1X0OA

Human arnt c-terminal pas domain
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
119
structure length
119
Chain Sequence
GAMDNVCQPTEFISRHNIEGIFTFVDHRCVATVGYQPQELLGKNIVEFCHPEDQQLLRDSFQQVVKLKGQVLSVMFRFRSKNQEWLWMRTSSFTFQNPYSDEIEYIICTNTNVKNSSQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Aryl hydrocarbon receptor nuclear translocator
publication title Structural Basis of ARNT PAS-B Dimerization: Use of a Common Beta-sheet Interface for Hetero- and Homodimerization.
pubmed doi rcsb
molecule tags Transcription
total genus 33
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2005-03-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14598 PAS_11 PAS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 1x0oA01
4MN5A 3ZQ5A 4F3LA 1G28A 4I3JA 3UB8A 4GCZA 3LUQA 2WKRA 2PR5A 2GJ3A 5DJTA 5DKLA 4HQAA 3MJQA 2QHKA 1V9YA 4HP4A 1OT9A 2PHYA 1UWPX 3F1NB 4HY8A 4NXFA 4LPZA 2HV1A 1LSWA 2P7JA 4GHIA 4I3IA 4H6JA 2L4RA 4GW9A 4JGQA 1OT6A 4HH2A 2R78A 1XJ3A 5HDCA 3VE4A 1GSXA 2V0UA 1GSWA 1MZUA 4HJ3A 5G4ZA 3F1NA 3EWKA 1P0ZA 4HH3A 4EXOA 3LI9A 3IBRA 5HD3A 2QWSA 3NHQA 4LRZE 2J80A 4XT2A 1OTEA 4K08A 2V1BA 3FG8A 4DJ2A 2PD8A 5A8BA 5TBMB 3H7WB 3BWLA 5IS1A 3LIFA 5J3WA 3UB6A 1T18A 4RQ9A 3VOLA 3HJKA 3RTYA 4JGPA 1OTIA 1TS0A 1S66L 2INWA 3LIEA 2B02A 1UWNX 4LRYC 4EETB 1X0OA 2A24B 3D72A 1T1AA 3H82A 2WKPA 4KUOA 3K3DA 3G6OA 1EW0A 3OLOA 4NXGA 1GSVA 1S4RA 3A0SA 1DP6A 4M4XA 5DKKA 4EESA 3UB7A 1LT0A 4BBTA 3A0RA 2EA9A 2W0NA 1S1YA 2A24A 1N9LA 3CLOA 2CMNA 4L9FA 4DJ3A 2PD7A 1TS7A 4GS9A 4PKYA 3E4QA 2ZOHA 5G4YA 4WLAA 1LSVA 4HI4A 3MQQA 2WKQA 1S67L 1V9ZA 1VB6A 1NWZA 3NOPC 1XFNA 3EEHA 3K3CA 3H9WA 5F5YA 1Y28A 4WN5A 5F68A 4B9OA 3C2WA 3LI8A 1JNUA 1TS6A 3E4PA 1XJ6A 2ZBBA 3F1OB 3PYPA 2L1MA 2VV6A 4EEPA 2M1CA 4HP9A 2KDKA 3LICA 5J7EA 1BYWA 1DP9A 4BBUA 4HIAA 4PKYG 3UB9A 3LIAA 3LIBA 4WF0A 3GECA 1N9OA 4WL9A 3HJIA 2KX6A 2YKHA 1D7EA 1ODVA 2D01A 1OTAA 2V9AA 2ZOIA 5HWVA 1F9IA 1XJ4A 5HWTA 3E4OA 2VV8A 3F1OA 2Z6CA 4NXBA 3UMDA 4R6LA 5TBMA 3H7WA 4LLOB 4R3AA 3MR0A 4WUJA 3KX0X 5HZHA 4KQDA 5AVFA 1OJGA 1OJ5A 5HSQA 1DRMA 2VLGA 3T50A 4R70A 3ULFA 2YKFA 3NOTC 1T19A 4I3AA 3LYXA 2BASA 2PDRA 3MFXA 3A0VA 4JGRA 1XJ2A 3MXQA 1T1BA 4H6JB 1S4SA 3C8CA 1S1ZA 5HDDA 1WA9A 1TS8A 1N9NA 3LIDA 1LSXA 3GDIA 5IU1A 3BY8A 2JHEA 3NOUC 1P97A 4L9EA 3MQOA 2QJ7A 1UGUA 3VE3A 2JN7A 3P7NA 3RH8B 4HOIA 4EERA 4YWZA 4I38A 4I5SA 5I5LA 4XT2B 1XFQA 2V1AA 2I9VA 4EQ1A 2PYPA 5F69A 3BY9A 2PR6A 2W27A 5F6AA 4NXEA 4HNBA 4R38A 2OWHA 1D06A 2VV7A 2D02A 3F1PB 1F98A 3FC7A 1OTBA 4HHDA 2QJ5A 1T1CA 1DP8A 2QKPA 3NJAA 3UMEA 3SW1A 5AVEA 5DJUA 2H28A 4LRXC 4HJ6A 1KOUA 5KIZA 4EW7A 3H82B 2V0WA 2OOLA 5HWWA 5HDSA 4I39A 3ICYA 3B33A 3F1PA 4HJ4A 3IS2B 4MN6A 4E04A 1OTDA 2L0WA 4F3LB 4JGOA 3CWFA 2OWJA 3PHYA 5J4EA 5EFWA 5HD5A 3UE6A 3CAXA 2PYRA 2Z6DA 2K7SA 2VEAA 4BBVA 1LL8A 4L9GA 4KUKA 4GS9B 3IS2A 4EEUA 4GHIB
chains in the Genus database with same CATH superfamily
3IWIA 4OOYA 4F3LA 3C7UA 1G28A 4I3JA 3UB8A 3MKEA 3NDGA 3E2KA 3LUQA 3IH8A 4HQAA 3CITA 5M1AA 2JBFA 2QHKA 5CHUA 1V9YA 1OT9A 4FSFA 4KQQA 1H3QA 4NXFA 1BSGA 4GHIA 4DE1A 3P01A 4H6JA 2L4RA 1K56D 1TDGA 1P9RA 3T4OA 2Y2MA 4KZAA 2ZC7A 1ERMA 3IF6B 2R78A 2JKTM 3A3IA 3PBRA 3MXSA 3ZNYA 3NULA 2V0UA 3VP2A 3IXHA 5GHXA 4HJ3A 1U60A 5G4ZA 5FEFA 3UPOA 3KSIA 4Q0IA 5L8MA 3EWKA 4HH3A 3BFGA 2XFSA 4JKTA 1PW1A 1IOUA 3U4LP 1BLSA 3G35A 3S7OA 2WKIA 4K08A 2V1BA 1CEGA 4HEFA 5CTNA 2VGJA 3L7HA 1OMEA 2V8CA 1YM1A 4MCWA 3ZNTA 5FDSA 4MLLA 4ZBEA 5J3WA 3KSHA 1T18A 2W3GA 2NUTC 5M18A 3HJKA 3RTYA 3GR2A 1NZOA 1CEFA 4UA7A 3WWXA 5GHYA 2ZQ9A 4PM6A 2J3TC 3LR4A 3FYZA 1YPRA 4E3IA 2BTFP 4R0QA 5FAPA 4EETB 3BLMA 2VKSA 4OQIA 1T1AA 4KUOA 3RFBA 2P08A 3K3DA 4O7DA 5HPIA 5CRFA 1XA7A 3C4PA 1C3BA 2JKRM 4M4XA 2XLNA 4EESA 1LT0A 3A0RA 3PBQA 1PI5A 5HAIA 3UPNA 1N9LA 3ISGA 2P9VA 2CMNA 3Q1FA 4E3LA 3BQAA 2K31A 1MXOA 1PWCA 1W63M 2B5RA 1YQSA 2ZOHA 3UE0A 1KE0A 4MN7A 5G4YA 4P6ZS 1NYMA 3JVUA 4ZRRA 3W4PA 3E98A 3CG5A 4HI4A 2WKQA 1VB6A 4E3MA 4MBFA 4WZ5A 4QY6A 5DFYA 1PIOA 3MXRA 2H0TA 1F5MA 5KSHA 5AQBA 5FASA 2RL3A 4HESA 1WYCA 4BQMA 1NRFA 1Y28A 2Z2LB 5F68A 2VA0A 2J3WA 4S2MA 3LI8A 2PBDP 3E4PA 5MC7A 1XJ6A 2ACGA 2CC1A 3TE8A 2EFUA 4YINA 1K38A 3PYPA 1VM1A 2L1MA 4K91A 1L0EA 4UQIM 4EUVA 2EXAA 1NLZA 1FSYA 4K0WA 1SKOB 3OPPA 4JF4A 3LIAA 3LIBA 4ZJ3A 4PM9A 4WL9A 2YKHA 1DY6A 2O9CA 3MQ0A 4Y17A 2ZOIA 3Q7VA 5HWVA 1W8QA 3F1OA 5EVIC 1MKIA 4NXBA 4X55A 1EROA 4S2KA 3T4JA 3H7WA 1JVJA 1STZA 2ZMAA 1CI9A 1FSWA 1L3LA 1KVMA 5HZHA 3EQUA 5FAOA 3OOVA 5AVFA 2HDUA 5D3OA 4K0XA 3UDFA 4WZ4A 3BECA 3GVBA 1CF0A 4GB7A 1DRMA 3S22A 2VLGA 4R70A 1KGGA 4FCFA 2M7VA 3BRMA 3NOTC 1T19A 4I3AA 3MS6A 3FKWA 4Q8IA 2PDRA 3V3RA 5FQ9A 3T4QA 1JTGA 4CQHA 1XGJA 4JBFA 5CXWA 4MBHA 1YT4A 1IKGA 4KQOA 5JYOA 5E2EA 4PM7A 4Y7PA 1S1ZA 1TS8A 1N9NA 5TJJA 3GTCA 5IU1A 5E43A 2BG1A 3SH9A 3T1XA 3BY8A 2AVXA 1Z09A 2FFFB 1N9BA 1G6AA 3P7NA 2O9AA 4HOIA 3AGFA 2HZ5A 4EERA 3EGDC 1Q2PA 2EX6A 4IBRA 1XFQA 2HPBA 3IWQA 2B18A 2Y2IA 1PYYA 2W3FA 4KZ3A 3BY9A 3T1SA 2PR6A 1ALQA 3T4LA 2ZMVA 3MZEA 5DF8A 3SH7A 4R38A 2OWHA 4H8RA 4RVAA 5LBRA 2VV7A 5HX9A 1F98A 4DDSA 4EQIA 3GSGA 2IWBA 4KG2A 3GRJA 4Y5FA 1IYQA 1DJBA 4R4SA 3W4QA 5HFOA 5M19A 4X6TA 3ZFZA 1SKFA 3VOZA 3UDIA 5GL9A 2H10A 3IT9A 2WYXA 4CLCA 5KIZA 2Y2GA 3OPLA 2IA2A 4LCMA 3V3SA 5DFXA 3V5MA 2WK0A 5HWWA 2PU2A 1J9MA 3TG9A 3DAVA 1RGZA 1IKIA 1H5XA 1PWGA 4E04A 1OTDA 4LCLA 2L0WA 3HLEA 4JGOA 3CWFA 4ARZB 1QMEA 3IBJA 3PHYA 2QZ6A 3QNBA 3CMZA 2R9XA 3LEQA 1BTLA 1HD8A 2VEAA 3NI9A 5IHVA 4G3WA 5EVEA 3G30A 5AQ9A 1BUEA 4ID4A 4KUKA 2G2WA 2XEPA 4LV3A 4EEUA 5FL3A 1K0KA 4BLMA 1K57C 5G18A 4S2NA 3DW0A 4GCZA 1BT5A 3ZG8B 5FQMA 4BD1A 3PBSA 4CJNA 2J9PA 2Y2QA 4OOLA 2PR5A 2GJ3A 5FQJA 4EU0A 2HP5A 2BLSA 2ZC5B 4S2PA 4F94A 2UWXA 1SZVA 3B47A 2WKEA 3F1NB 4HY8A 5FQKA 1XPBA 3KO6A 4LPZA 2IWCA 3WRTA 4Y13A 3OPRA 1PZOA 5FA7A 5L10A 2JKFA 4OONA 1ONGA 1MKMA 3N8LA 2I72A 4QPRA 4HH2A 3GMWA 2Y4AA 2ZM2A 3LCEA 4QY5A 4JXWA 3NECA 2EXBA 2V2FF 3CHWP 1HLUP 1GSWA 3BM6A 3AGDA 1P0ZA 5EVIB 1E3UD 4EV4A 2WKHA 4EXOA 2J80A 4XT2A 2ZL1B 5A91A 3ZVTA 4N92A 1IELA 1ACFA 4P85A 3ITAA 3T4TA 2X02A 4E3KA 2HJ9C 2PBYA 4ETXA 4PM5A 1L0DA 2B95A 4D60A 5TBMB 1J3WA 2OSUA 5EM0A 1D1JA 3BWLA 3LR0A 2ZC4B 3IHBA 2Y2OA 3B3XA 3D3OA 4UA6A 1TS0A 4MMNA 3HUNA 1S66L 2A3UA 3LIEA 5KSCA 4X1LA 4ZJ1A 1FCNA 1UWNX 3ZGAB 3A3FA 2WKPA 1HTZA 5CGSA 4Y3IA 4M3KA 3OLOA 4KZBA 1K56A 5CECA 2X01A 3O88A 1GSVA 1VQQA 1IYPA 4RA7A 1H8MA 5FI2A 1AXBA 2HDQA 3VP3A 3CZDA 4BBTA 4II7A 1K25A 3Q07A 3S1YA 1VETB 3TRCA 4E3JA 4LGWA 3M2JA 3VOYA 3JPUA 1JWVA 3IXGA 3N8RA 1KDWA 2Y2HA 1LHYA 1QMFA 1Z6FA 2ZQCA 5HL1A 2EX9A 1TS7A 2ZQ7A 4GS9A 3MSHA 2JE5A 3WS4A 2ZM0A 4GN2A 3ZG7B 2IWDA 1MPLA 5E2GA 3OCLA 3MQQA 1ZC2A 1NYYA 2OV5A 5EOOA 1S67L 2V1ZA 1NLYA 4P0MA 3EEHA 3K3CA 4KG5A 2ZQDA 1FCOA 3BFFA 3H9WA 4WEKA 4Y0OA 3RXWA 3HREA 1CI8A 5AJGA 4WN5A 4X53A 3C2WA 1DJAA 2W3EA 3NC8A 2JKTI 3V39A 4WZ5C 1JNUA 3BFCA 5DF9A 2J7VA 4N1HA 3HUOA 1ZHHB 3QP5A 1MWUA 4NG2A 3HLBA 2PAVP 4EEPA 4C6YA 2HDSA 2R9WA 3GV9A 1BYWA 4HIAA 4ZJ2A 1KE4A 4YNRA 1D7EA 2D01A 3VP4A 2W1TB 2EFXA 1XJ4A 3A3EA 4GKUA 2VV8A 4Y2FA 3EQVA 4IBXA 3V67A 2WGVA 2Z6CA 2DNSA 2QYBA 5DTSA 4OP8A 3UMDA 1LLBA 2K2NA 4LLOB 3MR0A 2HP9A 2X71A 1SKOA 4E3OA 3KX0X 5FQIA 4KQDA 1TVFA 3OBFA 1OJ5A 5CEDA 2E8IA 4OQGA 5HSQA 2HJEA 3BYDA 1ZTUA 3T50A 3ULFA 4KENB 4AFIA 4O01A 3PR6A 1ES3A 3HLDA 3MXQA 1GHMA 4H6JB 4C3QA 4LV2A 3PXPA 2JKRI 3VP0A 1S4SA 3C8CA 3FPVA 4O0PA 1W5DA 2XF3A 5A93A 5FI6A 1WA9A 5HDDA 3TSGA 3LIDA 3PTEA 2O0YA 3BW6A 2WGWA 4GOGA 3IXDA 3NOUC 3MQOA 5AQ7A 1KVLA 2JN7A 1YSQA 4YWZA 2G2UA 5FATA 4I5SA 1YKDA 3N8SA 2I9VA 1IYOA 1XA1A 3M6BA 2VK3A 1ES4A 4Q0JA 4KG6A 4ME4A 3NY4A 2W27A 1FQGA 4JF6A 4R1GA 5A90A 1RP5A 1K55A 1TDLA 1TEMA 1Q2QA 4HNBA 3FWLA 3WS0A 3VSLA 4S2IA 4DKIA 3FC7A 2Z2MB 4HHDA 4JXGA 3FPWA 1DP8A 1MC0A 1GA0A 4B88A 3UMEA 2P74A 1XXMA 5AVEA 2WUQA 4KZ9A 3UO9A 3PAEA 4DXCA 4NKPA 4RX2A 4DE3A 1ESUA 5CGWA 3D9YA 3IHAA 2V0WA 1L0GA 1YSPA 4FTXA 2HDRA 4N1XA 3NIAA 3R4KA 3B33A 3S7NA 2NUPC 3UE3A 5KZHA 1VEUA 3Q7ZA 3IS2B 1NRJA 4CLCC 4KZ7A 3Q82A 1LI9A 4DF6A 1G6OA 3O87A 4CPKA 1MWRA 1IFQA 2MJ6A 1L0FA 3CJMA 5HD5A 1ES2A 1K6RA 3G2YA 2EWVA 3CAXA 3VSKA 3BQ8A 3WS2A 3A3DA 4WYYA 2J3TD 3ITBA 1CQAA 3EEAA 2VJWA 4MN5A 3N7WA 4EBLA 1FR6A 3MF0A 4ARZA 3LY4A 2XSSA 2JKGA 2WKRA 1WE4A 4G3VA 1YMXA 1RCJA 3CPTB 3PBOA 3QP4A 4Z1WA 2QPNA 4HP4A 4X68A 3JVVA 2PHYA 1UWPX 3G32A 3UPPA 4S2NC 5FAQA 1XX2A 4RX3A 2HV1A 4DMZA 4E6WA 4WMCD 4IJGA 4JGQA 3SH8A 5FSRA 2J8YA 1I2SA 1ES5A 1KGEA 1XJ3A 4OP5A 5EV0A 3KYZA 3F1NA 4MBKA 4EBPA 3LI9A 3IBRA 5HD3A 2QWSA 3EGXC 3HLCA 3ZG5A 2VX8A 4KZ6A 1YLPA 4FH4A 1OTEA 1IYSA 1WYBA 1NZUA 3FG8A 3W2ZA 1K54A 5TFQA 4JXVA 3H7WB 3UE1A 1PI4A 1BLHA 1O7EA 1F2KA 3M6HA 3UB6A 5J8XA 4RQ9A 3VOLA 4X69A 1O07A 5CHJA 2OAQ1 3HVFA 2ZL1A 2INWA 3BJNA 3IQAA 4Q0HA 4LRYC 4IHQA 4X56A 4OH0A 2A24B 3D72A 3ZG9B 3P98A 3SZTA 1GHPA 5CGXA 3H82A 4XUZA 4L0LA 4EBNA 1ERQA 1IEMA 2VGLM 1TF1A 4GD8A 3TW8A 3EOIA 4GDNA 1PFLA 3A0SA 1K4EA 1VHMA 1E4DA 2OLVA 3D4FA 4RYEA 5EVID 2C5WB 3UB7A 2EA9A 3QP2A 4OPYA 3HBRA 3O3VA 4DXBA 1E3UA 3MKFA 2RCXA 4EWFA 2GX5A 1YAXA 1PNEA 4DJ3A 5E2FA 4DRTA 2FZ0A 3E4QA 4DE0A 5EPHA 4B93A 5F1GA 2ZQAA 1K6SA 4WLAA 4S2JA 1LSVA 1S0WA 4GZBA 1VETA 1V9ZA 1BZAA 1YLJA 4OPZA 2Y79A 4Z9QA 3C7VA 1ONHA 1JWPA 3MZFA 3VV4A 4NEED 3T12B 1GHIA 3S4XA 4IEDA 2LB5A 2HGVA 3U2AA 3PBNA 5TGFA 4E3NA 3W8KA 3IF6A 3TOIA 4Y15A 1H8ZA 4YOFA 2W3HA 2VV6A 3A3JA 4HP9A 3G34A 3OPHA 1FR1A 5J7EA 1DP9A 1Y54A 4IVIA 4PKYG 5CERA 1P9WA 3R7WB 2WGIA 2XK1A 3MZDA 4WF0A 4OPRA 3HJIA 1OTAA 2V9AA 2W1RA 4LFUA 4GD6A 3E4OA 1GCEA 2Y55A 5K5BA 2Y2KA 3W4OA 4HBTA 3G31A 4Y0UA 4WUJA 3N6IA 3T1RA 3FKVA 4MEZA 2ZJ9A 4OLGA 2EX8A 3T1QB 2Y59A 1DJCA 4CLCE 4OPQA 2BASA 3QHYA 4FH2A 3BFDA 3CUEA 3A0VA 2XA7S 4U0TA 2QMIA 3UN7A 4MNRA 4BJPA 2PU4A 2XH9A 1LSXA 2EWWA 3ZHHA 1I2WA 4WM9A 3C30A 2Y2JA 2A49A 2VGLS 2JHEA 3LGOA 4L9EA 4PPRA 1ZG6A 5DVAA 2H5SA 2LB9A 3VE3A 3RH8B 1G68A 4KZ4A 4PAUA 4I38A 4XT2B 2V1AA 1PWDA 1YLTA 4JLFA 2PYPA 1W7FA 3BFEA 5F69A 1LL5A 5DTTA 4IVKA 5IT5A 4NXEA 1S6RA 1D06A 4QHCA 3HCYA 5F82A 5F1FA 3F1PB 1W8YA 4S2LA 5GHZA 2WAEA 4O8GA 2QJ5A 5L07A 1JWZA 2P04A 3NJAA 3CI6A 1K55C 5HW3A 2WAFA 5DJUA 5GLAA 3ZCZA 4EW7A 3HL9A 3B42A 2GZAA 1PRQA 1Y4OA 4FD8A 2OOLA 1ZG4A 4OVDA 1SDEA 3S7PA 4DE2A 3ICYA 3LEZA 3LR3A 1MBLA 4HJ4A 4XUXA 3V50A 3C38A 2DCFA 1YMSA 4MN6A 3MFDA 1K4FA 3E2LA 4F3LB 1HZOA 4S2OA 3QNCA 2OWJA 4PM8A 2WADA 3M2KA 5J4EA 2KOIA 3UE6A 3GQZA 5HARA 3IH9A 3KYEA 5HL6A 4BBVA 2Q9MA 1LL8A 4DN0A 2H0YA 2VGKA 2ZD8A 3MBZA 5EM1A 4GS9B 2XFTA 4UHUA 3IS2A 4R4RA 4GHIB 3ZQ5A 5L09A 1H8YA 4FUWA 1PZPA 4ESPA 3BEBA 1ESIA 4NK3A 5DJTA 1H0MA 3RXXA 5EUAA 1NXYA 5DKLA 1MY8A 4KZ5A 3MJQA 4LENA 4QU3A 3T4KA 5F83A 1YLZA 3VFHA 1LSWA 2P7JA 4I3IA 3ZVWA 4GW9A 4XXRA 5GLDA 4D2OA 2Q0OA 2VZWA 1OT6A 3FZCA 3ZDJA 4LV1A 2EX2A 3CPTA 1M6KA 5HDCA 3VE4A 1GSXA 3HLWA 4Y0TA 1MZUA 2DMWA 4WEJA 1BLCA 4YFMA 1FILA 4A5RA 1TD5A 3ZG0A 3MMHA 1SDNA 1ZKJA 3NHQA 4LRZE 4QD4A 3SS5A 1A0KA 1W79A 1G5UA 4X25A 3ZYTA 3G4PA 4PHTA 3KSFA 1KE3A 3BLSA 4N9KA 4DJ2A 3IX8A 2XDMA 3NBLA 3QP6A 3IX3A 2PD8A 3IF5A 5A8BA 1E25A 4N9LA 4OQ0A 5IS1A 3LIFA 4B4XA 5BOHA 2XR0A 2Y8HA 2O99A 3K2NA 4JGPA 1OTIA 1K54C 3WRZA 3OCNA 4IUKA 2B02A 3WS5A 4WELA 5KMWA 1X0OA 5JYPA 2P9VB 2Y2LA 3Q81A 2PRFA 4HBUA 1N4OA 1LL9A 3G6OA 2G7UA 4BWIA 4OLDA 1EW0A 4WMCA 4JF5A 4NXGA 4WBGA 4R3BA 2HP6A 2ZC3B 1S4RA 1RGYA 3O5YA 3LO7A 1SHVA 4QJGA 1DP6A 5DKKA 5FEGA 2WGWB 1EI5A 2W0NA 3QP8A 3IWOA 4IUHA 1S1YA 2A24A 3QP1A 2V8FA 3SS4A 3CLOA 3HLFA 2Y2NA 3L9KA 4UA9A 4BL2A 4L9FA 2PD7A 2FH5A 4PKYA 3G2ZA 3UDXA 2WZZA 3JYIA 2XD1A 2PT7A 2XROA 4FOFA 2XGNA 4QB8A 1FOFA 5L2FA 3PAGA 4QWOA 1NWZA 3NOPC 1XFNA 3IXBA 3LFVA 3HLGA 2Y2PA 4BENA 3C4OA 5EE8A 4KZ8A 5F5YA 3NCKA 1KDSA 3HUMA 4UAAA 1LI0A 3DTEA 4B9OA 4OOMA 4P6BA 4GLQA 4GJ4A 3TJZC 3Q7VB 1TS6A 2OAP1 3SS3A 2ZBBA 1XGIA 3DWKA 3F1OB 2Q9NA 3RJUA 1FCMA 5EOEA 3UY6A 1BLPA 1YLYA 2M1CA 1VEUB 2KDKA 2M7UA 5DTKA 5I94A 3LICA 2O9BA 4GNUA 4G3KA 3VFFA 2ZLYA 5HAQA 4BBUA 5EVIA 3DTMA 3UB9A 4UEYA 5TR7A 3LR5A 3GECA 5DF7A 3IF6C 1N9OA 2ZM8A 2OLUA 2KX6A 1ODVA 3UNWA 4BL3A 3S7QA 2XA7M 4JPMA 3DWZA 1F9IA 3C5AA 5HWTA 3DBAA 1OPXA 4E6XA 4B4ZA 3SOIA 4R6LA 2ZMFA 5TBMA 4R3AA 2FFYA 3NDEA 5FI7A 3IX4A 5CTMA 4UQIS 3R7WA 1OJGA 5FDHA 2C6WB 4DDYA 2W3DA 3FV7A 2A2LA 2DRWA 4BD0A 2YKFA 1GA9A 4U3TA 1HVBA 3LYXA 4CLCD 4U0XA 2UV0E 3MFXA 1AWIA 1BULA 2J9OA 4JGRA 3KYQA 1XJ2A 4KQRA 1T1BA 1KGFA 2JC7A 3O86A 5AQAA 3GDIA 3DTKA 3CUEC 4LV0A 1YLWA 4PMAA 5GLBA 1EWZA 1P97A 5C5KA 2QJ7A 1UGUA 4EUZA 1W63Q 3VP1A 1SCWA 5I5LA 4ETZA 3E0YA 2GDNA 4EQ1A 1L2SA 4C75A 4BMWA 5GLCA 1M40A 4ZDXA 4CLCB 4ZTKA 3PBTA 5CHMA 3OZHA 5F6AA 1MWSA 2JCHA 1I5QA 1PW8A 2D02A 4P87A 1CK3A 1OTBA 1T1CA 2Y91A 2QKPA 4R23A 2XRNA 3SW1A 4ZAMA 2H28A 4LRXC 4HJ6A 1KOUA 3H82B 4GDBA 5CX7A 3KSGA 2WZXA 5U47A 5E2HA 2GNXA 5HDSA 4I39A 1JTDA 2XD5A 3F1PA 3DTIA 3VMAA 5HAPA 3P09A 2HF6A 4X1MA 3AGEA 2V20A 1XKZA 1XP4A 4NETA 3OC2A 5EVLA 3I7JA 1FIKA 2ZQ8A 5A92A 5FQQA 2E8JA 3T4SA 5EFWA 4MDZA 4R3JA 1K57A 5EECA 1CJFA 3LY3A 1MWTA 2PYRA 2Z6DA 2K7SA 2ZC6B 2W1TA 4P6ZM 4JXSA 4L9GA 5CEBA 1NY0A 2KLIA 5HPFA 1NJ4A 4OKPA 2XQZA 3N4IA 3WS1A 3UB5P 4OQHA
chains in the Genus database with same CATH topology
2VJWA 4MN5A 5FL3A 3ZQ5A 4F3LA 1G28A 3MF0A 4I3JA 4ARZA 3UB8A 4GCZA 2XSSA 3LUQA 3PBSA 2WKRA 4G3VA 4OOLA 2PR5A 2GJ3A 5DJTA 4EU0A 5DKLA 3PBOA 4HQAA 3CITA 3MJQA 4Z1WA 2QHKA 1V9YA 4HP4A 3B47A 1OT9A 3JVVA 2PHYA 1UWPX 3T4KA 3F1NB 4HY8A 4FSFA 1H3QA 4NXFA 3KO6A 4LPZA 2HV1A 1LSWA 2P7JA 4DMZA 4GHIA 4I3IA 3P01A 4H6JA 2L4RA 4GW9A 1P9RA 2VZWA 4IJGA 4JGQA 3T4OA 1OT6A 1MKMA 4QPRA 4HH2A 2R78A 2JKTM 3PBRA 1XJ3A 5HDCA 3VE4A 1GSXA 2V0UA 1GSWA 1MZUA 2DMWA 4WEJA 4HJ3A 3KYZA 5G4ZA 3KSIA 4Q0IA 3F1NA 5L8MA 3EWKA 1P0ZA 1TD5A 4HH3A 3MMHA 4EXOA 3LI9A 3IBRA 1IOUA 5HD3A 2QWSA 3EGXC 3NHQA 4LRZE 2J80A 4XT2A 2VX8A 3S7OA 1OTEA 3ZYTA 4K08A 4PHTA 3KSFA 3T4TA 2HJ9C 4ETXA 2V1BA 3FG8A 3W2ZA 4DJ2A 2PD8A 4MCWA 5A8BA 5TBMB 3H7WB 3BWLA 3LR0A 5IS1A 3LIFA 5J3WA 3KSHA 3UB6A 1T18A 3D3OA 2W3GA 2NUTC 4RQ9A 3VOLA 2Y8HA 2O99A 3HJKA 3RTYA 3K2NA 4JGPA 1OTIA 1TS0A 4MMNA 2OAQ1 1S66L 2INWA 3BJNA 3LIEA 2J3TC 3LR4A 3OCNA 4IUKA 2B02A 1UWNX 4Q0HA 4LRYC 4IHQA 4WELA 4EETB 1X0OA 2A24B 3D72A 2VKSA 1T1AA 3H82A 2WKPA 4KUOA 3RFBA 2P08A 3K3DA 4Y3IA 3G6OA 2G7UA 4BWIA 1EW0A 3OLOA 4L0LA 5HPIA 4NXGA 1GSVA 2VGLM 1TF1A 3TW8A 3EOIA 1S4RA 1H8MA 3O5YA 3A0SA 2JKRM 1DP6A 4M4XA 5DKKA 1VHMA 4EESA 3UB7A 1LT0A 4BBTA 3A0RA 2EA9A 3PBQA 2W0NA 4II7A 4IUHA 1S1YA 2A24A 3TRCA 1N9LA 3CLOA 2CMNA 3BQAA 2K31A 4L9FA 2GX5A 1YAXA 4DJ3A 1W63M 2PD7A 1TS7A 4GS9A 2FH5A 4PKYA 2FZ0A 3E4QA 2ZOHA 4B93A 4MN7A 5G4YA 4P6ZS 4WLAA 3JVUA 1LSVA 4ZRRA 3OCLA 2PT7A 3E98A 2XROA 4FOFA 4HI4A 3MQQA 2WKQA 1S67L 1V9ZA 1VB6A 1NLYA 1NWZA 3NOPC 1XFNA 3EEHA 3K3CA 5DFYA 2Y79A 3LFVA 1F5MA 5KSHA 3H9WA 4WEKA 5F5YA 3VV4A 1Y28A 5AJGA 4NEED 4WN5A 5F68A 2VA0A 4B9OA 3C2WA 4OOMA 2LB5A 2J3WA 4GLQA 2W3EA 3LI8A 2JKTI 4GJ4A 2HGVA 3U2AA 3PBNA 1JNUA 3TJZC 1TS6A 2OAP1 3E4PA 5MC7A 5DF9A 1XJ6A 2ZBBA 3TE8A 3F1OB 1ZHHB 2W3HA 3PYPA 4YOFA 2L1MA 2VV6A 4EEPA 4UQIM 2M1CA 4HP9A 4EUVA 2KDKA 2M7UA 1NLZA 3LICA 2O9BA 4G3KA 5J7EA 1BYWA 1DP9A 4BBUA 4HIAA 4PKYG 3UB9A 3LIAA 3LIBA 1P9WA 4UEYA 3R7WB 3LR5A 4WF0A 3GECA 1N9OA 4WL9A 3HJIA 2KX6A 2YKHA 1D7EA 1ODVA 4YNRA 2O9CA 3MQ0A 2D01A 3S7QA 1OTAA 2XA7M 2V9AA 2ZOIA 2W1RA 5HWVA 1F9IA 2W1TB 1XJ4A 5HWTA 3E4OA 2VV8A 4Y2FA 3DBAA 3EQVA 3F1OA 3V67A 5K5BA 1OPXA 2Z6CA 2QYBA 4NXBA 3UMDA 4R6LA 2K2NA 2ZMFA 3T4JA 5TBMA 3H7WA 4LLOB 4R3AA 3MR0A 4WUJA 1STZA 3KX0X 5HZHA 3EQUA 4UQIS 3OOVA 4KQDA 5AVFA 3R7WA 1OJGA 3OBFA 1OJ5A 2W3DA 5HSQA 1DRMA 2HJEA 2A2LA 1ZTUA 2VLGA 3T50A 4R70A 3ULFA 2YKFA 2M7VA 3NOTC 1T19A 4I3AA 4AFIA 4CLCE 4O01A 3LYXA 2BASA 4CLCD 2PDRA 3MFXA 3CUEA 3PR6A 3T4QA 4CQHA 3A0VA 2XA7S 4JGRA 3KYQA 1XJ2A 3MXQA 1T1BA 4H6JB 3PXPA 2JKRI 4KQOA 1S4SA 4BJPA 3C8CA 3FPVA 1S1ZA 4O0PA 5HDDA 1WA9A 1TS8A 1N9NA 5TJJA 3LIDA 1LSXA 2EWWA 3GDIA 5IU1A 2O0YA 3BW6A 3CUEC 3C30A 3BY8A 2VGLS 2JHEA 3NOUC 1P97A 4L9EA 3MQOA 5C5KA 2QJ7A 1UGUA 2LB9A 3VE3A 1W63Q 2JN7A 3P7NA 2O9AA 4HOIA 1YSQA 3RH8B 4EERA 4YWZA 3EGDC 4PAUA 4I38A 4I5SA 5I5LA 1YKDA 4XT2B 4ETZA 1XFQA 2V1AA 2I9VA 3E0YA 4EQ1A 2B18A 2PYPA 2W3FA 5F69A 3BY9A 4BMWA 2PR6A 4Q0JA 4ME4A 2W27A 4CLCB 5IT5A 3T4LA 3PBTA 2ZMVA 5F6AA 4NXEA 4HNBA 4R38A 2OWHA 1D06A 5LBRA 2VV7A 3HCYA 2D02A 3F1PB 1F98A 3FC7A 1OTBA 4O8GA 4Y5FA 4HHDA 3FPWA 2QJ5A 1T1CA 1DP8A 2QKPA 1MC0A 2P04A 2XRNA 3NJAA 3CI6A 3UMEA 3SW1A 5AVEA 5DJUA 2H28A 4LRXC 4HJ6A 1KOUA 4CLCA 5KIZA 4NKPA 4EW7A 2IA2A 3H82B 3B42A 2GZAA 5CX7A 3KSGA 5DFXA 2V0WA 2GNXA 2OOLA 5HWWA 1YSPA 3S7PA 5HDSA 4I39A 3R4KA 3ICYA 3B33A 3F1PA 3S7NA 3LR3A 2NUPC 4HJ4A 3C38A 3UE3A 3IS2B 2HF6A 4MN6A 1NRJA 4E04A 1OTDA 3OC2A 4CLCC 2L0WA 4F3LB 4JGOA 3CWFA 4ARZB 1G6OA 3IBJA 2OWJA 3PHYA 1IFQA 2MJ6A 3T4SA 5J4EA 5EFWA 5HD5A 4MDZA 2KOIA 3UE6A 2EWVA 3CAXA 2PYRA 2Z6DA 3BQ8A 2K7SA 2VEAA 5HL6A 4BBVA 4G3WA 2W1TA 4P6ZM 1LL8A 4DN0A 4L9GA 2J3TD 4KUKA 4GS9B 2KLIA 5HPFA 3IS2A 4EEUA 3EEAA 4GHIB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4MN5 A;  3ZQ5 A;  4F3L A;  1G28 A;  4I3J A;  3UB8 A;  4GCZ A;  3LUQ A;  2WKR A;  2PR5 A;  2GJ3 A;  5DJT A;  5DKL A;  4HQA A;  3MJQ A;  2QHK A;  1V9Y A;  4HP4 A;  1OT9 A;  2PHY A;  1UWP X;  3F1N B;  4HY8 A;  4NXF A;  4LPZ A;  2HV1 A;  1LSW A;  2P7J A;  4GHI A;  4I3I A;  4H6J A;  2L4R A;  4GW9 A;  4JGQ A;  1OT6 A;  4HH2 A;  2R78 A;  1XJ3 A;  5HDC A;  3VE4 A;  1GSX A;  2V0U A;  1GSW A;  1MZU A;  4HJ3 A;  5G4Z A;  3F1N A;  3EWK A;  1P0Z A;  4HH3 A;  4EXO A;  3LI9 A;  3IBR A;  5HD3 A;  2QWS A;  3NHQ A;  4LRZ E;  2J80 A;  4XT2 A;  1OTE A;  4K08 A;  2V1B A;  3FG8 A;  4DJ2 A;  2PD8 A;  5A8B A;  5TBM B;  3H7W B;  3BWL A;  5IS1 A;  3LIF A;  5J3W A;  3UB6 A;  1T18 A;  4RQ9 A;  3VOL A;  3HJK A;  3RTY A;  4JGP A;  1OTI A;  1TS0 A;  1S66 L;  2INW A;  3LIE A;  2B02 A;  1UWN X;  4LRY C;  4EET B;  1X0O A;  2A24 B;  3D72 A;  1T1A A;  3H82 A;  2WKP A;  4KUO A;  3K3D A;  3G6O A;  1EW0 A;  3OLO A;  4NXG A;  1GSV A;  1S4R A;  3A0S A;  1DP6 A;  4M4X A;  5DKK A;  4EES A;  3UB7 A;  1LT0 A;  4BBT A;  3A0R A;  2EA9 A;  2W0N A;  1S1Y A;  2A24 A;  1N9L A;  3CLO A;  2CMN A;  4L9F A;  4DJ3 A;  2PD7 A;  1TS7 A;  4GS9 A;  4PKY A;  3E4Q A;  2ZOH A;  5G4Y A;  4WLA A;  1LSV A;  4HI4 A;  3MQQ A;  2WKQ A;  1S67 L;  1V9Z A;  1VB6 A;  1NWZ A;  3NOP C;  1XFN A;  3EEH A;  3K3C A;  3H9W A;  5F5Y A;  1Y28 A;  4WN5 A;  5F68 A;  4B9O A;  3C2W A;  3LI8 A;  1JNU A;  1TS6 A;  3E4P A;  1XJ6 A;  2ZBB A;  3F1O B;  3PYP A;  2L1M A;  2VV6 A;  4EEP A;  2M1C A;  4HP9 A;  2KDK A;  3LIC A;  5J7E A;  1BYW A;  1DP9 A;  4BBU A;  4HIA A;  4PKY G;  3UB9 A;  3LIA A;  3LIB A;  4WF0 A;  3GEC A;  1N9O A;  4WL9 A;  3HJI A;  2KX6 A;  2YKH A;  1D7E A;  1ODV A;  2D01 A;  1OTA A;  2V9A A;  2ZOI A;  5HWV A;  1F9I A;  1XJ4 A;  5HWT A;  3E4O A;  2VV8 A;  3F1O A;  2Z6C A;  4NXB A;  3UMD A;  4R6L A;  5TBM A;  3H7W A;  4LLO B;  4R3A A;  3MR0 A;  4WUJ A;  3KX0 X;  5HZH A;  4KQD A;  5AVF A;  1OJG A;  1OJ5 A;  5HSQ A;  1DRM A;  2VLG A;  3T50 A;  4R70 A;  3ULF A;  2YKF A;  3NOT C;  1T19 A;  4I3A A;  3LYX A;  2BAS A;  2PDR A;  3MFX A;  3A0V A;  4JGR A;  1XJ2 A;  3MXQ A;  1T1B A;  4H6J B;  1S4S A;  3C8C A;  1S1Z A;  5HDD A;  1WA9 A;  1TS8 A;  1N9N A;  3LID A;  1LSX A;  3GDI A;  5IU1 A;  3BY8 A;  2JHE A;  3NOU C;  1P97 A;  4L9E A;  3MQO A;  2QJ7 A;  1UGU A;  3VE3 A;  2JN7 A;  3P7N A;  3RH8 B;  4HOI A;  4EER A;  4YWZ A;  4I38 A;  4I5S A;  5I5L A;  4XT2 B;  1XFQ A;  2V1A A;  2I9V A;  4EQ1 A;  2PYP A;  5F69 A;  3BY9 A;  2PR6 A;  2W27 A;  5F6A A;  4NXE A;  4HNB A;  4R38 A;  2OWH A;  1D06 A;  2VV7 A;  2D02 A;  3F1P B;  1F98 A;  3FC7 A;  1OTB A;  4HHD A;  2QJ5 A;  1T1C A;  1DP8 A;  2QKP A;  3NJA A;  3UME A;  3SW1 A;  5AVE A;  5DJU A;  2H28 A;  4LRX C;  4HJ6 A;  1KOU A;  5KIZ A;  4EW7 A;  3H82 B;  2V0W A;  2OOL A;  5HWW A;  5HDS A;  4I39 A;  3ICY A;  3B33 A;  3F1P A;  4HJ4 A;  3IS2 B;  4MN6 A;  4E04 A;  1OTD A;  2L0W A;  4F3L B;  4JGO A;  3CWF A;  2OWJ A;  3PHY A;  5J4E A;  5EFW A;  5HD5 A;  3UE6 A;  3CAX A;  2PYR A;  2Z6D A;  2K7S A;  2VEA A;  4BBV A;  1LL8 A;  4L9G A;  4KUK A;  4GS9 B;  3IS2 A;  4EEU A;  4GHI B; 
#chains in the Genus database with same CATH topology
 3IWI A;  4OOY A;  4F3L A;  3C7U A;  1G28 A;  4I3J A;  3UB8 A;  3MKE A;  3NDG A;  3E2K A;  3LUQ A;  3IH8 A;  4HQA A;  3CIT A;  5M1A A;  2JBF A;  2QHK A;  5CHU A;  1V9Y A;  1OT9 A;  4FSF A;  4KQQ A;  1H3Q A;  4NXF A;  1BSG A;  4GHI A;  4DE1 A;  3P01 A;  4H6J A;  2L4R A;  1K56 D;  1TDG A;  1P9R A;  3T4O A;  2Y2M A;  4KZA A;  2ZC7 A;  1ERM A;  3IF6 B;  2R78 A;  2JKT M;  3A3I A;  3PBR A;  3MXS A;  3ZNY A;  3NUL A;  2V0U A;  3VP2 A;  3IXH A;  5GHX A;  4HJ3 A;  1U60 A;  5G4Z A;  5FEF A;  3UPO A;  3KSI A;  4Q0I A;  5L8M A;  3EWK A;  4HH3 A;  3BFG A;  2XFS A;  4JKT A;  1PW1 A;  1IOU A;  3U4L P;  1BLS A;  3G35 A;  3S7O A;  2WKI A;  4K08 A;  2V1B A;  1CEG A;  4HEF A;  5CTN A;  2VGJ A;  3L7H A;  1OME A;  2V8C A;  1YM1 A;  4MCW A;  3ZNT A;  5FDS A;  4MLL A;  4ZBE A;  5J3W A;  3KSH A;  1T18 A;  2W3G A;  2NUT C;  5M18 A;  3HJK A;  3RTY A;  3GR2 A;  1NZO A;  1CEF A;  4UA7 A;  3WWX A;  5GHY A;  2ZQ9 A;  4PM6 A;  2J3T C;  3LR4 A;  3FYZ A;  1YPR A;  4E3I A;  2BTF P;  4R0Q A;  5FAP A;  4EET B;  3BLM A;  2VKS A;  4OQI A;  1T1A A;  4KUO A;  3RFB A;  2P08 A;  3K3D A;  4O7D A;  5HPI A;  5CRF A;  1XA7 A;  3C4P A;  1C3B A;  2JKR M;  4M4X A;  2XLN A;  4EES A;  1LT0 A;  3A0R A;  3PBQ A;  1PI5 A;  5HAI A;  3UPN A;  1N9L A;  3ISG A;  2P9V A;  2CMN A;  3Q1F A;  4E3L A;  3BQA A;  2K31 A;  1MXO A;  1PWC A;  1W63 M;  2B5R A;  1YQS A;  2ZOH A;  3UE0 A;  1KE0 A;  4MN7 A;  5G4Y A;  4P6Z S;  1NYM A;  3JVU A;  4ZRR A;  3W4P A;  3E98 A;  3CG5 A;  4HI4 A;  2WKQ A;  1VB6 A;  4E3M A;  4MBF A;  4WZ5 A;  4QY6 A;  5DFY A;  1PIO A;  3MXR A;  2H0T A;  1F5M A;  5KSH A;  5AQB A;  5FAS A;  2RL3 A;  4HES A;  1WYC A;  4BQM A;  1NRF A;  1Y28 A;  2Z2L B;  5F68 A;  2VA0 A;  2J3W A;  4S2M A;  3LI8 A;  2PBD P;  3E4P A;  5MC7 A;  1XJ6 A;  2ACG A;  2CC1 A;  3TE8 A;  2EFU A;  4YIN A;  1K38 A;  3PYP A;  1VM1 A;  2L1M A;  4K91 A;  1L0E A;  4UQI M;  4EUV A;  2EXA A;  1NLZ A;  1FSY A;  4K0W A;  1SKO B;  3OPP A;  4JF4 A;  3LIA A;  3LIB A;  4ZJ3 A;  4PM9 A;  4WL9 A;  2YKH A;  1DY6 A;  2O9C A;  3MQ0 A;  4Y17 A;  2ZOI A;  3Q7V A;  5HWV A;  1W8Q A;  3F1O A;  5EVI C;  1MKI A;  4NXB A;  4X55 A;  1ERO A;  4S2K A;  3T4J A;  3H7W A;  1JVJ A;  1STZ A;  2ZMA A;  1CI9 A;  1FSW A;  1L3L A;  1KVM A;  5HZH A;  3EQU A;  5FAO A;  3OOV A;  5AVF A;  2HDU A;  5D3O A;  4K0X A;  3UDF A;  4WZ4 A;  3BEC A;  3GVB A;  1CF0 A;  4GB7 A;  1DRM A;  3S22 A;  2VLG A;  4R70 A;  1KGG A;  4FCF A;  2M7V A;  3BRM A;  3NOT C;  1T19 A;  4I3A A;  3MS6 A;  3FKW A;  4Q8I A;  2PDR A;  3V3R A;  5FQ9 A;  3T4Q A;  1JTG A;  4CQH A;  1XGJ A;  4JBF A;  5CXW A;  4MBH A;  1YT4 A;  1IKG A;  4KQO A;  5JYO A;  5E2E A;  4PM7 A;  4Y7P A;  1S1Z A;  1TS8 A;  1N9N A;  5TJJ A;  3GTC A;  5IU1 A;  5E43 A;  2BG1 A;  3SH9 A;  3T1X A;  3BY8 A;  2AVX A;  1Z09 A;  2FFF B;  1N9B A;  1G6A A;  3P7N A;  2O9A A;  4HOI A;  3AGF A;  2HZ5 A;  4EER A;  3EGD C;  1Q2P A;  2EX6 A;  4IBR A;  1XFQ A;  2HPB A;  3IWQ A;  2B18 A;  2Y2I A;  1PYY A;  2W3F A;  4KZ3 A;  3BY9 A;  3T1S A;  2PR6 A;  1ALQ A;  3T4L A;  2ZMV A;  3MZE A;  5DF8 A;  3SH7 A;  4R38 A;  2OWH A;  4H8R A;  4RVA A;  5LBR A;  2VV7 A;  5HX9 A;  1F98 A;  4DDS A;  4EQI A;  3GSG A;  2IWB A;  4KG2 A;  3GRJ A;  4Y5F A;  1IYQ A;  1DJB A;  4R4S A;  3W4Q A;  5HFO A;  5M19 A;  4X6T A;  3ZFZ A;  1SKF A;  3VOZ A;  3UDI A;  5GL9 A;  2H10 A;  3IT9 A;  2WYX A;  4CLC A;  5KIZ A;  2Y2G A;  3OPL A;  2IA2 A;  4LCM A;  3V3S A;  5DFX A;  3V5M A;  2WK0 A;  5HWW A;  2PU2 A;  1J9M A;  3TG9 A;  3DAV A;  1RGZ A;  1IKI A;  1H5X A;  1PWG A;  4E04 A;  1OTD A;  4LCL A;  2L0W A;  3HLE A;  4JGO A;  3CWF A;  4ARZ B;  1QME A;  3IBJ A;  3PHY A;  2QZ6 A;  3QNB A;  3CMZ A;  2R9X A;  3LEQ A;  1BTL A;  1HD8 A;  2VEA A;  3NI9 A;  5IHV A;  4G3W A;  5EVE A;  3G30 A;  5AQ9 A;  1BUE A;  4ID4 A;  4KUK A;  2G2W A;  2XEP A;  4LV3 A;  4EEU A;  5FL3 A;  1K0K A;  4BLM A;  1K57 C;  5G18 A;  4S2N A;  3DW0 A;  4GCZ A;  1BT5 A;  3ZG8 B;  5FQM A;  4BD1 A;  3PBS A;  4CJN A;  2J9P A;  2Y2Q A;  4OOL A;  2PR5 A;  2GJ3 A;  5FQJ A;  4EU0 A;  2HP5 A;  2BLS A;  2ZC5 B;  4S2P A;  4F94 A;  2UWX A;  1SZV A;  3B47 A;  2WKE A;  3F1N B;  4HY8 A;  5FQK A;  1XPB A;  3KO6 A;  4LPZ A;  2IWC A;  3WRT A;  4Y13 A;  3OPR A;  1PZO A;  5FA7 A;  5L10 A;  2JKF A;  4OON A;  1ONG A;  1MKM A;  3N8L A;  2I72 A;  4QPR A;  4HH2 A;  3GMW A;  2Y4A A;  2ZM2 A;  3LCE A;  4QY5 A;  4JXW A;  3NEC A;  2EXB A;  2V2F F;  3CHW P;  1HLU P;  1GSW A;  3BM6 A;  3AGD A;  1P0Z A;  5EVI B;  1E3U D;  4EV4 A;  2WKH A;  4EXO A;  2J80 A;  4XT2 A;  2ZL1 B;  5A91 A;  3ZVT A;  4N92 A;  1IEL A;  1ACF A;  4P85 A;  3ITA A;  3T4T A;  2X02 A;  4E3K A;  2HJ9 C;  2PBY A;  4ETX A;  4PM5 A;  1L0D A;  2B95 A;  4D60 A;  5TBM B;  1J3W A;  2OSU A;  5EM0 A;  1D1J A;  3BWL A;  3LR0 A;  2ZC4 B;  3IHB A;  2Y2O A;  3B3X A;  3D3O A;  4UA6 A;  1TS0 A;  4MMN A;  3HUN A;  1S66 L;  2A3U A;  3LIE A;  5KSC A;  4X1L A;  4ZJ1 A;  1FCN A;  1UWN X;  3ZGA B;  3A3F A;  2WKP A;  1HTZ A;  5CGS A;  4Y3I A;  4M3K A;  3OLO A;  4KZB A;  1K56 A;  5CEC A;  2X01 A;  3O88 A;  1GSV A;  1VQQ A;  1IYP A;  4RA7 A;  1H8M A;  5FI2 A;  1AXB A;  2HDQ A;  3VP3 A;  3CZD A;  4BBT A;  4II7 A;  1K25 A;  3Q07 A;  3S1Y A;  1VET B;  3TRC A;  4E3J A;  4LGW A;  3M2J A;  3VOY A;  3JPU A;  1JWV A;  3IXG A;  3N8R A;  1KDW A;  2Y2H A;  1LHY A;  1QMF A;  1Z6F A;  2ZQC A;  5HL1 A;  2EX9 A;  1TS7 A;  2ZQ7 A;  4GS9 A;  3MSH A;  2JE5 A;  3WS4 A;  2ZM0 A;  4GN2 A;  3ZG7 B;  2IWD A;  1MPL A;  5E2G A;  3OCL A;  3MQQ A;  1ZC2 A;  1NYY A;  2OV5 A;  5EOO A;  1S67 L;  2V1Z A;  1NLY A;  4P0M A;  3EEH A;  3K3C A;  4KG5 A;  2ZQD A;  1FCO A;  3BFF A;  3H9W A;  4WEK A;  4Y0O A;  3RXW A;  3HRE A;  1CI8 A;  5AJG A;  4WN5 A;  4X53 A;  3C2W A;  1DJA A;  2W3E A;  3NC8 A;  2JKT I;  3V39 A;  4WZ5 C;  1JNU A;  3BFC A;  5DF9 A;  2J7V A;  4N1H A;  3HUO A;  1ZHH B;  3QP5 A;  1MWU A;  4NG2 A;  3HLB A;  2PAV P;  4EEP A;  4C6Y A;  2HDS A;  2R9W A;  3GV9 A;  1BYW A;  4HIA A;  4ZJ2 A;  1KE4 A;  4YNR A;  1D7E A;  2D01 A;  3VP4 A;  2W1T B;  2EFX A;  1XJ4 A;  3A3E A;  4GKU A;  2VV8 A;  4Y2F A;  3EQV A;  4IBX A;  3V67 A;  2WGV A;  2Z6C A;  2DNS A;  2QYB A;  5DTS A;  4OP8 A;  3UMD A;  1LLB A;  2K2N A;  4LLO B;  3MR0 A;  2HP9 A;  2X71 A;  1SKO A;  4E3O A;  3KX0 X;  5FQI A;  4KQD A;  1TVF A;  3OBF A;  1OJ5 A;  5CED A;  2E8I A;  4OQG A;  5HSQ A;  2HJE A;  3BYD A;  1ZTU A;  3T50 A;  3ULF A;  4KEN B;  4AFI A;  4O01 A;  3PR6 A;  1ES3 A;  3HLD A;  3MXQ A;  1GHM A;  4H6J B;  4C3Q A;  4LV2 A;  3PXP A;  2JKR I;  3VP0 A;  1S4S A;  3C8C A;  3FPV A;  4O0P A;  1W5D A;  2XF3 A;  5A93 A;  5FI6 A;  1WA9 A;  5HDD A;  3TSG A;  3LID A;  3PTE A;  2O0Y A;  3BW6 A;  2WGW A;  4GOG A;  3IXD A;  3NOU C;  3MQO A;  5AQ7 A;  1KVL A;  2JN7 A;  1YSQ A;  4YWZ A;  2G2U A;  5FAT A;  4I5S A;  1YKD A;  3N8S A;  2I9V A;  1IYO A;  1XA1 A;  3M6B A;  2VK3 A;  1ES4 A;  4Q0J A;  4KG6 A;  4ME4 A;  3NY4 A;  2W27 A;  1FQG A;  4JF6 A;  4R1G A;  5A90 A;  1RP5 A;  1K55 A;  1TDL A;  1TEM A;  1Q2Q A;  4HNB A;  3FWL A;  3WS0 A;  3VSL A;  4S2I A;  4DKI A;  3FC7 A;  2Z2M B;  4HHD A;  4JXG A;  3FPW A;  1DP8 A;  1MC0 A;  1GA0 A;  4B88 A;  3UME A;  2P74 A;  1XXM A;  5AVE A;  2WUQ A;  4KZ9 A;  3UO9 A;  3PAE A;  4DXC A;  4NKP A;  4RX2 A;  4DE3 A;  1ESU A;  5CGW A;  3D9Y A;  3IHA A;  2V0W A;  1L0G A;  1YSP A;  4FTX A;  2HDR A;  4N1X A;  3NIA A;  3R4K A;  3B33 A;  3S7N A;  2NUP C;  3UE3 A;  5KZH A;  1VEU A;  3Q7Z A;  3IS2 B;  1NRJ A;  4CLC C;  4KZ7 A;  3Q82 A;  1LI9 A;  4DF6 A;  1G6O A;  3O87 A;  4CPK A;  1MWR A;  1IFQ A;  2MJ6 A;  1L0F A;  3CJM A;  5HD5 A;  1ES2 A;  1K6R A;  3G2Y A;  2EWV A;  3CAX A;  3VSK A;  3BQ8 A;  3WS2 A;  3A3D A;  4WYY A;  2J3T D;  3ITB A;  1CQA A;  3EEA A;  2VJW A;  4MN5 A;  3N7W A;  4EBL A;  1FR6 A;  3MF0 A;  4ARZ A;  3LY4 A;  2XSS A;  2JKG A;  2WKR A;  1WE4 A;  4G3V A;  1YMX A;  1RCJ A;  3CPT B;  3PBO A;  3QP4 A;  4Z1W A;  2QPN A;  4HP4 A;  4X68 A;  3JVV A;  2PHY A;  1UWP X;  3G32 A;  3UPP A;  4S2N C;  5FAQ A;  1XX2 A;  4RX3 A;  2HV1 A;  4DMZ A;  4E6W A;  4WMC D;  4IJG A;  4JGQ A;  3SH8 A;  5FSR A;  2J8Y A;  1I2S A;  1ES5 A;  1KGE A;  1XJ3 A;  4OP5 A;  5EV0 A;  3KYZ A;  3F1N A;  4MBK A;  4EBP A;  3LI9 A;  3IBR A;  5HD3 A;  2QWS A;  3EGX C;  3HLC A;  3ZG5 A;  2VX8 A;  4KZ6 A;  1YLP A;  4FH4 A;  1OTE A;  1IYS A;  1WYB A;  1NZU A;  3FG8 A;  3W2Z A;  1K54 A;  5TFQ A;  4JXV A;  3H7W B;  3UE1 A;  1PI4 A;  1BLH A;  1O7E A;  1F2K A;  3M6H A;  3UB6 A;  5J8X A;  4RQ9 A;  3VOL A;  4X69 A;  1O07 A;  5CHJ A;  2OAQ 1;  3HVF A;  2ZL1 A;  2INW A;  3BJN A;  3IQA A;  4Q0H A;  4LRY C;  4IHQ A;  4X56 A;  4OH0 A;  2A24 B;  3D72 A;  3ZG9 B;  3P98 A;  3SZT A;  1GHP A;  5CGX A;  3H82 A;  4XUZ A;  4L0L A;  4EBN A;  1ERQ A;  1IEM A;  2VGL M;  1TF1 A;  4GD8 A;  3TW8 A;  3EOI A;  4GDN A;  1PFL A;  3A0S A;  1K4E A;  1VHM A;  1E4D A;  2OLV A;  3D4F A;  4RYE A;  5EVI D;  2C5W B;  3UB7 A;  2EA9 A;  3QP2 A;  4OPY A;  3HBR A;  3O3V A;  4DXB A;  1E3U A;  3MKF A;  2RCX A;  4EWF A;  2GX5 A;  1YAX A;  1PNE A;  4DJ3 A;  5E2F A;  4DRT A;  2FZ0 A;  3E4Q A;  4DE0 A;  5EPH A;  4B93 A;  5F1G A;  2ZQA A;  1K6S A;  4WLA A;  4S2J A;  1LSV A;  1S0W A;  4GZB A;  1VET A;  1V9Z A;  1BZA A;  1YLJ A;  4OPZ A;  2Y79 A;  4Z9Q A;  3C7V A;  1ONH A;  1JWP A;  3MZF A;  3VV4 A;  4NEE D;  3T12 B;  1GHI A;  3S4X A;  4IED A;  2LB5 A;  2HGV A;  3U2A A;  3PBN A;  5TGF A;  4E3N A;  3W8K A;  3IF6 A;  3TOI A;  4Y15 A;  1H8Z A;  4YOF A;  2W3H A;  2VV6 A;  3A3J A;  4HP9 A;  3G34 A;  3OPH A;  1FR1 A;  5J7E A;  1DP9 A;  1Y54 A;  4IVI A;  4PKY G;  5CER A;  1P9W A;  3R7W B;  2WGI A;  2XK1 A;  3MZD A;  4WF0 A;  4OPR A;  3HJI A;  1OTA A;  2V9A A;  2W1R A;  4LFU A;  4GD6 A;  3E4O A;  1GCE A;  2Y55 A;  5K5B A;  2Y2K A;  3W4O A;  4HBT A;  3G31 A;  4Y0U A;  4WUJ A;  3N6I A;  3T1R A;  3FKV A;  4MEZ A;  2ZJ9 A;  4OLG A;  2EX8 A;  3T1Q B;  2Y59 A;  1DJC A;  4CLC E;  4OPQ A;  2BAS A;  3QHY A;  4FH2 A;  3BFD A;  3CUE A;  3A0V A;  2XA7 S;  4U0T A;  2QMI A;  3UN7 A;  4MNR A;  4BJP A;  2PU4 A;  2XH9 A;  1LSX A;  2EWW A;  3ZHH A;  1I2W A;  4WM9 A;  3C30 A;  2Y2J A;  2A49 A;  2VGL S;  2JHE A;  3LGO A;  4L9E A;  4PPR A;  1ZG6 A;  5DVA A;  2H5S A;  2LB9 A;  3VE3 A;  3RH8 B;  1G68 A;  4KZ4 A;  4PAU A;  4I38 A;  4XT2 B;  2V1A A;  1PWD A;  1YLT A;  4JLF A;  2PYP A;  1W7F A;  3BFE A;  5F69 A;  1LL5 A;  5DTT A;  4IVK A;  5IT5 A;  4NXE A;  1S6R A;  1D06 A;  4QHC A;  3HCY A;  5F82 A;  5F1F A;  3F1P B;  1W8Y A;  4S2L A;  5GHZ A;  2WAE A;  4O8G A;  2QJ5 A;  5L07 A;  1JWZ A;  2P04 A;  3NJA A;  3CI6 A;  1K55 C;  5HW3 A;  2WAF A;  5DJU A;  5GLA A;  3ZCZ A;  4EW7 A;  3HL9 A;  3B42 A;  2GZA A;  1PRQ A;  1Y4O A;  4FD8 A;  2OOL A;  1ZG4 A;  4OVD A;  1SDE A;  3S7P A;  4DE2 A;  3ICY A;  3LEZ A;  3LR3 A;  1MBL A;  4HJ4 A;  4XUX A;  3V50 A;  3C38 A;  2DCF A;  1YMS A;  4MN6 A;  3MFD A;  1K4F A;  3E2L A;  4F3L B;  1HZO A;  4S2O A;  3QNC A;  2OWJ A;  4PM8 A;  2WAD A;  3M2K A;  5J4E A;  2KOI A;  3UE6 A;  3GQZ A;  5HAR A;  3IH9 A;  3KYE A;  5HL6 A;  4BBV A;  2Q9M A;  1LL8 A;  4DN0 A;  2H0Y A;  2VGK A;  2ZD8 A;  3MBZ A;  5EM1 A;  4GS9 B;  2XFT A;  4UHU A;  3IS2 A;  4R4R A;  4GHI B;  3ZQ5 A;  5L09 A;  1H8Y A;  4FUW A;  1PZP A;  4ESP A;  3BEB A;  1ESI A;  4NK3 A;  5DJT A;  1H0M A;  3RXX A;  5EUA A;  1NXY A;  5DKL A;  1MY8 A;  4KZ5 A;  3MJQ A;  4LEN A;  4QU3 A;  3T4K A;  5F83 A;  1YLZ A;  3VFH A;  1LSW A;  2P7J A;  4I3I A;  3ZVW A;  4GW9 A;  4XXR A;  5GLD A;  4D2O A;  2Q0O A;  2VZW A;  1OT6 A;  3FZC A;  3ZDJ A;  4LV1 A;  2EX2 A;  3CPT A;  1M6K A;  5HDC A;  3VE4 A;  1GSX A;  3HLW A;  4Y0T A;  1MZU A;  2DMW A;  4WEJ A;  1BLC A;  4YFM A;  1FIL A;  4A5R A;  1TD5 A;  3ZG0 A;  3MMH A;  1SDN A;  1ZKJ A;  3NHQ A;  4LRZ E;  4QD4 A;  3SS5 A;  1A0K A;  1W79 A;  1G5U A;  4X25 A;  3ZYT A;  3G4P A;  4PHT A;  3KSF A;  1KE3 A;  3BLS A;  4N9K A;  4DJ2 A;  3IX8 A;  2XDM A;  3NBL A;  3QP6 A;  3IX3 A;  2PD8 A;  3IF5 A;  5A8B A;  1E25 A;  4N9L A;  4OQ0 A;  5IS1 A;  3LIF A;  4B4X A;  5BOH A;  2XR0 A;  2Y8H A;  2O99 A;  3K2N A;  4JGP A;  1OTI A;  1K54 C;  3WRZ A;  3OCN A;  4IUK A;  2B02 A;  3WS5 A;  4WEL A;  5KMW A;  1X0O A;  5JYP A;  2P9V B;  2Y2L A;  3Q81 A;  2PRF A;  4HBU A;  1N4O A;  1LL9 A;  3G6O A;  2G7U A;  4BWI A;  4OLD A;  1EW0 A;  4WMC A;  4JF5 A;  4NXG A;  4WBG A;  4R3B A;  2HP6 A;  2ZC3 B;  1S4R A;  1RGY A;  3O5Y A;  3LO7 A;  1SHV A;  4QJG A;  1DP6 A;  5DKK A;  5FEG A;  2WGW B;  1EI5 A;  2W0N A;  3QP8 A;  3IWO A;  4IUH A;  1S1Y A;  2A24 A;  3QP1 A;  2V8F A;  3SS4 A;  3CLO A;  3HLF A;  2Y2N A;  3L9K A;  4UA9 A;  4BL2 A;  4L9F A;  2PD7 A;  2FH5 A;  4PKY A;  3G2Z A;  3UDX A;  2WZZ A;  3JYI A;  2XD1 A;  2PT7 A;  2XRO A;  4FOF A;  2XGN A;  4QB8 A;  1FOF A;  5L2F A;  3PAG A;  4QWO A;  1NWZ A;  3NOP C;  1XFN A;  3IXB A;  3LFV A;  3HLG A;  2Y2P A;  4BEN A;  3C4O A;  5EE8 A;  4KZ8 A;  5F5Y A;  3NCK A;  1KDS A;  3HUM A;  4UAA A;  1LI0 A;  3DTE A;  4B9O A;  4OOM A;  4P6B A;  4GLQ A;  4GJ4 A;  3TJZ C;  3Q7V B;  1TS6 A;  2OAP 1;  3SS3 A;  2ZBB A;  1XGI A;  3DWK A;  3F1O B;  2Q9N A;  3RJU A;  1FCM A;  5EOE A;  3UY6 A;  1BLP A;  1YLY A;  2M1C A;  1VEU B;  2KDK A;  2M7U A;  5DTK A;  5I94 A;  3LIC A;  2O9B A;  4GNU A;  4G3K A;  3VFF A;  2ZLY A;  5HAQ A;  4BBU A;  5EVI A;  3DTM A;  3UB9 A;  4UEY A;  5TR7 A;  3LR5 A;  3GEC A;  5DF7 A;  3IF6 C;  1N9O A;  2ZM8 A;  2OLU A;  2KX6 A;  1ODV A;  3UNW A;  4BL3 A;  3S7Q A;  2XA7 M;  4JPM A;  3DWZ A;  1F9I A;  3C5A A;  5HWT A;  3DBA A;  1OPX A;  4E6X A;  4B4Z A;  3SOI A;  4R6L A;  2ZMF A;  5TBM A;  4R3A A;  2FFY A;  3NDE A;  5FI7 A;  3IX4 A;  5CTM A;  4UQI S;  3R7W A;  1OJG A;  5FDH A;  2C6W B;  4DDY A;  2W3D A;  3FV7 A;  2A2L A;  2DRW A;  4BD0 A;  2YKF A;  1GA9 A;  4U3T A;  1HVB A;  3LYX A;  4CLC D;  4U0X A;  2UV0 E;  3MFX A;  1AWI A;  1BUL A;  2J9O A;  4JGR A;  3KYQ A;  1XJ2 A;  4KQR A;  1T1B A;  1KGF A;  2JC7 A;  3O86 A;  5AQA A;  3GDI A;  3DTK A;  3CUE C;  4LV0 A;  1YLW A;  4PMA A;  5GLB A;  1EWZ A;  1P97 A;  5C5K A;  2QJ7 A;  1UGU A;  4EUZ A;  1W63 Q;  3VP1 A;  1SCW A;  5I5L A;  4ETZ A;  3E0Y A;  2GDN A;  4EQ1 A;  1L2S A;  4C75 A;  4BMW A;  5GLC A;  1M40 A;  4ZDX A;  4CLC B;  4ZTK A;  3PBT A;  5CHM A;  3OZH A;  5F6A A;  1MWS A;  2JCH A;  1I5Q A;  1PW8 A;  2D02 A;  4P87 A;  1CK3 A;  1OTB A;  1T1C A;  2Y91 A;  2QKP A;  4R23 A;  2XRN A;  3SW1 A;  4ZAM A;  2H28 A;  4LRX C;  4HJ6 A;  1KOU A;  3H82 B;  4GDB A;  5CX7 A;  3KSG A;  2WZX A;  5U47 A;  5E2H A;  2GNX A;  5HDS A;  4I39 A;  1JTD A;  2XD5 A;  3F1P A;  3DTI A;  3VMA A;  5HAP A;  3P09 A;  2HF6 A;  4X1M A;  3AGE A;  2V20 A;  1XKZ A;  1XP4 A;  4NET A;  3OC2 A;  5EVL A;  3I7J A;  1FIK A;  2ZQ8 A;  5A92 A;  5FQQ A;  2E8J A;  3T4S A;  5EFW A;  4MDZ A;  4R3J A;  1K57 A;  5EEC A;  1CJF A;  3LY3 A;  1MWT A;  2PYR A;  2Z6D A;  2K7S A;  2ZC6 B;  2W1T A;  4P6Z M;  4JXS A;  4L9G A;  5CEB A;  1NY0 A;  2KLI A;  5HPF A;  1NJ4 A;  4OKP A;  2XQZ A;  3N4I A;  3WS1 A;  3UB5 P;  4OQH A; 
#chains in the Genus database with same CATH homology
 2VJW A;  4MN5 A;  5FL3 A;  3ZQ5 A;  4F3L A;  1G28 A;  3MF0 A;  4I3J A;  4ARZ A;  3UB8 A;  4GCZ A;  2XSS A;  3LUQ A;  3PBS A;  2WKR A;  4G3V A;  4OOL A;  2PR5 A;  2GJ3 A;  5DJT A;  4EU0 A;  5DKL A;  3PBO A;  4HQA A;  3CIT A;  3MJQ A;  4Z1W A;  2QHK A;  1V9Y A;  4HP4 A;  3B47 A;  1OT9 A;  3JVV A;  2PHY A;  1UWP X;  3T4K A;  3F1N B;  4HY8 A;  4FSF A;  1H3Q A;  4NXF A;  3KO6 A;  4LPZ A;  2HV1 A;  1LSW A;  2P7J A;  4DMZ A;  4GHI A;  4I3I A;  3P01 A;  4H6J A;  2L4R A;  4GW9 A;  1P9R A;  2VZW A;  4IJG A;  4JGQ A;  3T4O A;  1OT6 A;  1MKM A;  4QPR A;  4HH2 A;  2R78 A;  2JKT M;  3PBR A;  1XJ3 A;  5HDC A;  3VE4 A;  1GSX A;  2V0U A;  1GSW A;  1MZU A;  2DMW A;  4WEJ A;  4HJ3 A;  3KYZ A;  5G4Z A;  3KSI A;  4Q0I A;  3F1N A;  5L8M A;  3EWK A;  1P0Z A;  1TD5 A;  4HH3 A;  3MMH A;  4EXO A;  3LI9 A;  3IBR A;  1IOU A;  5HD3 A;  2QWS A;  3EGX C;  3NHQ A;  4LRZ E;  2J80 A;  4XT2 A;  2VX8 A;  3S7O A;  1OTE A;  3ZYT A;  4K08 A;  4PHT A;  3KSF A;  3T4T A;  2HJ9 C;  4ETX A;  2V1B A;  3FG8 A;  3W2Z A;  4DJ2 A;  2PD8 A;  4MCW A;  5A8B A;  5TBM B;  3H7W B;  3BWL A;  3LR0 A;  5IS1 A;  3LIF A;  5J3W A;  3KSH A;  3UB6 A;  1T18 A;  3D3O A;  2W3G A;  2NUT C;  4RQ9 A;  3VOL A;  2Y8H A;  2O99 A;  3HJK A;  3RTY A;  3K2N A;  4JGP A;  1OTI A;  1TS0 A;  4MMN A;  2OAQ 1;  1S66 L;  2INW A;  3BJN A;  3LIE A;  2J3T C;  3LR4 A;  3OCN A;  4IUK A;  2B02 A;  1UWN X;  4Q0H A;  4LRY C;  4IHQ A;  4WEL A;  4EET B;  1X0O A;  2A24 B;  3D72 A;  2VKS A;  1T1A A;  3H82 A;  2WKP A;  4KUO A;  3RFB A;  2P08 A;  3K3D A;  4Y3I A;  3G6O A;  2G7U A;  4BWI A;  1EW0 A;  3OLO A;  4L0L A;  5HPI A;  4NXG A;  1GSV A;  2VGL M;  1TF1 A;  3TW8 A;  3EOI A;  1S4R A;  1H8M A;  3O5Y A;  3A0S A;  2JKR M;  1DP6 A;  4M4X A;  5DKK A;  1VHM A;  4EES A;  3UB7 A;  1LT0 A;  4BBT A;  3A0R A;  2EA9 A;  3PBQ A;  2W0N A;  4II7 A;  4IUH A;  1S1Y A;  2A24 A;  3TRC A;  1N9L A;  3CLO A;  2CMN A;  3BQA A;  2K31 A;  4L9F A;  2GX5 A;  1YAX A;  4DJ3 A;  1W63 M;  2PD7 A;  1TS7 A;  4GS9 A;  2FH5 A;  4PKY A;  2FZ0 A;  3E4Q A;  2ZOH A;  4B93 A;  4MN7 A;  5G4Y A;  4P6Z S;  4WLA A;  3JVU A;  1LSV A;  4ZRR A;  3OCL A;  2PT7 A;  3E98 A;  2XRO A;  4FOF A;  4HI4 A;  3MQQ A;  2WKQ A;  1S67 L;  1V9Z A;  1VB6 A;  1NLY A;  1NWZ A;  3NOP C;  1XFN A;  3EEH A;  3K3C A;  5DFY A;  2Y79 A;  3LFV A;  1F5M A;  5KSH A;  3H9W A;  4WEK A;  5F5Y A;  3VV4 A;  1Y28 A;  5AJG A;  4NEE D;  4WN5 A;  5F68 A;  2VA0 A;  4B9O A;  3C2W A;  4OOM A;  2LB5 A;  2J3W A;  4GLQ A;  2W3E A;  3LI8 A;  2JKT I;  4GJ4 A;  2HGV A;  3U2A A;  3PBN A;  1JNU A;  3TJZ C;  1TS6 A;  2OAP 1;  3E4P A;  5MC7 A;  5DF9 A;  1XJ6 A;  2ZBB A;  3TE8 A;  3F1O B;  1ZHH B;  2W3H A;  3PYP A;  4YOF A;  2L1M A;  2VV6 A;  4EEP A;  4UQI M;  2M1C A;  4HP9 A;  4EUV A;  2KDK A;  2M7U A;  1NLZ A;  3LIC A;  2O9B A;  4G3K A;  5J7E A;  1BYW A;  1DP9 A;  4BBU A;  4HIA A;  4PKY G;  3UB9 A;  3LIA A;  3LIB A;  1P9W A;  4UEY A;  3R7W B;  3LR5 A;  4WF0 A;  3GEC A;  1N9O A;  4WL9 A;  3HJI A;  2KX6 A;  2YKH A;  1D7E A;  1ODV A;  4YNR A;  2O9C A;  3MQ0 A;  2D01 A;  3S7Q A;  1OTA A;  2XA7 M;  2V9A A;  2ZOI A;  2W1R A;  5HWV A;  1F9I A;  2W1T B;  1XJ4 A;  5HWT A;  3E4O A;  2VV8 A;  4Y2F A;  3DBA A;  3EQV A;  3F1O A;  3V67 A;  5K5B A;  1OPX A;  2Z6C A;  2QYB A;  4NXB A;  3UMD A;  4R6L A;  2K2N A;  2ZMF A;  3T4J A;  5TBM A;  3H7W A;  4LLO B;  4R3A A;  3MR0 A;  4WUJ A;  1STZ A;  3KX0 X;  5HZH A;  3EQU A;  4UQI S;  3OOV A;  4KQD A;  5AVF A;  3R7W A;  1OJG A;  3OBF A;  1OJ5 A;  2W3D A;  5HSQ A;  1DRM A;  2HJE A;  2A2L A;  1ZTU A;  2VLG A;  3T50 A;  4R70 A;  3ULF A;  2YKF A;  2M7V A;  3NOT C;  1T19 A;  4I3A A;  4AFI A;  4CLC E;  4O01 A;  3LYX A;  2BAS A;  4CLC D;  2PDR A;  3MFX A;  3CUE A;  3PR6 A;  3T4Q A;  4CQH A;  3A0V A;  2XA7 S;  4JGR A;  3KYQ A;  1XJ2 A;  3MXQ A;  1T1B A;  4H6J B;  3PXP A;  2JKR I;  4KQO A;  1S4S A;  4BJP A;  3C8C A;  3FPV A;  1S1Z A;  4O0P A;  5HDD A;  1WA9 A;  1TS8 A;  1N9N A;  5TJJ A;  3LID A;  1LSX A;  2EWW A;  3GDI A;  5IU1 A;  2O0Y A;  3BW6 A;  3CUE C;  3C30 A;  3BY8 A;  2VGL S;  2JHE A;  3NOU C;  1P97 A;  4L9E A;  3MQO A;  5C5K A;  2QJ7 A;  1UGU A;  2LB9 A;  3VE3 A;  1W63 Q;  2JN7 A;  3P7N A;  2O9A A;  4HOI A;  1YSQ A;  3RH8 B;  4EER A;  4YWZ A;  3EGD C;  4PAU A;  4I38 A;  4I5S A;  5I5L A;  1YKD A;  4XT2 B;  4ETZ A;  1XFQ A;  2V1A A;  2I9V A;  3E0Y A;  4EQ1 A;  2B18 A;  2PYP A;  2W3F A;  5F69 A;  3BY9 A;  4BMW A;  2PR6 A;  4Q0J A;  4ME4 A;  2W27 A;  4CLC B;  5IT5 A;  3T4L A;  3PBT A;  2ZMV A;  5F6A A;  4NXE A;  4HNB A;  4R38 A;  2OWH A;  1D06 A;  5LBR A;  2VV7 A;  3HCY A;  2D02 A;  3F1P B;  1F98 A;  3FC7 A;  1OTB A;  4O8G A;  4Y5F A;  4HHD A;  3FPW A;  2QJ5 A;  1T1C A;  1DP8 A;  2QKP A;  1MC0 A;  2P04 A;  2XRN A;  3NJA A;  3CI6 A;  3UME A;  3SW1 A;  5AVE A;  5DJU A;  2H28 A;  4LRX C;  4HJ6 A;  1KOU A;  4CLC A;  5KIZ A;  4NKP A;  4EW7 A;  2IA2 A;  3H82 B;  3B42 A;  2GZA A;  5CX7 A;  3KSG A;  5DFX A;  2V0W A;  2GNX A;  2OOL A;  5HWW A;  1YSP A;  3S7P A;  5HDS A;  4I39 A;  3R4K A;  3ICY A;  3B33 A;  3F1P A;  3S7N A;  3LR3 A;  2NUP C;  4HJ4 A;  3C38 A;  3UE3 A;  3IS2 B;  2HF6 A;  4MN6 A;  1NRJ A;  4E04 A;  1OTD A;  3OC2 A;  4CLC C;  2L0W A;  4F3L B;  4JGO A;  3CWF A;  4ARZ B;  1G6O A;  3IBJ A;  2OWJ A;  3PHY A;  1IFQ A;  2MJ6 A;  3T4S A;  5J4E A;  5EFW A;  5HD5 A;  4MDZ A;  2KOI A;  3UE6 A;  2EWV A;  3CAX A;  2PYR A;  2Z6D A;  3BQ8 A;  2K7S A;  2VEA A;  5HL6 A;  4BBV A;  4G3W A;  2W1T A;  4P6Z M;  1LL8 A;  4DN0 A;  4L9G A;  2J3T D;  4KUK A;  4GS9 B;  2KLI A;  5HPF A;  3IS2 A;  4EEU A;  3EEA A;  4GHI B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...