A;  4BWI A;  5EOO A;  2Z2L B;  2ZQD A;  2PD8 A;  2NUT C;  3IT9 A;  3FYZ A;  4ZAM A;  5HZH A;  3KSH A;  5KZH A;  3T4J A;  3W4Q A;  5L8M A;  1W63 Q;  4MNR A;  2J3T C;  4ZBE A;  3PBS A;  4ZJ1 A;  3IHA A;  1TS8 A;  2FFY A;  3B47 A;  3NDE A;  2MJ6 A;  1IKI A;  5FI6 A;  3K3C A;  3BFF A;  4LV2 A;  4ZJ2 A;  4LRZ E;  1XGJ A;  1IEM A;  4L9F A;  2PDR A;  1G6O A;  3EQV A;  2Z6D A;  3BQA A;  2VGL M;  2K2N A;  4WMC D;  2HP5 A;  1VQQ A;  3ZYT A;  5A92 A;  5IT5 A;  1TDL A;  1K0K A;  1X0O A;  3Q81 A;  4PPR A;  4R6L A;  3KSI A;  2ZQC A;  3LIF A;  3O87 A;  4KZB A;  2BLS A;  1CEG A;  4OPQ A;  3OC2 A;  2Y8H A;  5DFX A;  3HRE A;  3IS2 B;  3A3J A;  1STZ A;  4FUW A;  1GHI A;  2WGI A;  4JXW A;  3IBJ A;  1VET B;  3BEB A;  4GZB A;  1MC0 A;  4LCM A;  3PHY A;  1MWS A;  3HUM A;  5DF9 A;  3VSK A;  1FOF A;  4OLD A;  4HP4 A;  5FQQ A;  3E4O A;  1H0M A;  4GDB A;  2Q9M A;  3HLD A;  4E3M A;  4RA7 A;  4OOM A;  1Y4O A;  3Q07 A;  2GNX A;  5E2E A;  1IYP A;  4N1X A;  2EX2 A;  2ZMA A;  1BLC A;  3Q82 A;  3M2K A;  4OKP A;  5CHJ A;  2C5W B;  4Q0H A;  4FH2 A;  1LSW A;  3DTE A;  2W3F A;  3EOI A;  2WGV A;  4ID4 A;  2VV7 A;  4KZA A;  4I3J A;  2X02 A;  2DMW A;  4LV1 A;  4LRY C;  4OPZ A;  1OTA A;  4DJ2 A;  2Y55 A;  4LV3 A;  3MFX A;  2PAV P;  3IXH A;  1CEF A;  2J80 A;  3D72 A;  4L9G A;  1UWN X;  5JYP A;  2ZJ9 A;  2WKE A;  3NI9 A;  4UEY A;  4NXG A;  3OBF A;  1JNU A;  3IXD A;  2A24 A;  4GHI B;  2H28 A;  4CQH A;  2J9O A;  1BYW A;  4Y0T A;  1D7E A;  1PI4 A;  2WKR A;  5CEB A;  3OOV A;  4E3K A;  3FPV A;  4UA6 A;  1VEU A;  4B9O A;  4WUJ A;  1NZU A;  3ZHH A;  3P09 A;  3DWK A;  1ZC2 A;  3MJQ A;  3MSH A;  1RP5 A;  2V1Z A;  5KSC A;  1ONH A;  4HNB A;  3VV4 A;  3U2A A;  4C3Q A;  2O9A A;  4X56 A;  4DE1 A;  3T4Q A;  2XR0 A;  5EVI B;  4MCW A;  1L2S A;  1FCN A;  3RJU A;  3N8S A;  3T4T A;  3HVF A;  3K2N A;  1JWV A;  3MXR A;  5CER A;  2ZM2 A;  5HD5 A;  3EEH A;  4BL3 A;  4OOL A;  4KQR A;  3LEZ A;  2OAQ 1;  4WM9 A;  3S7P A;  3VP2 A;  4R70 A;  1WE4 A;  3MS6 A;  1LSV A;  2V0W A;  4I3A A;  2D01 A;  3NDG A;  5EM1 A;  3NOP C;  4EQ1 A;  4ZRR A;  1WA9 A;  1RGY A;  1U60 A;  1V9Z A;  3IF5 A;  1QME A;  5EVI C;  2JE5 A;  2V1B A;  2Z6C A;  4R3B A;  3VE4 A;  4FOF A;  5I94 A;  4YIN A;  2EFX A;  3UB8 A;  3T12 B;  1IYQ A;  2PR5 A;  1S4R A;  2W3H A;  2EXA A;  5HL1 A;  4IUH A;  1OJG A;  1RGZ A;  3TSG A;  2O9C A;  2HJ9 C;  3UPP A;  3NOT C;  3PAE A;  1P9R A;  2JHE A;  3S7N A;  5D3O A;  3HLF A;  4LLO B;  5FAO A;  5AQ9 A;  1XA7 A;  2VK3 A;  3BEC A;  3BRM A;  4X25 A;  3EGD C;  1KGF A;  5HX9 A;  2B18 A;  5DVA A;  2WK0 A;  5TBM A;  5LBR A;  4S2J A;  4Y15 A;  3RXW A;  1ZG4 A;  3H82 B;  3NC8 A;  5K5B A;  1Q2P A;  4MBH A;  2XRN A;  5F68 A;  2JKT I;  2W0N A;  4A5R A;  3SH9 A;  3TRC A;  3PBT A;  1KDS A;  5HWW A;  1XFN A;  3I7J A;  4PM9 A;  3IX4 A;  3H7W A;  3HBR A;  5DKK A;  3HLB A;  3F1P A;  2OWJ A;  3ISG A;  3TG9 A;  3OPH A;  4IVK A;  4K0X A;  2PU4 A;  3KO6 A;  3MXQ A;  3DWZ A;  2P74 A;  4MN7 A;  4JF6 A;  2E8I A;  5U47 A;  4IBR A;  4N1H A;  3IXB A;  1PWC A;  4IHQ A;  4KUK A;  2ZQ9 A;  2QJ5 A;  1H3Q A;  5CXW A;  1PIO A;  3N8R A;  5KIZ A;  1L0D A;  3HCY A;  4L0L A;  4R23 A;  1UGU A;  1MWT A;  4EU0 A;  3EWK A;  3R7W B;  1MWU A;  5EVL A;  2I72 A;  3CJM A;  1FIL A;  3WRT A;  3BLM A;  4HI4 A;  3BWL A;  3VP0 A;  3SH8 A;  5CHM A;  4OQH A;  4JF5 A;  5EVE A;  2Y2L A;  4L9E A;  4NXF A;  3V50 A;  5HAQ A;  3CWF A;  1XGI A;  3VE3 A;  5AVF A;  4QPR A;  1HZO A;  1BUL A;  3MZF A;  4S2O A;  3P7N A;  2H0Y A;  3RH8 B;  2R9W A;  1GSX A;  1SKF A;  2IA2 A;  2OLV A;  5A91 A;  1ZTU A;  4F3L A;  4G3K A;  1VM1 A;  4KG2 A;  3CZD A;  2ZQA A;  3PBO A;  1SDE A;  2XA7 S;  1SKO A;  1O07 A;  3LYX A;  5F1F A;  4P87 A;  2LB5 A;  3WS1 A;  5L10 A;  2IWB A;  3TJZ C;  4OQG A;  1H8M A;  1PW8 A;  2JCH A;  1L3L A;  1MKM A;  4KG6 A;  2OAP 1;  3O3V A;  2XD1 A;  4KEN B;  2HPB A;  3IF6 A;  4E3I A;  1IKG A;  5EV0 A;  1ES5 A;  5A8B A;  5CEC A;  3BW6 A;  3KX0 X;  2K31 A;  5C5K A;  2Y2I A;  2VJW A;  1T1B A;  4S2N A;  4Q0J A;  3C8C A;  5J8X A;  2WUQ A;  4I38 A;  4ARZ A;  3RTY A;  4JGO A;  3NJA A;  4HJ4 A;  5AQB A;  2IWD A;  3AGF A;  2KLI A;  5DKL A;  1UWP X;  3HLC A;  2KOI A;  4CLC D;  2CMN A;  1K54 C;  4MBF A;  1GCE A;  1DP6 A;  4B4X A;  1RCJ A;  1NYY A;  3CAX A;  1MZU A;  5CTM A;  3T1Q B;  3T50 A;  4II7 A;  3E4P A;  1DP8 A;  4HQA A;  3MQQ A;  3UB6 A;  4X69 A;  3BFE A;  3S7Q A;  2EX8 A;  4CLC E;  2KX6 A;  5TJJ A;  2XH9 A;  5JYO A;  3KYZ A;  4JBF A;  5GLD A;  3SZT A;  4EET B;  4KZ3 A;  3CUE C;  4S2P A;  2ACG A;  5BOH A;  3UE0 A;  2A3U A;  4JXV A;  3PBN A;  2H10 A;  3UDF A;  1MWR A;  1XKZ A;  3A3D A;  1D06 A;  2JN7 A;  3LCE A;  4ZJ3 A;  4P85 A;  1DJA A;  3V39 A;  4XXR A;  5HWV A;  4MN5 A;  4K91 A;  1ERM A;  2JKG A;  4KQO A;  3UE3 A;  4R3J A;  5EOE A;  2Y2O A;  4D60 A;  2V8C A;  1F2K A;  4XT2 B;  2O99 A;  3F1O B;  4KZ7 A;  3VOZ A;  1KE3 A;  3IS2 A;  1YKD A;  1L0G A;  1ZHH B;  3HJI A;  3C38 A;  1MKI A;  2VV6 A;  2XA7 M;  1VET A;  3DTK A;  1KVL A;  5FI7 A;  4WMC A;  5F1G A;  2H5S A;  2O9B A;  3N6I A;  2ZC4 B;  3AGD A;  1LHY A;  1YT4 A;  4R0Q A;  5HD3 A;  1K55 A;  4OPY A;  2ZL1 B;  3V67 A;  4DE3 A;  2M7V A;  3GVB A;  3E0Y A;  2PU2 A;  2Z2M B;  1PZO A;  3IF6 C;  3JYI A;  4JPM A;  5EPH A;  5DFY A;  4I3I A;  1Z6F A;  4KG5 A;  3JVV A;  4DXB A;  3G32 A;  2W1T B;  3GR2 A;  4X53 A;  2JBF A;  1OPX A;  2B02 A;  4EXO A;  5FAS A;  5MC7 A;  3UE6 A;  4KQD A;  2A49 A;  2R9X A;  2C6W B;  3CPT A;  3K3D A;  2QYB A;  3SS5 A;  2NUP C;  1MXO A;  3FKW A;  1QMF A;  3EQU A;  5AQA A;  4GKU A;  1OTI A;  3T1S A;  1KE0 A;  4EES A;  5IS1 A;  4HJ3 A;  1WYC A;  2WAD A;  1CI8 A;  1PZP A;  5L07 A;  2ZD8 A;  3T4K A;  3G4P A;  1YLW A;  3PBQ A;  4QWO A;  3KSG A;  3T1R A;  2W1R A;  1K57 C;  3LR0 A;  4OPR A;  1W7F A;  1KDW A;  3MQ0 A;  4Y0O A;  4HH3 A;  3M6H A;  2WAF A;  3DAV A;  1BT5 A;  2Y2J A;  3ZNT A;  1H8Z A;  2M7U A;  5L2F A;  4WBG A;  2WZX A;  4P6Z S;  2ZQ7 A;  1XJ3 A;  4GHI A;  2Y2M A;  5DJT A;  3LY4 A;  2Y2K A;  1S66 L;  4WEK A;  4BLM A;  4U3T A;  5HAI A;  4DDS A;  1NRF A;  4DMZ A;  5DJU A;  3GRJ A;  3ZGA B;  3GQZ A;  3LIA A;  1W8Q A;  3ZNY A;  1TEM A;  4NEE D;  4C75 A;  1LSX A;  3C2W A;  3MZD A;  4BJP A;  1KGG A;  4E3L A;  1OME A;  4GS9 B;  3S7O A;  1ESU A;  4NK3 A;  4HHD A;  2WAE A;  5IHV A;  3HUN A;  2ZC5 B;  4WZ5 A;  3WS2 A;  4DE0 A;  1O7E A;  4MBK A;  1K38 A;  3LGO A;  4QU3 A;  2BTF P;  4RVA A;  2P08 A;  4HOI A;  2E8J A;  3CHW P;  2ZOH A;  1E25 A;  3GSG A;  2J9P A;  2WYX A;  3UMD A;  2GDN A;  3IBR A;  2EWW A;  1FCM A;  2XLN A;  3BLS A;  1AXB A;  4X1L A;  3C7U A;  3HLW A;  4WEJ A;  3W4P A;  2XF3 A;  3GMW A;  1YPR A;  5FSR A;  5E43 A;  4G3W A;  4DN0 A;  3PYP A;  2V9A A;  3UPN A;  4R4R A;  4P0M A;  4EEU A;  2AVX A;  2D02 A;  1VHM A;  4G3V A;  2XEP A;  5CED A;  4S2I A;  4PMA A;  1BZA A;  5TGF A;  3ZCZ A;  3UB5 P;  1OTD A;  3UNW A;  3UY6 A;  2EA9 A;  5G18 A;  5FQM A;  4M3K A;  4FCF A;  1PI5 A;  3NUL A;  1FSY A;  2ZM0 A;  5EE8 A;  3L9K A;  3IH8 A;  2Y2P A;  2PBY A;  3QHY A;  2KDK A;  4Q0I A;  3LEQ A;  3HLG A;  2J8Y A;  1XX2 A;  1S67 L;  2JC7 A;  3H82 A;  3LFV A;  4P6Z M;  3UDI A;  4R4S A;  1OT9 A;  4KUO A;  3SOI A;  2DNS A;  5HAR A;  5F69 A;  2PRF A;  3BM6 A;  1P9W A;  1FCO A;  1TD5 A;  4PKY A;  4Y7P A;  5J7E A;  2PHY A;  1XJ6 A;  2B95 A;  4Y2F A;  3UME A;  3MBZ A;  3W2Z A;  1TS7 A;  1K4F A;  1XJ2 A;  3ULF A;  3MXS A;  4OH0 A;  3M6B A;  4EWF A;  1PW1 A;  1NWZ A;  3QP1 A;  1Y54 A;  3LY3 A;  3OCN A;  4XUZ A;  1DP9 A;  1N4O A;  2QPN A;  1ES4 A;  1VEU B;  1A0K A;  2Y2Q A;  1F98 A;  4MLL A;  1S1Y A;  2M1C A;  1K4E A;  1N9B A;  3QP5 A;  4WZ4 A;  5FA7 A;  3R7W A;  4NET A;  2ZC6 B;  1FIK A;  5M1A A;  4KZ8 A;  2VGJ A;  2INW A;  1MY8 A;  2PYR A;  1EWZ A;  4JGR A;  3PTE A;  3QP6 A;  5F5Y A;  4XUX A;  1XPB A;  1FSW A;  4N9K A;  4QY5 A;  2O0Y A;  4RX2 A;  3ITB A;  1NLY A;  3ZG5 A;  4HY8 A;  4YOF A;  5G4Z A;  3SW1 A;  3V3S A;  2ZM8 A;  1ZKJ A;  3DW0 A;  1KE4 A;  4GD6 A;  3Q7Z A;  3IX3 A;  2I9V A;  1G68 A;  1M40 A;  2RCX A;  3LIB A;  2OWH A;  2GX5 A;  2WGW B;  3ZG7 B;  3UB7 A;  4Z9Q A;  1E3U A;  3C7V A;  3UDX A;  1BUE A;  5HDC A;  3G6O A;  2EXB A;  3OZH A;  3WS0 A;  3MKF A;  3PAG A;  3CIT A;  2IWC A;  1LLB A;  2HJE A;  1YSP A;  4BD0 A;  2BG1 A;  5AQ7 A;  1PNE A;  4ETX A;  4Y13 A;  3FC7 A;  5E2H A;  1IFQ A;  1W8Y A;  3NOU C;  4E3J A;  1E3U D;  3NBL A;  4RX3 A;  2ZMV A;  1MBL A;  1JWZ A;  1LL5 A;  4AFI A;  3QP4 A;  4H6J A;  2G7U A;  1ODV A;  4LRX C;  4K0W A;  2WKI A;  4GDN A;  1I2W A;  4MN6 A;  1GA0 A;  1IYS A;  3LI8 A;  2LB9 A;  3NY4 A;  5HDD A;  3ZQ5 A;  1YLT A;  4RQ9 A;  4K08 A;  3PBR A;  1C3B A;  4NXE A;  4Q8I A;  3OCL A;  2UWX A;  4OOY A;  1M6K A;  4N92 A;  3H7W B;  3TOI A;  1YLY A;  1ALQ A;  1T18 A;  3KYE A;  4LFU A;  5EFW A;  2W3G A;  4RYE A;  1FR6 A;  3Q7V B;  2JKR M;  3ITA A;  3SS3 A;  4GB7 A;  3RFB A;  1K6S A;  1CJF A;  5J4E A;  1OJ5 A;  1GHM A;  5J3W A;  5CHU A;  3CG5 A;  1VB6 A;  1GSV A;  3E2L A;  4CLC A;  1OTB A;  1S4S A;  4CJN A;  3S22 A;  5GL9 A;  3WWX A;  4KZ6 A;  3OPR A;  2J3T D;  1Y28 A;  3KSF A;  3LR4 A;  2XRO A;  3BY9 A;  2Y59 A;  4LGW A;  5E2F A;  4P6B A;  3ICY A;  4XT2 A;  2QJ7 A;  1L0F A;  2OOL A;  2GJ3 A;  3IWO A;  2PD7 A;  2V1A A;  3JPU A;  3WS5 A;  4X68 A;  2ZC7 A;  5DTS A;  3L7H A;  3OPL A;  5FQJ A;  1LI9 A;  2VGK A;  3O88 A;  4EBN A;  3B33 A;  4IVI A;  4NKP A;  4ZDX A;  3G30 A;  2HGV A;  4Y3I A;  4WF0 A;  1T1A A;  2K7S A;  2XSS A;  4DXC A;  4Y5F A;  4LPZ A;  2L4R A;  1SDN A;  2ZQ8 A;  2EFU A;  4JLF A;  3IWI A;  3NIA A;  3LO7 A;  5FDS A;  2XGN A;  3FWL A;  3B42 A;  1OTE A;  1F9I A;  4HH2 A;  2YKF A;  3NEC A;  3V3R A;  3IF6 B;  1I5Q A;  2J7V A;  5A90 A;  2VEA A;  3IH9 A;  1XXM A;  4EBP A;  3G34 A;  3U4L P;  5FEF A;  1DRM A;  3F1N B;  1GHP A;  2HDU A;  3G35 A;  5L09 A;  2HZ5 A;  4HP9 A;  4WL9 A;  2P9V B;  2XDM A;  3T1X A;  1NLZ A;  3EEA A;  1BLS A;  2ZMF A;  1YMX A;  1ES2 A;  4YNR A;  3SS4 A;  2JKF A;  2Q0O A;  5FI2 A;  3LR3 A;  1P0Z A;  4E3O A;  5FL3 A;  4UHU A;  4DE2 A;  1LL9 A;  4QJG A;  5FAQ A;  4HES A;  1V9Y A;  3ZVW A;  1SZV A;  4Y0U A;  2QKP A;  1PRQ A;  1YMS A;  2FH5 A;  3B3X A;  4DJ3 A;  4CLC C;  4BQM A;  1PYY A;  3D3O A;  4S2N C;  4IED A;  4S2M A;  1BLP A;  4R38 A;  1ACF A;  3R4K A;  1CQA A;  5KSH A;  1ESI A;  3N8L A;  4EQI A;  1XA1 A;  1EI5 A;  2XQZ A;  3C30 A;  1S1Z A;  1ZG6 A;  2UV0 E;  3FZC A;  1G5U A;  2Y91 A;  1T19 A;  1TDG A;  1LL8 A;  1K25 A;  2FFF B;  3OLO A;  3Q1F A;  4MMN A;  5HSQ A;  4GS9 A;  5EUA A;  4ESP A;  1ERQ A;  3MFD A;  4OP5 A;  1NXY A;  4YFM A;  5FDH A;  4OP8 A;  1IEL A;  3C5A A;  1YQS A;  3MMH A;  1H5X A;  5TFQ A;  3TE8 A;  4O0P A;  2WKP A;  3DBA A;  4GNU A;  4UA7 A;  3KYQ A;  4LCL A;  4BL2 A;  4OLG A;  1ONG A;  3AGE A;  4O8G A;  4HJ6 A;  3IQA A;  1CI9 A;  2RL3 A;  4X1M A;  5GHY A;  2ZOI A;  2Y2G A; 
#chains in the Genus database with same CATH homology
 3A0V A;  2JKT M;  3EWK A;  3H82 A;  3LFV A;  4P6Z M;  4EEP A;  3R7W B;  5IU1 A;  2A2L A;  1OT9 A;  3A0S A;  4KUO A;  2FZ0 A;  2BAS A;  3A0R A;  5F69 A;  3T4O A;  2VKS A;  3EGX C;  4BMW A;  4HI4 A;  2JKR I;  1P9W A;  1TD5 A;  3BJN A;  4PKY A;  2R78 A;  5J7E A;  3BWL A;  2PHY A;  1XJ6 A;  5HPF A;  1GSW A;  1UGU A;  3LR5 A;  3O5Y A;  2L0W A;  3CLO A;  4CLC B;  4Y2F A;  4L9E A;  4NXF A;  2VX8 A;  3CWF A;  3UME A;  3MQO A;  5AJG A;  1TS7 A;  3W2Z A;  1XJ2 A;  2HV1 A;  3ULF A;  3LUQ A;  3VE3 A;  5AVF A;  4QPR A;  4WN5 A;  4ARZ B;  4GJ4 A;  1NWZ A;  3P7N A;  3RH8 B;  4FSF A;  4BBV A;  3MF0 A;  4BWI A;  1YSQ A;  3OCN A;  1DP9 A;  1GSX A;  4HIA A;  2IA2 A;  1ZTU A;  4F3L A;  2PD8 A;  4G3K A;  2NUT C;  3PBO A;  1F98 A;  5HZH A;  2XA7 S;  3KSH A;  1S1Y A;  3T4J A;  5L8M A;  3LYX A;  2M1C A;  1W63 Q;  2J3T C;  3PBS A;  4UQI S;  2LB5 A;  4BBU A;  1TS8 A;  3B47 A;  3TJZ C;  3LIE A;  1H8M A;  2MJ6 A;  1TF1 A;  4JGP A;  1MKM A;  5G4Y A;  2OAP 1;  3R7W A;  3K3C A;  2W27 A;  3VOL A;  2INW A;  4LRZ E;  4Z1W A;  2PYR A;  4JGR A;  4L9F A;  4BBT A;  2PDR A;  5A8B A;  1G6O A;  3EQV A;  2Z6D A;  3BW6 A;  3KX0 X;  3BQA A;  2VGL M;  4GLQ A;  2K2N A;  2K31 A;  5F5Y A;  5C5K A;  3P01 A;  2VJW A;  3ZYT A;  1T1B A;  4PHT A;  4Q0J A;  3C8C A;  4IJG A;  2O0Y A;  5IT5 A;  3FG8 A;  2PT7 A;  1NLY A;  1X0O A;  4I38 A;  4R6L A;  1YAX A;  4HY8 A;  4ARZ A;  3RTY A;  3KSI A;  4YOF A;  1LT0 A;  5G4Z A;  3SW1 A;  4JGO A;  3LIF A;  3NJA A;  4HJ4 A;  2KLI A;  3NHQ A;  2QHK A;  5DKL A;  3GEC A;  1UWP X;  2KOI A;  4CLC D;  2CMN A;  2L1M A;  1EW0 A;  2I9V A;  3OC2 A;  1DP6 A;  1IOU A;  2Y8H A;  5DFX A;  3LIB A;  2OWH A;  2GX5 A;  3CAX A;  1MZU A;  4B93 A;  3IS2 B;  1STZ A;  4PAU A;  3T50 A;  4II7 A;  3E4P A;  1DP8 A;  4HQA A;  3UB7 A;  3MQQ A;  3UB6 A;  3IBJ A;  1MC0 A;  3PHY A;  5HDC A;  3S7Q A;  3G6O A;  2KX6 A;  4CLC E;  5TJJ A;  3KYZ A;  4M4X A;  3CIT A;  2HJE A;  5DF9 A;  1YSP A;  4EET B;  4ETX A;  3FC7 A;  3CUE C;  2PYP A;  1IFQ A;  4HP4 A;  3NOU C;  3E4O A;  2ZMV A;  3PBN A;  4AFI A;  1D06 A;  4OOM A;  2JN7 A;  4H6J A;  2GNX A;  2G7U A;  2WKQ A;  1ODV A;  5HWV A;  4MN5 A;  2A24 B;  4LRX C;  4KQO A;  3UE3 A;  4GW9 A;  4MN6 A;  2VV8 A;  3LI8 A;  1N9N A;  2LB9 A;  5HDD A;  3ZQ5 A;  2V0U A;  4Q0H A;  4XT2 B;  1LSW A;  2O99 A;  3F1O B;  4RQ9 A;  4I5S A;  2W3F A;  4K08 A;  3PBR A;  1W63 M;  3IS2 A;  4NXE A;  1XJ4 A;  1YKD A;  3EOI A;  3OCL A;  1NRJ A;  1ZHH B;  4EW7 A;  3HJI A;  1T1C A;  3C38 A;  2VV6 A;  2XA7 M;  2VV7 A;  3H7W B;  4I3J A;  1T18 A;  4UQI M;  2O9B A;  2DMW A;  5EFW A;  2QWS A;  5HWT A;  2W3G A;  4LRY C;  5HD3 A;  2JKR M;  1OTA A;  2EWV A;  4DJ2 A;  3V67 A;  3MFX A;  4IUK A;  2M7V A;  3RFB A;  3E0Y A;  5J4E A;  1OJ5 A;  3PXP A;  4WLA A;  1TS0 A;  5J3W A;  2J80 A;  3PR6 A;  3D72 A;  1VB6 A;  4L9G A;  5DFY A;  1GSV A;  1UWN X;  4CLC A;  4I3I A;  1OTB A;  2Y79 A;  1S4S A;  3JVV A;  2W1T B;  4WEL A;  3HJK A;  4UEY A;  3OBF A;  1JNU A;  4GHI B;  4NXG A;  1OPX A;  2A24 A;  2H28 A;  4CQH A;  2J3T D;  2B02 A;  1BYW A;  3E4Q A;  4EXO A;  1Y28 A;  3KSF A;  1XFQ A;  3LR4 A;  4YWZ A;  3UE6 A;  5MC7 A;  4KQD A;  2XRO A;  3BY9 A;  1D7E A;  2WKR A;  3K3D A;  2QYB A;  2NUP C;  3FPW A;  3OOV A;  2VA0 A;  3ICY A;  4XT2 A;  2QJ7 A;  3FPV A;  3EQU A;  2OOL A;  4B9O A;  2GJ3 A;  4WUJ A;  2P7J A;  2PD7 A;  2V1A A;  1OTI A;  4EES A;  5IS1 A;  4HJ3 A;  3GDI A;  3MJQ A;  5I5L A;  1TS6 A;  1N9O A;  2J3W A;  2YKH A;  4ETZ A;  3B33 A;  3BQ8 A;  3T4K A;  4NKP A;  3PBQ A;  3T4S A;  3KSG A;  2HGV A;  4HNB A;  4Y3I A;  3VV4 A;  4ME4 A;  2W1R A;  4WF0 A;  3U2A A;  1T1A A;  2O9A A;  3JVU A;  3T4L A;  2K7S A;  3LR0 A;  2HF6 A;  4NXB A;  3T4Q A;  2XSS A;  4MCW A;  3E98 A;  3BY8 A;  4Y5F A;  4LPZ A;  5HL6 A;  2L4R A;  3T4T A;  3MQ0 A;  4HH3 A;  5HDS A;  3K2N A;  2M7U A;  3B42 A;  4P6Z S;  4EUV A;  1OT6 A;  5HPI A;  5HD5 A;  1XJ3 A;  4GHI A;  1OTE A;  4EU0 A;  5DJT A;  4PKY G;  5TBM B;  3CUE A;  1F9I A;  3EEH A;  4HH2 A;  2YKF A;  1S66 L;  4OOL A;  4WEK A;  3LID A;  2OAQ 1;  3MR0 A;  2VEA A;  3S7P A;  4R70 A;  1DRM A;  3LI9 A;  3F1N B;  1LSV A;  2V0W A;  5DJU A;  4DMZ A;  4I3A A;  2D01 A;  3NOP C;  2VLG A;  3LIA A;  4HP9 A;  4WL9 A;  4EQ1 A;  4ZRR A;  1WA9 A;  4JGQ A;  4NEE D;  1V9Z A;  1NLZ A;  3EEA A;  1LSX A;  2V1B A;  3C2W A;  2Z6C A;  4BJP A;  3VE4 A;  2ZMF A;  4FOF A;  4GS9 B;  3S7O A;  3UB8 A;  2PR5 A;  1S4R A;  2W3H A;  4YNR A;  3F1P B;  4HHD A;  4IUH A;  1OJG A;  2O9C A;  2HJ9 C;  4MDZ A;  3NOT C;  3LR3 A;  1P0Z A;  1P9R A;  5FL3 A;  2JHE A;  2P08 A;  4HOI A;  3S7N A;  3UB9 A;  2ZOH A;  4LLO B;  1V9Y A;  3UMD A;  3EGD C;  3LIC A;  3IBR A;  2EWW A;  2ZBB A;  4I39 A;  2QKP A;  2B18 A;  5TBM A;  4WEJ A;  2FH5 A;  5LBR A;  4DJ3 A;  4CLC C;  4O01 A;  3D3O A;  1F5M A;  3H82 B;  4GCZ A;  2GZA A;  4EER A;  5K5B A;  2VGL S;  4R38 A;  2XRN A;  3F1N A;  3R4K A;  5F68 A;  2JKT I;  2W0N A;  5KSH A;  4G3W A;  4DN0 A;  3H9W A;  2V9A A;  3PYP A;  4EEU A;  3F1O A;  3TRC A;  3C30 A;  3PBT A;  2D02 A;  1S1Z A;  1VHM A;  5HWW A;  4G3V A;  1XFN A;  4H6J B;  1T19 A;  1LL8 A;  3H7W A;  3OLO A;  4MMN A;  5HSQ A;  3TW8 A;  4GS9 A;  5DKK A;  1OTD A;  3F1P A;  2W3D A;  4R3A A;  2OWJ A;  3CI6 A;  2EA9 A;  2VZW A;  1N9L A;  1KOU A;  5F6A A;  3KO6 A;  3MXQ A;  4MN7 A;  4E04 A;  3MMH A;  3TE8 A;  2W3E A;  2PR6 A;  4O0P A;  4F3L B;  2WKP A;  3DBA A;  4IHQ A;  4KUK A;  3KYQ A;  2QJ5 A;  1H3Q A;  1G28 A;  2P04 A;  1P97 A;  5AVE A;  4O8G A;  4HJ6 A;  5KIZ A;  2W1T A;  2KDK A;  4Q0I A;  5CX7 A;  4L0L A;  3HCY A;  2ZOI A;  1S67 L; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...